WorldWideScience

Sample records for cerium 134

  1. Cerium(III) molybdate nanoparticles: Synthesis, characterization and radionuclides adsorption studies

    Energy Technology Data Exchange (ETDEWEB)

    Yousefi, Taher, E-mail: Taher_yosefy@yahoo.com [NFCRS, Nuclear Science and Technology Institute, Kargher Ave, Tehran (Iran, Islamic Republic of); Tarbiat Moallem University, Mofatteh Ave, Tehran (Iran, Islamic Republic of); Khanchi, Ali Reza; Ahmadi, Seyed Javad [NFCRS, Nuclear Science and Technology Institute, Kargher Ave, Tehran (Iran, Islamic Republic of); Rofouei, Mohamad Kazem [Tarbiat Moallem University, Mofatteh Ave, Tehran (Iran, Islamic Republic of); Yavari, Ramin; Davarkhah, Reza; Myanji, Behzad [NFCRS, Nuclear Science and Technology Institute, Kargher Ave, Tehran (Iran, Islamic Republic of)

    2012-05-15

    Highlights: Black-Right-Pointing-Pointer A new inorganic nanoparticles with average size about 40 nm were synthesized by chemical method. Black-Right-Pointing-Pointer The morphology studies reveal existing nanowires among dense nanoparticles. Black-Right-Pointing-Pointer Investigation shows it has high stability in rough media and high affinity for Cs(I), U(VI), and Th(IV). Black-Right-Pointing-Pointer It was used for adsorption of radionuclides and removal of {sup 134}Cs from real sample. Black-Right-Pointing-Pointer These findings are important for evaluating human and environmental risk assessment. - Abstract: Cerium(III) molybdate nanostructure with average size about 40 nm was prepared by adding cerium(III) chloride and ammonium molybdate solutions under varying conditions. The product was characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Fourier transform infrared (FT-IR), thermogravimetric analysis (TGA) and Brunauere Emmette Teller (BET) techniques. Ion exchange capacity of the sample for potassium ion and distribution coefficients (K{sub d}) for 23 metal ions were determined, the K{sub d} values for Tl(I), Pb(II), Th(IV), U(VI), and Cs(I) ions were found to be sufficiently high for their removal from various effluents. The adsorption behavior of the sample towards Cs(I){sub 134} species were studied. Finally, the binary separation of Dy(III)-U(VI), Sm(III)-Th(IV) and Cs(I)-Rb(I) and removal of Cs(I){sub 134} from the real sample were successfully achieved.

  2. Determination of cerium

    International Nuclear Information System (INIS)

    Stepin, V.V.; Kurbatova, V.I.; Fedorova, N.D.

    1980-01-01

    Techniques of cerium determination in steels and alloys are developed. Amperometric method of determination which is based on Ce(4) titration by a solution of double salt of sulfuric Fe(2) and ammonium when cerium amount exceeds 0.01% is suggested. Cerium is oxidated to tetravalent state by KMnO 4 . The elements interfering with the determination (Cr, Ni etc.) are separated by means of deposition. When cerium content exceeds 0.005% in steels and alloys the determination is carried out using photometric method with arsenazo 3 in hydrochloric medium (pH 1.8-2.3). Optimum concentration is 5-50 μg [ru

  3. The use of cerium(IV) phosphate for the gravimetric determination and separation of cerium

    International Nuclear Information System (INIS)

    Masin, V.; Dolezal, J.

    1978-01-01

    A method for the gravimetric determination of cerium as Ce 3 (PO 4 ) 4 is described. Cerium can be separated from many metals in this form, as well as from permanganate and dichromate; the cerium separated can then be titrated with iron(II) solution. The method was verified for the determination of cerium in a rare earth concentrate. (Auth.)

  4. Reaction chemistry of cerium

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-01-01

    It is truly ironic that a synthetic organic chemist likely has far greater knowledge of the reaction chemistry of cerium(IV) than an inorganic colleague. Cerium(IV) reagents have long since been employed as oxidants in effecting a wide variety of organic transformations. Conversely, prior to the late 1980s, the number of well characterized cerium(IV) complexes did not extend past a handful of known species. Though in many other areas, interest in the molecular chemistry of the 4f-elements has undergone an explosive growth over the last twenty years, the chemistry of cerium(IV) has for the most part been overlooked. This report describes reactions of cerium complexes and structure.

  5. Cerium oxalate precipitation

    International Nuclear Information System (INIS)

    Chang, T.P.

    1987-02-01

    Cerium, a nonradioactive, common stand-in for plutonium in development work, has been used to simulate several plutonium precipitation processes at the Savannah River Laboratory. There are similarities between the plutonium trifluoride and the cerium oxalate precipitations in particle size and extent of plating, but not particle morphology. The equilibrium solubility, precipitation kinetics, particle size, extent of plating, and dissolution characteristics of cerium oxalate have been investigated. Interpretations of particle size and plating based on precipitation kinetics (i.e., nucleation and crystal growth) are presented. 16 refs., 7 figs., 6 tabs

  6. Preparation of high-purity cerium nitrate

    International Nuclear Information System (INIS)

    Avila, Daniela Moraes; Silva Queiroz, Carlos Alberto da; Santos Mucillo, Eliana Navarro dos

    1995-01-01

    The preparation of high-purity cerium nitrate has been carried out Cerium oxide has been prepared by fractioned precipitation and ionic exchange techniques, using a concentrate with approximately 85% of cerium oxide from NUCLEMON as raw material. Five sequential ion-exchange columns with a retention capacity of 170 g each have been used. The ethylenediamine-tetraacetic acid (EDTA) was used as eluent. The cerium content has been determined by gravimetry and iodometry techniques. The resulting cerium oxide has a purity > 99%. This material was transformed in cerium nitrate to be used as precursor for the preparation of Zirconia-ceria ceramics by the coprecipitation technique. (author)

  7. Uptake and accumulation of bulk and nanosized cerium oxide particles and ionic cerium by radish (Raphanus sativus L.).

    Science.gov (United States)

    Zhang, Weilan; Ebbs, Stephen D; Musante, Craig; White, Jason C; Gao, Cunmei; Ma, Xingmao

    2015-01-21

    The potential toxicity and accumulation of engineered nanomaterials (ENMs) in agricultural crops has become an area of great concern and intense investigation. Interestingly, although below-ground vegetables are most likely to accumulate the highest concentrations of ENMs, little work has been done investigating the potential uptake and accumulation of ENMs for this plant group. The overall objective of this study was to evaluate how different forms of cerium (bulk cerium oxide, cerium oxide nanoparticles, and the cerium ion) affected the growth of radish (Raphanus sativus L.) and accumulation of cerium in radish tissues. Ionic cerium (Ce(3+)) had a negative effect on radish growth at 10 mg CeCl3/L, whereas bulk cerium oxide (CeO2) enhanced plant biomass at the same concentration. Treatment with 10 mg/L cerium oxide nanoparticles (CeO2 NPs) had no significant effect on radish growth. Exposure to all forms of cerium resulted in the accumulation of this element in radish tissues, including the edible storage root. However, the accumulation patterns and their effect on plant growth and physiological processes varied with the characteristics of cerium. This study provides a critical frame of reference on the effects of CeO2 NPs versus their bulk and ionic counterparts on radish growth.

  8. A cerium(IV)-carbon multiple bond

    Energy Technology Data Exchange (ETDEWEB)

    Gregson, Matthew; Lu, Erli; McMaster, Jonathan; Lewis, William; Blake, Alexander J.; Liddle, Stephen T. [Nottingham Univ. (United Kingdom). School of Chemistry

    2013-12-02

    Straightforward access to a cerium(IV)-carbene complex was provided by one-electron oxidation of an anionic ''ate'' cerium(III)-carbene precursor, thereby avoiding decomposition reactions that plague oxidations of neutral cerium(III) compounds. The cerium(IV)-carbene complex is the first lanthanide(IV)-element multiple bond and involves a twofold bonding interaction of two electron pairs between cerium and carbon. [German] Auf direktem Wege zu einem Cer(IV)-Carbenkomplex gelangt man durch die Einelektronenoxidation einer anionischen Carben-Cerat(III)-Vorstufe. So werden Zersetzungsprozesse vermieden, die die Oxidation neutraler Cer(III)-Verbindungen erschweren. Der Cer(IV)-Carbenkomplex enthaelt die erste Lanthanoid(IV)-Element-Mehrfachbindung; dabei binden Cer und Kohlenstoff ueber zwei Elektronenpaare.

  9. Calcination of the cerium concentrate to be cerium oxide

    International Nuclear Information System (INIS)

    Suyanti; MV Purwani

    2016-01-01

    Calcination of the cerium concentrate to be cerium oxide has done. The cerium concentrate were obtained from the Ce making process wear KBrO_3 and without using KBrO_3. The calcination were done with a variation of time 1, 2, 3 and 4 hours with the temperature variations of 700, 800 and 900°C. The easiest calcination of Ce concentrates to be CeO_2 containing majority of Ce(OH)_4 and contains least impurities as Th(OH)_4, (NH_4)_2Y(NO_3), H_4N_5O_1_2La, H_1_2N_3NdO_1_5 and N_3O_9Sm. On the calcination of Ce concentrates process results without using KBrO_3 1, the calcination temperature 900°C was obtained CeO_2 content of 73.53% for calcination time of 4 hours, has little difference when compared with the predictions and calculation result of complete calcination was equal 73.84%. (author)

  10. Cerium and jojoba in engines?; Cerium et jojoba dans les moteurs?

    Energy Technology Data Exchange (ETDEWEB)

    Massy-Delhotel, E.

    1996-10-01

    The Belgium company CreaTel proposes a new system, called Forac, which can lead to a 10% reduction of fuel consumption in thermal engines together with a quasi-complete reduction of CO, HC, NOx pollutants and CO{sub 2} particulates emission. The system comprises a steam production device and an admission pipe with a cerium alloy whorl inside. The steam produced is mixed with the admission air and tears cerium particles from the inside of the admission pipe to the combustion chamber. The cerium particles act as a catalyst which favours the complete combustion of the fuel. The same company proposes also lubricant additives made from liquid jojoba wax which allow the reduction of pollutant emissions, fuel consumption and noise emissions of diesel engines. (J.S.)

  11. Cerium and rare earth separation process

    International Nuclear Information System (INIS)

    Martin, M.; Rollat, M.

    1986-01-01

    An aqueous solution containing cerium III and rare earths is oxidized in the anodic compartment of an electrolytic cell, cerium IV is extracted by an organic solvent, the organic phase containing Ce IV is reduced in the catodic compartment of the same electrolytic cell and cerium III is extracted in a nitric aqueous phase [fr

  12. Multifunctional cerium-based nanomaterials and methods for producing the same

    Science.gov (United States)

    O'Keefe, Matthew J.; Castano Londono, Carlos E.; Fahrenholtz, William G.

    2018-01-09

    Embodiments relate to a cerium-containing nano-coating composition, the composition including an amorphous matrix including one or more of cerium oxide, cerium hydroxide, and cerium phosphate; and crystalline regions including one or more of crystalline cerium oxide, crystalline cerium hydroxide, and crystalline cerium phosphate. The diameter of each crystalline region is less than about 50 nanometers.

  13. Some Environmentally Relevant Reactions of Cerium Oxide

    Directory of Open Access Journals (Sweden)

    Janoš Pavel

    2014-12-01

    Full Text Available Reactive forms of cerium oxide were prepared by a thermal decomposition of various precursors, namely carbonates, oxalates and citrates, commercially available nanocrystalline cerium oxide (nanoceria was involved in the study for comparison. Scanning electron microscopy (SEM and x-ray diffraction analysis (XRD were used to examine the morphology and crystallinity of the samples, respectively, whereas the Brunauer-Emmett-Teller (BET method of nitrogen adsorption was used to determine surface areas. Interactions of cerium oxide with some phosphorus-containing compounds were investigated. Some of the examined samples, especially those prepared by annealing from carbonate precursors, exhibited an outstanding ability to destroy highly toxic organophosphates, such as pesticides (parathion methyl, or nerve agents (soman, VX. There were identified some relations between the degradation efficiency of cerium oxides and their crystallinity. It was also shown that cerium oxide is able to destroy one of widely used flame retardants - triphenyl phosphate. A phosphatase-mimetic activity of various cerium oxides was examined with the aid of a standardized phosphatase test.

  14. Local Structure of Cerium in Aluminophosphate and Silicophosphate Glasses

    International Nuclear Information System (INIS)

    Rygel, Jennifer L.; Chen, Yongsheng; Pantano, Carlo G.; Shibata, Tomohiro; Du, Jincheng; Kokou, Leopold; Woodman, Robert; Belcher, James

    2011-01-01

    The local structure of cerium in two systematic compositional series of glasses, nominally CeP 3 O 9 -AlP 3 O 9 and CeP 3 O 9 -SiP 2 O 7 , was interrogated using X-ray photoelectron spectroscopy (XPS) and X-ray absorption fine structure (XAFS) spectroscopy. XPS revealed that, for glasses melted in air, ≥95% of cerium ions are Ce 3+ . This was independently confirmed using X-ray absorption near edge spectroscopy (XANES). Ce K-edge extended X-ray absorption fine structure (EXAFS) has been used to determine the local structure of Ce 3+ . Near the metaphosphate composition, cerium was found to have an average cerium coordination number of ∼7.0 and an average cerium-oxygen bond length of 2.41 (angstrom). The average cerium coordination number and average cerium-oxygen bond distance were found to increase with decreasing cerium concentration in both compositional series. Rare-earth clustering is suggested based on numerical calculations for glasses containing ≥14 and ≥15 mol% Ce 2 O 3 for the aluminophosphate and silicophosphate series, respectively.

  15. Metabolism of cerium 144 in rat. Distribution - elimination - dosimetry; Metabolisme du cerium 144 chez le rat. Distribution - elimination - dosimetrie

    Energy Technology Data Exchange (ETDEWEB)

    Remy, Jacques

    1959-07-01

    This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [French] Le Cerium 144 est injecte a des rats de trois mois par voie intraveineuse, sous forme de chlorure en solution aqueuse a pH = 9,5. Une telle solution est colloidale. Les rats sont sacrifies par groupe de 5 a des temps differents apres l'injection et des prelevements d'organes ou de tissus sont effectues qui permettent d'etudier la distribution de l'isotope dans l'organisme. Cette etude de la distribution du Cerium 144 dans l'organiqme du rat a permis egalement le calcul des doses d'irradiation interne recues localement par l'animal. Ces donnees permettent de definir les organes critiques de l'organisme pour le Cerium 144: Jusqu'au 20eme jour l'organe critique est le foie. Ce sera ensuite le squelette, et ce, pendant toute la vie de l'animal. L'irradiation interne de l'os constitue, en raison des menaces qu'elle comporte pour les fonctions hematopoietiques de l'organisme, le plus grand danger d'une contamination interne par le Cerium 144.

  16. Structural, optical, morphological and dielectric properties of cerium oxide nanoparticles

    International Nuclear Information System (INIS)

    Prabaharan, Devadoss Mangalam Durai Manoharadoss; Sadaiyandi, Karuppasamy; Mahendran, Manickam; Sagadevan, Suresh

    2016-01-01

    Cerium oxide (CeO 2 ) nanoparticles were prepared by the precipitation method. The average crystallite size of cerium oxide nanoparticles was calculated from the X-ray diffraction (XRD) pattern and found to be 11 nm. The FT-IR spectrum clearly indicated the strong presence of cerium oxide nanoparticles. Raman spectrum confirmed the cubic nature of the cerium oxide nanoparticles. The Scanning Electron Microscopy (SEM) analysis showed that the nanoparticles agglomerated forming spherical-shaped particles. The Transmission Electron Microscopic (TEM) analysis confirmed the prepared cerium oxide nanoparticles with the particle size being found to be 16 nm. The optical absorption spectrum showed a blue shift by the cerium oxide nanoparticles due to the quantum confinement effect. The dielectric properties of cerium oxide nanoparticles were studied for different frequencies at different temperatures. The dielectric constant and the dielectric loss of the cerium oxide nanoparticles decreased with increase in frequency. The AC electrical conductivity study revealed that the conduction depended on both the frequency and the temperature. (author)

  17. Structural, optical, morphological and dielectric properties of cerium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Prabaharan, Devadoss Mangalam Durai Manoharadoss [Department of Physics, NPR College of Engineering and Technology, Natham, Dindigul, Tamil Nadu (India); Sadaiyandi, Karuppasamy [Department of Physics, Alagappa Government Arts College, Karaikudi, Sivaganga, Tamil Nadu (India); Mahendran, Manickam [Department of Physics, Thiagarajar College of Engineering, Madurai, Tamil Nadu (India); Sagadevan, Suresh, E-mail: duraiphysics2011@gmail.com [Department of Physics, AMET University (India)

    2016-03-15

    Cerium oxide (CeO{sub 2}) nanoparticles were prepared by the precipitation method. The average crystallite size of cerium oxide nanoparticles was calculated from the X-ray diffraction (XRD) pattern and found to be 11 nm. The FT-IR spectrum clearly indicated the strong presence of cerium oxide nanoparticles. Raman spectrum confirmed the cubic nature of the cerium oxide nanoparticles. The Scanning Electron Microscopy (SEM) analysis showed that the nanoparticles agglomerated forming spherical-shaped particles. The Transmission Electron Microscopic (TEM) analysis confirmed the prepared cerium oxide nanoparticles with the particle size being found to be 16 nm. The optical absorption spectrum showed a blue shift by the cerium oxide nanoparticles due to the quantum confinement effect. The dielectric properties of cerium oxide nanoparticles were studied for different frequencies at different temperatures. The dielectric constant and the dielectric loss of the cerium oxide nanoparticles decreased with increase in frequency. The AC electrical conductivity study revealed that the conduction depended on both the frequency and the temperature. (author)

  18. Electrochemical reduction of cerium oxides in molten salts

    International Nuclear Information System (INIS)

    Claux, B.; Serp, J.; Fouletier, J.

    2011-01-01

    This brief article describes a pyrochemical process that is used by CEA to turn actinide oxides into metal actinides. This process is applied to Cerium oxides (CeO 2 ) that simulate actinide oxides well chemically as cerium belongs to the lanthanide family. The process is in fact an electrolysis of cerium oxide in a bath of molten calcium chloride salt whose temperature is between 800 and 900 Celsius degrees. At those temperatures calcium chloride becomes a ionic liquid (Ca 2+ and Cl - ) that is a good electrical conductor and is particularly well-adapted as solvent to an electrolytic process. The electrolysis current allows the transformation of solvent Ca 2+ ions into metal calcium which, in turn, can reduce cerium oxide into metal cerium through chromatically. Experimental data shows the reduction of up to 90% of 10 g samples of CeO 2 in a 6 hour long electrolysis while the best reduction rate ever known was 80% so far. This result is all the more promising that cerium oxides are more difficult to reduce than actinide oxides from the thermodynamical perspective

  19. Valence instabilities in cerium intermetallics

    International Nuclear Information System (INIS)

    Dijkman, W.H.

    1982-01-01

    The primary purpose of this investigation was to study the magnetic behaviour of cerium in intermetallic compounds, that show an IV behaviour, e.g. CeSn 3 . In the progress of the investigations, it became of interest to study the effect of changes in the lattice of the IV compound by substituting La or Y for Ce, thus constituting the Cesub(1-x)Lasub(x)Sn 3 and Cesub(1-x)Ysub(x)Sn 3 quasibinary systems. A second purpose was to examine the possibility of introducing instabilities in the valency of a trivalent intermetallic cerium compound: CeIn 3 , also by La and Y-substitutions in the lattice. Measurements on the resulting Cesub(1-x)Lasub(x)In 3 and Cesub(1-x)Ysub(x)In 3 quasibinaries are described. A third purpose was to study the (gradual) transition from a trivalent cerium compound into an IV cerium compound. This was done by examining the magnetic properties of the CeInsub(x)Snsub(3-x) and CePbsub(x)Snsub(3-x) systems. Finally a new possibility was investigated: that of the occurrence of IV behaviour in CeSi 2 , CeSi, and in CeGa 2 . (Auth.)

  20. Determination of silver and cerium in the liver and the kidney from a severely burned infant treated with silver sulfadiazine and cerium nitrate

    International Nuclear Information System (INIS)

    Hirakawa, Keiko

    1983-01-01

    Silver and cerium in the liver and the kidney from severely burned infant were analyzed by neutron activation method. The patient was treated topically with cerium nitrate/silver sulfadiazine cream and cerium nitrate solution for 3 months. Then, the treatment with these drugs was stopped because o f abdominal distention. The patient died 1 month after the cessation of the treatment with these drugs. The tissue specimens, blank liver sample and reference standards were irradiated with TRIGA MARK II Reactor of Rikkyo University. About 1 month after the irradiation, the activities were measured with a Ge(Li) detector coupled to a 4096 channel pulse height analyzer. A large amount of silver was detected both in the liver and in the kidney and a trace of cerium only in the liver. A considerable amount of silver was detected in the liver and its quantity was about 1600 times more than that of normal livers reported by Hamilton, Minski and Cleary (1972 -- 73). Neither silver nor cerium were detected in the blank liver. These results suggest that prolonged topical chemotherapy of cerium nitrate/silver sulfadiazine cream and cerium nitrate solution for the extensive burn injuries causes considerable absorption of silver and cerium into the liver and the kidney. (author)

  1. Membrane assisted liquid-liquid extraction of cerium

    International Nuclear Information System (INIS)

    Soldenhoff, K.M.

    2000-02-01

    Membrane assisted liquid-liquid extraction of cerium was investigated, with emphasis placed on the study of the reaction chemistry and the kinetics of non-dispersive solvent extraction and stripping with microporous membranes. A bulk liquid membrane process was developed for the purification of cerium(IV) from sulfate solutions containing other rare earth elements. The cerium process was studied in both a flat sheet contained liquid membrane configuration and with hollow fibre contactors. Di-2-ethylhexyl phosphoric acid (DEHPA) was identified as a suitable extractant for cerium(IV) from sulfuric acid solution, with due consideration of factors such as extraction ability, resistance to degradation, solvent selectivity and potential for sulfate transfer into a strip solution. A detailed study of the extraction of cerium(IV) with DEHPA defined the extraction reaction chemistry. The Ce/DEHPA/sulfate system was also investigated with a flat sheet bulk liquid membrane configuration, using both sulfuric and hydrochloric acid as receiver solutions. These tests identified that hydrophobic membranes provide better mass transfer for extraction and hydrophilic membranes are better for stripping. The presence of an impurity, mono 2-ethylhexyl phosphoric acid (MEHPA), was found to have a dramatic accelerating effect on the rate of the chemical extraction reaction. This was attributed to its higher interfacial activity and population compared to DEHPA, and the fact that MEHPA was also found to be an active carrier for cerium(IV). The mass transfer rate of membrane assisted extraction and stripping of cerium, using hydrophobic and hydrophilic microporous membranes, respectively, was investigated using a modified Lewis-type cell. It was quantitatively demonstrated that the extraction process was mainly controlled by membrane diffusion and the stripping process was controlled by the chemical reaction rate, with membrane diffusion becoming important at low distribution coefficients

  2. Obtainment of cerium dioxide for use as spectrochemical standard

    International Nuclear Information System (INIS)

    Silva Queiroz, C.A. da; Hespanhol, E.C.B.; Abrao, A.

    1992-01-01

    This paper describes a simple method for cerium separation and purification. Cerium is previously precipitated with N H 3 /air/H 2 O 2 system in a mixed chlorides solution obtained from Brazilian monazite treatment. The cerium fraction as cerium chloride is run down throughout a strong cationic resin bed and then the rare earth impurities separation is done by elution of the resin with separation ammonium salt of EDTA. None retainer ion is used in the purification technique by ion exchange. (author)

  3. Selected cerium phase diagrams

    International Nuclear Information System (INIS)

    Gschneidner, K.A. Jr.; Verkade, M.E.

    1974-09-01

    A compilation of cerium alloy phase equilibria data based on the most reliable information available is presented. The binary systems selected are those of cerium with each of the following twenty nine elements which might be commonly found in steels: Al, Sb, As, Bi, Ca, C, Cr, Co, Nb, Cu, Fe, Pb, Mg, Mn, Mo, Ni, N, O, P, Se, Si, Ag, S, Te, Sn, Ti, W, and Zn. A brief discussion, a summary of crystal lattice parameters where applicable, and a list of references is included for each element surveyed. (U.S.)

  4. Novel in situ coordinated cerium salt/acrylonitrile-butadiene rubber composite

    International Nuclear Information System (INIS)

    Han, Jianjun; Lu, Haifeng; Zhang, Jie; Feng, Shengyu

    2012-01-01

    A novel rubber composite of acrylonitrile-butadiene rubber (NBR) filled with cerium salt particles was vulcanized via in situ coordination for the first time. The resulting materials exhibit good mechanical properties. Curing characteristics analysis, differential scanning calorimetry, X-ray photoelectron spectroscopy, tensile testing, and an equilibrium swelling method were used for the characterization of the composite. The results in this paper indicate that the composite is a kind of elastomer based on the in situ coordination crosslinking interactions between the nitrile groups (–CN) of NBR and cerium ions. The mechanical properties of vulcanized cerium salt/ NBR rubber are altered when changing the sorts of cerium salt. Moreover, these materials show good irradiation resistance because of the introduction of the cerium salt. -- Highlights: ► Cerium salts were firstly used to vulcanize the acrylonitrile-butadiene rubber. ► Cerium salts act as not only crosslink agents but also reinforcing fillers in the matrix. ► These materials show good irradiation resistance and mechanical properties at same time.

  5. Two-phase titration of cerium(3) by permanganate

    International Nuclear Information System (INIS)

    Lazarev, A.I.; Lazareva, V.I.; Gerko, V.V.

    1986-01-01

    Reaction of cerium (3) and permanganate was investigated at a room temperature depending on PH, concentrations of pyrophosphate, cerium (3), tetraphenylphosphonium and foreign compounds. Selective method of two-phase titration determination of cerium (3) by permanganate without using silver compounds, preliminary separation of chlorides, nitrates, was developed. The method was tested using alloys based on iron, nickel, REE, copper, cobalt (S r ≤0.008). Correctness is proved with method of standard additives

  6. Novel in situ coordinated cerium salt/acrylonitrile-butadiene rubber composite

    Energy Technology Data Exchange (ETDEWEB)

    Han, Jianjun [Key Laboratory of Special Functional Aggregated Materials, Ministry of Education, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Lu, Haifeng, E-mail: lhf@sdu.edu.cn [Key Laboratory of Special Functional Aggregated Materials, Ministry of Education, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Zhang, Jie [Key Laboratory of Special Functional Aggregated Materials, Ministry of Education, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Feng, Shengyu, E-mail: fsy@sdu.edu.cn [Key Laboratory of Special Functional Aggregated Materials, Ministry of Education, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)

    2012-09-14

    A novel rubber composite of acrylonitrile-butadiene rubber (NBR) filled with cerium salt particles was vulcanized via in situ coordination for the first time. The resulting materials exhibit good mechanical properties. Curing characteristics analysis, differential scanning calorimetry, X-ray photoelectron spectroscopy, tensile testing, and an equilibrium swelling method were used for the characterization of the composite. The results in this paper indicate that the composite is a kind of elastomer based on the in situ coordination crosslinking interactions between the nitrile groups (-CN) of NBR and cerium ions. The mechanical properties of vulcanized cerium salt/ NBR rubber are altered when changing the sorts of cerium salt. Moreover, these materials show good irradiation resistance because of the introduction of the cerium salt. -- Highlights: Black-Right-Pointing-Pointer Cerium salts were firstly used to vulcanize the acrylonitrile-butadiene rubber. Black-Right-Pointing-Pointer Cerium salts act as not only crosslink agents but also reinforcing fillers in the matrix. Black-Right-Pointing-Pointer These materials show good irradiation resistance and mechanical properties at same time.

  7. Preparation of cerium oxide for lens polishing powder

    International Nuclear Information System (INIS)

    Injarean, Uthaiwan; Rodthongkom, Chouvana; Pichestapong, Pipat; Changkrurng, Kalaya

    2003-10-01

    Cerium is an element of rare earth group which is called lanthanide series. It is found in the ores like monazite and xenotime which are the tailings of tin mines in the south of Thailand. Cerium is used mostly as lens polishing powder besides the applications in other industries. In this study, cerium extracted from monazite ore breakdown by alkaline process was used for the preparation of lens polishing powder. Cerium hydroxide cake from the process was dissolved by hydrochloric acid and precipitated with oxalic acid. The oxalate precipitate then was calcined to oxide powder and its particle size was measured. Precipitation conditions being studied are concentration of feed cerium chloride solution, concentration of oxalic acid used for the precipitation, concentration of sulfuric acid used as precipitation control reagent and the precipitation temperature. It was found that the appropriate precipitation conditions yielded the fine oxide powder with particle size about 12μm. The oxide powder can be ground to the size of 1-3 μm which is suitable for making lens polishing powder

  8. Bordoni relaxation and magnetic transformation in cerium and cerium-lanthanum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Postnikov, V S; Polner, G L; Sharshakov, I M

    1975-11-01

    The internal friction in pure cerium and cerium-base alloys with 2.5 and 12 weight percent of lanthanum added at temperature ranging from 4.2 deg up to 77/sup 0/K is described. Amplitude-independent internal friction has been measured with an inverse torsion pendulum with a specimen oscillation frequency of 1-30 hz in vacuum not less than 1.10/sup -5/ torr. A temperature of the specimen has been determined with a capacitance-type sensor and a gas gage. A curve showing the dependence of internal friction upon a temperature of pure cerium has two distinct peaks; the first at 12.5/sup 0/K, the second at 45/sup 0/K. The 12.5/sup 0/K peak is accounted for by a transition of antiferromagnetic ..beta..-Ce into a paramagnetic state. The 45/sup 0/K peak is a Bordoni maximum. The paper describes an influence of additions, specimen oscillation frequency variations, deformation and annealing upon the peak behavor. Added lanthanum reduces not only a peak temperature but a height as well. Studies of the 45/sup 0/K peak have shown that its temperature location depends upon the specimen oscillation frequency. As the frequency increases the peak tends to a range of high temperatures which confirms its relaxation nature.

  9. Dissolution properties of cerium dibutylphosphate corrosion inhibitors

    NARCIS (Netherlands)

    Soestbergen, van M.; Erich, S.J.F.; Huinink, H.P.; Adan, O.C.G.

    2013-01-01

    The corrosion inhibitor cerium dibutylphosphate, Ce(dbp)3, prevents corrosion by cerium and dbp deposition at the alkaline cathode and acidic anode respectively. The pH dependent Ce(dbp)3 solubility seems to play an essential role in the inhibition degree. We found that Ce(dbp)3 scarcely dissolves

  10. Fundamental aspects of regenerative cerium oxide nanoparticles and their applications in nanobiotechnology

    Science.gov (United States)

    Patil, Swanand D.

    Cerium oxide has been used extensively for various applications over the past two decades. The use of cerium oxide nanoparticles is beneficial in present applications and can open avenues for future applications. The present study utilizes the microemulsion technique to synthesize uniformly distributed cerium oxide nanoparticles. The same technique was also used to synthesize cerium oxide nanoparticles doped with trivalent elements (La and Nd). The fundamental study of cerium oxide nanoparticles identified variations in properties as a function of particle size and also due to doping with trivalent elements (La and Nd). It was found that the lattice parameter of cerium oxide nanoparticles increases with decrease in particle size. Also Raman allowed mode shift to lower energies and the peak at 464 cm-1 becomes broader and asymmetric. The size dependent changes in cerium oxide were correlated to increase in oxygen vacancy concentration in the cerium oxide lattice. The doping of cerium oxide nanoparticles with trivalent elements introduces more oxygen vacancies and expands the cerium oxide lattice further (in addition to the lattice expansion due to the size effect). The lattice expansion is greater for La-doped cerium oxide nanoparticles compared to Nd-doping due to the larger ionic radius of La compared to Nd, the lattice expansion is directly proportional to the dopant concentration. The synthesized cerium oxide nanoparticles were used to develop an electrochemical biosensor of hydrogen peroxide (H2O2). The sensor was useful to detect H2O2 concentrations as low as 1muM in water. Also the preliminary testing of the sensor on tomato stem and leaf extracts indicated that the sensor can be used in practical applications such as plant physiological studies etc. The nanomolar concentrations of cerium oxide nanoparticles were also found to be useful in decreasing ROS (reactive oxygen species) mediated cellular damages in various in vitro cell cultures. Cerium oxide

  11. Cerium-modified Aurivillius-type sodium lanthanum bismuth titanate with enhanced piezoactivities

    International Nuclear Information System (INIS)

    Wang Chunming; Zhao Liang; Wang Jinfeng; Zheng Limei; Du Juan; Zhao Minglei; Wang Chunlei

    2009-01-01

    The electrical, piezoelectric and dielectric properties of cerium-modified Aurivillius-type sodium lanthanum bismuth titanate (Na 0.5 La 0.5 Bi 4 Ti 4 O 15 , NLBT) ceramics were investigated. It was found the piezoelectric activities of NLBT ceramics were significantly improved by cerium modification. The piezoelectric coefficient d 33 and Curie temperature T c for the 0.50 wt.% cerium-modified NLBT were found to be 29 pC/N and 573 deg. C, respectively. The reasons for piezoelectric activities improvement by cerium modification were given. A small dielectric abnormity was observed in NLBT ceramics, which can be suppressed by cerium modification.

  12. Specific Features of the Response of Cerium to Pulsed Actions

    Science.gov (United States)

    Atroshenko, S. A.; Zubareva, A. N.; Morozov, V. A.; Savenkov, G. G.; Utkin, A. V.

    2018-02-01

    Experimental studies of cerium at high rates and nanosecond durations of action have been performed. The isomorphic phase transition was studied upon shock compression. The spall strength of cerium has been determined. Cerium demonstrates anomalous compressibility upon dynamic loading. Stress waves dampen under action of a high-current electron beam due to the energy dissipation during fragmentation and twinning.

  13. A contribution to the radiologic findings in cerium pneumoconiosis

    International Nuclear Information System (INIS)

    Hecht, F.M.; Wesch, H.; Deutsches Krebsforschungszentrum, Heidelberg

    1980-01-01

    Report on a 69 year old man, who had been employed as photographer in the printing industry and who had been exposed to Cerium for 40 years. The chest X-ray which was performed 9 years after the end of the exposure displayes striate densities of the lungs, which must be considered as a late stage of Cerium-pneumoconiosis. The changes which were found fulfill the code 't 1/0 RO, RM, RU, LO, LM, LU, p 0/1 RO, RM, LO, LM, em, tbu' according to the 'ILO U/C 1971 classification of pneumoconiosis'. The diagnosis could be substantiated by measureing Cerium in the lung parenchyma qualitatively and quantitatively using neutrone activating analysis. The radiolgic findings of the Cerium pneumoconiosis are discussed. (orig.) [de

  14. Electronic state of cerium-based catalysts studied by spectroscopic methods (XPS, XAS)

    International Nuclear Information System (INIS)

    Le Normand, F.; Bernhardt, P.; Hilaire, L.; Kili, K.; Maire, G.; Krill, G.

    1987-01-01

    X-ray Photoelectron Spectroscopy (XPS) of the 3d core level of cerium and X-ray Absorption Spectroscopy (XAS) of the L III absorption edge of cerium have been used to study Pd/CeO 2 , Pd-Ce/γAl 2 O 3 and Ce/γAl 2 O 3 catalysts. The oxidation state of cerium was found to decrease with decreasing amounts of cerium on the surface. It was quite close to III for very low contents of cerium (2-3%). For higher cerium contents the oxidation state was nearer to IV but differences between the two methods were found, owing to the fact that XAS is a volume sensitive probe. The oxidation state of cerium was also lower for Pd-Ce/γAl 2 O 3 than for Ce/γAl 2 O 3 , suggesting the formation of Ce III OCl, chlorine coming from the precursor salt of palladium. 15 refs.; 5 figs.; 1 table

  15. Adsorption of Some Hazardous Radionuclides on Cerium(IV) Antimonate

    International Nuclear Information System (INIS)

    Aly, H.F.; Zakaria, E.S.; Shady, S.A.; El-Naggar, I.M.

    1999-01-01

    Cerium(IV) antimonate had been prepared by the dropwise addition of 0.6 M antimony pentachloride and 0.6 M cerium ammonium nitrate solutions by a molar radio of Ce/Sb 0.75. Exchange isotherms for H +/ Co 2+ , H +/ Cs +, H +/ Zn 2+ , H +/ Sr 2+ and H +/ Eu 3+ have been determined at 25, 40 and 60 degree. Besides it was proved that europium is physically adsorbed while zinc, strontium, cobalt and cesium are chemically adsorbed. Moreover, the heat of adsorption of zinc, strontium, cobalt and cesium on cerium(IV) antimonate had been calculated and indicated that cerium(IV) antimonate is of endothermic behaviour towards these ions. Also the distribution coefficients of these ions were determined and it was found that the selectivity in the order: Eu 3+ >Sr 2+ > Cs +> Na +

  16. Metabolism of cerium 144 in rat. Distribution - elimination - dosimetry

    International Nuclear Information System (INIS)

    Remy, Jacques

    1959-01-01

    This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [fr

  17. Investigation of AA2024-T3 surfaces modified by cerium compounds: A localized approach

    International Nuclear Information System (INIS)

    Paussa, L.; Andreatta, F.; De Felicis, D.; Bemporad, E.; Fedrizzi, L.

    2014-01-01

    Highlights: •The precipitation of cerium compounds occurs on the entire AA2024-T3 surface. •The matrix is less involved in the cerium precipitation. •Cerium intensely precipitates on Mg-rich IM particles. •The electrochemical behavior of Mg-rich IM particles influences the mechanism of cerium precipitation. -- Abstract: The precipitation of cerium compounds on polished AA2024-T3 surfaces was investigated following an electrochemical and microstructural localized approach. It was found that cerium precipitation occurs on the entire surface covering intermetallic particles and the matrix as well. The matrix is the region where the precipitation of cerium is less favoured. The highest amount of cerium was observed on magnesium-rich intermetallic particles. The localized analyses suggest that precipitation of cerium on magnesium-rich intermetallic particles could happen following two mechanisms: the former based on a potential reversal of the intermetallic particles and the latter due to a partial magnesium dissolution

  18. Electrochemical redox processes involving soluble cerium species

    International Nuclear Information System (INIS)

    Arenas, L.F.; Ponce de León, C.; Walsh, F.C.

    2016-01-01

    Highlights: • The relevance of cerium in laboratory and industrial electrochemistry is considered. • The history of fundamental electrochemical studies and applications is considered. • The chemistry, redox thermodynamics and electrode kinetics of cerium are summarised. • The uses of cerium ions in synthesis, energy storage, analysis and environmental treatment are illustrated. • Research needs and development perspectives are discussed. - Abstract: Anodic oxidation of cerous ions and cathodic reduction of ceric ions, in aqueous acidic solutions, play an important role in electrochemical processes at laboratory and industrial scale. Ceric ions, which have been used for oxidation of organic wastes and off-gases in environmental treatment, are a well-established oxidant for indirect organic synthesis and specialised cleaning processes, including oxide film removal from tanks and process pipework in nuclear decontamination. They also provide a classical reagent for chemical analysis in the laboratory. The reversible oxidation of cerous ions is an important reaction in the positive compartment of various redox flow batteries during charge and discharge cycling. A knowledge of the thermodynamics and kinetics of the redox reaction is critical to an understanding of the role of cerium redox species in these applications. Suitable choices of electrode material (metal or ceramic; coated or uncoated), geometry/structure (2-or 3-dimensional) and electrolyte flow conditions (hence an acceptable mass transport rate) are critical to achieving effective electrocatalysis, a high performance and a long lifetime. This review considers the electrochemistry of soluble cerium species and their diverse uses in electrochemical technology, especially for redox flow batteries and mediated electrochemical oxidation.

  19. Lattice dynamics of α-cerium

    International Nuclear Information System (INIS)

    Smith, G.S.

    1985-01-01

    The lattice dynamics of the fcc α-phase of cerium metal was investigated using inelastic neutron scattering techniques. This phase of cerium is an example of a mixed-valent system. Various physical properties of α-Ce suggest that there may be coupling between the phonons and the f d transitions associated with the mixed valence phenomenon. These measurements of the dispersion curves provide important information about the electron-phonon interaction in this phase of cerium. These studies were not performed in the past because single crystals of α-Ce were not available. We were able to prepare a single α-Ce crystal using a high temperature, high pressure technique. The sample was of sufficient size for inelastic neutron scattering experiments, but the measurements were complicated because of the large mosaic spread (approx.7.0 0 ) of the crystal. It was possible, however, to obtain a set of dispersion curves along the [00zeta], [zeta,zeta,0], and [zeta,zeta,zeta] symmetry directions. Comparison of the dispersion curves with those of fcc γ-Ce indicate that the branches exhibit anomalous features that may be related to the mixed-valence effects

  20. Systems of cerium(3) nitrate-dimethyl amine nitrate-water and cerium(3) nitrate-dimethyl amine nitrate-water

    International Nuclear Information System (INIS)

    Mininkov, N.E.; Zhuravlev, E.F.

    1976-01-01

    Solubility of solid phases in the systems cerium(3)nitrate-water-dimethyl amine nitrate and cerium(3)nitrate-water-dimethyl amine nitrate has been st ed by the method of isothermal sections at 25 and 50 deo. C. It has been shown that one anhydrous compound is formed in each system with a ratio of cerium(3) nitrate to amine nitrate 1:5. The compounds formed in the systems have been separated from the corresponding solutions and studied by microcrystalloscopic, X-ray phase, thermal and infrared spectroscopic methods. On the basis of spectroscopic studies the following formula has been assigned to the compound: [(CH 3 ) 2 NH 2 + ] 5 x[Ce(NO 3 ) 8 ]. The thermal analysis of the compound has shown that its melting point is 106 deg C. The solubility isotherms in the system Ce(NO 3 ) 3 -H 2 O-(C 2 H 5 ) 2 NHxHNO 3 consist of three branches which intersect in two eutonic points

  1. Method of cerium separation from other lanthanides and yttrium

    International Nuclear Information System (INIS)

    Tran, Duc Hiep; Mostecky, J.

    1988-01-01

    Cerium is separated from a suspension produced during the aerial oxidation process. The suspension is subject to a cyclic process of two-stage fractional dissolution. Following the first dissolution, almost all cerium remains undissolved while 95% of the other lanthanides pass into the solution. The filtrate of the second stage of dissolution containing about 5% of ceriumm is returned for oxidation with the next batch of hydroxide mixed concentrate. Following oxidation, the two-stage fractional dissolution is repeated. This cycling provides quantitative cerium separation from other rare earth elements. (E.S.)

  2. Characterization of platinized and unplatinized cerium dioxide and other cerium containing catalyst supports

    International Nuclear Information System (INIS)

    Daniel, D.W.

    1984-01-01

    The adsorption of CO on platinized cerium dioxide has been investigated by FTIR (Fourier Transform Infrared Spectroscopy). Four active surface sites and two adsorption geometries were found for the oxidized catalyst. Although the metallic sites and both geometries, linear and bridged, were retained upon reduction the two cationic sites were not. During stepwise desorption, CO dissociates leaving behind adsorbed carbon inhibiting readsorption. At elevated temperatures CeO 2 oxidizes Pt. The large decrease in CO adsorption resulting from high temperature reduction was reversed by reoxidation. XPS (X-ray Photoelectron Spectroscopy) data provided no evidence of encapsulation and XRD (X-ray Diffraction) showed the retention of a constant particle size. The results were interpreted as electronic metal-support interaction. The addition of H 2 or D 2 to adsorbed CO at 25 0 C caused spillover of the CO onto the support and a decrease in CO band frequency. When O 2 was added to preadsorbed CO a new band associated with oxygen and CO coadsorbed on a single Pt atom appeared. Carbon dioxide dissociation at room temperature is proposed to occur via a Langmuir-Hinshelwood mechanism. CO adsorption on platinized titania, silica, ceria/titania, ceria/silica, and cerium titanate has also been studied by the same techniques. The adsorption/desorption behavior of the cerium/titania and the single oxide systems paralleled that of Pt/CeO 2

  3. Stepwise hydrochloric acid extraction of monazite hydroxides for the recovery of cerium lean rare earths, cerium, uranium and thorium

    International Nuclear Information System (INIS)

    Swaminathan, T.V.; Nair, V.R.; John, C.V.

    1988-01-01

    Monazite sand is normally processed by the caustic soda route to produce mixed rare earth chloride, thorium hydroxide and trisodium phosphate. Bulk of the mixed rare earth chloride is used for the preparation of FC catalysts. Recently some of the catalyst producers have shown preference to cerium depleted (lanthanum enriched) rare earth chloride rather than the natural rare earth chloride obtained from monazite. Therefore, a process for producing cerium depleted rare earth chloride, cerium, thorium and uranium from rare earth + thorium hydroxide obtained by treating monazite, based on stepwise hydrochloric acid extraction, was developed in the authors laboratory. The process involves drying of the mixed rare earth-thorium hydroxide cake obtained by monazite-caustic soda process followed by stepwise extraction of the dried cake with hydrochloric acid under specified conditions

  4. Studies on the promotion of nickel—alumina coprecipitated catalysts: III. Cerium oxide

    NARCIS (Netherlands)

    Lansink Rotgerink, H.G.J.; Slaa, J.C.; van Ommen, J.G.; Ross, J.R.H.

    1988-01-01

    Three series of cerium-promoted nickel—alumina catalysts with different nickel-to-aluminium ratios each containing different amounts of cerium have been prepared and characterized. The calcination and reduction behaviour were found not to be altered by the presence of cerium. Part of the promoter

  5. Cerium-doped scintillating fused-silica fibers

    Science.gov (United States)

    Akchurin, N.; Cowden, C.; Damgov, J.; Dragoiu, C.; Dudero, P.; Faulkner, J.; Kunori, S.

    2018-04-01

    We report on a set of measurements made on (scintillating) cerium-doped fused-silica fibers using high-energy particle beams. These fibers were uniformly embedded in a copper absorber in order to utilize electromagnetic showers as a source of charged particles for generating signals. This new type of cerium-doped fiber potentially offers myriad new applications in calorimeters in high-energy physics, tracking systems, and beam monitoring detectors for future applications. The light yield, pulse shape, attenuation length, and light propagation speeds are given and discussed. Possible future applications are also explored.

  6. Preparation of high-purity cerium nitrate; Preparacao de nitrato de cerio de alta pureza

    Energy Technology Data Exchange (ETDEWEB)

    Avila, Daniela Moraes; Silva Queiroz, Carlos Alberto da; Santos Mucillo, Eliana Navarro dos [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1995-12-31

    The preparation of high-purity cerium nitrate has been carried out Cerium oxide has been prepared by fractioned precipitation and ionic exchange techniques, using a concentrate with approximately 85% of cerium oxide from NUCLEMON as raw material. Five sequential ion-exchange columns with a retention capacity of 170 g each have been used. The ethylenediamine-tetraacetic acid (EDTA) was used as eluent. The cerium content has been determined by gravimetry and iodometry techniques. The resulting cerium oxide has a purity > 99%. This material was transformed in cerium nitrate to be used as precursor for the preparation of Zirconia-ceria ceramics by the coprecipitation technique. (author) 2 tabs.

  7. Synthesis and crystal kinetics of cerium oxide nanocrystallites prepared by co-precipitation process

    International Nuclear Information System (INIS)

    Shih, C.J.; Chen, Y.J.; Hon, M.H.

    2010-01-01

    Cerium oxide nanocrystallites were synthesized at a relatively low temperature using cerium nitrate as starting materials in a water solution by a co-precipitation process. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K by XRD analysis. When calcined from 473 to 1273 K, the crystallization of the face-centered cubic phase was observed by XRD. The crystallite size of the cerium oxide increased from 10.0 to 43.8 nm with calcining temperature increasing from 673 to 1273 K. The activation energy for growth of cerium oxide nanoparticles was found to be 16.0 kJ mol -1 .

  8. Synthesis and crystal kinetics of cerium oxide nanocrystallites prepared by co-precipitation process

    Energy Technology Data Exchange (ETDEWEB)

    Shih, C.J., E-mail: cjshih@kmu.edu.tw [Department of Fragrance and Cosmetics Science, Kaohsiung Medical University, 100 Shi-Chuan 1st Road, Kaohsiung 807, Taiwan (China); Chen, Y.J. [Institute of Biomedical Sciences, National Sun Yat-Sen University, Kaohsiung 804, Taiwan (China); Hon, M.H. [Department of Materials Science and Engineering, National Cheng Kung University, Tainan 701, Taiwan (China)

    2010-05-15

    Cerium oxide nanocrystallites were synthesized at a relatively low temperature using cerium nitrate as starting materials in a water solution by a co-precipitation process. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K by XRD analysis. When calcined from 473 to 1273 K, the crystallization of the face-centered cubic phase was observed by XRD. The crystallite size of the cerium oxide increased from 10.0 to 43.8 nm with calcining temperature increasing from 673 to 1273 K. The activation energy for growth of cerium oxide nanoparticles was found to be 16.0 kJ mol{sup -1}.

  9. Synthesis and characterization of magnesium doped cerium oxide for the fuel cell application

    International Nuclear Information System (INIS)

    Kumar, Amit; Kumari, Monika; Kumar, Mintu; Kumar, Sacheen; Kumar, Dinesh

    2016-01-01

    Cerium oxide has attained much attentions in global nanotechnology market due to valuable application for catalytic, fuel additive, and widely as electrolyte in solid oxide fuel cell. Doped cerium oxide has large oxygen vacancies that allow for greater reactivity and faster ion transport. These properties make cerium oxide suitable material for SOFCs application. Cerium oxide electrolyte requires lower operation temperature which shows improvement in processing and the fabrication technique. In our work, we synthesized magnesium doped cerium oxide by the co-precipitation method. With the magnesium doping catalytic reactivity of CeO_2 was increased. Synthesized nanoparticle were characterized by the XRD and UV absorption techniques.

  10. Thin film ionic conductors based on cerium oxide

    International Nuclear Information System (INIS)

    Haridoss, P.; Hellstrom, E.; Garzon, F.H.; Brown, D.R.; Hawley, M.

    1994-01-01

    Fluorite and perovskite structure cerium oxide based ceramics are a class of materials that may exhibit good oxygen ion and/or protonic conductivity. The authors have successfully deposited thin films of these materials on a variety of substrates. Interesting orientation relationships were noticed between cerium oxide films and strontium titanate bi-crystal substrates. Near lattice site coincidence theory has been used to study these relationships

  11. Antimicrobial cerium ion-chitosan crosslinked alginate biopolymer films: A novel and potential wound dressing.

    Science.gov (United States)

    Kaygusuz, Hakan; Torlak, Emrah; Akın-Evingür, Gülşen; Özen, İlhan; von Klitzing, Regine; Erim, F Bedia

    2017-12-01

    Wound dressings require good antiseptic properties, mechanical strength and, more trustably, natural material ingredients. Antimicrobial properties of cerium ions and chitosan are known and alginate based wound dressings are commercially available. In this study, the advantages of these materials were combined and alginate films were crosslinked with cerium(III) solution and chitosan added cerium(III) solution. Films were characterized by Fourier transform infrared spectroscopy (FTIR), light transmittance, scanning electron microscopy (SEM), swelling experiments, water vapor transmittance tests, and mechanical stretching tests. The antibacterial and physical properties of the films were compared with those of conventional calcium alginate films. Both cerium ion crosslinked and cerium ion-chitosan crosslinked alginate films gained antibacterial activity against Gram-negative (Escherichia coli) and Gram-positive (Staphylococcus aureus) bacteria. Cerium alginate-chitosan films showed high resistance to being deformed elastically. Results show that cerium alginate-chitosan films can be flexible, ultraviolet-protecting, and antibacterial wound dressings. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Casting Characteristics of High Cerium Content Aluminum Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, D; Rios, O R; Sims, Z C; McCall, S K; Ott, R T

    2017-09-05

    This paper compares the castability of the near eutectic aluminum-cerium alloy system to the aluminum-silicon and aluminum-copper systems. The alloys are compared based on die filling capability, feeding characteristics and tendency to hot tear in both sand cast and permanent mold applications. The castability ranking of the binary Al–Ce systems is as good as the aluminum-silicon system with some deterioration as additional alloying elements are added. In alloy systems that use cerium in combination with common aluminum alloying elements such as silicon, magnesium and/or copper, the casting characteristics are generally better than the aluminum-copper system. In general, production systems for melting, de-gassing and other processing of aluminum-silicon or aluminum-copper alloys can be used without modification for conventional casting of aluminum-cerium alloys.

  13. Effect of adduct formation on valent state of cerium in its ν-diketonates

    International Nuclear Information System (INIS)

    Spitsyn, V.I.; Martynenko, L.I.; Pechurova, N.I.; Snezhko, N.I.; Murav'eva, I.A.; Anufrieva, S.I.

    1982-01-01

    Physicochemical investigation of the system cerium (III, IV)-ν-diketone-additional ligand shows that ν-diketonate ability to adduct formation decreases in the series tenoyltrifluoro-acetonate > acetylacetonate > dibenzoylmethanate > benzoylmethanate. Adduct formation of the cerium (III, IV) ν-diketonates stabilizes cerium in trivalent condition, while oxidation degree 4+ is stable in tetrakis-ν-diketonates. The additional ligands are arranged in the series: tributhylphosphate < trioctyl-phosphineoxide < triphenylphosphineoxide < α, α'-dipyridyl < o-phenanthroline by the effect on cerium (III) stabilization in its ν-diketonates

  14. Effect of adduct formation on valent state of cerium in its. beta. -diketonates

    Energy Technology Data Exchange (ETDEWEB)

    Spitsyn, V.I.; Martynenko, L.I.; Pechurova, N.I.; Snezhko, N.I.; Murav' eva, I.A.; Anufrieva, S.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1982-04-01

    Physicochemical investigation of the system cerium (III, IV)-..beta..-diketone-additional ligand shows that ..beta..-diketonate ability to adduct formation decreases in the series tenoyltrifluoro-acetonate > acetylacetonate > dibenzoylmethanate > benzoylmethanate. Adduct formation of the cerium (III, IV) ..beta..-diketonates stabilizes cerium in trivalent condition, while oxidation degree 4+ is stable in tetrakis-..beta..-diketonates. The additional ligands are arranged in the series: tributhylphosphate < trioctyl-phosphineoxide < triphenylphosphineoxide < ..cap alpha.., ..cap alpha..'-dipyridyl < o-phenanthroline by the effect on cerium (III) stabilization in its ..beta..-diketonates.

  15. Tuning Reactivity and Electronic Properties through Ligand Reorganization within a Cerium Heterobimetallic Framework

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, Jerome R.; Gordon, Zachary; Booth, Corwin H.; Carroll, Patrick J.; Walsh, Patrick J.; Schelter, Eric J.

    2014-06-24

    Cerium compounds have played vital roles in organic, inorganic, and materials chemistry due to their reversible redox chemistry between trivalent and tetravalent oxidation states. However, attempts to rationally access molecular cerium complexes in both oxidation states have been frustrated by unpredictable reactivity in cerium(III) oxidation chemistry. Such oxidation reactions are limited by steric saturation at the metal ion, which can result in high energy activation barriers for electron transfer. An alternative approach has been realized using a rare earth/alkali metal/1,1'-BINOLate (REMB) heterobimetallic framework, which uses redox-inactive metals within the secondary coordination sphere to control ligand reorganization. The rational syntheses of functionalized cerium(IV) products and a mechanistic examination of the role of ligand reorganization in cerium(III) oxidation are presented.

  16. Comparison of Titration ICP and XRF Spectrometry Methods in Determination of Cerium in Lens Polishing Powder

    International Nuclear Information System (INIS)

    Ninlaphruk, Sumalee; Pichestapong, Pipat; Mungpayabal, Harinate; Jiyavaranant, Thitima; Srisukho, Supapan; Chaisai, Prapassurn

    2004-10-01

    Three analytical methods in determination of cerium in cerium oxide separated from monazite ore for producing lens polishing powder were compared. These methods are titration ICP and XRF spectrometry techniques. The cerium oxide sample with estimated 45% cerium content needed to be digested and converted into solution before the analysis. The analytical results shown significantly no difference between each method. However, the titration method was found to be more convenient and suitable for quality control in the production of cerium oxide as it does not require standard cerium and the complicated analytical instruments

  17. Direct growth of cerium oxide nanorods on diverse substrates for superhydrophobicity and corrosion resistance

    International Nuclear Information System (INIS)

    Cho, Young Jun; Jang, Hanmin; Lee, Kwan-Soo; Kim, Dong Rip

    2015-01-01

    Graphical abstract: - Highlights: • Cerium oxide nanorods were uniformly grown on diverse substrates. • Changes in growth conditions led to morphology evolution of cerium oxide nanostructures. • The grown cerium oxide nanostructures were single or poly crystalline. • Direct growth of cerium oxide nanorods made the diverse substrates superhydrophobic and anti-corrosive without any surface modifiers. - Abstract: Superhydrophobic surfaces with anti-corrosion properties have attracted great interest in many industrial fields, particularly to enhance the thermal performance of offshore applications such as heat exchangers, pipelines, power plants, and platform structures. Nanostructures with hydrophobic materials have been widely utilized to realize superhydrophobicity of surfaces, and cerium oxide has been highlighted due to its good corrosion resistive and intrinsically hydrophobic properties. However, few studies of direct growth of cerium oxide nanostructures on diverse substrates have been reported. Herein we report a facile hydrothermal method to directly grow cerium oxide nanorods on diverse substrates, such as aluminum alloy, stainless steel, titanium, and silicon. Diverse substrates with cerium oxide nanorods exhibited superhydrophobicity with no hydrophobic modifiers on their surfaces, and showed good corrosion resistive properties in corrosive medium. We believe our method could pave the way for realization of scalable and sustainable corrosion resistive superhydrophobic surfaces in many industrial fields

  18. Direct growth of cerium oxide nanorods on diverse substrates for superhydrophobicity and corrosion resistance

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Young Jun; Jang, Hanmin; Lee, Kwan-Soo [School of Mechanical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, Dong Rip, E-mail: dongrip@hanyang.ac.kr [School of Mechanical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Institute of Nano Science and Technology, Hanyang University, Seoul 133-791 (Korea, Republic of)

    2015-06-15

    Graphical abstract: - Highlights: • Cerium oxide nanorods were uniformly grown on diverse substrates. • Changes in growth conditions led to morphology evolution of cerium oxide nanostructures. • The grown cerium oxide nanostructures were single or poly crystalline. • Direct growth of cerium oxide nanorods made the diverse substrates superhydrophobic and anti-corrosive without any surface modifiers. - Abstract: Superhydrophobic surfaces with anti-corrosion properties have attracted great interest in many industrial fields, particularly to enhance the thermal performance of offshore applications such as heat exchangers, pipelines, power plants, and platform structures. Nanostructures with hydrophobic materials have been widely utilized to realize superhydrophobicity of surfaces, and cerium oxide has been highlighted due to its good corrosion resistive and intrinsically hydrophobic properties. However, few studies of direct growth of cerium oxide nanostructures on diverse substrates have been reported. Herein we report a facile hydrothermal method to directly grow cerium oxide nanorods on diverse substrates, such as aluminum alloy, stainless steel, titanium, and silicon. Diverse substrates with cerium oxide nanorods exhibited superhydrophobicity with no hydrophobic modifiers on their surfaces, and showed good corrosion resistive properties in corrosive medium. We believe our method could pave the way for realization of scalable and sustainable corrosion resistive superhydrophobic surfaces in many industrial fields.

  19. Dielectric parameters of blood plasma of rats treated with cerium-144 and external irradiation

    International Nuclear Information System (INIS)

    Hadzhidekova, E.; Kiradzhiev, G.; Paskalev, Z.; Miloslavov, V.

    1988-01-01

    Investigation was carried out of the dielectric parameters of blood plasma of male Wistar rats treated with cerium 144 in doses of 370 kBq/animal and external gamma irradiation in doses of 200 cGy and 400 cGy. The radioactive cerium was introduced intraperitoneally 1 h after the external irradiation with dose rate of 1,6 cGy/sec. The permittivity ε, the time of relaxation τ and the coefficient of Debaye κ of plasma protein molecules were determined at the 1st, 3rd, 10th, 15th, and 30th days after treatement for frequence ranges of 1,4, 2,2, 3,6 and 6 MHz. At the same terms the content of cerium 144 was measured in the organs of predilectional accumulation of cerium. It was established that the treatment only with cerium lead to most essential changes of dielectric parameters at frequence of 3,6 MHz. The external irradiation didn't influence essentially the kinetics of absorbed cerium. In combination of both radiation factors the action of cerium was predominant

  20. Critical indices for reversible gamma-alpha phase transformation in metallic cerium

    Science.gov (United States)

    Soldatova, E. D.; Tkachenko, T. B.

    1980-08-01

    Critical indices for cerium have been determined within the framework of the pseudobinary solution theory along the phase equilibrium curve, the critical isotherm, and the critical isobar. The results obtained verify the validity of relationships proposed by Rushbrook (1963), Griffiths (1965), and Coopersmith (1968). It is concluded that reversible gamma-alpha transformation in metallic cerium is a critical-type transformation, and cerium has a critical point on the phase diagram similar to the critical point of the liquid-vapor system.

  1. Characterization of microstructure and catalytic of cerium oxide obtained by colloidal solution

    International Nuclear Information System (INIS)

    Senisse, C.A.L.; Bergmann, C.P.; Alves, A.K.

    2012-01-01

    This study investigated to obtain particles of cerium oxide, for use as catalysts for the combustion of methane using the technique of through polymeric colloidal solution. Obtaining the colloidal system is based on hydrolysis of salts such as cerium acetylacetonate, cerium nitrate in the presence of additives such as polyvinylbutyral (PVB), polyvinylpyrrolidone (PVP) and polyvinyl acetate (PVA), at concentrations of 5, 10 and 15% in aqueous or alcoholic medium. These solutions containing ions of interest were subjected to a heat treatment at 650° C for 30 minutes, with heating rate of 2 ° C/ min. After heat treatment, the fibers were characterized according to their morphology, surface area, crystallinity, weight loss and catalytic activity. Samples obtained from cerium acetylacetonate were more reactive than the cerium nitrate to the combustion of methane, as showed greater conversions and higher temperatures reached during the process, which is of utmost importance since the combustion catalytic methane is used for generating thermal energy. After the reaction with methane, the samples underwent significant change in surface area, probably due to the intensity of combustion reactions of the nitrate and the generation of heat involved in this reaction, which gave rise to coarse particles. During the combustion process using the obtained from particles of cerium acetylacetonate, there was the release of large quantities of nitrogen compared to the results of assays with the particles obtained with cerium nitrate. (author)

  2. Nanoparticulate cerium dioxide and cerium dioxide-titanium dioxide composite thin films on glass by aerosol assisted chemical vapour deposition

    International Nuclear Information System (INIS)

    Qureshi, Uzma; Dunnill, Charles W.; Parkin, Ivan P.

    2009-01-01

    Two series of composite thin films were deposited on glass by aerosol assisted chemical vapour deposition (AACVD)-nanoparticulate cerium dioxide and nanoparticulate cerium dioxide embedded in a titanium dioxide matrix. The films were analysed by a range of techniques including UV-visible absorption spectroscopy, X-ray diffraction, scanning electron microscopy and energy dispersive analysis by X-rays. The AACVD prepared films showed the functional properties of photocatalysis and super-hydrophilicity. The CeO 2 nanoparticle thin films displaying photocatalysis and photo-induced hydrophilicity almost comparable to that of anatase titania.

  3. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  4. Separation of cerium and fractionation of rare earths from mixed chlorides

    International Nuclear Information System (INIS)

    Silva Queiroz, C.A. da; Sood, S.P.; Abrao, A.

    1982-01-01

    The separation of cerium from rare earths chlorides solutions by precipitation with hydrogen peroxide/air/dil. ammonium hydroxide; purification of cerium; fractionation by ion exchange and analytical control of the process are presented. (A.R.H.) [pt

  5. Two-phase titration of cerium(III) by permanganate

    International Nuclear Information System (INIS)

    Lazarev, A.I.; Lazareva, V.I.; Gerko, V.V.

    1987-01-01

    This paper presents a method for the two-phase titrimetric determination of cerium(III) with permanganate which does not require an expenditure of sugar and preliminary removal of chlorides and nitrates. The interaction of cerium(III) with permanganate at room temperature was studied as a function of the pH, the concentration of pyrophosphate, tetraphenylphosphonium (TPP), permanganate, and extraneous compounds, the rate of titration, and the time of stay of the solution in air before titration. The investigations were conducted according to the following methodology: water, solution of cerium(III) pyrophosphate, and TPP were introduced into an Erlenmeyer flask with a side branch near the bottom for clearer observation of the color of the chloroform phase. The authors established the given pH value, poured the water into a volume of 50 ml, and added chloroform. The result was titrated with permanganate solutions of various concentrations until a violet color appeared in the chloroform phase

  6. Processing and Characterization of Sol-Gel Cerium Oxide Microspheres

    Energy Technology Data Exchange (ETDEWEB)

    McClure, Zachary D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Padilla Cintron, Cristina [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-09-27

    Of interest to space exploration and power generation, Radioisotope Thermoelectric Generators (RTGs) can provide long-term power to remote electronic systems without the need for refueling or replacement. Plutonium-238 (Pu-238) remains one of the more promising materials for thermoelectric power generation due to its high power density, long half-life, and low gamma emissions. Traditional methods for processing Pu-238 include ball milling irregular precipitated powders before pressing and sintering into a dense pellet. The resulting submicron particulates of Pu-238 quickly accumulate and contaminate glove boxes. An alternative and dust-free method for Pu-238 processing is internal gelation via sol-gel techniques. Sol-gel methodology creates monodisperse and uniform microspheres that can be packed and pressed into a pellet. For this study cerium oxide microspheres were produced as a surrogate to Pu-238. The similar electronic orbitals between cerium and plutonium make cerium an ideal choice for non-radioactive work. Before the microspheres can be sintered and pressed they must be washed to remove the processing oil and any unreacted substituents. An investigation was performed on the washing step to find an appropriate wash solution that reduced waste and flammable risk. Cerium oxide microspheres were processed, washed, and characterized to determine the effectiveness of the new wash solution.

  7. Cerium; crystal structure and position in the periodic table.

    Science.gov (United States)

    Johansson, Börje; Luo, Wei; Li, Sa; Ahuja, Rajeev

    2014-09-17

    The properties of the cerium metal have intrigued physicists and chemists for many decades. In particular a lot of attention has been directed towards its high pressure behavior, where an isostructural volume collapse (γ phase → α phase) has been observed. Two main models of the electronic aspect of this transformation have been proposed; one where the 4f electron undergoes a change from being localized into an itinerant metallic state, and one where the focus is on the interaction between the 4f electron and the conduction electrons, often referred to as the Kondo volume collapse model. However, over the years it has been repeatedly questioned whether the cerium collapse really is isostructural. Most recently, detailed experiments have been able to remove this worrisome uncertainty. Therefore the isostructural aspect of the α-γ transition has now to be seriously addressed in the theoretical modeling, something which has been very much neglected. A study of this fundamental characteristic of the cerium volume collapse is made in present paper and we show that the localized [rlhar2 ] delocalized 4f electron picture provides an adequate description of this unique behavior. This agreement makes it possible to suggest that an appropriate crossroad position for cerium in The Periodic Table.

  8. Cerium oxide and platinum nanoparticles protect cells from oxidant-mediated apoptosis

    International Nuclear Information System (INIS)

    Clark, Andrea; Zhu Aiping; Sun Kai; Petty, Howard R.

    2011-01-01

    Catalytic nanoparticles represent a potential clinical approach to replace or correct aberrant enzymatic activities in patients. Several diseases, including many blinding eye diseases, are promoted by excessive oxidant stress due to reactive oxygen species (ROS). Cerium oxide and platinum nanoparticles represent two potentially therapeutic nanoparticles that de-toxify ROS. In the present study, we directly compare these two classes of catalytic nanoparticles. Cerium oxide and platinum nanoparticles were found to be 16 ± 2.4 and 1.9 ± 0.2 nm in diameter, respectively. Using surface plasmon-enhanced microscopy, we find that these nanoparticles associate with cells. Furthermore, cerium oxide and platinum nanoparticles demonstrated superoxide dismutase catalytic activity, but did not promote hemolytic or cytolytic pathways in living cells. Importantly, both cerium oxide and platinum nanoparticles reduce oxidant-mediated apoptosis in target cells as judged by the activation of caspase 3. The ability to diminish apoptosis may contribute to maintaining healthy tissues.

  9. Thermal Treatment of Cerium Oxide and Its Properties: Adsorption Ability versus Degradation Efficiency

    Directory of Open Access Journals (Sweden)

    Pavel Janoš

    2014-01-01

    Full Text Available Cerium oxide belongs to the most important heterogeneous catalysts, but its applicability as so-called reactive sorbent for the degradation of toxic chemicals was only recently discovered. For these purposes, cerium oxide is prepared by precipitation of insoluble cerium salts (carbonates with a subsequent thermal decomposition. Properties of cerium oxide prepared from the carbonate precursor are strongly affected by the temperature during the calcination. Main physicochemical properties of cerium oxide (specific surface area, crystallinity, and surface chemistry were examined in dependence on the calcination temperature. As the adsorptive properties of CeO2 are undoubtedly of great importance in the abovementioned applications, the adsorption ability was studied using an azo dye Acid Orange 7 (AO7 as a model compound. The highest sorption efficiency towards AO7 exhibited sorbents prepared at temperatures below 700°C, which was attributed mainly to the presence of hydroxyl groups on the oxide surface. A strong correlation was found between an adsorption efficiency of cerium oxides and their degradation efficiency for organophosphate pesticide parathion methyl. The >Ce–OH groups on the sorbent surface are responsible for the dye binding by the surface-complexation mechanism, and probably also for the nucleophilic cleavage of the P–O–aryl bond in the pesticide molecule.

  10. An Economic Model and Experiments to Understand Aluminum-Cerium Alloy Recycling

    Science.gov (United States)

    Iyer, Ananth V.; Lim, Heejong; Rios, Orlando; Sims, Zachary; Weiss, David

    2018-04-01

    We provide an economic model to understand the impact of adoption, sorting and pricing of scrap on the recycling of a new aluminum-cerium (AlCe) alloy for use in engine blocks in the automobile industry. The goal of the laboratory portion of this study is to investigate possible effects of cerium contamination on well-established aluminum recycling streams. Our methodology includes three components: (1) focused data gathering from industry supply chain participants, (2) experimental data through laboratory experiments to understand the impact of cerium on existing alloys and (3) an economic model to understand pricing incentives on a recycler's separation of AlCe engine blocks.

  11. Extraction-differential-photometric method to determine rare earths of cerium subgroup

    International Nuclear Information System (INIS)

    Askerov, D.N.; Gusejnov, I.K.; Melikov, A.A.

    1985-01-01

    The extraction - photometric method to determine great quantities of rare earths of the cerium subgroup as a complex with antipyrine A and diphenylguanidine is developed. Isobutyl and n-butyl alcohols are used as extractants. It is established that proportional dependence between relative optical density and concentration of rare earths of the cerium subgroup in the solution takes place in the concentration interval of 10.3-14.7 μg of rare earths in 1 ml of the solution. Determination error is+-1.12%. The technique is used to determine rare earths of the cerium subgroup in rare earth oxides of a mixed composition, as well as in monozite and loparite

  12. Spectrophotometric determination of cerium with methylthymol blue in the presence of oxalate and cyanide as masking agents

    Energy Technology Data Exchange (ETDEWEB)

    Cabrera-Martin, A; Izquierdo-Hornillos, R; Quejido-Cabezas, A J; Peral-Fernandez, J L [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Quimicas

    1983-04-01

    The spectrophotometric determination of cerium can be carried out by several methods, which involve either the formation of complexes of cerium(III) and cerium(IV) or the oxidation of suitable reagents by cerium(IV) and further measuring the intensity of the colour of the oxidised matter. The latter methods show a lack of selectivity and low sensitivity owing to the nature of the redox reaction. The methods that involve the formation of complexes have also been shown to have low selectivity and sensitivity. However, the most useful methods are those based on the complexes of cerium(III) with Xylenol Orange and Methylthymol Blue (MTB), but they are affected by many interferences. In this work the reaction of cerium(III) with MTB in the presence of oxalate and cyanide ions was studied at pH 10.2, which improves the sensitivity and the selectivity of the determination of cerium.

  13. Inhibition of pH fronts in corrosion cells due to the formation of cerium hydroxide

    NARCIS (Netherlands)

    Soestbergen, M. van; Erich, S.J.F.; Huinink, H.P.; Adan, O.C.G.

    2013-01-01

    The effect of cerium-based corrosion inhibitors on the pH front between the alkaline cathode and acidic anode in corrosion cells has been studied. The cerium component of these inhibitors can affect the pH front since it precipitates in an alkaline environment as cerium hydroxide, which is important

  14. Solvent extraction of cerium (III) with high molecular weight amines

    International Nuclear Information System (INIS)

    Chatterjee, A.; Basu, S.

    1992-01-01

    The use of high molecular weight amines in the extraction of cerium (III) as EDTA complex from neutral aqueous medium is reported. The extraction condition was optimised from the study of effects of several variables like concentration of amine and EDTA pH nature of diluents etc. The method has been applied for the determination of cerium in few mineral samples. (author). 7 refs., 5 tabs

  15. Study of cerium diffusion in undoped lithium-6 enriched glass with Rutherford backscattering spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xiaodong, E-mail: xzhang39@utk.edu [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Moore, Michael E.; Lee, Kyung-Min; Lukosi, Eric D. [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Hayward, Jason P. [Department of Nuclear Engineering, University of Tennessee, TN 37996 (United States); Oak Ridge National Lab, Oak Ridge, TN 37831 (United States)

    2016-07-01

    Undoped lithium-6 enriched glasses coated with pure cerium (99.9%) with a gold protection layer on top were heated at three different temperatures (500, 550, and 600 °C) for varied durations (1, 2, and 4 h). Diffusion profiles of cerium in such glasses were obtained with the conventional Rutherford backscattering technique. Through fitting the diffusion profiles with the thin-film solution of Fick’s second law, diffusion coefficients of cerium with different annealing temperatures and durations were solved. Then, the activation energy of cerium for the diffusion process in the studied glasses was found to be 114 kJ/mol with the Arrhenius equation.

  16. Optical properties of cerium oxide (CeO2) nanoparticles synthesized by hydroxide mediated method

    Science.gov (United States)

    Ali, Mawlood Maajal; Mahdi, Hadeel Salih; Parveen, Azra; Azam, Ameer

    2018-05-01

    The nanoparticles of cerium oxide have been successfully synthesized by hydroxide mediated method, using cerium nitrate and sodium hydroxide as precursors. The microstructural properties were analyzed by X-ray diffraction technique (XRD). The X-ray diffraction results show that the cerium oxide nanoparticles were in cubic structure. The optical absorption spectra of cerium oxide were recorded by UV-VIS spectrophotometer in the range of 320 to 600 nm and photoluminescence spectra in the range of 400-540 nm and have been presented. The energy band gap was determined by Tauc relationship. The crystallite size was determined from Debye-Scherer equation and came out to be 6.4 nm.

  17. Study of cerium diffusion in undoped lithium-6 enriched glass with Rutherford backscattering spectrometry

    Science.gov (United States)

    Zhang, Xiaodong; Moore, Michael E.; Lee, Kyung-Min; Lukosi, Eric D.; Hayward, Jason P.

    2016-07-01

    Undoped lithium-6 enriched glasses coated with pure cerium (99.9%) with a gold protection layer on top were heated at three different temperatures (500, 550, and 600 °C) for varied durations (1, 2, and 4 h). Diffusion profiles of cerium in such glasses were obtained with the conventional Rutherford backscattering technique. Through fitting the diffusion profiles with the thin-film solution of Fick's second law, diffusion coefficients of cerium with different annealing temperatures and durations were solved. Then, the activation energy of cerium for the diffusion process in the studied glasses was found to be 114 kJ/mol with the Arrhenius equation.

  18. Study of phase transitions in cerium in shock-wave experiments

    Directory of Open Access Journals (Sweden)

    Zhernokletov M.V.

    2015-01-01

    Full Text Available Cerium has a complex phase diagram that is explained by the presence of structure phase transitions. Planar gauges were used in various combinations in experiments for determination of sound velocity dependence on pressure in cerium by the technique of PVDF gauge. The data of time dependence on pressure profiles with use of x(t diagrams and the D(u relation for cerium allowed the definition of the Lagrangian velocity of the unloading wave CLagr and the Eulerian velocity CEul by taking into account the compression σ. These results accords with data obtained by using the technique of VISAR and a manganin-based gauge, and calculated pressure dependence of isentropic sound velocity according to the VNIITF EOS. Metallography analysis of post-experimental samples did not find any changes in a phase composition.

  19. The solvent extraction of cerium from sulphate solution - mini plant trials

    International Nuclear Information System (INIS)

    Soldenhoff, K.; Wilkins, D.; Ring, R.

    1998-01-01

    Full text: The Mt. Weld deposit in Western Australia has a complex rare earth mineralisation. The rare earth phosphate minerals, which include monazite, are amenable to conventional caustic cracking followed by hydrochloric acid dissolution of the trivalent rare earths. The presence of the mineral cerianite in the ore, which is unaffected by the alkali attack, results in rejection of a considerable proportion of the cerium to the acid leach residue. The recovery of cerium from a sulphate solution, resulting from the processing of such a residue, is the subject of the current paper. The liquor treated by solvent extraction contained 63 g L -1 rare earths and the cerium to total rare earth ratio was 75%. Other impurities, including Fe and Th, totalled 2000 ppm. A solvent mixture of commercially available extractants in a low aromatic content diluent was used to extract Ce 4+ selectively over the trivalent rare earths. Partial co-extraction of Fe and Th occurred but it was found that these elements were not easily stripped and therefore selective back extraction of cerium was possible. The cerium was stripped from the organic phase by hydrochloric acid and hydrogen peroxide. In continuous counter-current trials two extraction stages and three strip stages were used. In order to produce two grades of strip liquor, stripping was divided into two circuits. The first strip circuit consisting of a single stage, contained proportionally more of the trivalent rare earths. The second strip circuit, consisting of two stages, removed the remaining cerium with proportionally less of the rare earths. A bleed solvent stream was treated for removal of impurities to prevent build-up in the solvent. In the continuous counter current trials, 95% Ce 4+ extraction was achieved and the Ce to total rare earth ratio was upgraded to > 99%

  20. Spectrofluorimetric determination of cerium by flow injection analysis

    International Nuclear Information System (INIS)

    Liu Shaorong; Meng Jian; Liu Wenhua

    1990-01-01

    A spectrofluorimetric method for the determination of cerium (λ ex/em:251/365 nm) in hydrochloric acid solution by flow injection analysis is presented. It has well developed the normal spectrofluorimetric method for determination of cerium and has made: 1, the determination procedure shortened; 2, the determination speed increased to about 180 samples per hour; 3, the determination range widened to 0.05-100.0 ppm CeO 2 , abouot two times as wide as the normal spectrofluorimetric method; and 4, the relative standard deviation lessened (about 0.47% for 0.1 ppm CeO 2 , n = 13)

  1. Environmental Geochemistry of Cerium: Applications and Toxicology of Cerium Oxide Nanoparticles

    Directory of Open Access Journals (Sweden)

    Jessica T. Dahle

    2015-01-01

    Full Text Available Cerium is the most abundant of rare-earth metals found in the Earth’s crust. Several Ce-carbonate, -phosphate, -silicate, and -(hydroxide minerals have been historically mined and processed for pharmaceutical uses and industrial applications. Of all Ce minerals, cerium dioxide has received much attention in the global nanotechnology market due to their useful applications for catalysts, fuel cells, and fuel additives. A recent mass flow modeling study predicted that a major source of CeO2 nanoparticles from industrial processing plants (e.g., electronics and optics manufactures is likely to reach the terrestrial environment such as landfills and soils. The environmental fate of CeO2 nanoparticles is highly dependent on its physcochemical properties in low temperature geochemical environment. Though there are needs in improving the analytical method in detecting/quantifying CeO2 nanoparticles in different environmental media, it is clear that aquatic and terrestrial organisms have been exposed to CeO2 NPs, potentially yielding in negative impact on human and ecosystem health. Interestingly, there has been contradicting reports about the toxicological effects of CeO2 nanoparticles, acting as either an antioxidant or reactive oxygen species production-inducing agent. This poses a challenge in future regulations for the CeO2 nanoparticle application and the risk assessment in the environment.

  2. Electrorefining of Cerium in LiCl-KCl Molten Salts

    International Nuclear Information System (INIS)

    Campbell-Kelly, R.P.; Paget, T.J.

    2010-01-01

    Electrorefining of cerium from cerium-gallium alloys has been demonstrated in lithium chloride-potassium chloride salts at temperatures below 500 deg. C, with excellent current efficiencies and high product yields. These experiments are being carried out as non-active trials for a process for the purification of impure actinide metals. The results reported show anodic current efficiencies consistently close to 100%, and in several experiments complete oxidation of the cerium in the feed occurred. The cathodic product is hard and metallic, and incorporates a significant amount of salt into its structure. The product can be consolidated into a dense, pure metal by melting under calcium chloride at 850 deg. C. The yield of this consolidation step varies between 16 and 75%, seeming to depend on the total mass of metal being consolidated and the quality of inert atmosphere. A small-scale electrochemical cell has been demonstrated which will be used in initial active experiments. (authors)

  3. Corrosion resistance of flaky aluminum pigment coated with cerium oxides/hydroxides in chloride and acidic electrolytes

    International Nuclear Information System (INIS)

    Niroumandrad, S.; Rostami, M.; Ramezanzadeh, B.

    2015-01-01

    Graphical abstract: - Highlights: • Flaky aluminum pigments were modified with cerium nitrate salt. • pH value of 3.0 was chosen as the optimized pH for the cerium solution. • Corrosion resistance of the pigment significantly increased after modification. • Alkaline pre-treatment prior to modification affected the cerium layer performance. - Abstract: The objective of this study was to enhance the corrosion resistance of lamellar aluminum pigment through surface treatment by cerium oxides/hydroxides. The surface composition of the pigments was studied by energy-dispersive spectroscopy (EDS) and X-ray photoelectron spectroscopy (XPS). The corrosion resistance of the pigment was evaluated by conventional hydrogen evolution measurements in acidic solution and electrochemical impedance spectroscopy (EIS) in 3.5% NaCl solution. Results showed that the Ce-rich coating composed of Ce 2 O 3 and CeO 2 was precipitated on the pigment surface after immersion in the cerium solution. The corrosion resistance of pigment was significantly enhanced after modification with cerium layer.

  4. Corrosion resistance of flaky aluminum pigment coated with cerium oxides/hydroxides in chloride and acidic electrolytes

    Energy Technology Data Exchange (ETDEWEB)

    Niroumandrad, S. [Institute for Color Science and Technology (ICST), PO 16765-654, Tehran (Iran, Islamic Republic of); Rostami, M. [Department of Nanomaterials and Nanocoatings, Institute for Color Science and Technology (ICST), PO 16765-654, Tehran (Iran, Islamic Republic of); Ramezanzadeh, B., E-mail: ramezanzadeh-bh@icrc.ac.ir [Department of Surface Coatings and Corrosion, Institute for Color Science and Technology (ICST), PO 16765-654, Tehran (Iran, Islamic Republic of)

    2015-12-01

    Graphical abstract: - Highlights: • Flaky aluminum pigments were modified with cerium nitrate salt. • pH value of 3.0 was chosen as the optimized pH for the cerium solution. • Corrosion resistance of the pigment significantly increased after modification. • Alkaline pre-treatment prior to modification affected the cerium layer performance. - Abstract: The objective of this study was to enhance the corrosion resistance of lamellar aluminum pigment through surface treatment by cerium oxides/hydroxides. The surface composition of the pigments was studied by energy-dispersive spectroscopy (EDS) and X-ray photoelectron spectroscopy (XPS). The corrosion resistance of the pigment was evaluated by conventional hydrogen evolution measurements in acidic solution and electrochemical impedance spectroscopy (EIS) in 3.5% NaCl solution. Results showed that the Ce-rich coating composed of Ce{sub 2}O{sub 3} and CeO{sub 2} was precipitated on the pigment surface after immersion in the cerium solution. The corrosion resistance of pigment was significantly enhanced after modification with cerium layer.

  5. The developments and challenges of cerium half-cell in zinc–cerium redox flow battery for energy storage

    International Nuclear Information System (INIS)

    Xie, Zhipeng; Liu, Qingchao; Chang, Zhiwen; Zhang, Xinbo

    2013-01-01

    Zinc–cerium redox flow batteries (ZCBs) are emerging as a very promising new technology with the potential to store a large amount of energy economically and efficiently, thanking to its highest thermodynamic open-circuit cell voltage among all the currently studied aqueous redox flow batteries. However, there are numerous scientific and technical challenges that must be overcome if this alluring promise is to turn into reality, from designing the battery structure, to optimizing the electrolyte compositions and elucidating the complex chemical reactions that occur during charge and discharge. This review article is the first summary of the most significant developments and challenges of cerium half-cell and the current understanding of their chemistry. We are certain that this review will be of great interest to audience over a broad range, especially in fields of energy storage, electrochemistry, and chemical engineering

  6. Molecular and physiological responses to titanium dioxide and cerium oxide nanoparticles in Arabidopsis

    Science.gov (United States)

    - Changes in tissue transcriptomes and productivity of Arabidopsis thaliana were investigated during exposure of plants to two widely-used engineered metal oxide nanoparticles, titanium dioxide (nano-titanium) and cerium dioxide (nano-cerium). Microarray analyses confirmed that e...

  7. Electrochemical reduction of cerium oxide into metal

    Energy Technology Data Exchange (ETDEWEB)

    Claux, Benoit [CEA, Valduc, F-21120 Is-sur-Tille (France); Universite de Grenoble, LEPMI-ENSEEG, 1130 rue de la Piscine, BP75, F-38402 St Martin d' Heres Cedex (France); Serp, Jerome, E-mail: jerome.serp@cea.f [CEA, Valduc, F-21120 Is-sur-Tille (France); Fouletier, Jacques [Universite de Grenoble, LEPMI-ENSEEG, 1130 rue de la Piscine, BP75, F-38402 St Martin d' Heres Cedex (France)

    2011-02-28

    The Fray Farthing and Chen (FFC) and Ono and Suzuki (OS) processes were developed for the reduction of titanium oxide to titanium metal by electrolysis in high temperature molten alkali chloride salts. The possible transposition to CeO{sub 2} reduction is considered in this study. Present work clarifies, by electro-analytical techniques, the reduction pathway leading to the metal. The reduction of CeO{sub 2} into metal was feasible via an indirect mechanism. Electrolyses on 10 g of CeO{sub 2} were carried out to evaluate the electrochemical process efficiency. Ca metal is electrodeposited at the cathode from CaCl{sub 2}-KCl solvent and reacts chemically with ceria to form not only metallic cerium, but also cerium oxychloride.

  8. Energy-dispersive X-ray fluorescence analysis of cerium in ferrosilicon

    International Nuclear Information System (INIS)

    Marbec, E.R.

    1987-01-01

    The cerium was determined in ferrosilicon samples by energy-dispersive X-ray fluorescence techniques (XRF) techniques, with a secondary target of gadolinium. The methods employed were: comparison and linear regression with reference materials with cerium concentration between 0.4 and 1.0%. The samples were prepared in the form of pellets and the analytical results are reported as an average of five determinations with a confidence limits at 95% probability. (Author) [es

  9. Analysis of the effects of cerium on calcium ion in the protoplasts of ...

    African Journals Online (AJOL)

    Administrator

    2011-09-12

    Sep 12, 2011 ... African Journal of Biotechnology Vol. 10(52), pp. ... Paper. Analysis of the effects of cerium on calcium ion in the .... plasma membrane (Zeng et al., 2003). Recently .... cerium on vegetable growth of wheat (Triticum aestivum L.).

  10. Study on the uranium-cerium extraction and his application to the treatment of irradiated uranium

    International Nuclear Information System (INIS)

    Lobao, Afonso dos Santos Tome

    1979-01-01

    It was made a study on the behavior of uranium and cerium(IV) extraction, using the latter element as a plutonium simulator in a flowsheet of the treatment of irradiated uranium. Cerium(IV) was used under the same conditions as a plutonium in the Purex process because the admitted similar properties. An experimental work was initiated to determine the equilibrium curves of uranium, under the following conditions: concentration of 1 to 20 g U/1 and acidity varying from 1 to 5M in HNO 3 . Other parameters studied were the volumetric ratio of the phases and the influence of the concentration of TBP (tri-n-butyl phosphate). To guarantee the cerium(IV) extraction, the diluent (varsol) was previously treated with 10% potassium dichromate in perchloric acid, potassium permanganate in 1M sulphuric acid and concentrated sulphuric acid at 70 deg to eliminate reducing compounds. The results obtained for cerium extraction, allowed a better understanding of its behavior in solution. The results permitted to conclude that the decontamination for cerium are very high in the first Purex extraction cycle. The easy as cerium(IV) is reduced to the trivalent state contributes a great deal to its decontamination. (author)

  11. Influences of the main anodic electroplating parameters on cerium oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yang; Yang, Yumeng; Du, Xiaoqing; Chen, Yu [Department of Chemistry, Zhejiang University, Hangzhou 310027, Zhejiang (China); Zhang, Zhao, E-mail: eaglezzy@zjuem.zju.edu.cn [Department of Chemistry, Zhejiang University, Hangzhou 310027, Zhejiang (China); Zhang, Jianqing [Department of Chemistry, Zhejiang University, Hangzhou 310027, Zhejiang (China); State Key Laboratory for Corrosion and Protection of Metals, Shenyang 110016 (China)

    2014-06-01

    Cerium oxide thin films were fabricated onto 316 L stainless steel via a potentiostatically anodic electrodeposition approach in the solutions containing cerium(III) nitrate (0.05 M), ammonia acetate (0.1 M) and ethanol (10% V/V). The electrochemical behaviors and deposition parameters (applied potential, bath temperature, dissolving O{sub 2} and bath pH) have been investigated. Results show that, the electrochemical oxidation of Ce{sup 3+} goes through one electrochemical step, which is under charge transfer control. The optimum applied potential for film deposition is 0.8 V. Bath temperature plays a significant effect on the deposition rate, composition (different colors of the film) and surface morphology of the deposits. Due to the hydrolysis of Ce{sup 3+}, cerous hydroxide is facility to form when the bath temperature is higher than 60 °C. The electroplating bath pH is another key role for the anodic deposition of cerium oxide thin films, and the best bath pH is around 6.20. N{sub 2} or O{sub 2} purged into the bath will result in film porosities and O{sub 2} favors cerium oxide particles and film generation.

  12. Growth and characterization of Sm3+ doped cerium oxalate single crystals

    Directory of Open Access Journals (Sweden)

    Minu Mary C

    2016-07-01

    Full Text Available Single crystals of Sm3+ doped cerium oxalate decahydrate were synthesized using single diffusion gel technique and the conditions influencing the size, morphology, nucleation density and quality of the crystals were optimized. Highly transparent single crystals of average size 3 mm × 2 mm × 1 mm with well-defined hexagonal morphology were grown during a time period of two weeks. X-ray powder diffraction analysis revealed that the grown crystals crystallize in the monoclinic system with space group P21/c as identical with the pure cerium oxalate. The various functional groups of the oxalate ligand and the water of crystallization were identified by Fourier transform infrared spectroscopy. The photoluminescence spectrum of the Sm3+ doped cerium oxalate indicated that the Sm3+ ions are optically active in the cerium oxalate matrix. The crystal has a strong and efficient orange red emission with a wavelength peak at 595 nm and hence can be effectively used for optical amplification. Microhardness measurements of the crystal revealed that they belong to the soft material category.

  13. Synthesis, characterization and antibacterial activity of hybrid chitosan-cerium oxide nanoparticles: As a bionanomaterials.

    Science.gov (United States)

    Senthilkumar, R P; Bhuvaneshwari, V; Ranjithkumar, R; Sathiyavimal, S; Malayaman, V; Chandarshekar, B

    2017-11-01

    The hybrid chitosan cerium oxide nanoparticles were prepared for the first time by green chemistry approach using plant leaf extract. The intense peak observed around 292nm in the UV-vis spectrum indicate the formation of cerium oxide nanoparticles. The XRD pattern revealed that the hybrid chitosan-cerium oxide nanoparticles have a polycrystalline structure with cubic fluorite phase. The FTIR spectrum of prepared samples showed the formation of Ce-O bonds and chitosan main chains COC and CO. The FESEM image of hybrid chitosan cerium oxide nanoparticles revealed that the particles are spherical in shape with grains size varying from 23.12nm to 89.91nm. EDAX analysis confirmed the presence of Ce, O, C and N elements in the prepared sample. TEM images showed that the prepared hybrid chitosan-cerium oxide nanoparticles are predominantly uniform in size and most of the particles are spherical in shape with less agglomeration and the particles size varies from 3.61nm to 24.40nm. The prepared chitosan cerium oxide nanoparticles of 50μL concentration showed good antibacterial properties against test pathogens, which was confirmed by the FESEM analysis. The prepared small particle size facilitate that these hybrid ChiCO 2 NPs could effectively be used in biomedical applications. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Oxochloroalkoxide of the Cerium (IV and Titanium (IV as oxides precursor

    Directory of Open Access Journals (Sweden)

    Machado Luiz Carlos

    2002-01-01

    Full Text Available The Cerium (IV and Titanium (IV oxides mixture (CeO2-3TiO2 was prepared by thermal treatment of the oxochloroisopropoxide of Cerium (IV and Titanium (IV. The chemical route utilizing the Cerium (III chloride alcoholic complex and Titanium (IV isopropoxide is presented. The compound Ce5Ti15Cl16O30 (iOPr4(OH-Et15 was characterized by elemental analysis, FTIR and TG/DTG. The X-ray diffraction patterns of the oxides resulting from the thermal decomposition of the precursor at 1000 degreesC for 36 h indicated the formation of cubic cerianite (a = 5.417Å and tetragonal rutile (a = 4.592Å and (c = 2.962 Å, with apparent crystallite sizes around 38 and 55nm, respectively.

  15. Procedure for the separation of cerium from crude phosphates and rare earth concentrates

    International Nuclear Information System (INIS)

    Richter, H.; Koenig, O.; Schmitt, A.; Grauss, H.; Freitag, S.

    1986-01-01

    The invention has to do with a procedure for the separation of cerium from crude phosphates and rare earth phosphate concentrates originating from the partial neutralization of nitric crude phosphate decomposition solutions. It is aimed at the cerium separation from the raw material at an early stage of reprocessing without preceding elimination of other components and impurities. The rare earth phosphate concentrates or crude phosphates are dissolved in nitric acid, the Ce 3+ is oxidized with potassium permanganate or magnanese(IV) hydroxide, and cerium(IV) phosphate is precipitated as pure substance by decreasing the acidity of the solution

  16. Oxidative stress induced by cerium oxide nanoparticles in cultured BEAS-2B cells

    International Nuclear Information System (INIS)

    Park, Eun-Jung; Choi, Jinhee; Park, Young-Kwon; Park, Kwangsik

    2008-01-01

    Cerium oxide nanoparticles of different sizes (15, 25, 30, 45 nm) were prepared by the supercritical synthesis method, and cytotoxicity was evaluated using cultured human lung epithelial cells (BEAS-2B). Exposure of the cultured cells to nanoparticles (5, 10, 20, 40 μg/ml) led to cell death, ROS increase, GSH decrease, and the inductions of oxidative stress-related genes such as heme oxygenase-1, catalase, glutathione S-transferase, and thioredoxin reductase. The increased ROS by cerium oxide nanoparticles triggered the activation of cytosolic caspase-3 and chromatin condensation, which means that cerium oxide nanoparticles exert cytotoxicity by an apoptotic process. Uptake of the nanoparticles to the cultured cells was also tested. It was observed that cerium oxide nanoparticles penetrated into the cytoplasm and located in the peri-region of the nucleus as aggregated particles, which may induce the direct interaction between nanoparticles and cellular molecules to cause adverse cellular responses

  17. Effect of correlation on the band structure of α-cerium

    International Nuclear Information System (INIS)

    Rao, R.S.; Singh, R.P.

    1975-01-01

    The electronic band structure of f.c.c. phase of the rare earth metal cerium (α-cerium) has been calculated using a formulation of the crystal potential where correlation also has been included in addition to exchange. The Green's function method of Korringa-Kohn and Rostoker has been used due to obvious advantages in calculation. The calculations indicate that the s-d bands are hybridized with the f-levels but the f-bands are fairly narrow and lie slightly above the Fermi level. The structure of the bands is qualitatively similar to those of calculations by others except for a general shift of the entire set of bands by about 0.1 Ryd. Thd density of states has also been calculated from the bands obtained. The spin susceptibility of α-cerium has also been calculated using the Kohn-Sham method. However, the calculated additional contributions to the band structure values cannot still explain the large experimental values reported in the literature. (author)

  18. Solid-soluted content of cerium in solid solution of sphene

    International Nuclear Information System (INIS)

    Zhao Wei; Teng Yuancheng; Li Yuxiang; Ren Xuetan; Huang Junjun

    2010-01-01

    The sphene solid solution was synthesized by solid-state method,with calcium carbonate, silica, titanium dioxide, cerium oxalate and alumina as raw materials. The solid-soluted content of cerium in sphene was researched by means of X-ray diffraction (XRD), backscattering scanning electron microscopy (BSE), energy dispersive spectroscopy (EDS) and so on. The influence of A l3+ ion introduction to sphene on the solid-soluted content of cerium in sphene solid solution was studied. The results indicate that when introducing Al 3+ to sphene as electrovalence compensation, Ce 4+ could be well solidified to Ca 1-x Ce x Ti 1-2x A l2x SiO 5 , and the solid-soluted content is approximately 12.61%. With no electrovalence compensation, Ce 4+ could be solidified to Ca 1-2x Ce x TiSiO 5 , and the solid-soluted content is approximately 10.98%. The appropriate synthesis temperature of sphene solid solution is 1 260 degree C.(authors)

  19. Production of cerium dioxide microspheres by an internal gelation sol–gel method

    Energy Technology Data Exchange (ETDEWEB)

    Katalenich, Jeffrey A.

    2017-03-27

    An internal gelation sol-gel technique was used to prepare cerium dioxide microspheres with uniform diameters near 100 µm. In this process, chilled aqueous solutions containing cerium, hexamethylenetetramine (HMTA), and urea are transformed into a solid gel by heat addition and are subsequently washed, dried, and sintered to produce pure cerium dioxide. Cerous nitrate and ceric ammonium nitrate solutions were compared for their usefulness in microsphere production. Gelation experiments were performed with both cerous nitrate and ceric ammonium nitrate to determine desirable concentrations of cerium, HMTA, and urea in feed solutions as well as the necessary quantity of ammonium hydroxide added to cerium solutions. Analysis of the pH before and after sample gelation was found to provide a quantitative metric for optimal parameter selection along with subjective evaluations of gel qualities. The time necessary for chilled solutions to gel upon inserting into a hot water bath was determined for samples with a variety of parameters and also used to determine desirable formulations for microsphere production. A technique for choosing the optimal mixture of ceric ammonium nitrate, HMTA, and urea was determined using gelation experiments and used to produce microspheres by dispersion of the feed solution into heated silicone oil. Gelled spheres were washed to remove excess reactants and reaction products before being dried and sintered. X-ray diffraction of air-dried microspheres, sintered microspheres, and commercial CeO2 powders indicated that air-dried and sintered spheres were pure CeO2.

  20. Effects of PEG4000 template on sol-gel synthesis of porous cerium titanate photocatalyst

    Science.gov (United States)

    Zhang, Wenjie; Tao, Yingjie; Li, Chuanguo

    2018-04-01

    Porous cerium titanate was synthesized by sol-gel method, using polyethylene glycol (PEG4000) as template agent. Brannerite structured CeTi2O6 in monoclinic system is the major substance formed in the materials. Formation of CeO2 and rutile TiO2 depends on the amount of PEG4000. The addition of PEG4000 leads to production of fine particles in the samples, but it does not apparently affect the band gap energy. Pore volume of the cerium titanate sample continuously increases with rising PEG4000 amount. The sample obtained using 3.5 g PEG4000 has BET surface area of 16.2 m2/g and pore volume of 0.0232 cm3/g. The addition of PEG4000 can obviously promote photocatalytic activity of cerium titanate, which can be proven by both enhanced production of hydroxyl radical and ofloxacin degradation efficiency. As much as 95.2% of the initial ofloxacin molecules are removed from the solution after 50 min of photocatalytic degradation on the cerium titanate obtained using 3.5 g PEG4000, while only 48.4% ofloxacin is removed on cerium titanate obtained without PEG4000.

  1. Analysis of cerium-composite polymer-electrolyte membranes during and after accelerated oxidative-stability test

    Science.gov (United States)

    Shin, Dongwon; Han, Myungseong; Shul, Yong-Gun; Lee, Hyejin; Bae, Byungchan

    2018-02-01

    The oxidative stability of membranes constructed from a composite of pristine sulfonated poly(arylene ether sulfone) and cerium was investigated by conducting an accelerated oxidative-stability test at the open-circuit voltage (OCV). The membranes were analyzed in situ through OCV and impedance measurements, cyclic voltammetry, and linear-sweep voltammetry to monitor the electrochemical properties during the stability test. Although the high-frequency resistance of a composite membrane was slightly higher than that of a pristine membrane because of the exchange of protons from the sulfonic acid with cerium ions, the composite membrane maintained its potential for much longer than the pristine membrane. The effect of the cerium ions as radical scavengers was confirmed by analyzing the drain water and chemical structure after operation. These post-operation analyses confirmed that cerium ions improved the oxidative stability of the hydrocarbon-based polymer during fuel-cell operation. It is clear that the cerium-based radical scavengers prevented chemical degradation of the polymer membrane as well as the electrode in terms of hydrogen cross-over, polymer-chain scission, and the electrochemical surface area, while they rarely diffused outward from the membrane.

  2. Immobilization of simulated radioactive soil waste containing cerium by self-propagating high-temperature synthesis

    International Nuclear Information System (INIS)

    Mao, Xianhe; Qin, Zhigui; Yuan, Xiaoning; Wang, Chunming; Cai, Xinan; Zhao, Weixia; Zhao, Kang; Yang, Ping; Fan, Xiaoling

    2013-01-01

    A simulated radioactive soil waste containing cerium as an imitator element has been immobilized by a thermite self-propagating high-temperature synthesis (SHS) process. The compositions, structures, and element leaching rates of products with different cerium contents have been characterized. To investigate the influence of iron on the chemical stability of the immobilized products, leaching tests of samples with different iron contents with different leaching solutions were carried out. The results showed that the imitator element cerium mainly forms the crystalline phases CeAl 11 O 18 and Ce 2 SiO 5 . The leaching rate of cerium over a period of 28 days was 10 −5 –10 −6 g/(m 2 day). Iron in the reactants, the reaction products, and the environment has no significant effect on the chemical stability of the immobilized SHS products

  3. Immobilization of simulated radioactive soil waste containing cerium by self-propagating high-temperature synthesis

    Science.gov (United States)

    Mao, Xianhe; Qin, Zhigui; Yuan, Xiaoning; Wang, Chunming; Cai, Xinan; Zhao, Weixia; Zhao, Kang; Yang, Ping; Fan, Xiaoling

    2013-11-01

    A simulated radioactive soil waste containing cerium as an imitator element has been immobilized by a thermite self-propagating high-temperature synthesis (SHS) process. The compositions, structures, and element leaching rates of products with different cerium contents have been characterized. To investigate the influence of iron on the chemical stability of the immobilized products, leaching tests of samples with different iron contents with different leaching solutions were carried out. The results showed that the imitator element cerium mainly forms the crystalline phases CeAl11O18 and Ce2SiO5. The leaching rate of cerium over a period of 28 days was 10-5-10-6 g/(m2 day). Iron in the reactants, the reaction products, and the environment has no significant effect on the chemical stability of the immobilized SHS products.

  4. Synthesis of cerium oxide catalysts supported on MCM-41 molecular sieve

    International Nuclear Information System (INIS)

    Souza, E.L.S.; Barros, T.R.B.; Sousa, B.V. de

    2016-01-01

    Porous materials have been widely studied as catalysts and catalyst support. The MCM-41 structure is the one that has been most studied because of its application possibilities in chemical processes. This work aimed to obtain and characterize cerium oxide catalysts supported on MCM-41 molecular sieve. The molecular sieve was synthesized by the conventional method with the following molar composition: 1 SiO2: 0.30 CTABr: NH3 11: 144 H2O. Then, 25% w/w cerium was incorporated into the MCM-41 using the wet impregnation process and the material obtained was activated by calcination. From the XRD patterns was confirmed the structure of the molecular sieve, and were identified the cerium oxide phases in its structure. The textural catalysts characteristics were investigated by isotherms of N2 adsorption/desorption (BET method). (author)

  5. Imidazolium ionic liquids as solvents for cerium(IV)-mediated oxidation reactions

    OpenAIRE

    Mehdi, Hasan; Bodor, Andrea; Lantos, Diana; Horváth, István T; De Vos, Dirk; Binnemans, Koen

    2007-01-01

    Use of imidazolium ionic liquids as solvents for organic transformations with tetravalent cerium salts as oxidizing agents was evaluated. Good solubility was found for ammonium hexanitratocerate(IV) (ceric ammonium nitrate, CAN) and cerium(IV) triflate in 1-alkyl-3-methylimidazolium triflate ionic liquids. Oxidation of benzyl alcohol to benzaldehyde in 1-ethyl-3-methylimidazolium triflate was studied by in-situ FTIR spectroscopy and 13C NMR spectroscopy on carbon-13-labeled benzyl alcohol. Ca...

  6. Procedure for the separation of cerium from rare earth phosphate mixtures

    International Nuclear Information System (INIS)

    Richter, H.; Grauss, H.; Schmitt, A.; Schade, H.; Lindeholz, M.; Lorenz, E.; Weickart, J.

    1986-01-01

    The invention is concerned with a procedure for the separation of cerium from rare earth concentrates originating from the partial neutralization of nitric crude phosphate decomposition solutions without preceding elimination of impurities from the raw material. The rare earth phosphates are treated with an excess of concentrated nitric acid through which the Ce 3+ , contained in the solution, is oxidized to Ce 4+ and precipitated as cerium(IV) phosphate by neutralization with alkalis

  7. Synthesis and structure of cerium nitrosocarbonylcyanmethanid complex

    International Nuclear Information System (INIS)

    Gerasimenko, H.; Scopenko, V.V.; Kapshuk, A.A.

    1998-01-01

    Full text: The complex compound [CeL 4 Dy 2 ]Na*2Ac (where L- nitrosocarbonylcyanmethanid, Dy -- dipyridile, Ac - acetone) were synthesised by interaction of cerium chloride and sodium nitrosocarbonylcyanmethanid from acetone solution. After two hours of mixing the dipyridil solution in acetone was added for complex stabilization. After filtration solution was put to desiccator for crystallisation. The complex was studied using IR- and UV-spectroscopy. The structure of the complex was determined using X-ray structure analysis. It was found that the structure of the complex belongs to orthorhombic Pna2(1) syngony with the unit cell parameters 17.010, 16.280 and 16.340Angstroms, respectively. It was found that cerium in the compound was eight co-ordinated. Four nitroso ligands were co-ordinated by bidentate bridge method and two dipyridiles by bidentate-cycle method

  8. Fixation of radioactive cerium-144 on white blood cells. Possibilities for use in physiopathology; Fixation du cerium radioactif ({sup 144}Ce) sur les globules blancs. Possibilites d'emploi en physiopathologie

    Energy Technology Data Exchange (ETDEWEB)

    Aeberhardt, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of {sup 144}Ce-{sup 144}Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [French] L'etude du mode de transport du cerium dans le sang chez differents animaux de laboratoire, apres injection intra-veineuse de {sup 144}Ce-{sup 144}Pr sans entraineur, nous a permis de mettre en evidence le rale des globules blancs dans le transport de ce produit de fission au cours de son passage dans le sang. Cette constatation nous a conduit a etudier, in vitro, les modalites de la fixation du cerium sur les globules blancs afin de preciser les possibilites d'utilisation de cette propriete pour le marquage des globules blancs, les methodes employees jusqu'ici ne donnant pas entiere satisfaction. Disposant de la methode de separation des elements figures du sang que nous avons proposee en 1956, nous avons etudie la fixation du cerium, dans diverses conditions: - sur des suspensions de globules blancs de lapin, - sur une suspension de globules blancs humains, - sur les globules blancs dans le sang total de lapin. (auteur)

  9. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  10. Investigating the Influence of the Cerium loading in prepared Y zeolite from Iraqi kaolin on its Catalytic Performance

    Directory of Open Access Journals (Sweden)

    Karim Khalifa Esgair

    2018-01-01

    Full Text Available In this study, the effects of different loading doses of cerium in the prepared NaY zeolite from Iraqi kaolin were investigated. Al-Duara refinery atmospheric residue fluid catalytic cracking was selected as palpation reaction for testing the catalytic activity of cerium loading NaY zeolite. The insertion of cerium in NaY zeolites has been synthesized by simple ion exchange methods. Three samples of modified zeolite Y have been obtained by replacing the sodium ions in the original sample with cerium and the weight percent added are 0.35, 0.64, and 1.06 respectively. The effects of cerium loading to zeolite Y in different weight percent on the cracking catalysts were studied by employing a laboratory fluidized bed reactor. The experiments have been performed with weight hourly space velocity (WHSV range from 6 to 24 h-1, and the temperature range from 450 to 510 oC. The activity of the catalyst with 1.06 wt% cerium has been shown to be much greater than that of the sample parent NaY. Also it was observed that the addition of the cerium causes an increase in the thermal stability of the zeolite.

  11. Synthesis of cerium oxide (CeO{sub 2}) nanoparticles using simple CO-precipitation method

    Energy Technology Data Exchange (ETDEWEB)

    Farahmandjou, M.; Zarinkamar, M.; Firoozabadi, T. P., E-mail: farahamndjou@iauvaramin.ac.ir [Islamis Azad University, Varamin-Phisva Branch, Department of Physics, Varamin (Iran, Islamic Republic of)

    2016-11-01

    Synthesis of cerium oxide (CeO{sub 2}) nanoparticles was studied by new and simple co-precipitation method. The cerium oxide nanoparticles were synthesized using cerium nitrate and potassium carbonate precursors. Their physicochemical properties were characterized by high resolution transmission electron microscopy (HRTEM), scanning electron microscopy (Sem), X-ray diffraction (XRD), energy dispersive spectroscopy (EDS), Fourier transform infrared spectroscopy (Ftir) and UV-Vis spectrophotometer. XRD pattern showed the cubic structure of the cerium oxide nanoparticles. The average particle size of CeO{sub 2} was around 20 nm as estimated by XRD technique and direct HRTEM observations. The surface morphological studies from Sem and Tem depicted spherical particles with formation of clusters. The sharp peaks in Ftir spectrum determined the existence of CeO{sub 2} stretching mode and the absorbance peak of UV-Vis spectrum showed the bandgap energy of 3.26 eV. (Author)

  12. Direct growth of cerium oxide nanorods on diverse substrates for superhydrophobicity and corrosion resistance

    Science.gov (United States)

    Cho, Young Jun; Jang, Hanmin; Lee, Kwan-Soo; Kim, Dong Rip

    2015-06-01

    Superhydrophobic surfaces with anti-corrosion properties have attracted great interest in many industrial fields, particularly to enhance the thermal performance of offshore applications such as heat exchangers, pipelines, power plants, and platform structures. Nanostructures with hydrophobic materials have been widely utilized to realize superhydrophobicity of surfaces, and cerium oxide has been highlighted due to its good corrosion resistive and intrinsically hydrophobic properties. However, few studies of direct growth of cerium oxide nanostructures on diverse substrates have been reported. Herein we report a facile hydrothermal method to directly grow cerium oxide nanorods on diverse substrates, such as aluminum alloy, stainless steel, titanium, and silicon. Diverse substrates with cerium oxide nanorods exhibited superhydrophobicity with no hydrophobic modifiers on their surfaces, and showed good corrosion resistive properties in corrosive medium. We believe our method could pave the way for realization of scalable and sustainable corrosion resistive superhydrophobic surfaces in many industrial fields.

  13. Study of the effect of cerium nitrate on AA2024-T3 by means of electrochemical micro-cell technique

    International Nuclear Information System (INIS)

    Paussa, L.; Andreatta, F.; Rosero Navarro, N.C.; Durán, A.; Fedrizzi, L.

    2012-01-01

    Highlights: ► We evaluate the cerium nitrate effect on the electrochemical behavior of AA2024-T3. ► We examine how AA2024-T3 microstructure affects cerium precipitation mechanism. ► The entire AA2024-T3 surface is involved in cerium precipitation. ► Anodic and cathodic inhibitions are both provided by cerium precipitation. ► Mg-rich intermetallics are preferential sites for cerium precipitation. - Abstract: This work evaluates the effect of cerium nitrate as corrosion inhibitor for AA2024-T3 in the view of its introduction in sol–gel coatings able to provide self-healing ability. Since it is well established that deposition of Ce species is activated by the local pH increase, the objective of this paper is to investigate the behavior of AA2024-T3 (open circuit potential and polarization curves) in the presence of Ce species in aggressive solutions by means of a local technique, the electrochemical micro-cell. This technique enables the investigation of small areas with resolution in the micrometer range by the use of glass capillaries to define the working electrode area. The micro-cell results clearly displayed that the entire AA2024-T3 area exposed to the cerium-containing electrolyte was involved in the cerium precipitation mechanism. The heterogeneous electrochemical behavior of the microstructure is minimized by the formation of a cerium-containing layer able to protect the metal substrate.

  14. Determination of trace amounts of cerium in silicate rocks based on its candoluminescence in a calcium oxide based matrix

    International Nuclear Information System (INIS)

    Belcher, R.; Nasser, T.A.K.; Polo-Diez, L.; Townshend, A.

    1977-01-01

    A very sensitive method for the determination of cerium (above 10 ng ml -1 ) has been developed (Belcher et al., Analyst;100:415(1975)), based on the measurement of the green candoluminescence produced by cerium in a calcium oxide-calcium sulphate matrix, with sulphuric acid as a coactivator, when the matrix is inserted into a hydrogen-nitrogen-air flame. This paper describes the application of this method to the determination of trace amounts of cerium in rocks. It involves the fusion of the sample with lithium metaborate, and does not require the isolation of cerium from other components of the rock, before measuring the candoluminescence intensity of the cerium. (author)

  15. Methods study of homogeneity and stability test from cerium oxide CRM candidate

    International Nuclear Information System (INIS)

    Samin; Susanna TS

    2016-01-01

    The methods study of homogeneity and stability test from cerium oxide CRM candidate has been studied based on ISO 13258 and KAN DP. 01. 34. The purpose of this study was to select the test method homogeneity and stability tough on making CRM cerium oxide. Prepared 10 sub samples of cerium oxide randomly selected types of analytes which represent two compounds, namely CeO_2 and La_2O_3. At 10 sub sample is analyzed CeO_2 and La_2O_3 contents in duplicate with the same analytical methods, by the same analyst, and in the same laboratory. Data analysis results calculated statistically based on ISO 13528 and KAN DP.01.34. According to ISO 13528 Cerium Oxide samples said to be homogeneous if Ss ≤ 0.3 σ and is stable if | Xr – Yr | ≤ 0.3 σ. In this study, the data of homogeneity test obtained CeO_2 is Ss = 2.073 x 10-4 smaller than 0.3 σ (0.5476) and the stability test obtained | Xr - Yr | = 0.225 and the price is < 0.3 σ. Whereas for La_2O_3, the price for homogeneity test obtained Ss = 1.649 x 10-4 smaller than 0.3 σ (0.4865) and test the stability of the price obtained | Xr - Yr | = 0.2185 where the price is < 0.3 σ. Compared with the method from KAN, a sample of cerium oxide has also been homogenized for Fcalc < Ftable and stable, because | Xi - Xhm | < 0.3 x n IQR. Provided that the results of the evaluation homogeneity and stability test from CeO_2 CRM candidate test data were processed using statistical methods ISO 13528 is not significantly different with statistical methods from KAN DP.01.34, which together meet the requirements of a homogeneous and stable. So the test method homogeneity and stability test based on ISO 13528 can be used to make CRM cerium oxide. (author)

  16. Phase segregation in cerium-lanthanum solid solutions

    NARCIS (Netherlands)

    Belliere, V.; Joorst, G; Stephan, O; de Groot, FMF; Weckhuysen, BM

    2006-01-01

    Electron energy-loss spectroscopy (EELS) in combination with scanning transmission electron microscopy ( STEM) reveals that the La enrichment at the surface of cerium-lanthanum solid solutions is an averaged effect and that segregation occurs in a mixed oxide phase. This separation occurs within a

  17. Effect of cerium on structure modifications of a hybrid sol–gel coating, its mechanical properties and anti-corrosion behavior

    International Nuclear Information System (INIS)

    Cambon, Jean-Baptiste; Esteban, Julien; Ansart, Florence; Bonino, Jean-Pierre; Turq, Viviane; Santagneli, S.H.; Santilli, C.V.; Pulcinelli, S.H.

    2012-01-01

    Highlights: ► New sol–gel routes to replace chromates for corrosion protection of aluminum. ► Effect of cerium concentration on the microstructure of xerogel. ► Electrochemical and mechanical performances of hybrid coating with different cerium contents. ► Good correlation between the different results with an optimal cerium content of 0.01 M. -- Abstract: An organic–inorganic hybrid coating was developed to improve the corrosion resistance of the aluminum alloy AA 2024-T3. Organic and inorganic coatings derived from glycidoxypropyl-trimethoxysilane (GPTMS) and aluminum tri-sec-butoxide Al(O s Bu) 3 , with different cerium contents, were deposited onto aluminum by dip-coating process. Corrosion resistance and mechanical properties were investigated by electrochemical impedance measurements and nano-indentation respectively. An optimal cerium concentration of 0.01 M was evidenced. To correlate and explain the hybrid coating performances in relation to the cerium content, NMR experiments were performed. It has been shown that when the cerium concentration in the hybrid is higher than 0.01 M there are important modifications in the hybrid structure that account for the mechanical properties and anti-corrosion behavior of the sol–gel coating.

  18. Dry sliding wear behaviour of Al-12Si-4Mg alloy with cerium addition

    International Nuclear Information System (INIS)

    Anasyida, A.S.; Daud, A.R.; Ghazali, M.J.

    2010-01-01

    The purpose of this work is to understand the effect of cerium addition on wear resistance behaviour of as-cast alloys. Al-12Si-4 Mg alloys with 1-5 wt% cerium addition were prepared using the casting technique. A sliding wear test was carried out under applied loads of 10 N, 30 N and 50 N at a fixed sliding speed of 1 m/s using a pin-on-disc configuration. The wear test was conducted in dry conditions at room temperature of ∼25 o C. Detailed analysis of the microstructure, worn surface, collected debris and microhardness was undertaken in order to investigate the differences between the as-cast alloys with different levels of cerium addition. The addition of 1-5 wt% cerium was found to lead to the precipitation of intermetallic phases (Al-Ce), resulting a needle-like structures. Increasing cerium content up to 2 wt% improved both wear resistance and microhardness of as-cast alloys. Addition of more than 2 wt% cerium, however, led to a decrease in microhardness, resulting in lower wear resistance of the alloys. Moderate wear was observed at all loads, with specific wear rates (K') ranging from 6.82 x 10 -5 with 2 wt% Ce at applied load of 50 N to 21.48 x 10 -5 mm 3 /N m without added Ce at an applied load of 10 N. Based on K' ranges, the as-cast alloys exhibited moderate wear regimes, and the mechanism of wear is a combination of abrasion and adhesion. Alloy containing 2 wt% Ce, with the highest hardness and lowest K' value, showed the greatest wear resistance.

  19. Corrosion electrochemical behaviors of silane coating coated magnesium alloy in NaCl solution containing cerium nitrate

    Energy Technology Data Exchange (ETDEWEB)

    Luo, F.; Li, Q.; Zhong, X.K.; Gao, H.; Dai, Y.; Chen, F.N. [School of Chemistry and Chemical Engineering, Southwest University Chongqing (China)

    2012-02-15

    Sol-gel coatings cannot provide adequate corrosion protection for metal/alloys in the corrosive environments due to their high crack-forming potential. This paper demonstrates the possibility to employ cerium nitrate as inhibitor to decrease the corrosion development of sol-gel-based silane coating on the magnesium alloy in NaCl solution. Cerium nitrate was added into the NaCl solution where the silane coating coated magnesium alloy was immersed. Scanning electron microscopy (SEM) was used to examine surface morphology of the silane coating coated magnesium alloy immersed in NaCl solutions doped and undoped with cerium nitrate. The corrosion electrochemical behaviors were investigated using potentiodynamic polarization and electrochemical impedance spectroscopy (EIS) tests. The results showed that the introduction of cerium nitrate into NaCl solution could effectively inhibit the corrosion of the silane coating coated magnesium alloy. Moreover, the influence of concentration of cerium nitrate on the corrosion inhibition and the possible inhibiting mechanism were also discussed in detail. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Effect of cerium substitution on structural and magnetic properties of magnetite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Padalia, Diwakar, E-mail: Padalia.diwakar@gmail.com [Department of Physics, G.B.Pant University of Agriculture & Technology, Pantnagar, Uttrakhand (India); Johri, U.C. [Department of Physics, G.B.Pant University of Agriculture & Technology, Pantnagar, Uttrakhand (India); Zaidi, M.G.H. [Supercritical Fluid Processing Laboratory, Department of Chemistry, G.B.Pant University of Agriculture & Technology, Pantnagar, Uttrakhand (India)

    2016-02-01

    The current work presents the synthesis and properties of cerium doped magnetite (Fe{sub 3}O{sub 4}) nanoparticles synthesized by standard chemical co-precipitation method using NH{sub 4}OH as co-precipitating agent. The effects of cerium ion substitution on structural and magnetic properties of magnetite (Fe{sub 3}O{sub 4}) nanoparticles were reported. These materials were characterized by X-ray powder diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and vibrating sample magnetometer (VSM). The cerium content has a significant influence on structural and magnetic properties. The X-ray diffraction study confirmed the formation of single-phase magnetite with space group Fd3m and crystallite size ranging from 39 to 58 nm. The addition of cerium resulted in a reduction of crystallite size and an increase of cell parameters. FTIR measurements confirmed the formation of different samples and suggested that the reduction of Fe{sup +3} to Fe{sup +2} preferred on a site adjacent to Ce{sup +4}. Magnetic measurements revealed that the saturation magnetization (Ms) and remanence (M{sub r}) decreased while the coercivity (H{sub C}) and squareness (M{sub r}/M{sub S}) increased with increasing cerium content. - Highlights: • There is an increase in cell parameters and strain with Ce-content. • Samples show the presence of secondary phase after 1.0% doping level. • Ce-ions prefer octahedral sites and charge neutrality is accompanied by Fe{sup +3} → Fe{sup +2}. • Magnetization decreases due to weakening of the super exchange interactions. • Squareness and coercivity start to increase with Ce content.

  1. Effect of calcination temperature on the crystallite growth of cerium oxide nano-powders prepared by the co-precipitation process

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Jian-Chih [Department of Orthopaedics, Kaohsiung Medical University Hospital, Kaohsiung 807, Taiwan (China); Chen, Wen-Cheng [School of Dentistry, College of Dental Medicine, Kaohsiung Medical University, Kaohsiung 807, Taiwan (China); Tien, Yin-Chun [Department of Orthopaedics, Kaohsiung Medical University Hospital, Kaohsiung 807, Taiwan (China); Shih, Chi-Jen, E-mail: cjshih@kmu.edu.t [Department of Fragrance and Cosmetics Science, Kaohsiung Medical University, 100 Shi-Chuan1st Road, Kaohsiung 80708, Taiwan (China)

    2010-04-30

    Cerium oxide nanocrystallites were synthesized by a co-precipitation process at a relatively low temperature, using cerium (III) nitrate as the starting material in a water solution with pH in the range of 8-9. The effect of calcination temperature on the crystallite growth of cerium oxide nano-powders was investigated by X-ray diffraction, transmission electron microscopy and electron diffraction. The crystallization temperature of the cerium oxide powders was estimated to be about 273 K, by XRD analysis. When calcined at temperatures from 473 to 1273 K, face-centered cubic phase crystallization was observed by XRD. The crystallite size of the cerium oxide increased from 12.0 to 48 nm as the calcining temperature increased from 473 to 1273 K, in the pH range 8-9. The activation energy for the growth of cerium oxide nanoparticles was found to have very low values of 17.5 kJ/mol for pH = 8 and 16.0 kJ/mol for pH = 9.

  2. Mesoporous cerium oxide nanospheres for the visible-light driven photocatalytic degradation of dyes

    Directory of Open Access Journals (Sweden)

    Subas K. Muduli

    2014-04-01

    Full Text Available A facile, solvothermal synthesis of mesoporous cerium oxide nanospheres is reported for the purpose of the photocatalytic degradation of organic dyes and future applications in sustainable energy research. The earth-abundant, relatively affordable, mixed valence cerium oxide sample, which consists of predominantly Ce7O12, has been characterized by powder X-ray diffraction, X-ray photoelectron and UV–vis spectroscopy, and transmission electron microscopy. Together with N2 sorption experiments, the data confirms that the new cerium oxide material is mesoporous and absorbs visible light. The photocatalytic degradation of rhodamin B is investigated with a series of radical scavengers, suggesting that the mechanism of photocatalytic activity under visible-light irradiation involves predominantly hydroxyl radicals as the active species.

  3. Assessement of the effect of Pyrimetin in combined injury with external irradiation and oral cerium-144 incorporation

    International Nuclear Information System (INIS)

    Kiradzhiev, G.; Khadzhidekova, E.

    1985-01-01

    The effect of the preparation Pyrimetin on rats, subjected to external irradiation combined with oral cerium 144 incorporation was studied. LD 50/30 of cerium-144 was used as biological criterion. It was shown that by this criterion Pyrimetin essentially abolished the potentiated by external radiation effect of cerium. Probably, the preparation leads to normalization of the gastro-intestinal motor function and the dose loading of the colon

  4. Obtainment of cerium dioxide for use as spectrochemical standard. Obtencao de dioxido de cerio para uso como padrao espectroquimico

    Energy Technology Data Exchange (ETDEWEB)

    Silva Queiroz, C.A. da; Hespanhol, E C.B.; Abrao, A [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1992-01-01

    This paper describes a simple method for cerium separation and purification. Cerium is previously precipitated with N H{sub 3}/air/H{sub 2} O{sub 2} system in a mixed chlorides solution obtained from Brazilian monazite treatment. The cerium fraction as cerium chloride is run down throughout a strong cationic resin bed and then the rare earth impurities separation is done by elution of the resin with separation ammonium salt of EDTA. None retainer ion is used in the purification technique by ion exchange. (author).

  5. 13 CFR 134.402 - Appeal petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...

  6. 22 CFR 134.25 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...

  7. 6 CFR 13.4 - Investigation.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...

  8. 13 CFR 134.310 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...

  9. First heats of cerium solution in liquid aluminium, gallium, indium, tin, lead and bismuth

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Lebedev, V.A.; Nichkov, I.F.; Raspopin, S.P.; Shein, V.G.

    1983-01-01

    Cerium solution heats in liquid alluminium, gallium, indium, tin, lead and bismuth are determined in high temperature mixing calorimeter with an isothermal shell. The statistical analysis carried out proves that values of cerium solution heat in fusible metals obtained by the methods of electric motive forces and calorimety give a satisfactory agreement

  10. 13 CFR 134.213 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...

  11. Decontamination of alpha contaminated metallic waste by cerium IV redox process

    International Nuclear Information System (INIS)

    Shah, J.G.; Dhami, P.S.; Gandhi, P.M.; Wattal, P.K.

    2012-01-01

    Decontamination of alpha contaminated metallic waste is an important aspect in the management of waste generated during dismantling and decommissioning of nuclear facilities. Present work on cerium redox process targets decontamination of alpha contaminated metallic waste till it qualifies for the non alpha waste category for disposal in near surface disposal facility. Recovery of the alpha radio nuclides and cerium from aqueous secondary waste streams was also studied deploying solvent extraction process and established. The alpha-lean secondary waste stream has been immobilised in cement based matrix for final disposal. (author)

  12. LUMINESCENT PROPERTIES OF SILICATE GLASSES WITH CERIUM IONS AND ANTIMONY

    Directory of Open Access Journals (Sweden)

    A. M. Klykova

    2014-05-01

    Full Text Available The paper deals with the results of an experimental study of luminescence excitation spectra and luminescence of silicate glasses containing cerium ions and antimony. The aim of this work was to study the features of the luminescence and the effect of UV irradiation and heat treatment on luminescence and the state of cerium ions and antimony in glass. We investigated glass system Na2O-ZnO-Al2O3-SiO2-NaF-NaBr with additives CeO2 and Sb2O3. Synthesis was carried out in platinum crucibles in the air at 14500C. The samples were polished glass plates with a thickness of 0.5-1 mm. UV irradiation was carried out with a mercury lamp having a wide range of radiation in the spectral range 240-390 nm. It was conducted in a Nabertherm muffle furnaces. Luminescence spectra and excitation spectra were measured using a spectrofluorimeter MPF-44A (PerkinElmer at the room temperature. Measured luminescence spectra were corrected in view of the spectral sensitivity of the photodetector for spectrofluorimeter. Adjustment of the excitation spectra for the spectral dependence of the intensity of the excitation source was not carried out. During the experiments it was found that in silicate glasses Sb3+ ions can exist in two energy states, which corresponds to a different environment with oxygen ions. Heat treatment of these glasses in an oxidizing atmosphere leads to an increase in ion concentration of Sb3+ ions with a greater amount of oxygen in the environment. In glasses containing antimony and cerium ions, ultraviolet irradiation causes a change in the valence of cerium ions and antimony, which is accompanied by luminescence quenching. Subsequent heat treatment of glass leads to the inverse processes and restore luminescence excitation spectra. The study of fluorescent properties of silicate glasses with cerium and antimony ions led to the conclusion of the practical significance of this work. Promising multifunctional materials can be created on the basis of

  13. Enhanced hot ductility of a Cr–Mo low alloy steel by rare earth cerium

    International Nuclear Information System (INIS)

    Jiang, X.; Song, S.-H.

    2014-01-01

    The hot ductility of a 1Cr–0.5Mo low alloy steel is investigated over a temperature range of 700–1050 °C using a Gleeble thermomechanical simulator in conjunction with various characterization techniques. The steel samples undoped and doped with cerium are heated at 1300 °C for 3 min and then cooled with a rate of 5 K s −1 down to different test temperatures, followed by tensile deformation until fracture. The results show that the hot ductility of the steel, evaluated by the reduction in area, can be substantially enhanced by a minor addition of cerium, especially in the range 800–1000 °C. In the austenite–ferrite dual-phase region, cerium may delay the formation of proeutectoid ferrite layers along austenite grain boundaries, thereby increasing the hot ductility of the steel. In the single austenite region, grain boundary segregation of cerium may increase the grain boundary cohesion, toughening the steel and thus raising the resistance to grain boundary sliding as well as promoting dynamic recrystallization. Consequently, the hot ductility of the steel is enhanced

  14. 13 CFR 134.217 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...

  15. 24 CFR 13.4 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...

  16. Contribution to research on the metabolism of fission product. Studies on the physico-chemical state and the metabolic fate of radio-cerium solution

    International Nuclear Information System (INIS)

    Aeberhardt, A.

    1961-01-01

    This paper describes a study of the physico-chemical state of radio-cerium in dilute solutions on the tracer scale, as a function of the pH of the solution. The way in which this radioelement is transported in the blood is studied in vitro and in vivo, with reference to the ionic or colloidal state of the radio-cerium used. The distribution of cerium amongst the various components of the blood is studied by a new method of blood fractionation and by paper electrophoresis. Evidence of a cerium globulin connection is shown in the case of ionic cerium. A study of the initial distribution of radio-cerium in rats, after intravenous administration of ionic or colloidal solutions, shows considerable differences according to the physico-chemical state of the cerium injected. (author) [fr

  17. The effects of cerium doping on the size, morphology, and optical properties of α-hematite nanoparticles for ultraviolet filtration

    Energy Technology Data Exchange (ETDEWEB)

    Cardillo, Dean [Institute for Superconducting and Electronic Materials, AIIM Facility, University of Wollongong Innovation Campus, Squires Way, North Wollongong, NSW 2500 (Australia); Konstantinov, Konstantin, E-mail: konstan@uow.edu.au [Institute for Superconducting and Electronic Materials, AIIM Facility, University of Wollongong Innovation Campus, Squires Way, North Wollongong, NSW 2500 (Australia); Devers, Thierry [Centre de Recherche sur la Matière Divisée, Institut de Physique, site de Chartres, Université d’Orléans (France)

    2013-11-15

    Highlights: • Possible application of cerium-doped α-hematite as ultraviolet filter. • Nanoparticles obtained through co-precipitation technique using various cerium doping levels followed by annealing. • Comprehensive materials characterisation utilizing XRD, DSC/TGA, STEM, UV–vis spectroscopy. • Increasing cerium content reduces particle sizing and alters morphology. • Solubility of cerium in hematite seen between 5 and 10% doping, 10% cerium doping greatly enhances attenuation in ultraviolet region and increases optical bandgap. - Abstract: Metal oxide nanoparticles have potential use in energy storage, electrode materials, as catalysts and in the emerging field of nanomedicine. Being able to accurately tailor the desirable properties of these nanoceramic materials, such as particle size, morphology and optical bandgap (E{sub g}) is integral in the feasibility of their use. In this study we investigate the altering of both the structure and physical properties through the doping of hematite (α-Fe{sub 2}O{sub 3}) nanocrystals with cerium at a range of concentrations, synthesised using a one-pot co-precipitation method. This extremely simple synthesis followed by thermal treatment results in stable Fe{sub 2−x}Ce{sub x}O{sub y} nanoceramics resulting from the burning of any unreacted precursors and transformation of goethite-cerium doped nanoparticle intermediate. The inclusion of Ce into the crystal lattice of these α-Fe{sub 2}O{sub 3} nanoparticles causes a significantly large reduction in mean crystalline size and alteration in particle morphology with increasing cerium content. Finally we report an increase optical semiconductor bandgap, along with a substantial increase in the ultraviolet attenuation found for a 10% Ce-doping concentration which shows the potential application of cerium-doped hematite nanocrystals to be used as a pigmented ultraviolet filter for cosmetic products.

  18. Ceria nanoparticles vis-à-vis cerium nitrate as corrosion inhibitors for silica-alumina hybrid sol-gel coating

    Energy Technology Data Exchange (ETDEWEB)

    Lakshmi, R.V. [Surface Engineering Division, Council of Scientific and Industrial Research – National Aerospace Laboratories, HAL Airport Road, Kodihalli, Bengaluru 560017 (India); Aruna, S.T., E-mail: staruna194@gmail.com [Surface Engineering Division, Council of Scientific and Industrial Research – National Aerospace Laboratories, HAL Airport Road, Kodihalli, Bengaluru 560017 (India); Sampath, S. [Department of Inorganic and Physical Chemistry, Indian Institute of Science, Bengaluru 560012 (India)

    2017-01-30

    Highlights: • Corrosion protection efficiency comparison of ceria nanoparticles and cerium nitrate. • Silica-alumina hybrid coating exhibited good barrier protection. • Detailed XPS study confirm the hybrid structure and presence of Ce species in coating. • Loss of cerium ions not prevalent in ceria doped coating unlike that of cerium nitrate. • Ceria increased the coating integrity, corrosion inhibition and barrier protection. - Abstract: The present work provides a comparative study on the corrosion protection efficiency of defect free sol-gel hybrid coating containing ceria nanoparticles and cerium nitrate ions as corrosion inhibitors. Less explored organically modified alumina-silica hybrid sol-gel coatings are synthesized from 3-glycidoxypropyltrimethoxysilane and aluminium-tri-sec-butoxide. The microemulsion derived nanoparticles and the hybrid coatings are characterized and compared with coatings containing cerium nitrate. Corrosion inhibiting capability is assessed using electrochemical impedance spectroscopy. Scanning Kelvin probe measurements are also conducted on the coatings for identifying the apparent corrosion prone regions. Detailed X-ray photoelectron spectroscopy (XPS) analysis is carried out to comprehend the bonding and corrosion protection rendered by the hybrid coatings.

  19. Effects of uncoated and citric acid coated cerium oxide nanoparticles, bulk cerium oxide, cerium acetate, and citric acid on tomato plants

    International Nuclear Information System (INIS)

    Barrios, Ana Cecilia; Rico, Cyren M.; Trujillo-Reyes, Jesica; Medina-Velo, Illya A.; Peralta-Videa, Jose R.; Gardea-Torresdey, Jorge L.

    2016-01-01

    Little is known about the physiological and biochemical responses of plants exposed to surface modified nanomaterials. In this study, tomato (Solanum lycopersicum L.) plants were cultivated for 210 days in potting soil amended with uncoated and citric acid coated cerium oxide nanoparticles (nCeO_2, CA + nCeO_2) bulk cerium oxide (bCeO_2), and cerium acetate (CeAc). Millipore water (MPW), and citric acid (CA) were used as controls. Physiological and biochemical parameters were measured. At 500 mg/kg, both the uncoated and CA + nCeO_2 increased shoot length by ~ 9 and ~ 13%, respectively, while bCeO_2 and CeAc decreased shoot length by ~ 48 and ~ 26%, respectively, compared with MPW (p ≤ 0.05). Total chlorophyll, chlo-a, and chlo-b were significantly increased by CA + nCeO_2 at 250 mg/kg, but reduced by bCeO_2 at 62.5 mg/kg, compared with MPW. At 250 and 500 mg/kg, nCeO_2 increased Ce in roots by 10 and 7 times, compared to CA + nCeO_2, but none of the treatments affected the Ce concentration in above ground tissues. Neither nCeO_2 nor CA + nCeO_2 affected the homeostasis of nutrient elements in roots, stems, and leaves or catalase and ascorbate peroxidase in leaves. CeAc at 62.5 and 125 mg/kg increased B (81%) and Fe (174%) in roots, while at 250 and 500 mg/kg, increased Ca in stems (84% and 86%, respectively). On the other hand, bCeO_2 at 62.5 increased Zn (152%) but reduced P (80%) in stems. Only nCeO_2 at 62.5 mg/kg produced higher total number of tomatoes, compared with control and the rest of the treatments. The surface coating reduced Ce uptake by roots but did not affect its translocation to the aboveground organs. In addition, there was no clear effect of surface coating on fruit production. To our knowledge, this is the first study comparing the effects of coated and uncoated nCeO_2 on tomato plants. - Highlights: • At 500 mg/kg, coated and bare NPs increased stem length by 13 and 9%, respectively. • Coated NPs at 500 mg/kg increased CAT activity in

  20. Effects of uncoated and citric acid coated cerium oxide nanoparticles, bulk cerium oxide, cerium acetate, and citric acid on tomato plants

    Energy Technology Data Exchange (ETDEWEB)

    Barrios, Ana Cecilia [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); Rico, Cyren M. [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Trujillo-Reyes, Jesica [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); Medina-Velo, Illya A. [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); Environmental Science and Engineering Ph.D. Program, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Gardea-Torresdey, Jorge L., E-mail: jgardea@utep.edu [Department of Chemistry, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); Environmental Science and Engineering Ph.D. Program, The University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States)

    2016-09-01

    Little is known about the physiological and biochemical responses of plants exposed to surface modified nanomaterials. In this study, tomato (Solanum lycopersicum L.) plants were cultivated for 210 days in potting soil amended with uncoated and citric acid coated cerium oxide nanoparticles (nCeO{sub 2}, CA + nCeO{sub 2}) bulk cerium oxide (bCeO{sub 2}), and cerium acetate (CeAc). Millipore water (MPW), and citric acid (CA) were used as controls. Physiological and biochemical parameters were measured. At 500 mg/kg, both the uncoated and CA + nCeO{sub 2} increased shoot length by ~ 9 and ~ 13%, respectively, while bCeO{sub 2} and CeAc decreased shoot length by ~ 48 and ~ 26%, respectively, compared with MPW (p ≤ 0.05). Total chlorophyll, chlo-a, and chlo-b were significantly increased by CA + nCeO{sub 2} at 250 mg/kg, but reduced by bCeO{sub 2} at 62.5 mg/kg, compared with MPW. At 250 and 500 mg/kg, nCeO{sub 2} increased Ce in roots by 10 and 7 times, compared to CA + nCeO{sub 2}, but none of the treatments affected the Ce concentration in above ground tissues. Neither nCeO{sub 2} nor CA + nCeO{sub 2} affected the homeostasis of nutrient elements in roots, stems, and leaves or catalase and ascorbate peroxidase in leaves. CeAc at 62.5 and 125 mg/kg increased B (81%) and Fe (174%) in roots, while at 250 and 500 mg/kg, increased Ca in stems (84% and 86%, respectively). On the other hand, bCeO{sub 2} at 62.5 increased Zn (152%) but reduced P (80%) in stems. Only nCeO{sub 2} at 62.5 mg/kg produced higher total number of tomatoes, compared with control and the rest of the treatments. The surface coating reduced Ce uptake by roots but did not affect its translocation to the aboveground organs. In addition, there was no clear effect of surface coating on fruit production. To our knowledge, this is the first study comparing the effects of coated and uncoated nCeO{sub 2} on tomato plants. - Highlights: • At 500 mg/kg, coated and bare NPs increased stem length by 13 and 9

  1. Performance comparison of a refrigerator system using R134a and hydrocarbon refrigerant (HCR134a) with different expansion devices

    Science.gov (United States)

    Aziz, A.; Izzudin; Mainil, A. K.

    2017-09-01

    The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.

  2. Jet formation in cerium metal to examine material strength

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, B. J., E-mail: bjjensen@lanl.gov; Cherne, F. J.; Prime, M. B.; Yeager, J. D.; Ramos, K. J.; Hooks, D. E.; Cooley, J. C.; Dimonte, G. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Fezzaa, K. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Iverson, A. J.; Carlson, C. A. [National Security Technologies LLC, Los Alamos, New Mexico 87544 (United States)

    2015-11-21

    Examining the evolution of material properties at extreme conditions advances our understanding of numerous high-pressure phenomena from natural events like meteorite impacts to general solid mechanics and fluid flow behavior. Recent advances in synchrotron diagnostics coupled with dynamic compression platforms have introduced new possibilities for examining in-situ, spatially resolved material response with nanosecond time resolution. In this work, we examined jet formation from a Richtmyer-Meshkov instability in cerium initially shocked into a transient, high-pressure phase, and then released to a low-pressure, higher-temperature state. Cerium's rich phase diagram allows us to study the yield stress following a shock induced solid-solid phase transition. X-ray imaging was used to obtain images of jet formation and evolution with 2–3 μm spatial resolution. From these images, an analytic method was used to estimate the post-shock yield stress, and these results were compared to continuum calculations that incorporated an experimentally validated equation-of-state (EOS) for cerium coupled with a deviatoric strength model. Reasonable agreement was observed between the calculations and the data illustrating the sensitivity of jet formation on the yield stress values. The data and analysis shown here provide insight into material strength during dynamic loading which is expected to aid in the development of strength aware multi-phase EOS required to predict the response of matter at extreme conditions.

  3. Investigation of cerium salt/sulfuric acid anodizing technology for 1420 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Di Li; Yue Peng Deng; Bao Lan Guo; Guo Qiang Li [Beijing Univ. of Aeronautics and Astronautics (China). Dept. of Mater. Sci. and Eng.

    2000-07-01

    In this paper, the effect of cerium addition agent on the property of anodized coating of 1420 Al alloy has been studied by corrosion experiment (immersion test and neutral salt spray test), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and measurement of polarization curves. The result show that only pitting could be observed in all corrosion tests while intergranular corrosion and exfoliation corrosion did not appear on 1420 Al-Li alloys. When organic carboxylic acid S or the cerium (IV) salt was added into sulfuric acid anodizing electrolyte separately, there was no significant improvement in corrosion resistance of anodized film. However, in the case of adding them into sulfuric acid anodizing electrolyte together, the corrosion resistance of anodized film increased greatly owing to synergistic effect. The synergistic effect may relate to the formation of cerium-organic carboxylic acid S complex compound and its effects on film growth and film structure. (orig.)

  4. Charge transfer cross sections for dysprosium and cerium

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82{+-}0.14) x 10{sup -14} cm{sup 2} for dysprosium and (0.88{+-}0.12) x 10{sup -14} cm{sup 2} for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  5. Charge transfer cross sections for dysprosium and cerium

    International Nuclear Information System (INIS)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82±0.14) x 10 -14 cm 2 for dysprosium and (0.88±0.12) x 10 -14 cm 2 for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  6. Exposure, Health and Ecological Effects Review of Engineered Nanoscale Cerium and Cerium Oxide Associated with its Use as a Fuel Additive

    Science.gov (United States)

    Advances of nanoscale science have produced nanomaterials with unique physical and chemical properties at commercial levels which are now incorporated into over 1000 products. Nanoscale cerium (di) oxide (CeO(2)) has recently gained a wide range of applications which includes coa...

  7. Conditioning of inorganic ion exchangers based on cerium (IV) antimonate in cement matrix. Vol. 3

    International Nuclear Information System (INIS)

    Aly, H.F.; Zakareia, N.; El-Dessouky, M.I.; Abo-Mosallem, N.M.; EL-Naggar, I.M.

    1996-01-01

    The use of inorganic adsorbents for treatment of aqueous radioactive waste has many advantages; namely; better resistance to chemical action, thermal stability, compatibility with immobilization matrices and resistance to radiation. Inorganic ion exchangers process many properties which make them more suitable for rad waste treatment than organic exchange resins. Inorganic ion exchange materials can be immobilized using cement matrix to obtain good solidified waste form. In this work, the removal of radioactive nuclides from radioactive waste is carried out by chemical in-situ precipitation. The addition of cerium (IV) antimonate (cesb) to cement mixture enhances the compressive strength more than plain cement. Waste package containing cesb increased the compressive strength relative to original ordinary portland cement (OPC) matrix for waste products immersed in tap water for one month. The compressive strength increases in the order; st Ce Sb> mix Ce Sb> Na Ce Sb> Co Ce Sb> Cs Ce Sb> OPC> Eu Ce Sb> Ce Sb; (mix refers to all the radionuclides used here). The cumulative leached fractions of 60 Co and 134 Cs decreased for solidified waste products containing Ce Sb in comparison to plain cement. 2 figs., 9 tabs

  8. Conditioning of inorganic ion exchangers based on cerium (IV) antimonate in cement matrix. Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    Aly, H F; Zakareia, N; El-Dessouky, M I; Abo-Mosallem, N M; EL-Naggar, I M [Hot Laboratory and Waste Management Centre, Atomic Energy Authority, P.O. Box 13759, Cairo (Egypt)

    1996-03-01

    The use of inorganic adsorbents for treatment of aqueous radioactive waste has many advantages; namely; better resistance to chemical action, thermal stability, compatibility with immobilization matrices and resistance to radiation. Inorganic ion exchangers process many properties which make them more suitable for rad waste treatment than organic exchange resins. Inorganic ion exchange materials can be immobilized using cement matrix to obtain good solidified waste form. In this work, the removal of radioactive nuclides from radioactive waste is carried out by chemical in-situ precipitation. The addition of cerium (IV) antimonate (cesb) to cement mixture enhances the compressive strength more than plain cement. Waste package containing cesb increased the compressive strength relative to original ordinary portland cement (OPC) matrix for waste products immersed in tap water for one month. The compressive strength increases in the order; st Ce Sb> mix Ce Sb> Na Ce Sb> Co Ce Sb> Cs Ce Sb> OPC> Eu Ce Sb> Ce Sb; (mix refers to all the radionuclides used here). The cumulative leached fractions of {sup 60} Co and {sup 134} Cs decreased for solidified waste products containing Ce Sb in comparison to plain cement. 2 figs., 9 tabs.

  9. Thermometric titrimetry Studies of the cerium(IV) oxidation of alpha-mercaptocarboxylic acids.

    Science.gov (United States)

    Alexander, W A; Mash, C J; McAuley, A

    1969-04-01

    The cerium(IV) oxidation of thioglycollic, thiolactic and thiomalic acids has been examined by thermometric titration. The titration curves indicate stoichiometries of more than 1 mole of cerium(IV) per mole of alpha-thiol, suggesting possible side-reactions. In the presence of methyl acrylate, however, the expected ratio is observed. The overall heat of each reaction has been derived. Only with a titration method of this kind where allowance can be made for side-reactions can the heats of reaction for these systems be measured.

  10. Fabrication of mesoporous cerium dioxide films by cathodic electrodeposition.

    Science.gov (United States)

    Kim, Young-Soo; Lee, Jin-Kyu; Ahn, Jae-Hoon; Park, Eun-Kyung; Kim, Gil-Pyo; Baeck, Sung-Hyeon

    2007-11-01

    Mesoporous cerium dioxide (Ceria, CeO2) thin films have been successfully electrodeposited onto ITO-coated glass substrates from an aqueous solution of cerium nitrate using CTAB (Cetyltrimethylammonium Bromide) as a templating agent. The synthesized films underwent detailed characterizations. The crystallinity of synthesized CeO2 film was confirmed by XRD analysis and HR-TEM analysis, and surface morphology was investigated by SEM analysis. The presence of mesoporosity in fabricated films was confirmed by TEM and small angle X-ray analysis. As-synthesized film was observed from XRD analysis and HR-TEM image to have well-crystallized structure of cubic phase CeO2. Transmission electron microscopy and small angle X-ray analysis revealed the presence of uniform mesoporosity with a well-ordered lamellar phase in the CeO2 films electrodeposited with CTAB templating.

  11. Catalysts with Cerium in a Membrane Reactor for the Removal of Formaldehyde Pollutant from Water Effluents

    Directory of Open Access Journals (Sweden)

    Mirella Gutiérrez-Arzaluz

    2016-05-01

    Full Text Available We report the synthesis of cerium oxide, cobalt oxide, mixed cerium, and cobalt oxides and a Ce–Co/Al2O3 membrane, which are employed as catalysts for the catalytic wet oxidation (CWO reaction process and the removal of formaldehyde from industrial effluents. Formaldehyde is present in numerous waste streams from the chemical industry in a concentration low enough to make its recovery not economically justified but high enough to create an environmental hazard. Common biological degradation methods do not work for formaldehyde, a highly toxic but refractory, low biodegradability substance. The CWO reaction is a recent, promising alternative that also permits much lower temperature and pressure conditions than other oxidation processes, resulting in economic benefits. The CWO reaction employing Ce- and Co-containing catalysts was carried out inside a slurry batch reactor and a membrane reactor. Experimental results are reported. Next, a mixed Ce–Co oxide film was supported on an γ-alumina membrane used in a catalytic membrane reactor to compare formaldehyde removal between both types of systems. Catalytic materials with cerium and with a relatively large amount of cerium favored the transformation of formaldehyde. Cerium was present as cerianite in the catalytic materials, as indicated by X-ray diffraction patterns.

  12. Exposure of cerium oxide nanoparticles to kidney bean shows disturbance in the plant defense mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Majumdar, Sanghamitra [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Bandyopadhyay, Susmita [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Castillo-Michel, Hiram [European Synchrotron Radiation Facility, B.P. 220-38043 Grenoble, Cedex (France); Hernandez-Viezcas, Jose-Angel [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States); Sahi, Shivendra [Department of Biology, Western Kentucky University, Bowling Green, KY 42101 (United States); Gardea-Torresdey, Jorge L., E-mail: jgardea@utep.edu [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN) (United States)

    2014-08-15

    Graphical abstract: - Highlights: • Kidney bean roots uptake nCeO{sub 2} primarily without biotransformation. • Cerium reached the root vascular tissues through gaps in the Casparian strip. • On longer exposure to high concentration, roots demonstrate stress response. • In leaves, guaiacol peroxidase plays a major role in ROS scavenging. - Abstract: Overwhelming use of engineered nanoparticles demands rapid assessment of their environmental impacts. The transport of cerium oxide nanoparticles (nCeO{sub 2}) in plants and their impact on cellular homeostasis as a function of exposure duration is not well understood. In this study, kidney bean plants were exposed to suspensions of ∼8 ± 1 nm nCeO{sub 2} (62.5 to 500 mg/L) for 15 days in hydroponic conditions. Plant parts were analyzed for cerium accumulation after one, seven, and 15 days of nCeO{sub 2} exposure. The primary indicators of stress like lipid peroxidation, antioxidant enzyme activities, total soluble protein and chlorophyll contents were studied. Cerium in tissues was localized using scanning electron microscopy and synchrotron μ-XRF mapping, and the chemical forms were identified using μ-XANES. In the root epidermis, cerium was primarily shown to exist as nCeO{sub 2}, although a small fraction (12%) was biotransformed to Ce(III) compound. Cerium was found to reach the root vascular tissues and translocate to aerial parts with time. Upon prolonged exposure to 500 mg nCeO{sub 2}/L, the root antioxidant enzyme activities were significantly reduced, simultaneously increasing the root soluble protein by 204%. In addition, leaf's guaiacol peroxidase activity was enhanced with nCeO{sub 2} exposure in order to maintain cellular homeostasis.

  13. Cerium, uranium, and plutonium behavior in glass-bonded sodalite, a ceramic nuclear waste form

    International Nuclear Information System (INIS)

    Lewis, M. A.; Lexa, D.; Morss, L. R.; Richmann, M. K.

    1999-01-01

    Glass-bonded sodalite is being developed as a ceramic waste form (CWF) to immobilize radioactive fission products, actinides, and salt residues from electrometallurgical treatment of spent nuclear reactor fuel. The CWF consists of about 75 mass % sodalite, 25 mass % glass, and small amounts of other phases. This paper presents some results and interpretation of physical measurements to characterize the CWF structure, and dissolution tests to measure the release of matrix components and radionuclides from the waste form. Tests have been carried out with specimens of the CWF that contain rare earths at concentrations similar to those expected in the waste form. Parallel tests have been carried out on specimens that have uranium or plutonium as well as the rare earths at concentrations similar to those expected in the waste forms; in these specimens UCl 3 forms UO 2 and PuCl 3 forms PuO 2 . The normalized releases of rare earths in dissolution tests were found to be much lower than those of matrix elements (B, Si, Al, Na). When there is no uranium in the CWF, the release of cerium is two to ten times lower than the release of the other rare earths. The low release of cerium may be due to its tetravalent state in uranium-free CWF. However, when there is uranium in the CWF, the release of cerium is similar to that of the other rare earths. This trivalent behavior of cerium is attributed to charge transfer or covalent interactions among cerium, uranium, and oxygen in (U,Ce)O 2

  14. Synthesis and characterization of platinum supported on alumina doped with cerium catalyst

    International Nuclear Information System (INIS)

    Yusof Abdullah; Abd Fatah Awang Mat; Mohd Ali Sufi; Sarimah Mahat; Razali Kassim; Nurhaslinda Abdullah.

    1996-03-01

    The synthesis and characterization of gamma-alumina doped with cerium as platinum support for the automobile exhaust catalyst are described. Platinum/alumina/ceria catalyst were prepared by impregnation of hexachloroplatinic acid and sintered at 500 degree Celsius to obtain metal dispersions of 1.0 wt%. Catalyst distribution inside the powder and the effects of the addition of cerium to alumina were analyzed by the scanning electron microscopy (SEM) and x-ray fluorescence spectroscopy (XRF). The results showed that the alumina - supported catalysts contained well dispersion of the noble metal

  15. Dicty_cDB: CHI134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  16. Cerium fluoride nanoparticles protect cells against oxidative stress

    International Nuclear Information System (INIS)

    Shcherbakov, Alexander B.; Zholobak, Nadezhda M.; Baranchikov, Alexander E.; Ryabova, Anastasia V.; Ivanov, Vladimir K.

    2015-01-01

    A novel facile method of non-doped and fluorescent terbium-doped cerium fluoride stable aqueous sols synthesis is proposed. Intense green luminescence of CeF 3 :Tb nanoparticles can be used to visualize these nanoparticles' accumulation in cells using confocal laser scanning microscopy. Cerium fluoride nanoparticles are shown for the first time to protect both organic molecules and living cells from the oxidative action of hydrogen peroxide. Both non-doped and terbium-doped CeF 3 nanoparticles are shown to provide noteworthy protection to cells against the vesicular stomatitis virus. - Highlights: • Facile method of CeF 3 and CeF 3 :Tb stable aqueous sols synthesis is proposed. • Naked CeF 3 nanoparticles are shown to be non-toxic and to protect cells from the action of H 2 O 2 . • CeF 3 and CeF 3 :Tb nanoparticles are shown to protect living cells against the vesicular stomatitis virus

  17. Cerium fluoride nanoparticles protect cells against oxidative stress

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, Alexander B.; Zholobak, Nadezhda M. [Zabolotny Institute of Microbiology and Virology, National Academy of Sciences of Ukraine, Kyiv D0368 (Ukraine); Baranchikov, Alexander E. [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); Ryabova, Anastasia V. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Nuclear University MEPhI (Moscow Engineering Physics Institute), Moscow 115409 (Russian Federation); Ivanov, Vladimir K., E-mail: van@igic.ras.ru [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Tomsk State University, Tomsk 634050 (Russian Federation)

    2015-05-01

    A novel facile method of non-doped and fluorescent terbium-doped cerium fluoride stable aqueous sols synthesis is proposed. Intense green luminescence of CeF{sub 3}:Tb nanoparticles can be used to visualize these nanoparticles' accumulation in cells using confocal laser scanning microscopy. Cerium fluoride nanoparticles are shown for the first time to protect both organic molecules and living cells from the oxidative action of hydrogen peroxide. Both non-doped and terbium-doped CeF{sub 3} nanoparticles are shown to provide noteworthy protection to cells against the vesicular stomatitis virus. - Highlights: • Facile method of CeF{sub 3} and CeF{sub 3}:Tb stable aqueous sols synthesis is proposed. • Naked CeF{sub 3} nanoparticles are shown to be non-toxic and to protect cells from the action of H{sub 2}O{sub 2}. • CeF{sub 3} and CeF{sub 3}:Tb nanoparticles are shown to protect living cells against the vesicular stomatitis virus.

  18. 19 CFR 134.34 - Certain repacked articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...

  19. 19 CFR 134.53 - Examination packages.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...

  20. Reactive removal of 2-chloroethyl ethyl sulfide vapors under visible light irradiation by cerium oxide modified highly porous zirconium (hydr) oxide

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, Joshua K.; Arcibar-Orozco, Javier A.; Bandosz, Teresa J., E-mail: tbandosz@ccny.cuny.edu

    2016-12-30

    Highlights: • Microporous zirconium-cerium (hydr) oxides were synthetized. • Ce presence narrowed the band gap of the materials. • The samples showed a high efficiency for removal of CEES vapors. • 1,2-Bis (ethyl thio) ethane and ethyl vinyl sulfide were the main reaction products. • 5% (Ce/Zr mol) addition of cerium oxide results in the best performing material. - Abstract: Highly porous cerium oxide modified Zr(OH){sub 4} samples were synthesized using a simple one stage urea precipitation method. The amorphicity level of zirconium hydroxide did not change upon addition of cerium oxide particles. A unique aspect of the cerium oxide-modified materials is the presence of both the oxide (CeO{sub 2}) and hydroxide (Zr(OH){sub 4}) phases resulting in a unique microporous structure of the final material. Extensive characterization using various chemical and physical methods revealed significant differences in the surface features. All synthesized materials were microporous and small additions of cerium oxide affected the surface chemistry. These samples were found as effective catalysts for a decontamination of mustard gas surrogate, 2-chloroethyl ethyl sulfide (CEES). Cerium oxide addition significantly decreased the band gap of zirconium hydroxide. Ethyl vinyl sulfide and 1,2-bis (Ethyl thio) ethane were identified as surface reaction products.

  1. The study on preparation of high dispersion and pure cerium dioxide for producing automotive exhaust catalysts

    International Nuclear Information System (INIS)

    Le Minh Tuan; Nguyen Trong Hung; Nguyen Thanh Chung

    2003-01-01

    The multi-stage counter-current solvent extraction process using TBP as the solvent has been carried out for purifying cerium and the ammonium carbonate precipitation method has been used to produce the cerium oxide of high dispersion and pure. The flow sheet of extraction system includes 3 extraction stages with O/A = 0.7,2 stripping stages and 4 scrubbing stages with O/A = 5. The condition for ammonium carbonate precipitation, drying and calcination have been investigated and a procedure that seem to be practically suitable to prepare cerium dioxide powder with great specific surface area for producing automotive exhaust catalyst has been proposed. (LMT)

  2. Corrosion resistance of flaky aluminum pigment coated with cerium oxides/hydroxides in chloride and acidic electrolytes

    Science.gov (United States)

    Niroumandrad, S.; Rostami, M.; Ramezanzadeh, B.

    2015-12-01

    The objective of this study was to enhance the corrosion resistance of lamellar aluminum pigment through surface treatment by cerium oxides/hydroxides. The surface composition of the pigments was studied by energy-dispersive spectroscopy (EDS) and X-ray photoelectron spectroscopy (XPS). The corrosion resistance of the pigment was evaluated by conventional hydrogen evolution measurements in acidic solution and electrochemical impedance spectroscopy (EIS) in 3.5% NaCl solution. Results showed that the Ce-rich coating composed of Ce2O3 and CeO2 was precipitated on the pigment surface after immersion in the cerium solution. The corrosion resistance of pigment was significantly enhanced after modification with cerium layer.

  3. Complex formation of transferrin with tetravalent plutonium and cerium

    International Nuclear Information System (INIS)

    Subramanian, M.S.; Oomen, I.K.

    1981-01-01

    Gel filtration experiments with 239 Pu labelled In Vitro bovine serum showed that the metal ion is bound to the transferrin of the serum proteins as in the case of iron labelled serum. This was confirmed by polyacrylamide gel electrophoresis. The ovotransferrin prepared from chicken egg white which was devoid of hemopexin contaminant was found to complex both tetravalent plutonium and cerium giving visible absorption peak at 365 and 435 nm respectively. The binding capacity of ovotransferrin with tetravalent plutonium and cerium, determined by spectrophotometric titration indicates that two metal ions are bound to each protein molecule as in the case of iron. The average molecular weight computed from this binding capacity measurements was found to be 71,000-75,000. The number of protons liberated for each metal ion bound was found to be three as in the case of iron. (author)

  4. Synthesis and ion-exchange properties of cerium(IV) molybdate

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, S K; Singh, Raj Pal; Agrawal, Sushma; Kumar, Satish [Roorkee Univ. (India). Dept. of Chemistry

    1977-01-01

    The synthesis, ion exchange properties, and the separation of a number of cation pairs on the columns of cerium (IV) molybdate is discussed. In order to obtain the product in gel form showing a high exchange capacity and suitable for column operation, preliminary experiments were performed to determine the optimum conditions of precipitation, i.e., the concentration of ceric and molybdate solutions, mixing ratio, pH of precipitation and the order of mixing. Cerium (IV) molybdate, prepared under the optimum conditions of concentration, acidity etc., shows exchange capacity of 0.96 meg per g of exchanger. The sorption of a large number of metal ions has been investigated and the compound shows promising behaviour as cation exchanger. Numerous separations of analytical and radiochemical interest have been performed on the column of this exchanger with great efficiency.

  5. Synthesis and ion-exchange properties of cerium(IV) molybdate

    International Nuclear Information System (INIS)

    Srivastava, S.K.; Raj Pal Singh; Sushma Agrawal; Satish Kumar

    1977-01-01

    The synthesis, ion exchange properties, and the separation of a number of cation pairs on the columns of cerium (IV) molybdate is discussed. In order to obtain the product in gel form showing a high exchange capacity and suitable for column operation, preliminary experiments were performed to determine the optimum conditions of precipitation, i.e., the concentration of ceric and molybdate solutions, mixing ratio, pH of precipitation and the order of mixing. Cerium (IV) molybdate, prepared under the optimum conditions of concentration, acidity etc., shows exchange capacity of 0.96 meg per g of exchanger. The sorption of a large number of metal ions has been investigated and the compound shows promising behaviour as cation exchanger. Numerous separations of analytical and radiochemical interest have been performed on the column of this exchanger with great efficiency. (T.G.)

  6. Crystalline cerium(IV) phosphates

    International Nuclear Information System (INIS)

    Herman, R.G.; Clearfield, A.

    1976-01-01

    The ion exchange behaviour of seven crystalline cerium(IV) phosphates towards some of the alkali metal cations is described. Only two of the compounds (A and C) possess ion exchange properties in acidic solutions. Four others show some ion exchange characteristics in basic media with some of the alkali cations. Compound G does not behave as an ion exchanger in solutions of pH + , but show very little Na + uptake. Compound E undergoes ion exchange with Na + and Cs + , but not with Li+. Both Li + and Na + are sorbed by compounds A and C. The results are indicative of structures which show steric exclusion phenomena. (author)

  7. Appearance of minimum on the curve of cerium melting

    International Nuclear Information System (INIS)

    Boguslavskij, Yu.Ya.; Grigor'ev, S.B.

    1986-01-01

    It is shown by means of simple and obvious thermodynamical considerations that the reduced stability line continues up to the solid phase boundary. The existence of this line causes the appearance of minimum on the fcc cerium melting curve

  8. Study of cerium doped magnetite (Fe 3O 4:Ce)/PMMA nanocomposites

    Science.gov (United States)

    Padalia, Diwakar; Johri, U. C.; Zaidi, M. G. H.

    2012-03-01

    The paper presents the synthesis and properties of polymer nanocomposite material based on cerium doped magnetite (Fe 3O 4) as filler material and poly methyl methacrylate (PMMA) as host matrix. The magnetite (Fe 3O 4) particles were synthesized by co-precipitation route using stable ferrous and ferric salts with ammonium hydroxide as precipitating agent. Further, they doped by cerium oxide (CeO 2) non-stoichiometrically. The composite material was fabricated by solvent evaporation method. Here 2.4 GHz microwaves were used to study the effect of microwaves heating on polymerization. The phase and crystal structure is determined by X-ray diffraction (XRD). The average crystallite size of the composites varies from 28 to 35 nm. The chemical structure is confirmed by Fourier transform infrared (FTIR) spectroscopy. The magnetic and thermal properties are investigated by vibrating sample magnetometer (VSM) and differential scanning calorimetry (DSC). The thermal study shows that the microwave heated samples possess higher glass transition temperature ( Tg). The magnetic results suggest that coercivity ( HC) and squareness ( Mr/ Ms) of the loop increases with increasing doping percent of cerium.

  9. Fabrication of Cerium Oxide and Uranium Oxide Microspheres for Space Nuclear Power Applications

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey A. Katalenich; Michael R. Hartman; Robert C. O' Brien

    2013-02-01

    Cerium oxide and uranium oxide microspheres are being produced via an internal gelation sol-gel method to investigate alternative fabrication routes for space nuclear fuels. Depleted uranium and non-radioactive cerium are being utilized as surrogates for plutonium-238 (Pu-238) used in radioisotope thermoelectric generators and for enriched uranium required by nuclear thermal rockets. While current methods used to produce Pu-238 fuels at Los Alamos National Laboratory (LANL) involve the generation of fine powders that pose a respiratory hazard and have a propensity to contaminate glove boxes, the sol-gel route allows for the generation of oxide microsphere fuels through an aqueous route. The sol-gel method does not generate fine powders and may require fewer processing steps than the LANL method with less operator handling. High-quality cerium dioxide microspheres have been fabricated in the desired size range and equipment is being prepared to establish a uranium dioxide microsphere production capability.

  10. 13 CFR 134.203 - The petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...

  11. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  12. Cerium concentrate and mixed rare earth chloride by the oxidative decomposition of bastnaesite in molten sodium hydroxide

    International Nuclear Information System (INIS)

    Iijima, Toshio; Kato, Kazuhiro; Kuno, Toyohiko; Okuwaki, Akitsugu; Umetsu, Yoshiaki; Okabe, Taijiro

    1993-01-01

    Bastnaesite was treated in molten NaOH at 623-777 K for 10-60 min under atmosphere. Cerium-(III) in the ore was easily oxidized 95% or more within 30 min to give an oxidation product composed of solid solutions of CeO 2 -rich and CeO 2 -lean phases and Ce-free rare earth oxide phase. Simultaneously fluoride ion was removed 97% or more. Cerium concentrate was prepared from the oxidation product by leaching with 0.1-3 M HCl solution. The yield of cerium concentrate and the CeO 2 content reached 55-57% and 70-72%, respectively. Mixed rare earth chloride is composed of about 90% rare earth chloride and 10% alkaline earth chloride, and the contents of CeCl 3 , LaCl 3 , NdCl 3 , and PrCl 3 are 11.5, 58.5, 14.4, and 5.4%, respectively. The particle size of resulting cerium concentrate was fairly uniform and about 0.1 μm

  13. Synthesis of mesoporous cerium-zirconium mixed oxides by hydrothermal templating method

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Mesoporous cerium-zirconium mixed oxides were prepared by hydrothermal method using cetyl trimethyl ammonium bromide (CTAB) as template.The effects of amount of template,pH value of solution and hydrothermal temperature on mesostructure of samples were systematically investigated.The final products were characterized by XRD,TEM,FT-IR,and BET.The results indicate that all the cerium-zirconium mixed oxides present a meso-structure.At molar ratio of n(CTAB)/n((Ce)+(Zr))=0.15,pH value of 9,and hydrothermal temperature of 120 ℃,the samples obtained possess a specific surface area of 207.9 m2/g with pore diameter of 3.70 nm and pore volume of 0.19 cm3/g.

  14. Synergism between cerium nitrate and sodium dodecylbenzenesulfonate on corrosion of AA5052 aluminium alloy in 3 wt.% NaCl solution

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Jie; Wang, Dapeng; Gao, Lixin; Zhang, Daquan, E-mail: zhdq@sh163.net

    2016-12-15

    Highlights: • Effectively prevent corrosion of AA5052 alloy by using the mixture of cerium nitrate and sodium dodecylbenzenesulfonate. • Synergistic mechanism of the combination of cerium nitrate and sodium dodecylbenzenesulfonate. • Structure of the complex formed between cerium ions and dodecylbenzenesulfonate. • The optimal adsorption model of dodecylbenzenesulfonate on the Al{sub 2}O{sub 3} and CeO{sub 2} surface. - Abstract: The synergistic inhibition effect of rare earth cerium nitrate and sodium dodecylbenzenesulfonate (DBS) on corrosion of AA5052 aluminium alloy in 3 wt.% NaCl solution was investigated by electrochemical impedance spectroscopy (EIS), potentiodynamic polarization curve, scanning electron microscope (SEM) and Fourier transform infrared spectroscopy (FT-IR). The results show that the single cerium nitrate or DBS has a limited inhibition effect against corrosion of AA5052 alloy. The combination cerium ions with DBS produced strong synergistic effect on corrosion inhibition for AA5052 alloy and rendered a negaitve shift of the corrosion potential. The formation of the complex of Al(DBS){sub 3} and Ce(DBS){sub 3} stabilized the passive film of Al{sub 2}O{sub 3} and CeO{sub 2}, retarding both the cathodic and anodic processes of AA5052 alloy corrosion reaction significantly.

  15. Nanostructured sol-gel coatings doped with cerium nitrate as pre-treatments for AA2024-T3

    International Nuclear Information System (INIS)

    Zheludkevich, M.L.; Serra, R.; Montemor, M.F.; Yasakau, K.A.; Salvado, I.M. Miranda; Ferreira, M.G.S.

    2005-01-01

    Nanostructured hybrid sol-gel coatings doped with cerium ions were investigated in the present work as pre-treatments for the AA2024-T3 alloy. The sol-gel films have been synthesized from tetraethylorthosilicate (TEOS) and 3-glycidoxypropyltrimethoxysilane (GPTMS) precursors. Additionally the hybrid sol was doped with zirconia nanoparticles prepared from hydrolyzed tetra-n-propoxyzirconium (TPOZ). Cerium nitrate, as corrosion inhibitor, was added into the hybrid matrix or into the oxide nanoparticles. The chemical composition and the structure of the hybrid sol-gel films were studied by XPS (X-ray photoelectron spectroscopy) and AFM (atomic force microscopy), respectively. The evolution of the corrosion protection properties of the sol-gel films was studied by EIS (electrochemical impedance spectroscopy), which can provide quantitative information on the role of the different pre-treatments. Different equivalent circuits, for different stages of the corrosion processes, were used in order to model the coating degradation. The models were supported by SEM (scanning electron microscopy) measurements. The results show that the sol-gel films containing zirconia nanoparticles present improved barrier properties. Doping the hybrid nanostructured sol-gel coatings with cerium nitrate leads to additional improvement of the corrosion protection. The zirconia particles present in the sol-gel matrix seem to act as nanoreservoirs providing a prolonged release of cerium ions. The nanostructured sol-gel films doped with cerium nitrate can be proposed as a potential candidate for substitution of the chromate pre-treatments for AA2024-T3

  16. Effect of cerium oxide addition on electrical properties of ZnO

    Energy Technology Data Exchange (ETDEWEB)

    Ibrahim, D.M. [National Research Center, Dokki, Giza (Egypt). Dept. of Ceramics; Mounir, M. [Dept. of Physics, Cairo Univ., Giza (Egypt); Mahgoub, A.S. [Cairo Univ., Giza (Egypt). Dept. of Chemistry; Turky, G. [Dept. of Physics, National Research Center, Dokki, Giza (Egypt); El-Desouky, O.A. [Cer. Cleopatra Co., Ramadan City (Egypt)

    2002-07-01

    Mixtures of ZnO and Ce{sub 6} O{sub 11} as additive were prepared by solid state reaction from the calcined oxides with the following proportions: 0.03, 0.08, 0.1, 0.2 and 0.4 mole. Disc specimens 1.2 cm 5 cm in diameter and 0.3 cm thickness were processed under a force of 70 kN and fired at 1150 C/ 30 minutes. XRD revealed the presence of limited solid solution of cerium in ZnO, as evident from the shift in the peaks [0.03-0.04 A ] up to 0.1 mole addition and remains constant. SEM revealed the presence of inter-granular phase. EDAX showed it to be a mixture of ZnO and Ce{sub 6}O{sub 11}. Also cerium was detected in the ZnO grains confirming the XRD results. RCL circuit was used to measure the capacitance and resistance at different frequencies at room temperature. The dielectric constant and conductivity were calculated. The change in resistivity with temperature was followed up to 523 K. The change in dielectric strength with temperature at spot frequency of 10 kHz is demonstrated. The electrical conductivity was found to increase with the proportion of cerium oxide up to 0.2 mole then decreased. (orig.)

  17. Cerium Modified Pillared Montmorillonite Supported Cobalt Catalysts for Fischer Tropsch Synthesis

    International Nuclear Information System (INIS)

    Ahmad, N.; Ali, Z.; Abbas, S. M.; Hussain, F.

    2015-01-01

    Fischer-Tropsch (FT) synthesis was accomplished over Al-pillared Montmorillonite supported 20 wt% Co modified with different weight% of cerium catalysts. These catalysts were prepared by impregnation method while structural characterizations of the prepared samples were performed by XRD, TPR, NH/sub 3/TPD, TGA, BET, XRF and SEM techniques. The Fischer Tropsch reaction was studied in fixed bed micro catalytic reactor at temperature range of 220, 260 and 275 degree C and at different pressure (1, 5 and 10 bars). From the activity results, it was found that by pillaring NaMMT with Al higher catalytic activity and lower methane selectivity of NaMMT was achieved. Furthermore, the results of FT synthesis reaction revealed that cerium incorporation increased the dispersion of Co/sub 3/O/sub 4/ on the surface and consequently resulted in enhanced catalytic activity. Additionally, the C/sub 5/-C/sub 12/ hydrocarbons and methane selectivity increased while C/sub 22+/ hydrocarbons selectivity was decreased over cerium modified catalysts. Higher reaction temperature (>220 degree C) resulted in significant enhancement in CO conversion and methane selectivity. Though, increase in pressure from 1 to 10 bars eventually resulted in increase in C/sub 5+/ hydrocarbons and decrease in methane and C/sub 2/-C/sub 5/ hydrocarbons selectivity. (author)

  18. Influence of agglomeration of cerium oxide nanoparticles and speciation of cerium(III) on short term effects to the green algae Chlamydomonas reinhardtii

    Energy Technology Data Exchange (ETDEWEB)

    Röhder, Lena A. [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); ETH-Zurich, Institute of Biogeochemistry and Pollutant Dynamics, Zürich 8092 (Switzerland); Brandt, Tanja [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); Sigg, Laura [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland); ETH-Zurich, Institute of Biogeochemistry and Pollutant Dynamics, Zürich 8092 (Switzerland); Behra, Renata, E-mail: Renata.behra@eawag.ch [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Department of Environmental Toxicology, Dübendorf 8600 (Switzerland)

    2014-07-01

    Highlights: • Phosphate-dispersed CeO₂ NP did not affect photosynthetic yield in C. reinhardtii. • Agglomerated CeO₂ NP slightly decreased photosynthetic yield. • Cerium(III) was shown to affect photosynthetic yield and intracellular ROS level. • Slight effects of CeO₂ NP were caused by dissolved Ce³⁺ ions present in suspensions. • Wild type and cell wall free mutant of C. reinhardtii showed the same sensitivity. - Abstract: Cerium oxide nanoparticles (CeO₂ NP) are increasingly used in industrial applications and may be released to the aquatic environment. The fate of CeO₂ NP and effects on algae are largely unknown. In this study, the short term effects of CeO₂ NP in two different agglomeration states on the green algae Chlamydomonas reinhardtii were examined. The role of dissolved cerium(III) on toxicity, its speciation and the dissolution of CeO₂ NP were considered. The role of cell wall of C. reinhardtii as a barrier and its influence on the sensitivity to CeO₂ NP and cerium(III) was evaluated by testing both, the wild type and the cell wall free mutant of C. reinhardtii. Characterization showed that CeO₂ NP had a surface charge of ~0 mV at physiological pH and agglomerated in exposure media. Phosphate stabilized CeO₂ NP at pH 7.5 over 24 h. This effect was exploited to test CeO₂ NP dispersed in phosphate with a mean size of 140 nm and agglomerated in absence of phosphate with a mean size of 2000 nm. The level of dissolved cerium(III) in CeO₂ NP suspensions was very low and between 0.1 and 27 nM in all tested media. Exposure of C. reinhardtii to Ce(NO₃)₃ decreased the photosynthetic yield in a concentration dependent manner with EC₅₀ of 7.5 ± 0.84 μM for wild type and EC₅₀ of 6.3 ± 0.53 μM for the cell wall free mutant. The intracellular level of reactive oxygen species (ROS) increased upon exposure to Ce(NO₃)₃ with effective concentrations similar to those inhibiting photosynthesis. The agglomerated Ce

  19. Extraction of Cerium (IV) Using Di–n-butylsulfoxide in Chloroform ...

    African Journals Online (AJOL)

    NICO

    2015-01-12

    Jan 12, 2015 ... Cerium is the most abundant among rare earth metals and is extracted from monazite, allanite and ... Variamine blue, 2,4, dihydroxy benzophenoe benzoic hydrazone, ... thoroughly for colour development. The reagent blank ...

  20. Thermodynamic Studies of the Phase Relationships of Nonstoichiometric Cerium Oxides at Higher Temperatures

    DEFF Research Database (Denmark)

    Sørensen, Ole Toft

    1976-01-01

    Partial molar thermodynamic quantities for oxygen in nonstoichiometric cerium oxides were determined by thermogravimetric analysis in CO/CO2 mixtures in the temperature range 900–1400°C. Under these conditions compositions within the range 2.00 greater-or-equal, slanted O/M greater-or-equal, slan......Partial molar thermodynamic quantities for oxygen in nonstoichiometric cerium oxides were determined by thermogravimetric analysis in CO/CO2 mixtures in the temperature range 900–1400°C. Under these conditions compositions within the range 2.00 greater-or-equal, slanted O/M greater...

  1. Determination of Ideal Broth Formulations Needed to Prepare Hydrous Cerium Oxide Microspheres via the Internal Gelation Process

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Jack Lee [ORNL; Chi, Anthony [ORNL

    2009-02-01

    A simple test tube methodology was used to determine optimum process parameters for preparing hydrous cerium oxide microspheres via the internal gelation process.1 Broth formulations of cerium ammonium nitrate [(NH4)2Ce(NO3)6], hexamethylenetetramine, and urea were found that can be used to prepare hydrous cerium oxide gel spheres in the temperature range of 60 to 90 C. A few gel-forming runs were made in which microspheres were prepared with some of these formulations to be able to equate the test-tube gelation times to actual gelation times. These preparations confirmed that the test-tube methodology is reliable for determining the ideal broth formulations.

  2. Effect of cerium and thermomechanical processing on microstructure

    Indian Academy of Sciences (India)

    The effect of cerium content and thermomechanical processing on structure and properties of Fe–10.5 wt.%Al–0.8 wt%C alloy has been investigated. Alloys were prepared by a combination of air induction melting with flux cover (AIMFC) and electroslag remelting (ESR). The ESR ingots were hot-forged and hotrolled at ...

  3. Using cerium anomaly as an indicator of redox reactions in constructed wetland

    Science.gov (United States)

    Liang, R.

    2013-12-01

    The study area, Chiayi County located in southern Taiwan, has highly developed livestock. The surface water has very low dissolved oxygen and high NH4. Under the situation, constructed wetland becomes the most effective and economic choice to treat the wastewater in the natural waterways. Hebao Island free surface constructed wetland started to operate in late 2006. It covers an area of 0.28 km2 and is subdivided into 3 major cells, which are sedimentation cell, 1st aeration cell with rooted plants and 2nd aeration cell with float plants. The water depth of cells ranges from 0.6 m to 1.2 m. The total hydraulic retention time is about a half day. In this study, the water samples were sequentially collected along the flow path. The results of hydrochemical analysis show that the untreated inflow water can be characterized with enriched NH4 (11 ppm), sulfate (6 ppm) and arsenic (50 ppb). The removal efficiency of NH4 in the first two cells is arsenic is still higher than the permissible limits recommended by WHO (10 ppb). The wetland operation should be tuned to take more arsenic away in the future. As demonstrated in the above, oxidation reaction is the most dominant mechanism to remove pollutants from the wastewater; therefore, dissolved oxygen is traditionally considered as an important indicator to evaluate the operation efficiency of wetland. However, it would need longer time to achieve equilibrium state of redox reaction involving dissolved oxygen due to the slower reaction rate. For example, the input water in this study has fairly high dissolved oxygen (5 ppm) but the NH4 content is still high, which indicates a non-equilibrium condition. In this study, the cerium anomaly is alternatively utilized to evaluate the water redox state. The results demonstrate that the input water has the negative cerium anomaly of -0.16. Along the flow path, the cerium negative anomaly does not change in the first two cells and dramatically becomes -0.23 in cell 3. The trend of

  4. Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a

    Science.gov (United States)

    Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul

    2012-06-01

    An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.

  5. Behavior of cesium-134 in the tea tree

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Kaixuan; Chen Chuangqun

    1996-01-01

    The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%

  6. Study of cerium doped magnetite (Fe3O4:Ce)/PMMA nanocomposites

    International Nuclear Information System (INIS)

    Padalia, Diwakar; Johri, U.C.; Zaidi, M.G.H.

    2012-01-01

    The paper presents the synthesis and properties of polymer nanocomposite material based on cerium doped magnetite (Fe 3 O 4 ) as filler material and poly methyl methacrylate (PMMA) as host matrix. The magnetite (Fe 3 O 4 ) particles were synthesized by co-precipitation route using stable ferrous and ferric salts with ammonium hydroxide as precipitating agent. Further, they doped by cerium oxide (CeO 2 ) non-stoichiometrically. The composite material was fabricated by solvent evaporation method. Here 2.4 GHz microwaves were used to study the effect of microwaves heating on polymerization. The phase and crystal structure is determined by X-ray diffraction (XRD). The average crystallite size of the composites varies from 28 to 35 nm. The chemical structure is confirmed by Fourier transform infrared (FTIR) spectroscopy. The magnetic and thermal properties are investigated by vibrating sample magnetometer (VSM) and differential scanning calorimetry (DSC). The thermal study shows that the microwave heated samples possess higher glass transition temperature (T g ). The magnetic results suggest that coercivity (H C ) and squareness (M r /M s ) of the loop increases with increasing doping percent of cerium.

  7. Behaviour of 134Cs in the aquatic ecosystems

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Chuanqun

    1992-07-01

    The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function

  8. Thermal decomposition study of uranyl nitrate and cerium hydroxide in a spray dryer

    International Nuclear Information System (INIS)

    Silva Wildhagen, G.R. da.

    1993-05-01

    A study, in a spray dryer system based on drying and thermal decomposition of uranyl nitrate solutions aiming the production of uranium trioxide adequate for the use in posterior steps of reduction and hydro fluorination in nuclear fuel cycle; and cerium hydroxide suspensions for the production of cerium oxide with high surface area is presented. Thus, the project and construction of a countercurrent spray dryer was elaborated for capacity of 10 Kg U O 3 /h and 3,5 k Ce O 2 /h. The methodology used in these experiments consisted in the analysis of several parameters (concentration and flow rate of the feed, atomization pressure and inlet temperature of the dryer) over the physical and chemical properties of the products. Using the obtained results, with the help of a mathematical model, it was developed the project of a continuous pilot unity for the production of uranium trioxide or cerium oxide, with capacity of 20 Kg U O 3 /h or 10 Kg Ce O 2 /h, respectively. (author)

  9. Cerium valence change in the solid solutions Ce(Rh1-xRux)Sn

    International Nuclear Information System (INIS)

    Niehaus, Oliver; Riecken, Jan F.; Winter, Florian; Poettgen, Rainer; Muenster Univ.; Abdala, Paula M.; Chevalier, Bernard

    2013-01-01

    The solid solutions Ce(Rh 1-x Ru x )Sn were investigated by means of susceptibility measurements, specific heat, electrical resistivity, X-ray absorption spectroscopy (XAS), and 119 Sn Moessbauer spectroscopy. Magnetic measurements as well as XAS data show a cerium valence change in dependence on the ruthenium content. Higher ruthenium content causes an increase from 3.22 to 3.45 at 300 K. Furthermore χ and χ -1 data indicate valence fluctuation for cerium as a function of temperature. For example, Ce(Rh 0.8 Ru 0.2 )Sn exhibits valence fluctuations between 3.42 and 3.32 in the temperature range of 10 to 300 K. This could be proven by using the interconfiguration fluctuation (ICF) model introduced by Sales and Wohlleben. Cerium valence change does not influence the tin atoms as proven by 119 Sn Moessbauer spectroscopy, but it influences the electrical properties. Ce(Rh 0.9 Ru 0.1 )Sn behaves like a typical valence fluctuating compound, and higher ruthenium content causes an increase of the metallic behavior. (orig.)

  10. Fixation of radioactive cerium-144 on white blood cells. Possibilities for use in physiopathology

    International Nuclear Information System (INIS)

    Aeberhardt, A.

    1958-01-01

    From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of 144 Ce- 144 Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [fr

  11. Indirect flow injection determination of N-acetyl-L-cysteine using cerium(IV) and ferroin

    International Nuclear Information System (INIS)

    Vieira, Heberth Juliano; Fatibello-Filho, Orlando

    2005-01-01

    An indirect flow injection spectrophotometric procedure is proposed for the determination of N-acetyl-L-cysteine in pharmaceutical formulations. In this system, ferroin ([Fe(II)-(fen) 2 ] 2+ ) in excess, with a strong absorption at 500 nm, is oxidized by cerium(IV) yielding cerium(III) and [Fe(III)-(fen) 2 ] 3+ (colorless), thus producing a baseline. When N-acetyl-L-cysteine solution is introduced into the flow injection system, it reacts with cerium(IV) increasing the analytical signal in proportion to the drug concentration. Under optimal experimental conditions, the linearity of the analytical curve for N-acetyl-L-cysteine ranged from 6.5x10 -6 to 1.3x10 -4 mol L -1 . The detection limit was 5.0x10 -6 mol L -1 and recoveries between 98.0 and 106% were obtained. The sampling frequency was 60 determinations per hour and the RSD was smaller than 1.4% for 2.2x10 -5 mol L -1 N-acetyl-L-cysteine. (author)

  12. Corrosion behaviors in physiological solution of cerium conversion coatings on AZ31 magnesium alloy

    International Nuclear Information System (INIS)

    Cui Xiufang; Yang Yuyun; Liu Erbao; Jin Guo; Zhong Jinggao; Li Qingfen

    2011-01-01

    In this paper, a non-toxic Ce-based conversion coating was obtained on the surface of bio-medical AZ31 magnesium alloys. The micro-morphology of the coating prepared with optimal technical parameters and immersed in physiological solution (Hank's solution) in different time was observed by scanning electron microscopy (SEM), composition of the cerium conversion coating and corrosion products in Hank's solution were characterized by X-ray photoelectron spectroscopy (XPS) and energy dispersive spectroscopy (EDS), respectively. In addition, the corrosion property in Hank's solution was studied by electrochemical experiment and immersion test. The results show that the dense Ce-based conversion coating is obtained on the surface of AZ31 magnesium alloys in optimal technical parameters and the conversion coating consists of a mass of trivalent and tetravalent cerium oxides. The cerium conversion coating can provide obvious protection of magnesium alloys and can effectively reduce the degradation speed in Hank's solution. Also the degradation products have little influence on human body.

  13. Cerium-loaded algae exoskeletons for active corrosion protection of coated AA2024-T3

    International Nuclear Information System (INIS)

    Denissen, Paul J.; Garcia, Santiago J.

    2017-01-01

    Highlights: •Nanoporous diatom algae exoskeletons allow for local inhibitor loading. •Cerium loaded exoskeletons show diffusion controlled release from coatings. •In-situ opto-electrochemical analysis allows for accurate corrosion evaluation. •Raman spectroscopy allows for precise identification of Ce at IMs in a scribe. •High levels of protection were obtained with the Ce-diatom coatings. -- Abstract: The use of micron sized nanoporous diatom algae exoskeletons for inhibitor storage and sustained corrosion protection of coated aluminium structures upon damage is presented. In this concept the algae exoskeleton allows local inhibitor loading, limits the interaction between the cerium and the epoxy/amine coating and allows for diffusion-controlled release of the inhibitor when needed. The inhibitor release and corrosion protection by loaded exoskeletons was evaluated by UV/Vis spectrometry, a home-built optical-electrochemical setup, and Raman spectroscopy. Although this concept has been proven for a cerium-epoxy-aluminium alloy system the main underlying principle can be extrapolated to other inhibitor-coating-metal systems.

  14. Eucalyptus tolerance mechanisms to lanthanum and cerium: subcellular distribution, antioxidant system and thiol pools.

    Science.gov (United States)

    Shen, Yichang; Zhang, Shirong; Li, Sen; Xu, Xiaoxun; Jia, Yongxia; Gong, Guoshu

    2014-12-01

    Guanglin 9 (Eucalyptus grandis × Eucalyptus urophlla) and Eucalyptus grandis 5 are two eucalyptus species which have been found to grow normally in soils contaminated with lanthanum and cerium, but the tolerance mechanisms are not clear yet. In this study, a pot experiment was conducted to investigate the tolerance mechanisms of the eucalyptus to lanthanum and cerium. Cell walls stored 45.40-63.44% of the metals under lanthanum or cerium stress. Peroxidase and catalase activities enhanced with increasing soil La or Ce concentrations up to 200 mg kg(-1), while there were no obvious changes in glutathione and ascorbate concentrations. Non-protein thiols concentrations increased with increasing treatment levels up to 200 mg kg(-1), and then decreased. Phytochelatins concentrations continued to increase under La or Ce stress. Therefore, the two eucalyptus species are La and Ce tolerant plants, and the tolerance mechanisms include cell wall deposition, antioxidant system response, and thiol compound synthesis. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. Electrolytic technique for the chemical decontamination process with sulfuric acid-cerium (IV) for decommissioning

    International Nuclear Information System (INIS)

    Wei, Tsong-Yang; Hsieh, Jung-Chun.

    1992-01-01

    An electrolyzer with an ion-exchange membrane as the separator has been used to study the electrolytic redox reaction of Ce 4+ / Ce 3+ in sulfuric acid solution, which is a reagent for predismantling system decontamination. Influencing factors such as current density, cerium concentration, acidity, electrolyte flow rate, membrane type and electrode material were studied experimentally. The results indicate that the redox can be achieved with high conversion even as the cerium concentration is below 0.005 M. However, the current efficiency strongly depends on the cerium concentration. In addition, the acid content and the electrolyte flow rate show little influence on the redox reaction. Both cation and anion membrane are feasible for this process. Therefore, the operation conditions are widely applicable. Moreover, two different electrode materials, platinized titanium meshes and graphite, were used. The results show that the platinized titanium meshes is preferable to the graphite for higher current efficiency. (author)

  16. Effect of ultrasound on the structural and textural properties of copper-impregnated cerium-modified zirconium-pillared bentonite

    International Nuclear Information System (INIS)

    Tomul, Fatma

    2011-01-01

    In this study, the synthesis of zirconium-pillared bentonite modified with cerium was performed via two different methods by the application of conventional and ultrasonic treatments during the intercalation stage. To synthesise copper-impregnated pillared clays by wet impregnation, cerium-modified zirconium-pillared clays were used as supportive materials after being calcined at 300 °C. Ultrasonic treatment significantly decreased the required processing time compared with the conventional treatment of the synthesised pillared bentonites. Chemical analysis confirmed the incorporation of Zr 4+ , Ce 4+ and Cu 2+ species into the pillared bentonites. X-ray diffraction (XRD) patterns of zirconium- and cerium/zirconium-pillared bentonites prepared by conventional treatment show that one large d-spacing above 3.5 nm corresponds to the mesoporous delaminated part, and another small d-spacing above 1.7 nm is indicative of the microporous pillared part. Zirconium- and cerium/zirconium-pillared bentonites prepared via ultrasonic treatment exhibited similar results, with the same high d-spacing but with a second low-intensity d-spacing above 1.9 nm. The delaminated structures of the pillared bentonites synthesised by both methods were conserved after copper impregnation. Nitrogen-adsorption isotherm analysis showed that the textural characteristics of products synthesised by ultrasonic treatment were comparable to those of products synthesised by conventional treatment. Fourier-transform infrared spectroscopy (FTIR) analyses showed the presence of Brønsted- and Lewis-acid sites, and zirconium-pillared clays synthesised by conventional treatment exhibited increased numbers of Brønsted- and Lewis-acid sites after cerium addition and copper impregnation. However, the products synthesised by ultrasonic treatment exhibited an increased number of Brønsted- and Lewis-acid sites after cerium addition, but a decreased number of acid sites after copper impregnation.

  17. Effect of HCl pre-treatment on corrosion resistance of cerium-based conversion coatings on magnesium and magnesium alloys

    International Nuclear Information System (INIS)

    Brunelli, Katya; Dabala, Manuele; Calliari, Irene; Magrini, Maurizio

    2005-01-01

    The corrosion protection afforded by a cerium conversion coating, formed by immersion in a solution containing rare earth salt and hydrogen peroxide, on pure magnesium and two magnesium alloys, AZ91 and AM50, has been studied. The effect of HCl pre-treatments on the morphology and on the corrosion resistance of the cerium conversion layer was investigated. A thicker and more homogeneous distribution of the conversion coating was obtained when the sample surface was pre-treated with acid. Higher amounts of cerium on the surface of the pre-treated samples were detected. The cerium conversion coating increased the corrosion resistance of the alloys because it ennobled the corrosion potential and decreased both the anodic and cathodic current. The acid pre-treatment further increased the corrosion resistance of the coated alloys. After five days of immersion in chloride environment the untreated samples showed localized corrosion while the chemical conversion coated samples appeared unaffected

  18. Zirconia dispersion as a toughening agent in alumina - Influence of the cerium oxide

    International Nuclear Information System (INIS)

    Gritti, Olivier

    1987-01-01

    The improvement of mechanical properties of alumina can be obtained by fine dispersion of zirconia particles. The addition of cerium oxide as a stabilizer of the tetragonal phase has been examined. Different powder preparations, based on impregnation of the alumina powder by zirconium and cerium precursor salts, have been studied. Parameters, such as properties of alumina powder and cerium oxide content, for the production of reactive powders have been determined by two laboratory processes. The sintering of these powders in air at 1600 deg. C has resulted in dense materials with homogeneous microstructure. The mechanical properties, in particular the biaxial flexure strength and the toughness, have been determined in the temperature range 20 deg. C-900 deg. C. A reinforcement of about 80 pc in comparison with alumina is achieved. The optimal composition is (Al 2 O 3 ) 0.8 (ZrO 2 ) 0.18 (CeO 2 ) 0.02 . In the other hand, powder preparation by spray drying has been chosen for an approach to a larger scale process. The sintered ceramics made with these powders present a double microstructure which does not affect the mechanical properties. The presence of cerium oxide produces the following improvements: - increased mobility of the intergranular zirconia inclusions which results in a faster densification; - stabilization of a tetragonal phase without prohibiting the stress induced transformation; - increase of the critical sizes of the tetragonal → monoclinic transformation; - a large decrease in the transformation kinetic in water at 300 deg. C in comparison with that observed for alumina-zirconia doped with yttrium oxide. (author) [fr

  19. 29 CFR 2570.134 - Consequences of default.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...

  20. 49 CFR 195.134 - CPM leak detection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...

  1. Soil organic matter influences cerium translocation and physiological processes in kidney bean plants exposed to cerium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Majumdar, Sanghamitra [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), El Paso, TX (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), El Paso, TX (United States); Trujillo-Reyes, Jesica [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Sun, Youping [Texas AgriLife Research Center at El Paso, Texas A& M University System, 1380 A & M Circle, El Paso, TX 79927 (United States); Barrios, Ana C. [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Niu, Genhua [Texas AgriLife Research Center at El Paso, Texas A& M University System, 1380 A & M Circle, El Paso, TX 79927 (United States); Margez, Juan P. Flores- [Autonomous University of Ciudad Juarez, Departamento de Química y Biología, Instituto de Ciencias Biomédicas, Anillo envolvente PRONAF y Estocolmo, Ciudad Juarez, Chihuahua 32310, México (Mexico); Gardea-Torresdey, Jorge L., E-mail: jgardea@utep.edu [Department of Chemistry, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Ave., El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), El Paso, TX (United States)

    2016-11-01

    Soil organic matter plays a major role in determining the fate of the engineered nanomaterials (ENMs) in the soil matrix and effects on the residing plants. In this study, kidney bean plants were grown in soils varying in organic matter content and amended with 0–500 mg/kg cerium oxide nanoparticles (nano-CeO{sub 2}) under greenhouse condition. After 52 days of exposure, cerium accumulation in tissues, plant growth and physiological parameters including photosynthetic pigments (chlorophylls and carotenoids), net photosynthesis rate, transpiration rate, and stomatal conductance were recorded. Additionally, catalase and ascorbate peroxidase activities were measured to evaluate oxidative stress in the tissues. The translocation factor of cerium in the nano-CeO{sub 2} exposed plants grown in organic matter enriched soil (OMES) was twice as the plants grown in low organic matter soil (LOMS). Although the leaf cover area increased by 65–111% with increasing nano-CeO{sub 2} concentration in LOMS, the effect on the physiological processes were inconsequential. In OMES leaves, exposure to 62.5–250 mg/kg nano-CeO{sub 2} led to an enhancement in the transpiration rate and stomatal conductance, but to a simultaneous decrease in carotenoid contents by 25–28%. Chlorophyll a in the OMES leaves also decreased by 27 and 18% on exposure to 125 and 250 mg/kg nano-CeO{sub 2}. In addition, catalase activity increased in LOMS stems, and ascorbate peroxidase increased in OMES leaves of nano-CeO{sub 2} exposed plants, with respect to control. Thus, this study provides clear evidence that the properties of the complex soil matrix play decisive roles in determining the fate, bioavailability, and biological transport of ENMs in the environment. - Highlights: • Ce translocation to leaves was facilitated by higher organic matter (OM) in soil. • Lower soil OM increased leaf cover area in nano-CeO{sub 2} exposed plants. • Nano-CeO{sub 2} effects on metabolic processes were more

  2. 13 CFR 134.409 - Decision on appeal.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...

  3. 19 CFR 134.14 - Articles usually combined.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...

  4. Corrosion inhibition of 7000 series aluminium alloys with cerium diphenyl phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Julie-Anne [Department of Materials Engineering and Australian Centre of Excellence for Electromaterials Science, Wellington Rd, Monash University, Clayton, Victoria (Australia); Markley, Tracey [Department of Materials Engineering and Australian Centre of Excellence for Electromaterials Science, Wellington Rd, Monash University, Clayton, Victoria (Australia); CSIRO, Division of Materials Science and Technology, Clayton, Victoria (Australia); Forsyth, Maria, E-mail: maria.forsyth@deakin.edu.au [Department of Materials Engineering and Australian Centre of Excellence for Electromaterials Science, Wellington Rd, Monash University, Clayton, Victoria (Australia); Howlett, Patrick C. [Department of Materials Engineering and Australian Centre of Excellence for Electromaterials Science, Wellington Rd, Monash University, Clayton, Victoria (Australia); Hinton, Bruce R.W. [Department of Materials Engineering and Australian Centre of Excellence for Electromaterials Science, Wellington Rd, Monash University, Clayton, Victoria (Australia); Defence Science and Technology Organisation, Melbourne, Victoria (Australia)

    2011-02-03

    Graphical abstract: Scanning electron micrographs of microtomed surface shows pristine surface free of corrosion related 'mud cracking' inset for an inhibited AA7050 specimen when only 150 ppm Ce(dpp)3 is present in 0.1 M NaCl solution. Display Omitted Research highlights: > The thin film of hydrolysis products of Ce(dpp)3 and aluminium oxide is proposed to cause the inhibition. > The film consists of discrete Ce rich particles and a thin film over the matrix of Ce, P and Al oxides. > Discrete deposition of Ce is specifically influenced by Cu rich intermetallics. - Abstract: Cerium diphenyl phosphate (Ce(dpp){sub 3}) has previously been shown to be a strong corrosion inhibitor for aluminium-copper magnesium alloy AA2024-T3 and AA7075 in chloride solutions. Surface characterisation including SEM and ToF-SIMS coupled with electrochemical impedance spectroscopy (EIS) measurements are used to propose a mechanism of corrosion inhibition which appears to involve the formation of a complex oxide film of aluminium and cerium also incorporating the organophosphate component. The formation of a thin complex film consisting of hydrolysis products of the Ce(dpp){sub 3} compound and aluminium oxide is proposed to lead to the observed inhibition. SEM analysis shows that some intermetallics favour the creation of thicker deposits predominantly containing cerium oxide compounds.

  5. Bioavailability of cerium oxide nanoparticles to Raphanus sativus L. in two soils.

    Science.gov (United States)

    Zhang, Weilan; Musante, Craig; White, Jason C; Schwab, Paul; Wang, Qiang; Ebbs, Stephen D; Ma, Xingmao

    2017-01-01

    Cerium oxide nanoparticles (CeO 2 NP) are a common component of many commercial products. Due to the general concerns over the potential toxicity of engineered nanoparticles (ENPs), the phytotoxicity and in planta accumulation of CeO 2 NPs have been broadly investigated. However, most previous studies were conducted in hydroponic systems and with grain crops. For a few studies performed with soil grown plants, the impact of soil properties on the fate and transport of CeO 2 NPs was generally ignored even though numerous previous studies indicate that soil properties play a critical role in the fate and transport of environmental pollutants. The objectives of this study were to evaluate the soil fractionation and bioavailability of CeO 2 NPs to Raphanus sativus L (radish) in two soil types. Our results showed that the silty loam contained slightly higher exchangeable fraction (F1) of cerium element than did loamy sand soil, but significantly lower reducible (F2) and oxidizable (F3) fractions as CeO 2 NPs concentration increased. CeO 2 NPs associated with silicate minerals or the residue fraction (F4) dominated in both soils. The cerium concentration in radish storage root showed linear correlation with the sum of the first three fractions (r 2  = 0.98 and 0.78 for loamy sand and silty loam respectively). However, the cerium content in radish shoots only exhibited strong correlations with F1 (r 2  = 0.97 and 0.89 for loamy sand and silty loam respectively). Overall, the results demonstrated that soil properties are important factors governing the distribution of CeO 2 NPs in soil and subsequent bioavailability to plants. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  6. Coulometric microdetermination of organic compounds with manganese(III) and cerium(IV)

    International Nuclear Information System (INIS)

    Chateau-Gosselin, M.; Patriarche, G.J.

    1977-01-01

    The oxidation of compounds such as hydroquinon, p-aminophenol, paracetamol and phenacetin was performed using cerium(IV) and manganese(III) coulometrically electrogenerated. Quantitative results obtained are excellent even at the microscale level. (author)

  7. 12 CFR 13.4 - Recommendations to customers.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...

  8. Effect of coating parameters on the microstructure of cerium oxide conversion coatings

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Benedict Y.; Edington, Joe; O' Keefe, Matthew J

    2003-11-25

    The microstructure and morphology of cerium oxide conversion coatings prepared under different deposition conditions were characterized by transmission electron microscopy (TEM). The coatings were formed by a spontaneous reaction between a water-based solution containing CeCl{sub 3} and aluminum alloy 7075-T6 substrates. Microstructural characterization was performed to determine the crystallinity of the coatings and to obtain a better understanding of the deposition parameters on coating microstructure. The results of TEM imaging and electron diffraction analysis indicated that the as-deposited coating was composed of nanocrystalline particles of a previously unreported cerium compound. The particles of the coatings produced using glycerol as an additive were found to be much finer than those of the coatings prepared in the absence of glycerol. This indicates that glycerol may act as a grain refiner and/or growth inhibitor during coating deposition. After deposition, the coated panels were treated for 5 min in a phosphate sealing solution. The sealing treatment converted the as-deposited coating into hydrated cerium phosphate. Panels coated from solutions containing no glycerol followed by phosphate sealing performed poorly in salt fog tests. With glycerol addition, the corrosion resistance of the coatings that were phosphate sealed improved considerably, achieving an average passing rate of 85%.

  9. Ultrathin, epitaxial cerium dioxide on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Flege, Jan Ingo, E-mail: flege@ifp.uni-bremen.de; Kaemena, Björn; Höcker, Jan; Schmidt, Thomas; Falta, Jens [Institute of Solid State Physics, University of Bremen, Otto-Hahn-Allee 1, 28359 Bremen (Germany); Bertram, Florian [Photon Science, Deutsches Elektronensynchrotron (DESY), Notkestraße 85, 22607 Hamburg (Germany); Wollschläger, Joachim [Department of Physics, University of Osnabrück, Barbarastraße 7, 49069 Osnabrück (Germany)

    2014-03-31

    It is shown that ultrathin, highly ordered, continuous films of cerium dioxide may be prepared on silicon following substrate prepassivation using an atomic layer of chlorine. The as-deposited, few-nanometer-thin Ce{sub 2}O{sub 3} film may very effectively be converted at room temperature to almost fully oxidized CeO{sub 2} by simple exposure to air, as demonstrated by hard X-ray photoemission spectroscopy and X-ray diffraction. This post-oxidation process essentially results in a negligible loss in film crystallinity and interface abruptness.

  10. Evaluation of mechanically treated cerium (IV) oxides as corrosion inhibitors for galvanized steel

    Energy Technology Data Exchange (ETDEWEB)

    Deflorian, F., E-mail: flavio.deflorian@ing.unitn.it [Department of Materials Engineering and Industrial Technology, University of Trento, Via Mesiano 77, 38123 Trento (Italy); Fedel, M.; Rossi, S. [Department of Materials Engineering and Industrial Technology, University of Trento, Via Mesiano 77, 38123 Trento (Italy); Kamarchik, P. [PPG Industries, Coatings Innovation Center, 4325 Rosanna Drive, Allison Park, PA 15101 (United States)

    2011-09-30

    The use of cerium salts as corrosion inhibitors for hot dip galvanized steel has been object of a numerous studies in the last few years. The role of cerium ions as corrosion inhibitors was proved: cerium is able to block the cathodic sites of the metal, forming insoluble hydroxides and oxides on the zinc surface. This fact leads to a dramatic decrease of the cathodic current densities and, therefore, to a reduction the overall corrosion processes. On the other hand, the potential of cerium oxides as corrosion inhibitors was also proposed. However, the real effectiveness of this kind of anticorrosive pigments has not been clarified yet. In this work cerium (IV) oxides are considered as corrosion inhibitors for galvanized steel. The corrosion inhibition mechanism of mechanically treated (milled) CeO{sub 2} alone and in combination with milled SiO{sub 2} nanoparticles was investigated. For this purpose milled CeO{sub 2}, CeO{sub 2} and SiO{sub 2} milled together and milled SiO{sub 2} particles were studied as corrosion inhibitors in water solution. Therefore, the different mechanically treated particles were dispersed in 0.1 M NaCl solution to test their effectiveness as corrosion inhibitors for galvanized steel. The galvanized steel was immersed in the different solutions and the corrosion inhibition efficiency of the different particles was measured by means of electrochemical techniques. For this purpose, electrochemical impedance spectroscopy (EIS) measurements were carried out, monitoring the evolution of the corrosion processes occurring at the metal surface with the immersion time in the solution. The effect of the different pigments was also investigated by carrying out anodic and cathodic polarization measurements. The polarization curves were acquired under conditions of varied pH. The experimental measurements suggest that the mechanical treatment performed on the SiO{sub 2} and CeO{sub 2} particles promote the formation of an effective corrosion pigment

  11. EXAFS and XANES analysis of plutonium and cerium edges from titanate ceramics for fissile materials disposal

    International Nuclear Information System (INIS)

    Fortner, J. A.; Kropf, A. J.; Bakel, A. J.; Hash, M. C.; Aase, S. B.; Buck, E. C.; Chamerlain, D. B.

    1999-01-01

    We report x-ray absorption near edge structure (XANES) and extended x-ray absorption fine structure (EXAFS) spectra from the plutonium L III edge and XANES from the cerium L II edge in prototype titanate ceramic hosts. The titanate ceramics studied are based upon the hafnium-pyrochlore and zirconolite mineral structures and will serve as an immobilization host for surplus fissile materials, containing as much as 10 weight % fissile plutonium and 20 weight % (natural or depleted) uranium. Three ceramic formulations were studied: one employed cerium as a ''surrogate'' element, replacing both plutonium and uranium in the ceramic matrix, another formulation contained plutonium in a ''baseline'' ceramic formulation, and a third contained plutonium in a formulation representing a high-impurity plutonium stream. The cerium XANES from the surrogate ceramic clearly indicates a mixed III-IV oxidation state for the cerium. In contrast, XANES analysis of the two plutonium-bearing ceramics shows that the plutonium is present almost entirely as Pu(IV) and occupies the calcium site in the zirconolite and pyrochlore phases. The plutonium EXAFS real-space structure shows a strong second-shell peak, clearly distinct from that of PuO 2 , with remarkably little difference in the plutonium crystal chemistry indicated between the baseline and high-impurity formulations

  12. Implementation of a complex multi-phase equation of state for cerium and its correlation with experiment

    Energy Technology Data Exchange (ETDEWEB)

    Cherne, Frank J [Los Alamos National Laboratory; Jensen, Brian J [Los Alamos National Laboratory; Elkin, Vyacheslav M [VNIITF

    2009-01-01

    The complexity of cerium combined with its interesting material properties makes it a desirable material to examine dynamically. Characteristics such as the softening of the material before the phase change, low pressure solid-solid phase change, predicted low pressure melt boundary, and the solid-solid critical point add complexity to the construction of its equation of state. Currently, we are incorporating a feedback loop between a theoretical understanding of the material and an experimental understanding. Using a model equation of state for cerium we compare calculated wave profiles with experimental wave profiles for a number of front surface impact (cerium impacting a plated window) experiments. Using the calculated release isentrope we predict the temperature of the observed rarefaction shock. These experiments showed that the release state occurs at different magnitudes, thus allowing us to infer where dynamic {gamma} - {alpha} phase boundary is.

  13. Colloidal stabilization of cerium-gadolinium oxide (CGO) suspensions via rheology

    DEFF Research Database (Denmark)

    Marani, Debora; Sudireddy, Bhaskar Reddy; Bentzen, Janet Jonna

    2015-01-01

    colloidally stable state. The method was applied to explore the ability of four commercial dispersants (acidic affine, neutral, basic affine, and polyvinylpyrrolidone (PVP)) to disperse cerium-gadolinium oxide (CGO) in ethanol. Only the acidic affine and the PVP dispersants were found to efficiently disperse...

  14. Gas sensing behaviour of cerium oxide and magnesium aluminate

    Indian Academy of Sciences (India)

    Gas sensing behaviour of cerium oxide and magnesium aluminate composites ... A lone pairof the electron state was identified from the electro paramagnetic ... carbon monoxide (CO) (at 0.5, 1.0 and 1.5 bar) and ethanol (at 50 and 100 ppm) was ... The magnitude of the temperature varied linearly regardless of the gas ...

  15. Exposure and Health Effects Review of Engineered Nanoscale Cerium and Cerium Dioxide Associated with its Use as a Fuel Additive - NOW IN PRINT IN THE JOURNAL

    Science.gov (United States)

    Advances of nanoscale science have produced nanomaterials with unique physical and chemical properties at commercial levels that are now incorporated into over 1000 products. Nanoscale cerium (di) oxide (Ce02) has recently gained a wide range of applications which includes coatin...

  16. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium

    International Nuclear Information System (INIS)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A.

    1998-01-01

    It has been detected that the addition of small amounts (<1%) of the so called 'reactive elements' such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  17. Influence of preliminary deformation and phase strengthening on γ reversible α transformation kinetics in cerium under pressure

    International Nuclear Information System (INIS)

    Larionov, L.V.; Livshits, L.D.; Peresada, G.I.; AN SSSR, Moscow. Inst. Fiziki Zemli)

    1985-01-01

    Using the methods of piezo- and resistometry the influence of preliminary plastic deformation, phase transformation induced strengthening and heat treatment on kinetics of γ reversible α transformation in cerium is studied. It is shown, that the used methods of preliminary treatment of sample material do not change pressure value of γ → α and α →γ transformation initiation and do not affect hysteresis value, but affect considerably its kinetics. Preliminary plastic deformation and structural strengthening increase the average formation rate of a new phase. According to the data of tensile tests, structural strengthening, apprearing as a result of one cycle of γ → α → γ transformation, increases cerium strength characteristics 6y 30-50% with simultaneous decrease in plasticity. Metallographic studies confirm martensitic character of γ → α → γ transformations in cerium

  18. Photocatalytic action of cerium molybdate and iron-titanium oxide hollow nanospheres on Escherichia coli

    Energy Technology Data Exchange (ETDEWEB)

    Kartsonakis, I. A., E-mail: ikartsonakis@ims.demokritos.gr; Kontogiani, P.; Pappas, G. S.; Kordas, G. [NCSR ' DEMOKRITOS' , Sol-Gel Laboratory, Institute of Advanced Materials, Physicochemical Processes, Nanotechnology and Microsystems (Greece)

    2013-06-15

    This study is focused on the production of hollow nanospheres that reveal antibacterial action. Cerium molybdate and iron-titanium oxide hollow nanospheres with a diameter of 175 {+-} 15 and 221 {+-} 10 nm, respectively, were synthesized using emulsion polymerization and the sol-gel process. Their morphology characterization was accomplished using scanning electron microscopy. Their antibacterial action was examined on pure culture of Escherichia coli considering the loss of their viability. Both hollow nanospheres presented photocatalytic action after illumination with blue-black light, but those of cerium molybdate also demonstrated photocatalytic action in the dark. Therefore, the produced nanospheres can be used for antibacterial applications.

  19. Evaluation of Antiproliferative Potential of Cerium Oxide Nanoparticles on HeLa Human Cervical Tumor Cell

    Directory of Open Access Journals (Sweden)

    Zoriţa Diaconeasa

    2015-05-01

    Full Text Available Cerium oxide nanoparticles (CeO2 nanoparticles as nanomaterials have promising biomedical applications. In this paper, the cytotoxicity induced by CONPs human cervical tumor cells was investigated. Cerium oxide nanoparticles were synthesized using the precipitation method. The nanoparticles were found to inhibit the proliferation of HeLa human cervical tumor cells in a dose dependent manner but did not showed to be cytotoxic as analyzed by MTT assay. The administrated treatment decreased the HeLa cell viability cells from 100% to 65% at the dose of 100 μg/mL.

  20. The kinetics of the cerium(IV)-uranium(IV) reaction at low sulfate concentrations

    International Nuclear Information System (INIS)

    Michaille, P.; Kikindai, T.

    1977-01-01

    The rate of oxidation of uranium(IV) by cerium(IV) was measured with a stopped-flow spectrophotometer at sulfuric acid concentrations of 2 x 10 -6 to 0.5 M. At a constant hydrogen ion concentration of 0.5 M, the maximum rate constant was observed for 2 x 10 -3 M sulfuric acid; at that concentration, two sulfate ions were involved in the activated complex. The dependence of the rate constant on the hydrogen ion concentration showed that the reaction paths involving one or two sulfate ions also involved one hydroxyl ion, whereas one hydrogen ion was involved in the five sulfate dependent path. Spectrophotometric measurements supported the existence of a hydrolyzed monosulfatocomplex of cerium(IV). (author)

  1. Correlation of the oxidation state of cerium in sol-gel glasses as a function of thermal treatment via optical spectroscopy and XANES studies.

    Science.gov (United States)

    Assefa, Zerihun; Haire, R G; Caulder, D L; Shuh, D K

    2004-07-01

    Sol-gel glass matrices containing lanthanides have numerous technological applications and their formation involves several chemical facets. In the case of cerium, its ability to exist in two different oxidation states or in mixed valence state provides additional complexities for the sol-gel process. The oxidation state of cerium present during different facets of preparation of sol-gel glasses, and also as a function of the starting oxidation state of cerium added, were studied both by optical spectroscopy and X-ray absorption near-edge structures (XANES). The findings acquired by each approach were compared. The primary focus was on the redox chemistries associated with sample preparation, gelation, and thermal treatment. When Ce3+ is introduced into the starting sols, the trivalent state normally prevails in the wet and room temperature-dried gels. Heating in air at >100 degrees C can generate a light yellow coloration with partial oxidation to the tetravalent state. Above 200 degrees C and up to approximately 1000 degrees C, cerium is oxidized to its tetravalent state. In contrast, when tetravalent cerium is introduced into the sol, both the wet and room temperature-dried gels lose the yellow-brown color of the initial ceric ammonium nitrate solution. When the sol-gel is heated to 110 degrees C it turns yellowish as the cerium tends to be re-oxidized. The yellow color is believed to represent the effect of oxidation and oligomerization of the cerium-silanol units in the matrix. The luminescence properties are also affected by these changes, the details of which are reported herein.

  2. The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs

    International Nuclear Information System (INIS)

    Poppy Intan Tjahaja; Putu Sukmabuana

    2008-01-01

    One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)

  3. Thermal expansion and transformation behavior of cerium and plutonium alloys: an application of the Aptekar-Ponyatovsky regular solution model.

    Science.gov (United States)

    Lawson, A C; Lashley, J C

    2011-09-14

    In this paper we apply the Aptekar-Ponyatovsky (AP) regular solution thermodynamic model to the analysis of experimental data for the coefficient of thermal expansion (CTE) and determine the AP model parameters for unalloyed cerium metal, Ce-Th-La alloys, and Pu-Ga alloys. We find that the high temperature CTE of cerium metal follows the predictions of the AP model based on low temperature, high pressure data. For Ce-Th-La alloys we use the AP parameters to track the suppression of the first-order γ-α cerium transition. We show the AP model accounts for the negative CTE observed for Pu-Ga alloys and is equivalent to an earlier invar model. Finally, we apply the AP parameters obtained for Pu-Ga alloys to rationalize the observed δ-α transformation pressures of these alloys. We show that the anomalous values of the Grüneisen and Grüneisen-Anderson parameters are important features of the thermal properties of plutonium. A strong analogy between the properties of plutonium and cerium is confirmed.

  4. 29 CFR 1915.134 - Abrasive wheels.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...

  5. Electrochemical separation of cerium and yttrium in molten chlorides on liquid-metallic electrodes

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Lebedev, V.A.; Nichkov, I.F.

    1978-01-01

    An estimating calculation of the coefficients of separation of cerium and yttrium in the process of electrolysis in molten salts on liquid electrodes of aluminium, gallium, indium, lead, tin, antimonium and zinc is carried out. The calculation of the separation coefficients was carried out according to the known values of activation coefficients of cerium and yttrium in fusible metals. The electrolysis was carried out at 973 K in the argon air in the cell with an eutectic mixture of NaCl and KCl as an elactrolyte. It is shown that the salten phase is concentrated by yttrium, and the melallic one- by cerium on all the electrodes. The value of the separation coefficient of Ce and Y is considerably high and continuously increases on the fusible metals in the Zn, In, Ga, Al, Pb, Sn, Sb series. The experimental values of the separation coefficients practically coincide with the theoretically calculated ones, testifying to the possibility of the effective separation of elements even in a single-staged possibility of the effective separation of elements even in a single-staged process. An electrolysis of molten salts is not inferior in its selectivity to the universally recognized methods of the fine purification of substances permitting to separate Ce and Y with the Ksub(sep) approximately equal to 10

  6. Study of cerium doped magnetite (Fe{sub 3}O{sub 4}:Ce)/PMMA nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Padalia, Diwakar, E-mail: Padalia.diwakar@gmail.com [Department of Physics, G.B. Pant University of Agriculture and Technology, Pantnagar, Uttrakhand (India); Johri, U.C. [Department of Physics, G.B. Pant University of Agriculture and Technology, Pantnagar, Uttrakhand (India); Zaidi, M.G.H. [Supercritical Fluid Processing Laboratory, Department of Chemistry, G.B. Pant University of Agriculture and Technology, Pantnagar, Uttrakhand (India)

    2012-03-01

    The paper presents the synthesis and properties of polymer nanocomposite material based on cerium doped magnetite (Fe{sub 3}O{sub 4}) as filler material and poly methyl methacrylate (PMMA) as host matrix. The magnetite (Fe{sub 3}O{sub 4}) particles were synthesized by co-precipitation route using stable ferrous and ferric salts with ammonium hydroxide as precipitating agent. Further, they doped by cerium oxide (CeO{sub 2}) non-stoichiometrically. The composite material was fabricated by solvent evaporation method. Here 2.4 GHz microwaves were used to study the effect of microwaves heating on polymerization. The phase and crystal structure is determined by X-ray diffraction (XRD). The average crystallite size of the composites varies from 28 to 35 nm. The chemical structure is confirmed by Fourier transform infrared (FTIR) spectroscopy. The magnetic and thermal properties are investigated by vibrating sample magnetometer (VSM) and differential scanning calorimetry (DSC). The thermal study shows that the microwave heated samples possess higher glass transition temperature (T{sub g}). The magnetic results suggest that coercivity (H{sub C}) and squareness (M{sub r}/M{sub s}) of the loop increases with increasing doping percent of cerium.

  7. Characterization of composite metal-ceramic of nickel-oxide cerium doped gadolinium

    International Nuclear Information System (INIS)

    Silva, M.L.A. da; Varela, M.C.R.S.

    2016-01-01

    Composite nickel doped cerium oxide are used in SOFC anode materials. In this study we evaluated the effect of the presence of gadolinium on the properties of composite nickel and ceria and. The supports were synthesized by sol-gel method. The impregnation with nickel nitrate was taken sequentially, followed by calcination. The materials were characterized by X-ray diffraction, measurement of specific surface area, temperature programmed reduction, Raman spectroscopy. The presence of gadolinium retained the fluorite structure of ceria by forming a solid solution, also not influencing significantly on the specific surface area of the support. On the other hand, there was a decrease in the area catalysts, which can be attributed to sintering of nickel. Furthermore, addition of gadolinium favored the formation of intrinsic and extrinsic vacancies in cerium oxide, which leads to an increase in the ionic conductivity of the solid, desirable property for an SOFC anode catalyst. (author)

  8. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    International Nuclear Information System (INIS)

    Ghosh, Swapankumar; Divya, Damodaran; Remani, Kottayilpadi C.; Sreeremya, Thadathil S.

    2010-01-01

    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 o C. The activation energy for growth of CeO 2 nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO 2 particles in narrow size range. CeO 2 nanocrystals precipitated at 35 o C were further annealed at temperatures in the range 300-700 o C. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  9. Molecular absorption spectra of beryllium, cerium, lanthanum, iron, and platinum salts

    International Nuclear Information System (INIS)

    Daidoji, Hidehiro

    1980-01-01

    The absorption spectra of some salts of beryllium, cerium, lanthanum, iron and platinum in air-acetylene flame were measured in the wavelength range from 200 to 400 nm. A Hitachi 207 type atomic absorption spectrophotometer was used. A deuterium lamp, a home-made continuous radiation lamp and some hollow cathode lamps were used as light sources. The new molecular absorption spectra of cerium, lanthanum and platinum and the absorption spectra due to Be(OH) 2 , LaO, PtH, FeO and FeCl in 200-400 nm region were obtained. Emission spectra of CeO, LaO and FeOH were also obtained. These molecular absorption bands were estimated as absorption errors of maximum 15 times to the sensitivity of each elements in atomic absorption spectrometry. In addition, spectral line interferences of iron were observed in atomic absorption spectrometry of Zn, Cd, Ni, Cu and Cr. (author)

  10. Preparation and characterization of gelatin/cerium(Ⅲ) film

    Institute of Scientific and Technical Information of China (English)

    黄崇军; 黄雅钦; 田娜; 童元建; 殷瑞贤

    2010-01-01

    A novel gelatin film with antibacterial activity was prepared by electrostatic crosslinking using cerium (Ⅲ) nitrate hexahydrate as the crosslinking agent. The structure and properties of the films were investigated by Fourier transform infrared spectra, tensile tests, thermogravimetric analysis, static drop contact angle and disc diffusion method. The results showed that cross-linking could not only improve the thermal and mechanical properties and lower the hydrophilic property of the films, but also make...

  11. Photocatalytic action of cerium molybdate and iron-titanium oxide hollow nanospheres on Escherichia coli

    International Nuclear Information System (INIS)

    Kartsonakis, I. A.; Kontogiani, P.; Pappas, G. S.; Kordas, G.

    2013-01-01

    This study is focused on the production of hollow nanospheres that reveal antibacterial action. Cerium molybdate and iron-titanium oxide hollow nanospheres with a diameter of 175 ± 15 and 221 ± 10 nm, respectively, were synthesized using emulsion polymerization and the sol–gel process. Their morphology characterization was accomplished using scanning electron microscopy. Their antibacterial action was examined on pure culture of Escherichia coli considering the loss of their viability. Both hollow nanospheres presented photocatalytic action after illumination with blue–black light, but those of cerium molybdate also demonstrated photocatalytic action in the dark. Therefore, the produced nanospheres can be used for antibacterial applications.

  12. Preparation of Carbon-Platinum-Ceria and Carbon-Platinum-Cerium catalysts and its application in Polymer Electrolyte Fuel Cell: Hydrogen, Methanol, and Ethanol

    Science.gov (United States)

    Guzman Blas, Rolando Pedro

    This thesis is focused on fuel cells using hydrogen, methanol and ethanol as fuel. Also, in the method of preparation of catalytic material for the anode: Supercritical Fluid Deposition (SFD) and impregnation method using ethylenediaminetetraacetic acid (EDTA) as a chelating agent. The first part of the thesis describes the general knowledge about Hydrogen Polymer Exchange Membrane Fuel Cell (HPEMFC),Direct Methanol Fuel Cell (DMFC) and Direct Ethanol Fuel Cell (DEFC), as well as the properties of Cerium and CeO2 (Ceria). The second part of the thesis describes the preparation of catalytic material by Supercritical Fluid Deposition (SFD). SFD was utilized to deposit Pt and ceria simultaneously onto gas diffusion layers. The Pt-ceria catalyst deposited by SFD exhibited higher methanol oxidation activity compared to the platinum catalyst alone. The linear sweep traces of the cathode made for the methanol cross over study indicate that Pt-Ceria/C as the anode catalyst, due to its better activity for methanol, improves the fuel utilization, minimizing the methanol permeation from anode to cathode compartment. The third and fourth parts of the thesis describe the preparation of material catalytic material Carbon-Platinum-Cerium by a simple and cheap impregnation method using EDTA as a chelating agent to form a complex with cerium (III). This preparation method allows the mass production of the material catalysts without additional significant cost. Fuel cell polarization and power curves experiments showed that the Carbon-Platinum-Cerium anode materials exhibited better catalytic activity than the only Vulcan-Pt catalysts for DMFC, DEFC and HPEMFC. In the case of Vulcan-20%Pt-5%w Cerium, this material exhibits better catalytic activity than the Vulcan-20%Pt in DMFC. In the case of Vulcan-40% Pt-doped Cerium, this material exhibits better catalytic activity than the Vulcan-40% Pt in DMFC, DEFC and HPEMFC. Finally, I propose a theory that explains the reason why the

  13. Ab initio molecular dynamics study of the properties of cerium in liquid sodium at 1000 K temperature

    Energy Technology Data Exchange (ETDEWEB)

    Samin, Adib; Li, Xiang; Zhang, Jinsuo [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, 201 W 19th Avenue, Columbus, Ohio 43210 (United States); Mariani, R. D. [Idaho National Laboratory, Materials and Fuels Complex, Idaho Falls, Idaho 83415 (United States); Unal, Cetin [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, New Mexico 87545 (United States)

    2015-12-21

    For liquid-sodium-cooled fast nuclear reactor systems, it is crucial to understand the behavior of lanthanides and other potential fission products in liquid sodium or other liquid metal solutions such as liquid cesium-sodium. In this study, we focus on lanthanide behavior in liquid sodium. Using ab initio molecular dynamics, we found that the solubility of cerium in liquid sodium at 1000 K was less than 0.78 at. %, and the diffusion coefficient of cerium in liquid sodium was calculated to be 5.57 × 10{sup −9} m{sup 2}/s. Furthermore, it was found that cerium in small amounts may significantly alter the heat capacity of the liquid sodium system. Our results are consistent with the experimental results for similar materials under similar conditions.

  14. Performance characteristics of silver cerium vanadate batteries

    OpenAIRE

    Arof , Abdul; Kamaluddin , Burhanuddin; Radhakrishna , S.

    1993-01-01

    Stoichiometric ratios of AR grade AgI, Ag2O, V2O5 and CeO2 were melted in a furnace and the melt was rapidly quenched to liquid nitrogen temperature to form a glass. The glassy nature of the sample has been confirmed by powder X-ray diffraction technique. The microstructure and microanalysis studies of the silver cerium vanadate (SCV) have been carried out by scanning electron microscopy (SEM) and energy dispersive analysis of X-rays (EDAX). The SEM micrograph of the as-quenched melt showed c...

  15. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Swapankumar, E-mail: swapankumar.ghosh2@mail.dcu.ie; Divya, Damodaran [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India); Remani, Kottayilpadi C. [Sree Neelakanda Government Sanskrit College, Department of Chemistry (India); Sreeremya, Thadathil S. [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India)

    2010-06-15

    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 {sup o}C. The activation energy for growth of CeO{sub 2} nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO{sub 2} particles in narrow size range. CeO{sub 2} nanocrystals precipitated at 35 {sup o}C were further annealed at temperatures in the range 300-700 {sup o}C. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  16. An Auger and XPS survey of cerium active corrosion protection for AA2024-T3 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Uhart, A. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Ledeuil, J.B. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Université de Toulouse, UPS-INP-CNRS, Institut Carnot CIRIMAT, 118 Route de Narbonne, 31062 Toulouse Cedex 09 (France); Gonbeau, D. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Dupin, J.C., E-mail: dupin@univ-pau.fr [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Bonino, J.P.; Ansart, F. [Université de Toulouse, UPS-INP-CNRS, Institut Carnot CIRIMAT, 118 Route de Narbonne, 31062 Toulouse Cedex 09 (France); Esteban, J. [Messier-Bugatti-Dowty, Etablissement de Molsheim, 3, rue Antoine de St Exupéry, 67129 Molsheim (France)

    2016-12-30

    Graphical abstract: Coupled SAM/SEM survey of cerium inhibitor migration towards corrosion pits in a conversion coating over AA2024-T3 substrate. - Highlights: • XPS evidenced the proximity of the inhibitor with the surface AA2024 alloy. • Cerium conversion coatings with [Ce] = 0.1 M offer the best corrosion resistance. • SAM shown the migration of Ce + III entities towards the corrosion pits or crevices. • High resolution analyses (Auger) connecting the nano-scale order with the chemical distribution.

  17. Measurement limits to 134Cs concentration in soil

    International Nuclear Information System (INIS)

    Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.

    2011-01-01

    We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.

  18. Cerium chloride stimulated controlled conversion of B-to-Z DNA in self-assembled nanostructures

    International Nuclear Information System (INIS)

    Bhanjadeo, Madhabi M.; Nayak, Ashok K.; Subudhi, Umakanta

    2017-01-01

    DNA adopts different conformation not only because of novel base pairs but also while interacting with inorganic or organic compounds. Self-assembled branched DNA (bDNA) structures or DNA origami that change conformation in response to environmental cues hold great promises in sensing and actuation at the nanoscale. Recently, the B-Z transition in DNA is being explored to design various nanomechanical devices. In this communication we have demonstrated that Cerium chloride binds to the phosphate backbone of self-assembled bDNA structure and induce B-to-Z transition at physiological concentration. The mechanism of controlled conversion from right-handed to left-handed has been assayed by various dye binding studies using CD and fluorescence spectroscopy. Three different bDNA structures have been identified to display B-Z transition. This approach provides a rapid and reversible means to change bDNA conformation, which can be used for dynamic and progressive control at the nanoscale. - Highlights: • Cerium-induced B-to-Z DNA transition in self-assembled nanostructures. • Lower melting temperature of Z-DNA than B-DNA confirmed by CD spectroscopy. • Binding mechanism of cerium chloride is explained using fluorescence spectroscopy. • Right-handed to left-handed DNA conformation is also noticed in modified bDNA structure.

  19. Assessment of the abatement of acelsulfame K using cerium doped ZnO as photocatalyst

    International Nuclear Information System (INIS)

    Calza, P.; Gionco, C.; Giletta, M.; Kalaboka, M.; Sakkas, V.A.; Albanis, T.; Paganini, M.C.

    2017-01-01

    Highlights: • Hydrothermal synthesis and characterization of Ce doped ZnO. • The abatement of ACE K is assessed in ultrapure water and in river water matrix. • Demonstrated higher degradation activity than P25 under visible light. • The degradation activity is less affected in river water than for P25. - Abstract: In the present study, we investigated the possibility to abate Acesulfame K, a persistent emerging contaminant, in aqueous media using zinc oxide based materials. For this purpose, bare and Ce-doped zinc oxide was prepared via an easy and cheap hydrothermal process using different cerium salts as precursors. Their photocatalytic performance was evaluated in different media, namely ultrapure and river water under both UV–vis and visible light. Commercial TiO_2 P25 was also employed and used as a reference photocatalyst for comparison purposes. The obtained results pointed out that cerium doped zinc oxide composites exhibit higher performance than TiO_2 P25, especially under visible light and in the presence of organic matter, when the activity of the latter is greatly depressed. In particular, ZnO doped with cerium (1%) was the most effective material, and could be a promising alternative to TiO_2 P25, especially in the treatment of natural waters.

  20. Microstructure and electrochemical behavior of cerium conversion coating modified with silane agent on magnesium substrates

    Science.gov (United States)

    Lei, Li; Shi, Jing; Wang, Xin; Liu, Dan; Xu, Haigang

    2016-07-01

    The cerium conversion coating with and without different concentrations of silane agent bis-(γ-triethoxysilylpropyl)-tetrasulfide (BTESPT) modification is obtained on magnesium alloys. Detailed properties of the coatings and the role of BTESPT as an additive are studied and followed with careful discussion. The coating morphology, wettability, chemical composition and corrosion resistance are characterized by scanning electronic microscope (SEM), water contact-angle, X-ray photoelectron spectroscopy (XPS), potentiodynamic measurements and electrochemical impedance spectroscopy (EIS). The electrochemical behavior of the coatings is investigated using EIS. The results indicate that the coating morphology and composition can be controlled by changing silane concentration. The combination of cerium ions and silane molecules could promote the formation of more homogenous and higher hydrophobic coating. The coating turns to be more compact and the adhesive strength between the coating and the magnesium substrate are strongly improved with the formation of Sisbnd Osbnd Si and Sisbnd Osbnd M chemical bonds. The optimum corrosion resistance of the coating in the corrosive media is obtained by 25 ml L-1 BTESPT modification. This whole study implies that the cerium conversion coating modified with certain silane agent deserves cautiousness before its application for corrosion resistance.

  1. Preparation and Characterization of Cerium (III Doped Captopril Nanoparticles and Study of their Photoluminescence Properties

    Directory of Open Access Journals (Sweden)

    Ghamami Shahriar

    2016-01-01

    Full Text Available In this research Ce3+ doped Captopril nanoparticles (Ce3+ doped CAP-NP were prepared by a cold welding process and have been studied. Captopril may be applied in the treatment of hypertension and some types of congestive heart failure and for preventing kidney failure due to high blood pressure and diabetes. CAP-NP was synthesized by a cold welding process. The cerium nitrate was added at a ratio of 10% and the optical properties have been studied by photoluminescence (PL. The synthesized compounds were characterized by Fourier transform infrared spectroscopy. The size of CAP-NP was calculated by X-ray diffraction (XRD. The size of CAP-NP was in the range of 50 nm. Morphology of surface of synthesized nanoparticles was studied by scanning electron microscopy (SEM. Finally the luminescence properties of undoped and doped CAP-NP were compared. PL spectra from undoped CAP-NP show a strong pack in the range of 546 nm after doped cerium ion into the captopril appeared two bands at 680 and 357 nm, which is ascribed to the well-known 5d–4f emission band of the cerium.

  2. 13 CFR 134.404 - Decision by Administrative Law Judge.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...

  3. Electron donating and acid-base properties of cerium oxide and its mixed oxides with alumina

    International Nuclear Information System (INIS)

    Sugunan, S.; Jalaja, J.M.

    1994-01-01

    The electron donating properties of cerium oxide activated at 300, 500 and 800 degC and of its mixed oxides with alumina were examined based on the adsorption of electron acceptors exhibiting different electron affinities. The surface acidity/basicity of the oxides was determined by titrimetry; the H 0,max values are given. The limit of electron transfer from the oxide surface lies within the region of 1.77 and 2.40 eV in terms of the electron affinity of the electron acceptor. Cerium oxide promotes the electron donor nature of alumina while leaving the limit of electron transfer unchanged. 2 tabs., 4 figs., 13 refs

  4. The absorption and distribution of Cesium-134 in rice-soil system

    International Nuclear Information System (INIS)

    Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming

    1991-01-01

    Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice

  5. Nutritional quality assessment of tomato fruits after exposure to uncoated and citric acid coated cerium oxide nanoparticles, bulk cerium oxide, cerium acetate and citric acid.

    Science.gov (United States)

    Barrios, Ana Cecilia; Medina-Velo, Illya A; Zuverza-Mena, Nubia; Dominguez, Osvaldo E; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L

    2017-01-01

    Little is known about the effects of surface modification on the interaction of nanoparticles (NPs) with plants. Tomato (Solanum lycopersicum L.) plants were cultivated in potting soil amended with bare and citric acid coated nanoceria (nCeO 2, nCeO 2 +CA), cerium acetate (CeAc), bulk cerium oxide (bCeO 2 ) and citric acid (CA) at 0-500 mg kg -1 . Fruits were collected year-round until the harvesting time (210 days). Results showed that nCeO 2 +CA at 62.5, 250 and 500 mg kg -1 reduced dry weight by 54, 57, and 64% and total sugar by 84, 78, and 81%. At 62.5, 125, and 500 mg kg -1 nCeO 2 +CA decreased reducing sugar by 63, 75, and 52%, respectively and at 125 mg kg -1 reduced starch by 78%, compared to control. The bCeO 2 at 250 and 500 mg kg -1 , increased reducing sugar by 67 and 58%. In addition, when compared to controls, nCeO 2 at 500 mg kg -1 reduced B (28%), Fe (78%), Mn (33%), and Ca (59%). At 125 mg kg -1 decreased Al by 24%; while nCeO 2 +CA at 125 and 500 mg kg -1 increased B by 33%. On the other hand, bCeO 2 at 62.5 mg kg -1 increased Ca (267%), but at 250 mg kg -1 reduced Cu (52%), Mn (33%), and Mg (58%). Fruit macromolecules were mainly affected by nCeO 2 +CA, while nutritional elements by nCeO 2 ; however, all Ce treatments altered, in some way, the nutritional quality of tomato fruit. To our knowledge, this is the first study comparing effects of uncoated and coated nanoceria on tomato fruit quality. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. 13 CFR 134.209 - Requirement of signature.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...

  7. 13 CFR 134.702 - Who may appeal?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

  8. Cyclic thermochemical process for producing hydrogen using cerium-titanium compounds

    Science.gov (United States)

    Bamberger, C.E.

    A thermochemical cyclic process for producing hydrogen employs the reaction between ceric oxide and titanium dioxide to form cerium titanate and oxygen. The titanate is treated with an alkali metal hydroxide to give hydrogen, ceric oxide, an alkali metal titanate and water. Alkali metal titanate and water are boiled to give titanium dioxide which, along with ceric oxide, is recycled.

  9. Cerium compounds in the fashion of the light actinides

    International Nuclear Information System (INIS)

    Koelling, D.D.

    1984-01-01

    Researchers familiar with the light actinides easily recognize in cerium compounds a microcosm of the rich variety of properties seen in the light actinides. The parallelism seen between comparable cerium and actinide compounds strongly suggests that the same physical models are applicable. The most significant is the relative size of the f-orbital. Localization is generally tighter in Ce compounds than uranium compounds, making Ce roughly analogous to Np through Am. A way to see the actinide parallelism is to compare Hill plots. Compounds in the different regions of the plots (representing different physics) are isostructural compounds with the same companion (B) elements. The most common materials exhibiting a direct f-f interaction are the cubic Laves compounds. Accordingly, we have determined the band structures of CeRu 2 , CeRh 2 , CeIr 2 , CeOs 2 , and CeNi 2 . Compounds illustrative of the interaction of f-orbitals with ligand orbitals are the Cu 3 Au structured materials. Materials calculated in this class are CeRh 3 , CePd 3 , and CeSn 3 - the materials of much interest as mixed valent. Although the focus is on the Ce compounds, calculations performed on uranium isomorphs are used to highlight the interesting physics

  10. 9 CFR 3.134-3.135 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  11. Far infrared properties of PbTe doped with cerium

    International Nuclear Information System (INIS)

    Nikolic, P.M.; Koenig, W.; Vujatovic, S.S.; Blagojevic, V.; Lukovic, D.; Savic, S.; Radulovic, K.; Urosevic, D.; Nikolic, M.V.

    2007-01-01

    Single crystal samples of lead telluride doped with cerium were made using the Bridgman method. Far infrared reflectivity spectra in the temperature range from 10 to 300 K are presented. The experimental data were numerically analyzed using a fitting procedure based on the plasmon-phonon interaction model and optical parameters were determined. Two additional local modes were observed at about 138 and 337 cm -1 . The origin of these local vibrational impurity modes was discussed

  12. 22 CFR 134.30 - Payment of award.

    Science.gov (United States)

    2010-04-01

    ... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...

  13. Kinetic and spectroscopic characterization of the E134A- and E134D-altered dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase from Haemophilus influenzae.

    Science.gov (United States)

    Davis, Ryan; Bienvenue, David; Swierczek, Sabina I; Gilner, Danuta M; Rajagopal, Lakshman; Bennett, Brian; Holz, Richard C

    2006-03-01

    Glutamate-134 (E134) is proposed to act as the general acid/base during the hydrolysis reaction catalyzed by the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase (DapE) from Haemophilus influenzae. To date, no direct evidence has been reported for the role of E134 during catalytic turnover by DapE. In order to elucidate the catalytic role of E134, altered DapE enzymes were prepared in which E134 was substituted with an alanine and an aspartate residue. The Michaelis constant (K (m)) does not change upon substitution with aspartate but the rate of the reaction changes drastically in the following order: glutamate (100% activity), aspartate (0.09%), and alanine (0%). Examination of the pH dependence of the kinetic constants k (cat) and K (m) for E134D-DapE revealed ionizations at pH 6.4, 7.4, and approximately 9.7. Isothermal titration calorimetry experiments revealed a significant weakening in metal K (d) values of E134D-DapE. D134 and A134 perturb the second divalent metal binding site significantly more than the first, but both altered enzymes can still bind two divalent metal ions. Structural perturbations of the dinuclear active site of DapE were also examined for two E134-substituted forms, namely E134D-DapE and E134A-DapE, by UV-vis and electron paramagnetic resonance (EPR) spectroscopy. UV-vis spectroscopy of Co(II)-substituted E134D-DapE and E134A-DapE did not reveal any significant changes in the electronic absorption spectra, suggesting that both Co(II) ions in E134D-DapE and E134A-DapE reside in distorted trigonal bipyramidal coordination geometries. EPR spectra of [Co_(E134D-DapE)] and [Co_(E1341A-DapE] are similar to those observed for [CoCo(DapE)] and somewhat similar to the spectrum of [Co(H(2)O)(6)](2+) which typically exhibit E/D values of approximately 0.1. Computer simulation returned an axial g-tensor with g ((x,y))=2.24 and E/D=0.07; g ( z ) was only poorly determined, but was estimated as 2.5-2.6. Upon the addition of a second Co

  14. Selective anodic dissolution of cerium from aluminium alloys under potentiostatic conditions

    International Nuclear Information System (INIS)

    Gol'dshtejn, S.L.; Raspopin, S.P.; Seleznev, V.D.; Tunin, A.V.; Fedorov, V.A.

    1975-01-01

    A study was made of selective anodic dissolution of aluminum alloys containing cerium in concentrations from 0.5 to 10% by mass. The electropurification was carried out with the aid of a potentiostatic setup at 700 deg C in atmosphere of purified argon. Liquid aluminum served as the cathode, with chlorine half-cell as reference electrode and the melt of equimolar KCl-NaCl mixture as the electrolyte. The ''current-time'' plots are presented for selective ionization of cerium from aluminum alloys at preset potential values on the installation. For PHIsub(preset)=-2.04 v the current of potentiostatic electrolysis fades out to that of the supporting electrolyte, and the process itself proceeds at a rate that provides maximal extraction of cerium from the alloy (csub9finite)approximately equal to 0.002% by mass) at minimal ionization of the metalsolvent (Δ Msub(Al)approximately equal to 0.2). Alloys containing not less then 1% by mass of Ce exhibit a characteristic abrupt change of the attenuation coefficient apparently owing to nonlinear dependence of unbalance (ΔE) of signals at the input of the potentiostat. The ''ΔE-c'' function for Al alloy containing 0.5% by mass of Ce can be approximated by linear function. In this case the current of potentiostatic electrolysis approaches the value of the limiting diffusion current. To obtain the relationship between the magnitude of the limiting current of Ce ionization and the initial composition of the dissolving alloy, measurements were made under potentiodynamic conditions at a scanning rate of approximately equal to 500 mv/min. The results indicate that isub(intermediate) is directly proportional to csub(initial). It was shown that under the conditions employed, practically complete (csub(finite)<=0.004% by mass) extraction of the electronegative component is possible without noticeable ionization of the metal-solvent

  15. Influence of annealing on texture properties of cerium oxide thin films

    International Nuclear Information System (INIS)

    Arunkumar, P.; Suresh Babu, K.; Ramaseshan, R.; Dash, S.

    2013-01-01

    Future power demand needs an energy source with higher efficiency, better power density, clean energy and fuel flexibility. Solid oxide fuel cell (SOFC) is one of the potential sources for future needs. Though the polymer and direct methanol based electrolyte are much suitable, for versatile applications (portable devices) they are having major challenges such as design, platinum based catalyst, lower power density and fuel flexibility (free from hydrocarbons). However, in SOFC the high operating temperature is the only major issue. Operating temperature of SOFC could be reduced by proper selection of electrolyte material which should have minimum ionic conductivity of 0.1 Scm -1 at reduced activation energy. This can be achieved by thin film based doped cerium oxide electrolyte for SOFC, leads to Intermediate Temperature Solid Oxide Fuel Cell (ITSOFC). In the present work, we focus on the synthesis of cerium oxide and 20 mol % samarium doped cerium oxide (SDC) nanoparticles by co-precipitation method and to synthesis thin films of the same. Pellets of those powders were heat treated at different temperatures and used as targets for e-beam evaporation to fabricate thin film based electrolyte. Stoichiometry of both powders and thin films were confirmed by XRF and EPMA. GIXRD profiles of ceria and SDC thin films are shown below and a preferred orientation effect is observed in SDC films. In SDC films the X-ray peaks have a shift towards lower angles, due to the difference in ionic radii of Ce 4+ and Sm 3+ . The band gap of CeO 2 (2.88 eV) from optical absorption technique indicates the presence of Ce 3+ with Ce 4+ , indirectly shows the concentration of oxygen vacancies which is required for the thin film electrolyte

  16. Energy transfer and thermal studies of Pr 3+ doped cerium oxalate ...

    Indian Academy of Sciences (India)

    The analysis of energy level diagrams of cerium and praseodymium ions indicates that the energy gap between the sensitizer and the activator ions varies in a small range suggesting a possible energy transfer from the Ce3+ to Pr3+. The emission and absorption spectra of these crystals were recorded. The overlapping of ...

  17. Nanoceria and bulk cerium oxide effects on the germination of asplenium adiantum-nigrum spores

    Directory of Open Access Journals (Sweden)

    Aranzazu Gomez-Garay

    2016-12-01

    Full Text Available Aim of study: The effect of cerium oxide engineered nanoparticles on the spore germination of the fern. Asplenium adiantum-nigrum. Area of study: France, Britanny Region, Finistére Department, Plougonvelin, in rocks near the sea. Material and methods: Asplenium spores were cultured in vitro on agar medium with Nano-CeO2 (less than 25 nm particle size and bulk-CeO2. The addition of each nano- and bulk particles ranged from 0 to 3000 mg L-1. Observations on rhizoidal and prothallial cells during first stages of gametophyte development were made. The No-Observed-Adverse-Effect concentration (NOAEC and Lowest-Observed-Adverse-Effect-Concentration (LOEC values for spore germination rate data were analyzed.  Main results: Germination was speeded up by 100 to 2000 mg L-1 nanoceria, while bulk cerium oxide had the same effect for 500 to 200 mg L-1 concentrations. Present results showed cellular damage in the protonema while rhizoid cells seemed not to be affected, as growth and membrane integrity remained. Research highlights: Both nanosized and bulk cerium oxide are toxic for the fern Asplenium adiantum-nigrum, although diverse toxicity patterns were shown for both materials. Diverse toxic effects have been observed: chloroplast membrane damage and lysis, cell wall and membrane disruption which leads to cell lysis; and alterations in morphology and development. Keywords: Nanoparticles; rhizoid; prothallus; chloroplast; fern.

  18. Nanoceria and bulk cerium oxide effects on the germination of asplenium adiantum-nigrum spores

    Energy Technology Data Exchange (ETDEWEB)

    Gomez-Garay, A.; Pintos, B.; Manzanera, J.A.; Prada, C.; Martin, L.; Gabriel y Galan, J.M.

    2016-07-01

    Aim of the study: The effect of cerium oxide engineered nanoparticles on the spore germination of the fern. Asplenium adiantum-nigrum. Area of study: France, Britanny Region, Finistére Department, Plougonvelin, in rocks near the sea. Material and methods: Asplenium spores were cultured in vitro on agar medium with Nano-CeO2 (less than 25 nm particle size) and bulk-CeO2. The addition of each nano- and bulk particles ranged from 0 to 3000 mg L-1. Observations on rhizoidal and prothallial cells during first stages of gametophyte development were made. The No-Observed-Adverse-Effect concentration (NOAEC) and Lowest-Observed-Adverse-Effect-Concentration (LOEC) values for spore germination rate data were analyzed. Main results: Germination was speeded up by 100 to 2000 mg L-1 nanoceria, while bulk cerium oxide had the same effect for 500 to 200 mg L-1 concentrations. Present results showed cellular damage in the protonema while rhizoid cells seemed not to be affected, as growth and membrane integrity remained. Research highlights: Both nanosized and bulk cerium oxide are toxic for the fern Asplenium adiantum-nigrum, although diverse toxicity patterns were shown for both materials. Diverse toxic effects have been observed: chloroplast membrane damage and lysis, cell wall and membrane disruption which leads to cell lysis; and alterations in morphology and development. (Author)

  19. Density-functional theory for f-electron systems. The α-γ phase transition in cerium

    International Nuclear Information System (INIS)

    Casadei, Marco

    2013-01-01

    Rare earths are technologically important and scientifically highly interesting elements. The description of the volume collapse exhibited by some rare earth metals poses a great challenge to density-functional theory (DFT) since local/semi-local functionals (LDA/GGA) only partially capture the associated phase transitions. In this work this problem is approached by treating all electrons at the same quantum mechanical level, using both hybrid functionals (e.g. PBE0 and HSE06) and exact-exchange plus correlation in the random-phase approximation (EX+cRPA). The performance of recently developed beyond RPA schemes is also assessed. The isostructural α-γ phase transition in cerium is the most studied. The exact exchange contribution in PBE0 and HSE06 is crucial to produce two distinct solutions that can be associated with the α and γ phases. The two solutions emerge in bulk as well as in cluster calculations. Most notable is their presence in the cerium dimer. However, quantitative agreement with the extrapolated phase diagram requires EX+cRPA. So far the EX+cRPA correction can only be applied to cerium clusters and not to the bulk. A cluster of 19 atoms cut from the fcc crystal structure (the same that characterizes the α and γ phases) was therefore determined as representative. (EX+cRPA) rate at PBE0 for Ce 19 provides good agreement with the extrapolated transition pressure to zero temperature. We predict that a pressure induced phase transition should exist at or close to zero. A finite temperature phase diagram can be drawn in reasonable agreement with experiment by adding entropic effects. The cerium neighbors are also studied: lanthanum, which has no f electrons, praseodymium, with three f electrons and a volume collapse, and neodymium, with four f electrons and no volume collapse. Multiple solutions are also present for these f electron elements, confirming the importance of exact-exchange for f electron systems.

  20. Cerium sorption in grounds modified by anti-deflation treatment

    International Nuclear Information System (INIS)

    Firsova, L.P.; Bogatyrev, I.O.

    2001-01-01

    Influence of soils and grounds treatment by anti-deflation compositions on the size of the soil particles was studied. Under static conditions sorption of 144 Ce by turf-podsolic soils prior to an after their modification by the anti-deflation reagents, i.e. bitumens and insoluble in water polyelectrolytic complexes, was considered. Degrees of 144 Ce sorption in the soil-solution systems, depending on solutions pH, presence of alkali metal carbonates and cerium concentration, were determined [ru

  1. Far infrared properties of PbTe doped with cerium

    Energy Technology Data Exchange (ETDEWEB)

    Nikolic, P.M. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia)]. E-mail: nikolic@sanu.ac.yu; Koenig, W. [Max Planck Institut fuer Festkoerperforschung, Heisenbergstrasse 1, 7000 Stuttgart 80 (Germany); Vujatovic, S.S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Blagojevic, V. [Faculty of Electronic Engineering, University of Belgrade, Bulevar Kralja Aleksandra 73, 11000 Belgrade (Serbia); Lukovic, D. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Savic, S. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Radulovic, K. [Institute of Technical Sciences SASA, Knez Mihailova 35/IV, 11000 Belgrade (Serbia); Urosevic, D. [Mathematical Institute SASA, Knez Mihailova 35/I, 11000 Belgrade (Serbia); Nikolic, M.V. [Center for Multidisciplinary Studies of the University of Belgrade, Kneza Viseslava 1, Belgrade (Serbia)

    2007-05-16

    Single crystal samples of lead telluride doped with cerium were made using the Bridgman method. Far infrared reflectivity spectra in the temperature range from 10 to 300 K are presented. The experimental data were numerically analyzed using a fitting procedure based on the plasmon-phonon interaction model and optical parameters were determined. Two additional local modes were observed at about 138 and 337 cm{sup -1}. The origin of these local vibrational impurity modes was discussed.

  2. Transient Increased Calcium and Calcitriol Requirements After Discontinuation of Human Synthetic Parathyroid Hormone 1-34 (hPTH 1-34) Replacement Therapy in Hypoparathyroidism.

    Science.gov (United States)

    Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T

    2015-11-01

    Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry

  3. Cerium oxide nanoparticles stimulate proliferation of primary mouse embryonic fibroblasts in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Popov, Anton L., E-mail: antonpopovleonid@gmail.com [Institute of Theoretical and Experimental Biophysics, Russian Academy of Sciences, Pushchino, Moscow region (Russian Federation); Popova, Nelly R. [Institute of Theoretical and Experimental Biophysics, Russian Academy of Sciences, Pushchino, Moscow region (Russian Federation); Selezneva, Irina I. [Institute of Theoretical and Experimental Biophysics, Russian Academy of Sciences, Pushchino, Moscow region (Russian Federation); Pushchino State Institute of Natural sciences, Pushchino, Moscow region (Russian Federation); Akkizov, Azamat Y. [Kabardino-Balkarian State University, Nalchik (Russian Federation); Ivanov, Vladimir K. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); National Research Tomsk State University, Tomsk (Russian Federation)

    2016-11-01

    The increasing application of cell therapy technologies in the treatment of various diseases requires the development of new effective methods for culturing primary cells. The major limitation for the efficient use of autologous cell material is the low rate of cell proliferation. Successful cell therapy requires sufficient amounts of cell material over a short period of time with the preservation of their differentiation and proliferative potential. In this regard, the development of novel, highly efficient stimulators of proliferative activity in stem cells is a truly urgent task. In this paper we have demonstrated that citrate-stabilized cerium oxide nanoparticles (nanoceria) enhance the proliferative activity of primary mouse embryonic fibroblasts in vitro. Cerium oxide nanoparticles stimulate cell proliferation in a wide range of concentrations (10{sup −3} M–10{sup −9} M) through reduction of intracellular levels of reactive oxygen species (ROS) during the lag phase of cell growth and by modulating the expression level of the major antioxidant enzymes. We found the optimal concentration of nanoceria, which provides the greatest acceleration of cell proliferation in vitro, while maintaining the levels of intracellular ROS and mRNA of antioxidant enzymes in the physiological range. Our results confirm that nanocrystalline ceria can be considered as a basis for effective and inexpensive supplements in cell culturing. - Highlights: • Citrate-stabilized cerium oxide nanoparticles are shown to stimulate proliferation of primary embryonic cells in vitro. • Some of mechanisms involved in stimulating of the proliferation by CeO{sub 2} have been uncovered. • The most effective (optimal) concentration of CeO{sub 2} nanoparticles for stimulation of proliferation was determined.

  4. Further results on cerium fluoride crystals

    International Nuclear Information System (INIS)

    Anderson, S.; Auffray, E.; Aziz, T.; Baccaro, S.; Banerjee, S.; Bareyre, P.; Barone, L.E.; Borgia, B.; Boutet, D.; Burq, J.P.; Chemarin, M.; Chipaux, R.; Dafinei, I.; D'Atanasio, P.; De Notaristefani, F.; Dezillie, B.; Dujardin, C.; Dutta, S.; Faure, J.L.; Fay, J.; Ferrere, D.; Francescangeli, O.; Fuchs, B.A.; Ganguli, S.N.; Gillespie, G.; Goyot, M.; Gupta, S.K.; Gurtu, A.; Heck, J.; Herve, A.; Hillemanns, H.; Holdener, F.; Ille, B.; Joensson, L.; Kierstead, J.; Krenz, W.; Kway, W.; Le Goff, J.M.; Lebeau, M.; Lebrun, P.; Lecoq, P.; Lemoigne, Y.; Loomis, G.; Lubelsmeyer, K.; Madjar, N.; Majni, G.; El Mamouni, H.; Mangla, S.; Mares, J.A.; Martin, J.P.; Mattioli, M.; Mauger, G.J.; Mazumdar, K.; Mengucci, P.; Merlo, J.P.; Moine, B.; Nikl, N.; Pansart, J.P.; Pedrini, C.; Poinsignon, J.; Polak, K.; Raghavan, R.; Rebourgeard, P.; Rinaldi, D.; Rosa, J.; Rosowsky, A.; Sahuc, P.; Samsonov, V.; Sarkar, S.; Schegelski, V.; Schmitz, D.; Schneegans, M.; Seliverstov, D.; Stoll, S.; Sudhakar, K.; Svensson, A.; Tonwar, S.C.; Topa, V.; Vialle, J.P.; Vivargent, M.; Wallraff, W.; Weber, M.J.; Winter, N.; Woody, C.; Wuest, C.R.; Yanovski, V.

    1993-01-01

    A systematic investigation of the properties of cerium fluoride monocrystals has been performed by the 'Crystal Clear' collaboration in view of a possible use of such crystals for the construction of high precision electromagnetic calorimeters for the future generation of high luminosity accelerators. A large sample of different crystals grown by several producers has been studied. The spectroscopic characteristics, the transmission, luminescence and excitation spectra and the decay time curves are analysed. The light yield of the different crystals is measured with photomultipliers and Si photodiodes and compared to reference standards like BGO and NaI(Tl). The radiation damage behaviour is then presented for γ and neutron irradiations, at different doses and dose rates, including thermal and optical bleaching. (orig.)

  5. Cerium and yttrium oxide nanoparticles are neuroprotective

    International Nuclear Information System (INIS)

    Schubert, David; Dargusch, Richard; Raitano, Joan; Chan, S.-W.

    2006-01-01

    The responses of cells exposed to nanoparticles have been studied with regard to toxicity, but very little attention has been paid to the possibility that some types of particles can protect cells from various forms of lethal stress. It is shown here that nanoparticles composed of cerium oxide or yttrium oxide protect nerve cells from oxidative stress and that the neuroprotection is independent of particle size. The ceria and yttria nanoparticles act as direct antioxidants to limit the amount of reactive oxygen species required to kill the cells. It follows that this group of nanoparticles could be used to modulate oxidative stress in biological systems

  6. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav

    2016-01-01

    Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016

  7. Effect of Thickness on the Morphology and Corrosion Behavior of Cerium-Based Conversion Coatings on AZ31B Magnesium Alloy

    Science.gov (United States)

    Castano, Carlos E.; Maddela, Surender; O'Keefe, Matthew J.; Wang, Yar-Ming

    Cerium-based conversion coatings (CeCCs) were deposited onto AZ31B magnesium alloy substrates using a spontaneous reaction of CeCl3, H2O2 and gelatin in a water-based solution. The coating thickness was adjusted by controlling the immersion time in the deposition solution. Prior to deposition, the AZ31B substrates were treated using an acid pickling in nitric acid and then an alkaline cleaning in sodium metasilicate pentahydrate. After deposition, the coated samples were immersed in a phosphate bath that converted cerium oxide/hydroxide into cerium phosphate. Electrochemical impedance spectroscopy, potentiodynamic polarization and neutral salt spray testing studies indicated that 100 nm thick CeCC had better corrosion performance than 400 nm coatings. Characterization of the CeCCs by transmission electron microscopy (TEM) revealed a three layer structure with different compositions.

  8. The R-134a energy efficiency problem

    International Nuclear Information System (INIS)

    Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.

    1990-01-01

    This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12

  9. Cerium compounds in the fashion of the light actinides

    International Nuclear Information System (INIS)

    Koelling, D.D.

    1985-01-01

    Researchers familiar with the light actinides easily recognize in cerium compounds a microcosm of the rich variety of properties seen in the light actinides. The parallelism seen between comparable cerium and actinide compounds strongly suggests that the same physical models are applicable. The most significant is the relative size of the f-orbital. Localization is generally tighter in Ce compounds than uranium compounds, making Ce roughly analogous to Np through Am. A way to see the actinide parallelism is to compare Hill plots. Compounds in the different regions of the plots (representing different physics) are isostructural compounds with the same companion (B) elements. The most common materials expected to exhibit direct f-f interaction are the cubic Laves compounds. Accordingly, we have determined the band structures of CeRu 2 , CeRh 2 , CeIr 2 , and CeNi 2 . Surprisingly, it was found that an f-d interaction overshadows any direct f-f interaction in these systems. Compounds illustrative of the interaction of f-orbitals with ''ligand'' orbitals are the Cu 3 Au structured materials. Materials calculated in this class are CeRh 3 , CePd 3 , and CeSn 3 - the materials of much interest as ''mixed valent''. Although the focus is on the Ce compounds, calculations performed on uranium isomorphs are used to highlight the interesting physics. (orig.)

  10. Effect of cerium additive and secondary phase analysis on Ag0.5Bi0 ...

    Indian Academy of Sciences (India)

    Technical University of Madrid (UPM), Madrid 28012, Spain. MS received 27 ... XRD analysis showed the presence of pyrochlore structure and secondary phase when more .... The present work reports the effect of incorporation of cerium in ...

  11. A glassy carbon electrode modified with cerium phosphate nanotubes for the simultaneous determination of hydroquinone, catechol and resorcinol.

    Science.gov (United States)

    Li, Zhen; Yue, Yuhua; Hao, Yanjun; Feng, Shun; Zhou, Xianli

    2018-03-12

    A nafion film containing cerium phosphate nanotubes was pasted onto a glassy carbon electrode (GCE) to obtain a sensor for hydroquinone (HQ). The morphologies and components of the coating were characterized by transmission electron microscopy, scanning electron microscopy and energy-dispersive spectroscopy. Cyclic voltammetry and differential pulse voltammetry (DPV) showed the specific surface of the electrode to be significantly increased and the electron transfer rate to be accelerated. The modified GCE was applied to the determination of hydroquinone (HQ) via DPV. The oxidation current increases linearly in the 0.23 μM to 16 mM HQ concentration range which is as wide as five orders of magnitude. The limit of detection is 0.12 μM (based on a signal-to-noise ratio of 3), and the sensitivity is 1.41 μA·μM -1  cm -2 . The method was further applied to the simultaneous determination of HQ, catechol and resorcinol. The potentials for the three species are well separated (20, 134, and 572 mV vs SCE). Average recoveries from (spiked) real water samples are between 95.2 and 107.0%, with relative standard deviations of 0.9~2.7% (for n = 3) at three spiking levels. The method was validated by independent assays using HPLC. Graphical abstract ᅟ.

  12. 41 CFR 105-53.134 - Office of Administration.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...

  13. Separation of uranium(V I) from binary solution mixtures with thorium(IV), zirconium(IV) and cerium(III) by foaming

    International Nuclear Information System (INIS)

    Shakir, K.; Aziz, M.; Benyamin, K.

    1992-01-01

    Foam separation has been investigated for the removal of uranium(V I), thorium(IV), zirconium(IV) and cerium(III) from dilute aqueous solutions at pH values ranging from about I to about II. Sodium laurel sulphate (Na L S) and acetyl trimethyl ammonium bromide (CTAB), being a strong anionic and a strong cationic surfactants, were used as collectors. The results indicate that Na L S can efficiently remove thorium(IV), zirconium(IV) and cerium(III) but not uranium(V I). CTAB, on the other hand, can successfully float only uranium(V I) and zirconium(IV). These differences in flotation properties of the different cations could be used to establish methods for the separation of uranium(V I) from binary mixtures with thorium(IV), zirconium(IV) or cerium(III). The results are discussed in terms of the hydrolytic behaviour of the tested cations and properties of used collectors.2 fig., 1 tab

  14. Direct and indirect contamination of tree crops with Cs-134

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.

    1996-01-01

    A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)

  15. Sodium nitrate-cerium nitrate-water ternary system at 25 deg C

    International Nuclear Information System (INIS)

    Fedorenko, T.P.; Onishchenko, M.K.

    1978-01-01

    Solubility isotherm of sodium nitrate-cerium nitrate-water system at 25 deg C consists of three crystallization branches of initial salts and double compound of the composition 2NaNO 3 xCe(NO 3 ) 3 x2H 2 O. Sodium nitrate introduced in the solution strengthens complexing. Physico-chemical characteristics are in a good agreement with solubility curve

  16. Effects of ethylenediaminetetraacetic acid (EDTA)and diethylenetriaminepentaacetic acid (DTPA) derivatives on penetration of ytterbium-169 and cerium-144 into the rat offspring

    Energy Technology Data Exchange (ETDEWEB)

    Baltrukiewicz, Z; Burakowski, T; Derecki, J [Wojskowy Inst. Higieny i Epidemiologii, Warsaw (Poland)

    1976-01-01

    Penetration of radioactive ytterbum-169 and cerium-144 into fetuses was determined at the end of pregnancy and penetration into the organism of suckling rats was studied during feeding with the milk of exposed mothers when EDTA or DTPA derivatives were being administered. Injection of ytterbum-169 as a complex with EDTA or DTPA or injection of Na/sub 2/Ca EDTA or Na/sub 3/Ca DTPA 1h after administration of cerium-144 to mothers reduced penetration of both radionuclides into offsprings in relation to the animals receiving no complex compounds. It was observed that the action of DTPA was stronger than that of EDTA. Passage of ytterbium with milk and across the placenta was greater than the passage of cerium.

  17. 42 CFR 84.134 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

  18. Unusual kinetics of poly(ethylene glycol) oxidation with cerium(IV) ions in sulfuric acid medium and implications for copolymer synthesis.

    Science.gov (United States)

    Szymański, Jan K; Temprano-Coleto, Fernando; Pérez-Mercader, Juan

    2015-03-14

    The cerium(IV)-alcohol couple in an acidic medium is an example of a redox system capable of initiating free radical polymerization. When the alcohol has a polymeric nature, the outcome of such a process is a block copolymer, a member of a class of compounds possessing many useful properties. The most common polymer with a terminal -OH group is poly(ethylene glycol) (PEG); however, the detailed mechanism of its reaction with cerium(IV) remains underexplored. In this paper, we report our findings for this reaction based on spectrophotometric measurements and kinetic modeling. We find that both the reaction order and the net rate constant for the oxidation process depend strongly on the nature of the acidic medium used. In order to account for the experimental observations, we postulate that protonation of PEG decreases its affinity for some of the cerium(IV)-sulfate complexes formed in the system.

  19. Cerium(III-Selective Membrane Electrode Based on Dibenzo-24-crown-8 as a Neutral Carrier

    Directory of Open Access Journals (Sweden)

    Susheel K. Mittal

    2010-01-01

    Full Text Available Cerium(III-selective membrane electrodes have been prepared using dibenzo-24-crown-8 (DB24C8 as an electroactive material. A membrane having a composition: DB24C8 (4.5%, plasticizer (NPOE, 62.5% and PVC (33% gives the best performance. It works well over a wide Ce(III ion-concentration range of 1x10-5 M to 1x10-1 M with a Nernstian slope of 19.0 mV/decade and a detection limit of 3x10-5 M. It has a fast response time of 20 seconds and has an average lifetime of four months. The internal solution concentration does not have a significant effect on the response of the electrode except for a change in intercept of the calibration curves. The working pH range for Ce(III solutions (1x10-2 M and 1x10-3 M is 3.5-8.0. The proposed sensor shows a good selectivity for cerium(III with respect to alkali, alkaline earth, some transition and rare earth metal ions that are normally present along with cerium in its ores. The proposed sensor was investigated in partially non-aqueous media using acetone, methanol and DMSO mixtures with water. The electrode was further used as an indicator electrode for the potentiometric titration of Ce(III solution against oxalic acid solution.

  20. Cerium intermetallics CeTX. Review III

    Energy Technology Data Exchange (ETDEWEB)

    Poettgen, Rainer; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ., Pessac (France). Inst. de Chimie de la Matiere Condensee de Bordeaux

    2016-05-01

    The structure-property relationships of CeTX intermetallics with structures other than the ZrNiAl and TiNiSi type are systematically reviewed. These CeTX phases form with electron-poor and electron-rich transition metals (T) and X = Mg, Zn, Cd, Hg, Al, Ga, In, Tl, Si, Ge, Sn, Pb, P, As, Sb, and Bi. The review focusses on the crystal chemistry, the chemical bonding peculiarities, and the magnetic and transport properties. Furthermore {sup 119}Sn Moessbauer spectroscopic data, high-pressure studies, hydrogenation reactions and the formation of solid solutions are reviewed. This paper is the third of a series of four reviews on equiatomic intermetallic cerium compound [Part I: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 289; Part II: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 695].

  1. 134Cs emission probabilities determination by gamma spectrometry

    Science.gov (United States)

    de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.

    2018-03-01

    The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).

  2. 40 CFR 86.134-96 - Running loss test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...

  3. Mixed mode and sequential oscillations in the cerium-bromate-4-aminophenol photoreaction

    Energy Technology Data Exchange (ETDEWEB)

    Bell, Jeffrey G.; Wang Jichang [Department of Chemistry and Biochemistry, University of Windsor, Windsor, Ontario N9B 3P4 (Canada)

    2013-09-15

    Cerium was introduced to the bromate-aminophenol photochemical oscillator to implement coupled autocatalytic feedbacks. Mixed mode and sequential oscillations emerged in the studied system, making it one of the few chemical oscillators known to support consecutive bifurcations in a batch system. The complex reaction behavior showed a strong dependence on the intensity of illumination supplied to the system. Removal of illumination during an oscillatory window affected both the frequency and amplitude of the oscillation but did not fully extinguish them, indicating that the cerium-bromate-4-aminophenol oscillator was photosensitive rather than photo-controlled. A moderate light intensity allowed for a slow evolution of the system, which proved to be critical for the emergence of transient complex oscillations. Variation of individual reaction parameters was carried out, which indicated that the development of complex oscillations occur in a narrow region and a phase diagram in the 4-aminophenol and sulfuric acid plane demonstrated this. Simulations provide strong support that transient complex oscillations observed experimentally arise from the coupling of two autocatalytic cycles.

  4. Microstructure and electrochemical behavior of cerium conversion coating modified with silane agent on magnesium substrates

    Energy Technology Data Exchange (ETDEWEB)

    Lei, Li; Shi, Jing, E-mail: shijing@ouc.edu.cn; Wang, Xin, E-mail: wangxin.hd@163.com; Liu, Dan; Xu, Haigang

    2016-07-15

    Graphical abstract: The unmodified coating shows averaged static water contact angles of a little more than 50º, which is clearly hydrophilic for water solutions. With the silane concentration increases, the water contact angles show an increase tendency. Especially, when the silane addition is increased to 25 ml L-1, the coating surface presents a hydrophobic feature, with static water contact angle of more than 110º. - Highlights: • BTESPT modification can effectively improve the uniformity, hydrophobic performance, chemical stability and corrosion inhibition capability of traditional cerium conversion coating. • Si-O-Si linkage builds a robust structure to increase of the coating density. Si−O−Mg bonds strengthen the adhesion between the coating/substrate. • The system modified with 25 ml L{sup −1} BTESPT displays the optimum corrosion protection performance. - Abstract: The cerium conversion coating with and without different concentrations of silane agent bis-(γ-triethoxysilylpropyl)-tetrasulfide (BTESPT) modification is obtained on magnesium alloys. Detailed properties of the coatings and the role of BTESPT as an additive are studied and followed with careful discussion. The coating morphology, wettability, chemical composition and corrosion resistance are characterized by scanning electronic microscope (SEM), water contact-angle, X-ray photoelectron spectroscopy (XPS), potentiodynamic measurements and electrochemical impedance spectroscopy (EIS). The electrochemical behavior of the coatings is investigated using EIS. The results indicate that the coating morphology and composition can be controlled by changing silane concentration. The combination of cerium ions and silane molecules could promote the formation of more homogenous and higher hydrophobic coating. The coating turns to be more compact and the adhesive strength between the coating and the magnesium substrate are strongly improved with the formation of Si−O−Si and Si

  5. Microstructure and electrochemical behavior of cerium conversion coating modified with silane agent on magnesium substrates

    International Nuclear Information System (INIS)

    Lei, Li; Shi, Jing; Wang, Xin; Liu, Dan; Xu, Haigang

    2016-01-01

    Graphical abstract: The unmodified coating shows averaged static water contact angles of a little more than 50º, which is clearly hydrophilic for water solutions. With the silane concentration increases, the water contact angles show an increase tendency. Especially, when the silane addition is increased to 25 ml L-1, the coating surface presents a hydrophobic feature, with static water contact angle of more than 110º. - Highlights: • BTESPT modification can effectively improve the uniformity, hydrophobic performance, chemical stability and corrosion inhibition capability of traditional cerium conversion coating. • Si-O-Si linkage builds a robust structure to increase of the coating density. Si−O−Mg bonds strengthen the adhesion between the coating/substrate. • The system modified with 25 ml L"−"1 BTESPT displays the optimum corrosion protection performance. - Abstract: The cerium conversion coating with and without different concentrations of silane agent bis-(γ-triethoxysilylpropyl)-tetrasulfide (BTESPT) modification is obtained on magnesium alloys. Detailed properties of the coatings and the role of BTESPT as an additive are studied and followed with careful discussion. The coating morphology, wettability, chemical composition and corrosion resistance are characterized by scanning electronic microscope (SEM), water contact-angle, X-ray photoelectron spectroscopy (XPS), potentiodynamic measurements and electrochemical impedance spectroscopy (EIS). The electrochemical behavior of the coatings is investigated using EIS. The results indicate that the coating morphology and composition can be controlled by changing silane concentration. The combination of cerium ions and silane molecules could promote the formation of more homogenous and higher hydrophobic coating. The coating turns to be more compact and the adhesive strength between the coating and the magnesium substrate are strongly improved with the formation of Si−O−Si and Si−O−M chemical

  6. Sorption studies of radionuclides on a modified mesoporous cerium(IV) silicate

    International Nuclear Information System (INIS)

    Sepehrian, H.; Tarbiat Moallem University, Tehran; Ghannadi-Maragheh, M.; Yavari, R.; Khanchi, A.R.; Waqif-Husain, S.

    2008-01-01

    Five different samples of a new sorbent, modified mesoporous cerium(IV) silicate have been prepared with various mole ratios of Si/Ce and Cetyltrimethylammonium bromide (CTMABr) as template. XRD, nitrogen sorption, SEM, IR, thermogravimetry and sorption of radionuclides have been studied. Separation of Hg(II)-Th(IV), Hg(II)-Zr(IV) and Rb(I)-Zr(IV) have been developed on columns of this novel sorbent. (author)

  7. Investigation of R-134a as a modeling fluid for supercritical water

    International Nuclear Information System (INIS)

    Jouvin, J.C.; Pioro, I.

    2014-01-01

    The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)

  8. MicroRNA-134 regulates poliovirus replication by IRES targeting

    OpenAIRE

    Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.

    2017-01-01

    Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...

  9. Atomic layer deposition of cerium oxide for potential use in diesel soot combustion

    Energy Technology Data Exchange (ETDEWEB)

    Ivanova, Tatiana V., E-mail: tatiana.ivanova@lut.fi, E-mail: ivanova.tatyana.v@gmail.com; Toivonen, Jenni; Maydannik, Philipp S.; Kääriäinen, Tommi; Sillanpää, Mika [ASTRaL Team, Laboratory of Green Chemistry, School of Engineering Science, Lappeenranta University of Technology, Sammonkatu 12, FI-50130 Mikkeli (Finland); Homola, Tomáš; Cameron, David C. [R& D Centre for Low-Cost Plasma and Nanotechnology Surface Modification, Masaryk University, Kotlářská 267/2, 611 37 Brno (Czech Republic)

    2016-05-15

    The particulate soot emission from diesel motors has a severe impact on the environment and people's health. The use of catalytic convertors is one of the ways to minimize the emission and decrease the hazard level. In this paper, the activity of cerium oxide for catalytic combustion of diesel soot was studied. Thin films of cerium dioxide were synthesized by atomic layer deposition using tetrakis(2,2,6,6-tetramethyl-3,5-heptanedionato)cerium [Ce(thd){sub 4}] and ozone as precursors. The characteristics of the films were studied as a function of deposition conditions within the reaction temperature range of 180–350 °C. Thickness, crystallinity, elemental composition, and morphology of the CeO{sub 2} films deposited on Si (100) were characterized by ellipsometry, x-ray diffraction, x-ray photoelectron spectroscopy, atomic force microscopy, and field emission scanning electron microscopy, respectively. The growth rate of CeO{sub 2} was observed to be 0.30 Å/cycle at temperatures up to 250 °C with a slight increase to 0.37 Å/cycle at 300 °C. The effect of CeO{sub 2} films grown on stainless steel foil supports on soot combustion was measured with annealing tests. Based on the analysis of these, in catalytic applications, CeO{sub 2} has been shown to be effective in lowering the soot combustion temperature from 600 °C for the uncoated substrates to 370 °C for the CeO{sub 2} coated ones. It was found that the higher deposition temperatures had a positive effect on the catalyst performance.

  10. Magnetic and Mössbauer Study of Cerium-Based Reactive Sorbent

    Czech Academy of Sciences Publication Activity Database

    Jirásková, Yvonna; Buršík, Jiří; Životský, O.; Luňáček, J.; Janos, P.

    2017-01-01

    Roč. 131, č. 4 (2017), s. 1096-1098 ISSN 0587-4246. [CSMAG 2016 - Czech and Slovak Conference on Magnetism /16./. Košice, 13.06.2016-17.06.2016] R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Cerium-based sorbent * magnetic properties * phase composition * composite Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.469, year: 2016

  11. Monte Carlo radiative transfer simulation of a cavity solar reactor for the reduction of cerium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Villafan-Vidales, H.I.; Arancibia-Bulnes, C.A.; Dehesa-Carrasco, U. [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n, Col. Centro, A.P. 34, Temixco, Morelos 62580 (Mexico); Romero-Paredes, H. [Departamento de Ingenieria de Procesos e Hidraulica, Universidad Autonoma Metropolitana-Iztapalapa, Av. San Rafael Atlixco No.186, Col. Vicentina, A.P. 55-534, Mexico D.F 09340 (Mexico)

    2009-01-15

    Radiative heat transfer in a solar thermochemical reactor for the thermal reduction of cerium oxide is simulated with the Monte Carlo method. The directional characteristics and the power distribution of the concentrated solar radiation that enters the cavity is obtained by carrying out a Monte Carlo ray tracing of a paraboloidal concentrator. It is considered that the reactor contains a gas/particle suspension directly exposed to concentrated solar radiation. The suspension is treated as a non-isothermal, non-gray, absorbing, emitting, and anisotropically scattering medium. The transport coefficients of the particles are obtained from Mie-scattering theory by using the optical properties of cerium oxide. From the simulations, the aperture radius and the particle concentration were optimized to match the characteristics of the considered concentrator. (author)

  12. 40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...

  13. Extraordinary superconductor with nearly trivalent cerium, CeCu2Si2

    International Nuclear Information System (INIS)

    Ishikawa, M.; Jaccard, D.; Jorda, J.-L.

    1982-01-01

    Concentrating on the ternary phase diagram, the authors have performed a complementary investigation on CeCu 2 Si 2 and confirm that the compound containing nearly trivalent cerium ions is a new type of superconductor with Tsub(c) around 0.5 K. The analyses of the upper critical field curve support the description of the compound by heavy fermion quasiparticles. Other particular features of this compound are also presented. (Auth.)

  14. Some observations concerning the direct titration of nitrite with cerium(IV)

    International Nuclear Information System (INIS)

    Muralikrishna, U.; Subrahmanyam, K.; Suryanarayana, M.V.S.; Krishnamurthy, M.

    1983-01-01

    Direct titration of nitrite with cerium(IV), with ferroin as indicator, is shown to give satisfactory results if the acidity is kept between 0.033 and 0.055 M at the end-point. Loss of nitrous acid owing to volatilization and decomposition is discussed. From 10 to 60 mg of sodium nitrite can be estimated with a standard deviation of 5 μg and an average error of 0.2%. (author)

  15. Phenotypic and genomic responses to titanium dioxide and cerium oxide nanoparticles in Arabidopsis germinants

    Science.gov (United States)

    The effects of exposure to two nanoparticles (NPs) -titanium dioxide (nano-titania) and cerium oxide (nano-ceria) at 500 mg NPs L-1 on gene expression and growth in Arabidopsis thaliana germinants were studied using microarrays and phenotype studies. After 12 days post treatment,...

  16. Electrospun cerium-based TiO2 nanofibers for photocatalytic oxidation of elemental mercury in coal combustion flue gas.

    Science.gov (United States)

    Wang, Lulu; Zhao, Yongchun; Zhang, Junying

    2017-10-01

    Photocatalytic oxidation is an attractive method for Hg-rich flue gas treatment. In the present study, a novel cerium-based TiO 2 nanofibers was prepared and selected as the catalyst to remove mercury in flue gas. Accordingly, physical/chemical properties of those nanofibers were clarified. The effects of some important parameters, such as calcination temperature, cerium dopant content and different illumination conditions on the removal of Hg 0 using the photocatalysis process were investigated. In addition, the removal mechanism of Hg 0 over cerium-based TiO 2 nanofibers focused on UV irradiation was proposed. The results show that catalyst which was calcined at 400 °C exhibited better performance. The addition of 0.3 wt% Ce into TiO 2 led to the highest removal efficiency at 91% under UV irradiation. As-prepared samples showed promising stability for long-term use in the test. However, the photoluminescence intensity of nanofibers incorporating ceria was significantly lower than TiO 2 , which was attributed to better photoelectron-hole separation. Although UV and O 2 are essential factors, the enhancement of Hg 0 removal is more obviously related to the participation of catalyst. The coexistence of Ce 3+ and Ce 4+ , which leads to the efficient oxidation of Hg 0 , was detected on samples. Hg 2+ is the final product in the reaction of Hg 0 removal. As a consequence, the emissions of Hg 0 from flue gas can be significantly suppressed. These indicate that combining photocatalysis technology with cerium-based TiO 2 nanofibers is a promising strategy for reducing Hg 0 efficiently. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells

    Institute of Scientific and Technical Information of China (English)

    ZhuShou-Peng; XiaFen; 等

    1997-01-01

    Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.

  18. Altering properties of cerium oxide thin films by Rh doping

    International Nuclear Information System (INIS)

    Ševčíková, Klára; Nehasil, Václav; Vorokhta, Mykhailo; Haviar, Stanislav; Matolín, Vladimír

    2015-01-01

    Highlights: • Thin films of ceria doped by rhodium deposited by RF magnetron sputtering. • Concentration of rhodium has great impact on properties of Rh–CeO x thin films. • Intensive oxygen migration in films with low concentration of rhodium. • Oxygen migration suppressed in films with high amount of Rh dopants. - Abstract: Ceria containing highly dispersed ions of rhodium is a promising material for catalytic applications. The Rh–CeO x thin films with different concentrations of rhodium were deposited by RF magnetron sputtering and were studied by soft and hard X-ray photoelectron spectroscopies, Temperature programmed reaction and X-ray powder diffraction techniques. The sputtered films consist of rhodium–cerium mixed oxide where cerium exhibits a mixed valency of Ce 4+ and Ce 3+ and rhodium occurs in two oxidation states, Rh 3+ and Rh n+ . We show that the concentration of rhodium has a great influence on the chemical composition, structure and reducibility of the Rh–CeO x thin films. The films with low concentrations of rhodium are polycrystalline, while the films with higher amount of Rh dopants are amorphous. The morphology of the films strongly influences the mobility of oxygen in the material. Therefore, varying the concentration of rhodium in Rh–CeO x thin films leads to preparing materials with different properties

  19. EMISSION REDUCTION FROM A DIESEL ENGINE FUELED BY CERIUM OXIDE NANO-ADDITIVES USING SCR WITH DIFFERENT METAL OXIDES COATED CATALYTIC CONVERTER

    Directory of Open Access Journals (Sweden)

    B. JOTHI THIRUMAL

    2015-11-01

    Full Text Available This paper reports the results of experimental investigations on the influence of the addition of cerium oxide in nanoparticle form on the major physiochemical properties and the performance of diesel. The fuel is modified by dispersing the catalytic nanoparticle by ultrasonic agitation. The physiochemical properties of sole diesel fuel and modified fuel are tested with ASTM standard procedures. The effects of the additive nanoparticles on the individual fuel properties, the engine performance, and emissions are studied, and the dosing level of the additive is optimized. Cerium oxide acts as an oxygen-donating catalyst and provides oxygen for the oxidation of CO during combustion. The active energy of cerium oxide acts to burn off carbon deposits within the engine cylinder at the wall temperature and prevents the deposition of non-polar compounds on the cylinder wall which results in reduction in HC emission by 56.5%. Furthermore, a low-cost metal oxide coated SCR (selective catalyst reduction, using urea as a reducing agent, along with different types of CC (catalytic converter, has been implemented in the exhaust pipe to reduce NOx. It was observed that a reduction in NOx emission is 50–60%. The tests revealed that cerium oxide nanoparticles can be used as an additive in diesel to improve complete combustion of the fuel and reduce the exhaust emissions significantly.

  20. Micromagnetic simulation of the influence of grain boundary on cerium substituted Nd-Fe-B magnets

    Directory of Open Access Journals (Sweden)

    D. Liu

    2017-05-01

    Full Text Available A three-dimensional finite element model was performed to study the magnetization reversal of (CexNd1-x2Fe14B nanocomposite permanent magnets. The influences of volume fraction, width and performance parameters of the grain boundary (GB composition on the coercivity were analyzed by the method of micromagnetic simulation. The calculation results indicate that the structure and chemistry of GB phase play important roles in Nd2Fe14B-based magnets. An abnormal increase in the value of coercivity is found to be connected with the GB phase, approximately when the percentage of doped cerium is between 20% and 30%. While the coercivity decreases directly with the increase in cerium content instead of being abnormal when there is no GB phase in magnets at all or the value of magnetocrystalline anisotropy or exchange integral is too large.

  1. Corrosion of Zn5Al and Zn55Al alloys with cerium, praseodymium and neodymium

    International Nuclear Information System (INIS)

    Alikhanova, S.D.

    2017-01-01

    The present work is devoted to corrosion of Zn5Al and Zn55Al alloys with cerium, praseodymium and neodymium. The purpose of present work is elaboration of optimal composition of zinc-aluminium alloys Zn5Al and Zn55Al alloyed by rare-earth metals of cerium subgroup which are used as anode covers for protection of steel from corrosion. Therefore, the regularities of change of corrosion-electrochemical properties in various corrosive mediums have been determined; processes mechanisms of high temperature oxidation of alloys in solid state have been studied; in the products of alloys oxidation their phase components have been defined and their role in the corrosion process have been revealed; the optimal compositions of zinc-aluminium alloys alloyed by rare earth metals, which are protected by two patents of the Republic of Tajikistan have been elaborated.

  2. Protective effects of Curcuma longa against neurobehavioral and neurochemical damage caused by cerium chloride in mice.

    Science.gov (United States)

    Kadri, Yamina; Nciri, Riadh; Brahmi, Noura; Saidi, Saber; Harrath, Abdel Halim; Alwasel, Saleh; Aldahmash, Waleed; El Feki, Abdelfatteh; Allagui, Mohamed Salah

    2018-05-07

    Cerium chloride (CeCl 3 ) is considered an environmental pollutant and a potent neurotoxic agent. Medicinal plants have many bioactive compounds that provide protection against damage caused by such pollutants. Curcuma longa is a bioactive compound-rich plant with very important antioxidant properties. To study the preventive and healing effects of Curcuma longa on cerium-damaged mouse brains, we intraperitoneally injected cerium chloride (CeCl 3 , 20 mg/kg BW) along with Curcuma longa extract, administrated by gavage (100 mg/kg BW), into mice for 60 days. We then examined mouse behavior, brain tissue damage, and brain oxidative stress parameters. Our results revealed a significant modification in the behavior of the CeCl 3 -treated mice. In addition, CeCl 3 induced a significant increment in lipid peroxidation, carbonyl protein (PCO), and advanced oxidation protein product levels, as well as a significant reduction in superoxide dismutase (SOD) and glutathione peroxidase (GPx) activities. Acetylcholinesterase (AChE) activity remarkably increased in the brain of CeCl 3 -treated mice. Histopathological observations confirmed these results. Curcuma longa attenuated CeCl 3 -induced oxidative stress and increased the activities of antioxidant enzymes. It also decreased AChE activity in the CeCl 3 -damaged mouse brain that was confirmed by histopathology. In conclusion, this study suggests that Curcuma longa has a neuroprotective effect against CeCl 3 -induced damage in the brain.

  3. The study of interaction of lanthanum-, cerium- and neodymium chlorides with sodium borohydride in pyridine- and tetrahydrofuran medium

    International Nuclear Information System (INIS)

    Mirsaidov, U.; Rotenberg, T.G.; Dymova, T.N.

    1976-01-01

    Bis-tetrahydrofurans of lanthanum and neodymium borohydrides and bis-pyridinates of lanthanum, cerium and neodymium borohydrides were obtained by interacting sodium borohydride with lanthanum-, cerium and neodymium chlorides in pyridine and tetrahydrofuran media. All operations involving reagent combination, sampling and phase separation are performed in inert atmosphere using argonvacuum equipment. The reaction in pyridine was virtually instantaneous and accompanied by flocculanet precipitation. The interaction of lanthanum chloride and neodymium chloride with sodium borohydride in tetrahydrofuran (THF) was a slow (23-30 hr) heterophase process. The interaction rate was affected by size reduction of the intial substances, temperature, reagent proportion and mixing rate. The reaction time was twice reduced with boiling tetrahydrofuran

  4. Synthesis and Characterization of Hybrid Silica-Zirconia Coatings with Cerium Inhibitor on Aluminum 6061

    Directory of Open Access Journals (Sweden)

    M. Bahrami

    2016-12-01

    Full Text Available Organic–inorganic hybrid coatings were prepared by sol–gel method and deposited on aluminum alloy 6061. Attenuated Total Reflectance-Fourier Transform Infrared (ATR-FTIR spectroscopy and Scanning Electron Microscopy (SEM were used for structural study of the hybrid coatings. Adhesive strength of sol–gel coatings to the substrate was evaluated quantitatively and qualitatively. Corrosion behavior of the samples was studied by cyclic potentiodynamic and linear polarization tests. Results showed that adhesion strength of the coatings to the substrates was increased with increasing tetrapropoxide of zirconium (TPOZ and cerium content. Corrosion tests showed that corrosion current density of coated samples were decreased three to seven orders of magnitude in comparison with uncoated aluminum alloy 6061. Decreasing in corrosion current density and increasing in polarization resistance was observed by increasing zirconia and cerium content. Unlike the uncoated aluminum alloy 6061, the crack-free coatings did not show pitting tendency. 

  5. Effect of cerium (IV) ions on the anticorrosion properties of siloxane-poly(methyl methacrylate) based film applied on tin coated steel

    Energy Technology Data Exchange (ETDEWEB)

    Suegama, P.H. [Departamento de Engenharia Quimica, Escola Politecnica, Universidade de Sao Paulo, CP 61548, 05424-970 Sao Paulo, SP (Brazil); Sarmento, V.H.V. [Departamento Fisico-Quimica, Instituto de Quimica, Universidade Estadual Paulista, UNESP, CP 355, 14801-970 Araraquara, SP (Brazil); Montemor, M.F. [ICEMS, Instituto Superior Tecnico, Technical University of Lisbon, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Benedetti, A.V. [Departamento Fisico-Quimica, Instituto de Quimica, Universidade Estadual Paulista, UNESP, CP 355, 14801-970 Araraquara, SP (Brazil); de Melo, H.G.; Aoki, I.V. [Departamento de Engenharia Quimica, Escola Politecnica, Universidade de Sao Paulo, CP 61548, 05424-970 Sao Paulo, SP (Brazil); Santilli, C.V., E-mail: santilli@iq.unesp.b [Departamento Fisico-Quimica, Instituto de Quimica, Universidade Estadual Paulista, UNESP, CP 355, 14801-970 Araraquara, SP (Brazil)

    2010-07-15

    This work investigates the influence of the addition of cerium (IV) ions on the anticorrosion properties of organic-inorganic hybrid coatings applied to passivated tin coated steel. In order to evaluate the specific effect of cerium (IV) addition on nanostructural features of the organic and inorganic phases of the hybrid coating, the hydrolytic polycondensation of silicon alkoxide and the radical polymerization of the methyl methacrylate (MMA) function were induced separately. The corrosion resistance of the coatings was evaluated by means of linear polarization, Tafel type curves and electrochemical impedance measurements. The impedance results obtained for the hybrid coatings were discussed based on an electrical equivalent circuit used to fit the experimental data. The electrochemical results clearly showed the improvement of the protective properties of the organic-inorganic hybrid coating mainly when the cerium (IV) was added to the organic phase solution precursor, which seemed to be due to the formation of a more uniform and densely reticulated siloxane-PMMA film.

  6. Effect of cerium (IV) ions on the anticorrosion properties of siloxane-poly(methyl methacrylate) based film applied on tin coated steel

    International Nuclear Information System (INIS)

    Suegama, P.H.; Sarmento, V.H.V.; Montemor, M.F.; Benedetti, A.V.; de Melo, H.G.; Aoki, I.V.; Santilli, C.V.

    2010-01-01

    This work investigates the influence of the addition of cerium (IV) ions on the anticorrosion properties of organic-inorganic hybrid coatings applied to passivated tin coated steel. In order to evaluate the specific effect of cerium (IV) addition on nanostructural features of the organic and inorganic phases of the hybrid coating, the hydrolytic polycondensation of silicon alkoxide and the radical polymerization of the methyl methacrylate (MMA) function were induced separately. The corrosion resistance of the coatings was evaluated by means of linear polarization, Tafel type curves and electrochemical impedance measurements. The impedance results obtained for the hybrid coatings were discussed based on an electrical equivalent circuit used to fit the experimental data. The electrochemical results clearly showed the improvement of the protective properties of the organic-inorganic hybrid coating mainly when the cerium (IV) was added to the organic phase solution precursor, which seemed to be due to the formation of a more uniform and densely reticulated siloxane-PMMA film.

  7. 134Cs in heather seed plants grown with and without mycorrhiza

    International Nuclear Information System (INIS)

    Strandberg, M.; Johansson, M.

    1988-01-01

    Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

  8. Study on recovering directly the commercial cerium oxide and total of residue rare earths from Dongpao bastnasite concentrate

    International Nuclear Information System (INIS)

    Nguyen Trong Hung; Nguyen Thanh Chung; Luu Xuan Dinh

    2003-01-01

    A technology for decomposition roasting and sequential leaching processes of Dong Pao bastnasite concentrate to recover directly commercial cerium oxide and total of residue rare earth elements from the leaching solution of the roasted product have been investigated. The bastnasite concentrate is initially roasted at temperature range of 600 - 650 degC and for time of 4 hrs in order to decompose and convert the hardly soluble carbonate forms of ore into easily soluble oxide. The roasted solid is then leached with sulfuric acid solution of 6N at 60 degC for 4 hrs to convert rare earths in oxide and fluoride form into rare earth sulfate. The recovery yield of rare earths of these stages is more than 95%. The attention has especially been paid on recovering directly the commercial cerium oxide and total of residue rare earth element from the above leaching solution. Complex ions of CeSO 4 2+ , Ce(SO 4 ) 2 , Ce(SO 4 ) 3 2- and Ce(SO 4 ) 4 4- exist in aqueous solution of cerium (IV) sulfate. Based on the property, the method of ion - sieve with DOWEX cation resin column has been applied to estimating separation of the ceric complex anions from Ln(III). The survey showed that most of the ceric complex anions are separated from total of residue rare earths. The latter which are absorbed in the cation column are recovered by elution of HCl of 4N. The recovery yield of cerium can only be reached 20% but the purity of that is very high, can be reached 99.6%. About 5 kg of CeO 2 of high grade and 5 kg of TREO of commercial specification have been produced. (author)

  9. 19 CFR 134.43 - Methods of marking specific articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...

  10. 13 CFR 134.713 - When is the record closed?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

  11. Tribological characteristics of monodispersed cerium borate nanospheres in biodegradable rapeseed oil lubricant

    Energy Technology Data Exchange (ETDEWEB)

    Boshui, Chen, E-mail: boshuichen@163.com; Kecheng, Gu; Jianhua, Fang; Jiang, Wu; Jiu, Wang; Nan, Zhang

    2015-10-30

    Graphical abstract: - Highlights: • Monodispersed stearic acid-capped cerium borate composite nanoparticles were prepared by hydrothermal method. Their morphologies, element compositions, size distributions, crystal and chemical structures, hydrophobic characteristics were also characterized. • The surface-capped cerium borate nanoparticles exhibited excellent dispersing stability in rapeseed oil. As new lubricating additives, they were also outstanding in enhancing friction-reducing and anti-wear capacities of rapeseed oil in biodegradable rapeseed oil. The results presented in this paper would be of important significance for developing green lubricants and lubricant additives. • The prominent tribological performances of SA/CeBO{sub 3} in rapeseed oil were investigated and attributed to the formation of a composite boundary lubrication film mainly composed of lubricous tribochemical species on the tribo-surfaces. - Abstract: Stearic acid-capped cerium borate composite nanoparticles, abbreviated as SA/CeBO{sub 3}, were prepared by hydrothermal method. The morphologies, element compositions, size distributions, crystal and chemical structures, hydrophobic characteristics, of SA/CeBO{sub 3} were characterized by scanning electron microscope, energy dispersive X-ray spectrometer, dynamic laser particle size analyzer, X-ray diffraction, and Fourier transform infrared spectrometer, respectively. The friction and wear performances of SA/CeBO{sub 3} as a lubricating additive in a rapeseed oil were evaluated on a four-ball tribo-tester. The tribochemical characteristics of the worn surfaces were investigated by X-ray photoelectron spectroscopy. The results showed that the hydrophobic SA/CeBO{sub 3} were monodispersed nanospheres with an average diameter of 8 nm, and exhibited excellent dispersing stability in rapeseed oil. Meanwhile, SA/CeBO{sub 3} nanospheres were outstanding in enhancing friction-reducing and anti-wear capacities of rapeseed oil. The prominent

  12. Cerium(III) pivalate [Ce(Piv)3(HPiv)3]2: synthesis, crystal structure, and thermal stability

    International Nuclear Information System (INIS)

    Khudyakov, M.Yu.; Kuz'mina, N.P.; Pisarevskij, A.P.; Martynenko, L.I.

    2002-01-01

    Complex [Ce(Piv) 3 (HPiv) 3 ] 2 was prepared by precipitation of cerium(III) nitrate aqueous solution with salt NH 4 (Piv) (HPiv = pivalic acid) and subsequent recrystallization from 5% HPiv solution in hexane. According to data of X-ray diffraction analysis and IR spectroscopy crystal structure of the complex is built of centrally symmetric dimers, in which cerium atoms are bound by four bridge pivalate ligands. Thermal analysis suggests that heating of the complex in nitrogen atmosphere results first in splitting off six HPiv molecules in the range of 90-190 deg C and then in thermolysis of Ce(Piv) 3 formed at 290-450 deg C. Sublimation of Ce(Piv) 3 occurs in the range of 290-350 deg C along with thermolysis during heating in vacuum (0.01 mm Hg), which permits preparing CeO 2 films by the method of chemical precipitation from gaseous phase [ru

  13. 19 CFR 134.54 - Articles released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...

  14. miR-134: A Human Cancer Suppressor?

    Directory of Open Access Journals (Sweden)

    Jing-Yu Pan

    2017-03-01

    Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.

  15. Cerium(terbium, erbium)chloride-choline chloride aqueous systems

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Zhuravlev, E.F.; Bikbaeva, G.G.; Domrachev, V.N.; Vanskova, G.I.

    1985-01-01

    To clarify the effect of rare earth nature on mutual solubility of rare earth salts and amines the solubility of solid phases in the systems, consisting of choline chloride, water and cerium, terbium, erbium chlorides, has been studied. It is established, that solubility isotherms of all the systems, testify to the formation of new solid phases of the composition: Ce(Tb, Er)xCl 3 x2C 5 H 14 ONClx3H 2 O. Individuality of new solid phases is proved by DTA method, the composition is confirmed by chemical analysis and data of PMR spectra, for choline chloride and its complexes with rare earth chlorides of the given composition PMR and IR spectra are studied

  16. A phosphate-dependent shift in redox state of cerium oxide nanoparticles and its effects on catalytic properties

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Sanjay; Dosani, Talib; Karakoti, Ajay S.; Kumar, Amit; Seal, Sudipta; Self, William

    2011-10-01

    Cerium oxide nanoparticles (CeNPs) have shown promise as catalytic antioxidants in cell culture and animal models as both superoxide dismutase and catalase mimetics. The reactivity of the cerium (Ce) atoms at the surface of its oxide particle is critical to such therapeutic properties, yet little is known about the potential for a protein or small molecule corona to form on these materials in vivo. Moreover Ce atoms in these active sites have the potential to interact with small molecule anions, peptides, or sugars when administered in culture or animal models. Several nanomaterials have been shown to alter or aggregate under these conditions, rendering them less useful for biomedical applications. In this work we have studied the change in catalytic properties of CeNPs when exposed to various biologically relevant conditions in vitro. We have found that CeNPs are resistant to broad changes in pH and also not altered by incubation in cell culture medium. However to our surprise phosphate anions significantly altered the characteristics of these nanomaterials and shifted the catalytic behavior due to the binding of phosphate anions to cerium. Given the abundance of phosphate in biological systems in an inorganic form, it is likely that the action of CeNPs as a catalyst may be strongly influenced by the local concentration of phosphate in the cells and/or tissues in which it has been introduced.

  17. Defect states and room temperature ferromagnetism in cerium oxide nanopowders prepared by decomposition of Ce-propionate

    DEFF Research Database (Denmark)

    Mihalache, V.; Grivel, J. C.; Secu, M.

    2018-01-01

    . An improvement of ferromagnetism and intensity of defect-related PL emission was observed when annealing the products in which nanocrystalline cerium oxide coexists with Ce - oxicarbonate traces, Ce2O2CO3. The experimental results were explained based on the following considerations: room temperature......Four batches of cerium oxide powders (with nanocrystallite size of 6.9 nm–572 nm) were prepared from four precursor nanopowders by thermal decomposition of Ce-propionate and annealing in air between 250 °C–1200 °C for 10 min–240 min. Ceria formation reactions, structure, vibrational, luminescence...... and magnetic properties were investigated by differential scanning calorimetry, x-ray diffraction, electron microscopy, infrared spectroscopy, photoluminescence and SQUID. All the samples exhibit room temperature ferromagnetism, RTFM, (with coercivity, Hc, of 8 Oe - 121 Oe and saturation magnetization, Ms...

  18. Corrosion behaviour of nanometre sized cerium oxide and titanium oxide incorporated aluminium in NaCl solution

    International Nuclear Information System (INIS)

    Ashraf, P. Muhamed; Edwin, Leela

    2013-01-01

    Highlights: ► Corrosion resistant aluminium incorporated with nano oxides of cerium and titanium. ► 0.2% nano CeO 2 and 0.05% nano TiO 2 showed increased corrosion resistance. ► Nano TiO 2 concentration influenced the optimum performance of the material. ► Comparison of Micro and nano CeO 2 and TiO 2 aluminium showed the latter is best. - Abstract: The study highlights the development of an aluminium matrix composite by incorporating mixture of nanometre sized cerium oxide and titanium oxide in pure aluminium and its corrosion resistance in marine environment. The mixed nanometre sized oxides incorporated aluminium exhibited improved microstructure and excellent corrosion resistance. Corrosion resistance depends on the concentration of nanometre sized titanium oxide. Electrochemical characteristics improved several folds in nanometre sized mixed oxides incorporated aluminium than micrometre sized oxides incorporated aluminium.

  19. {sup 134}Cs emission probabilities determination by gamma spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2017-07-01

    The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)

  20. Electric dipole transitions for four-times ionized cerium (Ce V)

    Energy Technology Data Exchange (ETDEWEB)

    Usta, Betül Karaçoban, E-mail: bkaracoban@sakarya.edu.tr; Akgün, Elif, E-mail: elif.akgun@ogr.sakarya.edu.tr; Alparslan, Büşra, E-mail: busra.alparslan1@ogr.sakarya.edu.tr [Physics Department, Sakarya University, 54187, Sakarya (Turkey)

    2016-03-25

    We have calculated the transition parameters, such as wavelengths, oscillator strengths, and transition probabilities (or rates), for the electric dipole (E1) transitions in four-times ionized cerium (Ce V, Z = 58) by using the multiconfiguration Hartree-Fock method within the framework of Breit-Pauli (MCHF+BP) relativistic corrections and the relativistic Hartree-Fock (HFR) method. The obtained results have been compared with other works available in literature. A discussion of these calculations for Ce V in this study has also been in view of the MCHF+BP and HFR methods.

  1. Construction of 1,3,4-Oxadiazole and 1,3,4-Thiadiazole Library with a High Level of Skeletal Diversity Based on Branching Diversity-Oriented Synthesis on Solid-Phase Supports.

    Science.gov (United States)

    Ha, Ji-Eun; Yang, Seung-Ju; Gong, Young-Dae

    2018-02-12

    An efficient solid-phase synthetic route for the construction of 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries based on branching diversity-oriented synthesis (DOS) has been developed in this study. The core skeleton resins, 1,3,4-oxadiazole and 1,3,4-thiadiazole, were obtained through desulfurative and dehydrative cyclizations of thiosemicarbazide resin, respectively. Various functional groups have been introduced to the core skeleton resins, such as aryl, amine, amide, urea, thiourea, and an amino acid. Most of the libraries were purified by simple trituration without extraction or column chromatography after cleavage of the products from the solid-supported resin. As a result, we obtained high yields of pure 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives (total numbers = 128). Finally, we confirmed the drug-like properties of our library by calculation of physicochemical properties, displays of the skeletal diversities of the library in 3D-space, and occupation of a broad range of areas by their functional groups.

  2. Identification of the lines in the L emission spectrum of cerium and samarium

    International Nuclear Information System (INIS)

    Shrivastava, B.D.; Singh, D.

    1992-01-01

    The occurrence of a line at 2.1556 A in the L emission spectrum of cerium and two lines at 1.6679 and 1.8379 A in the L emission spectrum of samarium, reported many years ago, has remained a puzzle. These have now been identified as EXAFS minima occurring at the L absorption edges of the respective elements. (author)

  3. 24 CFR 17.134 - Procedures for salary offset: when deductions may begin.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...

  4. Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)

    Science.gov (United States)

    Demore, W. B.

    1993-01-01

    Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.

  5. Brain suppression of AP-1 by inhaled diesel exhaust and reversal by cerium oxide nanoparticles

    NARCIS (Netherlands)

    Lung, Shyang; Cassee, Flemming R; Gosens, Ilse; Campbell, Arezoo

    One of the uses of cerium oxide nanoparticles (nanoceria, CeO2) is as a diesel fuel additive to improve fuel efficiency. Gene/environment interactions are important determinants in the etiology of age-related disorders. Thus, it is possible that individuals on high-fat diet and genetic

  6. Gene-expression changes in cerium chloride-induced injury of mouse hippocampus.

    Directory of Open Access Journals (Sweden)

    Zhe Cheng

    Full Text Available Cerium is widely used in many aspects of modern society, including agriculture, industry and medicine. It has been demonstrated to enter the ecological environment, is then transferred to humans through food chains, and causes toxic actions in several organs including the brain of animals. However, the neurotoxic molecular mechanisms are not clearly understood. In this study, mice were exposed to 0.5, 1, and 2 mg/kg BW cerium chloride (CeCl(3 for 90 consecutive days, and their learning and memory ability as well as hippocampal gene expression profile were investigated. Our findings suggested that exposure to CeCl(3 led to hippocampal lesions, apoptosis, oxidative stress and impairment of spatial recognition memory. Furthermore, microarray data showed marked alterations in the expression of 154 genes involved in learning and memory, immunity and inflammation, signal transduction, apoptosis and response to stress in the 2 mg/kg CeCl(3 exposed hippocampi. Specifically, the significant up-regulation of Axud1, Cdc37, and Ube2v1 caused severe apoptosis, and great suppression of Adcy8, Fos, and Slc5a7 expression led to impairment of mouse cognitive ability. Therefore, Axud1, Cdc37, Ube2v1, Adcy8, Fos, and Slc5a7 may be potential biomarkers of hippocampal toxicity caused by CeCl3 exposure.

  7. Synthesis of cerium oxide catalysts supported on MCM-41 molecular sieve; Sintese de catalisadores de oxido de cerio suportados na peneira molecular MCM-41

    Energy Technology Data Exchange (ETDEWEB)

    Souza, E.L.S.; Barros, T.R.B.; Sousa, B.V. de, E-mail: emylle.souza@gmail.com [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academica de Engenharia Quimica

    2016-07-01

    Porous materials have been widely studied as catalysts and catalyst support. The MCM-41 structure is the one that has been most studied because of its application possibilities in chemical processes. This work aimed to obtain and characterize cerium oxide catalysts supported on MCM-41 molecular sieve. The molecular sieve was synthesized by the conventional method with the following molar composition: 1 SiO2: 0.30 CTABr: NH3 11: 144 H2O. Then, 25% w/w cerium was incorporated into the MCM-41 using the wet impregnation process and the material obtained was activated by calcination. From the XRD patterns was confirmed the structure of the molecular sieve, and were identified the cerium oxide phases in its structure. The textural catalysts characteristics were investigated by isotherms of N2 adsorption/desorption (BET method). (author)

  8. Assessing Covalency in Cerium and Uranium Hexachlorides: A Correlated Wavefunction and Density Functional Theory Study

    Directory of Open Access Journals (Sweden)

    Reece Beekmeyer

    2015-11-01

    Full Text Available The electronic structure of a series of uranium and cerium hexachlorides in a variety of oxidation states was evaluated at both the correlated wavefunction and density functional (DFT levels of theory. Following recent experimental observations of covalency in tetravalent cerium hexachlorides, bonding character was studied using topological and integrated analysis based on the quantum theory of atoms in molecules (QTAIM. This analysis revealed that M–Cl covalency was strongly dependent on oxidation state, with greater covalency found in higher oxidation state complexes. Comparison of M–Cl delocalisation indices revealed a discrepancy between correlated wavefunction and DFT-derived values. Decomposition of these delocalisation indices demonstrated that the origin of this discrepancy lay in ungerade contributions associated with the f-manifold which we suggest is due to self-interaction error inherent to DFT-based methods. By all measures used in this study, extremely similar levels of covalency between complexes of U and Ce in the same oxidation state was found.

  9. 13 CFR 134.405 - Jurisdiction.

    Science.gov (United States)

    2010-01-01

    ... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...

  10. Long range ordered alloys modified by addition of niobium and cerium

    International Nuclear Information System (INIS)

    Liu, C.T.

    1987-01-01

    A long range ordered alloy composition is described consisting essentially of iron, nickel, cobalt, vanadium and a ductility enhancing metal, having the nominal composition (Fe, Ni,Co)/sub 3/(V,M) where M is the ductility enhancing metal selected from the group Ti, Zr, Hf and mixtures thereof. Effective amounts of creep property enhance elements selected from the group cerium, niobium and mixtures thereof sufficient to enhance creep properties in the resulting alloy without adversely affecting the fabrication of the alloy

  11. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice

    International Nuclear Information System (INIS)

    Cassee, Flemming R.; Campbell, Arezoo; Boere, A. John F.; McLean, Steven G.; Duffin, Rodger; Krystek, Petra; Gosens, Ilse; Miller, Mark R.

    2012-01-01

    Background: Cerium oxide (CeO 2 ) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Methods: Atherosclerosis-prone apolipoprotein E knockout (ApoE −/− ) mice were exposed by inhalation to diluted exhaust (1.7 mg/m 3 , 20, 60 or 180 min, 5 day/week, for 4 weeks), from an engine using standard diesel fuel (DE) or the same diesel fuel containing 9 ppm cerium oxide nanoparticles (DCeE). Changes in hematological indices, clinical chemistry, atherosclerotic burden, tissue levels of inflammatory cytokines and pathology of the major organs were assessed. Results: Addition of CeO 2 to fuel resulted in a reduction of the number (30%) and surface area (10%) of the particles in the exhaust, whereas the gaseous co-pollutants were increased (6–8%). There was, however, a trend towards an increased size and complexity of the atherosclerotic plaques following DE exposure, which was not evident in the DCeE group. There were no clear signs of altered hematological or pathological changes induced by either treatment. However, levels of proinflammatory cytokines were modulated in a brain region and liver following DCeE exposure. Conclusions: These results imply that addition of CeO 2 nanoparticles to fuel decreases the number of particles in exhaust and may reduce atherosclerotic burden associated with exposure to standard diesel fuel. From the extensive assessment of biological parameters performed, the only concerning effect of cerium addition was a slightly raised level of cytokines in a region of the central nervous system. Overall, the use of cerium as a fuel additive may be a potentially useful way to limit the health effects of vehicle exhaust. However, further testing is required to ensure that such an approach is not associated with a chronic inflammatory response which may eventually cause long-term health effects.

  12. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice

    Energy Technology Data Exchange (ETDEWEB)

    Cassee, Flemming R., E-mail: flemming.cassee@rivm.nl [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); Campbell, Arezoo, E-mail: acampbell@westernu.edu [Western University of Health Sciences, Pomona, CA (United States); Boere, A. John F., E-mail: john.boere@rivm.nl [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); McLean, Steven G., E-mail: smclean1@staffmail.ed.ac.uk [BHF/University Centre for Cardiovascular Sciences, University of Edinburgh, Edinburgh (United Kingdom); Duffin, Rodger, E-mail: Rodger.Duffin@ed.ac.uk [MRC Centre for Inflammation Research, University of Edinburgh, Edinburgh (United Kingdom); Krystek, Petra, E-mail: petra.krystek@philips.com [Philips Innovation Services, Eindhoven (Netherlands); Gosens, Ilse, E-mail: Ilse.gosens@rivm.nl [National Institute for Public Health and the Environment, PO box 1, 3720 BA Bilthoven (Netherlands); Miller, Mark R., E-mail: Mark.Miller@ed.ac.uk [BHF/University Centre for Cardiovascular Sciences, University of Edinburgh, Edinburgh (United Kingdom)

    2012-05-15

    Background: Cerium oxide (CeO{sub 2}) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Methods: Atherosclerosis-prone apolipoprotein E knockout (ApoE{sup -/-}) mice were exposed by inhalation to diluted exhaust (1.7 mg/m{sup 3}, 20, 60 or 180 min, 5 day/week, for 4 weeks), from an engine using standard diesel fuel (DE) or the same diesel fuel containing 9 ppm cerium oxide nanoparticles (DCeE). Changes in hematological indices, clinical chemistry, atherosclerotic burden, tissue levels of inflammatory cytokines and pathology of the major organs were assessed. Results: Addition of CeO{sub 2} to fuel resulted in a reduction of the number (30%) and surface area (10%) of the particles in the exhaust, whereas the gaseous co-pollutants were increased (6-8%). There was, however, a trend towards an increased size and complexity of the atherosclerotic plaques following DE exposure, which was not evident in the DCeE group. There were no clear signs of altered hematological or pathological changes induced by either treatment. However, levels of proinflammatory cytokines were modulated in a brain region and liver following DCeE exposure. Conclusions: These results imply that addition of CeO{sub 2} nanoparticles to fuel decreases the number of particles in exhaust and may reduce atherosclerotic burden associated with exposure to standard diesel fuel. From the extensive assessment of biological parameters performed, the only concerning effect of cerium addition was a slightly raised level of cytokines in a region of the central nervous system. Overall, the use of cerium as a fuel additive may be a potentially useful way to limit the health effects of vehicle exhaust. However, further testing is required to ensure that such an approach is not associated with a chronic inflammatory response which may eventually cause long-term health effects.

  13. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice.

    Science.gov (United States)

    Cassee, Flemming R; Campbell, Arezoo; Boere, A John F; McLean, Steven G; Duffin, Rodger; Krystek, Petra; Gosens, Ilse; Miller, Mark R

    2012-05-01

    Cerium oxide (CeO(2)) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Atherosclerosis-prone apolipoprotein E knockout (ApoE(-/-)) mice were exposed by inhalation to diluted exhaust (1.7 mg/m(3), 20, 60 or 180 min, 5 day/week, for 4 weeks), from an engine using standard diesel fuel (DE) or the same diesel fuel containing 9 ppm cerium oxide nanoparticles (DCeE). Changes in hematological indices, clinical chemistry, atherosclerotic burden, tissue levels of inflammatory cytokines and pathology of the major organs were assessed. Addition of CeO(2) to fuel resulted in a reduction of the number (30%) and surface area (10%) of the particles in the exhaust, whereas the gaseous co-pollutants were increased (6-8%). There was, however, a trend towards an increased size and complexity of the atherosclerotic plaques following DE exposure, which was not evident in the DCeE group. There were no clear signs of altered hematological or pathological changes induced by either treatment. However, levels of proinflammatory cytokines were modulated in a brain region and liver following DCeE exposure. These results imply that addition of CeO(2) nanoparticles to fuel decreases the number of particles in exhaust and may reduce atherosclerotic burden associated with exposure to standard diesel fuel. From the extensive assessment of biological parameters performed, the only concerning effect of cerium addition was a slightly raised level of cytokines in a region of the central nervous system. Overall, the use of cerium as a fuel additive may be a potentially useful way to limit the health effects of vehicle exhaust. However, further testing is required to ensure that such an approach is not associated with a chronic inflammatory response which may eventually cause long-term health effects. Copyright © 2012 Elsevier Inc. All rights reserved.

  14. Development of electrolytic process in molten salt media for light rare-earth metals production. The metallic cerium electrodeposition

    International Nuclear Information System (INIS)

    Restivo, T.A.G.

    1994-01-01

    The development of molten salt process and the respective equipment aiming rare-earth metals recovery was described. In the present case, the liquid cerium metal electrodeposition in a molten electrolytes of cerium chloride and an equimolar mixture of sodium and potassium chlorides in temperatures near 800 C was studied. Due the high chemical reactivity of the rare-earth metals in the liquid state and their molten halides, an electrolytic cell was constructed with controlled atmosphere, graphite crucibles and anodes and a tungsten cathode. The electrolytic process variables and characteristics were evaluated upon the current efficiency and metallic product purity. Based on this evaluations, were suggested some alterations on the electrolytic reactor design and upon the process parameters. (author). 90 refs, 37 figs, 20 tabs

  15. Yttrium and lanthanum recovery from low cerium carbonate, yttrium carbonate and yttrium concentrate

    International Nuclear Information System (INIS)

    Vasconcelos, Mari Estela de

    2006-01-01

    In this work, separation, enrichment and purification of lanthanum and yttrium were performed using as raw material a commercial low cerium rare earth concentrate named LCC (low cerium carbonate), an yttrium concentrate named 'yttrium carbonate', and a third concentrated known as 'yttrium earths oxide. The first two were industrially produced by the late NUCLEMON - NUCLEBRAS de Monazita e Associados Ltda, using Brazilian monazite. The 'yttrium earths oxide' come from a process for preparation of lanthanum during the course of the experimental work for the present thesis. The following techniques were used: fractional precipitation with urea; fractional leaching of the LCC using ammonium carbonate; precipitation of rare earth peroxycarbonates starting from the rare earth complex carbonates. Once prepared the enriched rare earth fractions the same were refined using the ion exchange chromatography with strong cationic resin without the use of retention ion and elution using the ammonium salt of ethylenediaminetetraacetic acid. With the association of the above mentioned techniques were obtained pure oxides of yttrium (>97,7%), lanthanum (99,9%), gadolinium (96,6%) and samarium (99,9%). The process here developed has technical and economic viability for the installation of a large scale unity. (author)

  16. Synergistic properties of graphitic carbon nitride/cerium molybdate nanocomposites for enhanced photocatalytic activity

    Science.gov (United States)

    Bhargava, V. S.; Singh, Gajendar; Sharma, Manu

    2018-05-01

    A polymeric semiconductor (g-C3N4), based nanocomposites have been achieved much attention due to its excellent thermal, chemical stability and suitable band positions for water splitting. g-C3N4 based nanocomposites show good performance in the field of photocatalysis, sensors, Li-ion batteries, supercapacitors and water purification technology. In this work, a series of novel g-C3N4/CeM nano composites were synthesized using a facile one-step ultra-sonication method. X-ray diffraction (XRD) pattern confirms the formation of g-C3N4 and cerium molybdate. The photocatalytic activity of nanocomposites indicated the substantial degradation of Methylene Blue (MB) dye up to 97% over the surface of g-C3N4/CeM under visible light illumination. All the g-C3N4/CeM composites possess higher photocatalytic activity than pure cerium molybdate. The proposed mechanism demonstrated that the different weight ratios of photocatalyst were most likely attributed to a synergistic effect between g-C3N4 and CeM. This approach is very simple, cost effective, and free from any surfactant that makes it valuable catalyst for various future applications.

  17. Thermally stimulated iron oxide transformations and magnetic behaviour of cerium dioxide/iron oxide reactive sorbents

    Czech Academy of Sciences Publication Activity Database

    Luňáček, J.; Životský, O.; Jirásková, Yvonna; Buršík, Jiří; Janoš, P.

    2016-01-01

    Roč. 120, OCT (2016), s. 295-303 ISSN 1044-5803 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Oxide -nano-composites * Mössbauer spectroscopy * TEM * Cerium oxide * Magnetic parameters Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.714, year: 2016

  18. Using EIS to analyse samples of Al-Mg alloy AA5083 treated by thermal activation in cerium salt baths

    International Nuclear Information System (INIS)

    Bethencourt, M.; Botana, F.J.; Cano, M.J.; Marcos, M.; Sanchez-Amaya, J.M.; Gonzalez-Rovira, L.

    2008-01-01

    This paper describes a study undertaken of the morphological and anticorrosive characteristics of surface layers formed on the Al-Mg alloy AA5083 from solutions of Ce(III), by means of various heat treatments while immersed in baths of cerium salts. SEM/EDS studies have demonstrated the existence of a heterogeneous layer formed by a film of aluminium oxide/hydroxide on the matrix and a series of dispersed islands of cerium deposited on the cathodic intermetallics. With the object of evaluating the degree of protection provided by the layers formed and of characterising the particular contribution of the electrochemical response of the system in NaCl, the results obtained by means of EIS are presented and discussed

  19. 13 CFR 134.407 - Evidence beyond the record and discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...

  20. Nanoporous cerium oxide thin film for glucose biosensor.

    Science.gov (United States)

    Saha, Shibu; Arya, Sunil K; Singh, S P; Sreenivas, K; Malhotra, B D; Gupta, Vinay

    2009-03-15

    Nanoporous cerium oxide (CeO(2)) thin film deposited onto platinum (Pt) coated glass plate using pulsed laser deposition (PLD) has been utilized for immobilization of glucose oxidase (GOx). Atomic force microscopy studies reveal the formation of nanoporous surface morphology of CeO(2) thin film. Response studies carried out using differential pulsed voltammetry (DPV) and optical measurements show that the GOx/CeO(2)/Pt bio-electrode shows linearity in the range of 25-300 mg/dl of glucose concentration. The low value of Michaelis-Menten constant (1.01 mM) indicates enhanced enzyme affinity of GOx to glucose. The observed results show promising application of the nanoporous CeO(2) thin film for glucose sensing application without any surface functionalization or mediator.

  1. Chemical and structural analyses of subsurface crevices formed during spontaneous deposition of cerium-based conversion coatings

    Energy Technology Data Exchange (ETDEWEB)

    Heller, Daimon K, E-mail: dkheller@mmm.com; Fahrenholtz, William G., E-mail: billf@mst.edu; O' Keefe, Matthew J., E-mail: mjokeefe@mst.edu

    2011-11-15

    Subsurface crevices formed during the deposition of cerium-based conversion coatings were analyzed in cross-section to assess the effect of deposition and post-treatment on the structure and chemistry of phases present. An Al-O containing phase, believed to be amorphous Al(OH){sub 3}, was formed in crevices during coating deposition. Analysis by energy dispersive X-ray spectroscopy revealed the presence of up to 1.6 at.% chlorine within the Al-O phase, which was likely a product of soluble chlorides that were present in the coating solution. Cerium was not detected within crevices. After post-treatment in an 85 deg. C aqueous phosphate solution, the chloride concentration was reduced to {<=} 0.30 at.% and electron diffraction of the Al-O phase produced ring patterns, indicating it had crystallized. Some diffraction patterns could be indexed to gibbsite (Al(OH){sub 3}), but others are believed to be a combination of hydrated aluminum hydroxides and/or oxides. Aluminum phosphate was not identified. Separately from its effect on cerium-based conversion coatings, phosphate post-treatment improved the corrosion resistance of Al 2024-T3 substrates by acting to crystallize Al(OH){sub 3} present on interior surfaces of crevices and by reducing the chloride concentration in this phase. - Highlights: {yields} Analysis of subsurface crevices formed during deposition of Ce-based conversion coatings. {yields} Phosphate post-treatment improved corrosion protection in salt spray testing. {yields} Post-treatment affected the composition and structure of regions within crevices. {yields} Crystallized Al(OH){sub 3} within crevices acted as a more effective barrier to chloride ions.

  2. 13 CFR 134.218 - Judges.

    Science.gov (United States)

    2010-01-01

    ... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...

  3. 32 CFR 13.4 - Duties and responsibilities of the defense.

    Science.gov (United States)

    2010-07-01

    ... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...

  4. 27 CFR 17.134 - Determination of unfitness for beverage purposes.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...

  5. Mechanochemical synthesis and spark plasma sintering of the cerium silicides

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, Gordon A.; Jaques, Brian; Bateman, Allyssa [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Butt, Darryl P., E-mail: darrylbutt@boisestate.edu [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States)

    2014-12-15

    Highlights: • Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−x} and CeSi{sub 2} were mechanochemically synthesized. • Temperature and pressure were monitored to investigate reaction progress. • All syntheses proceeded through a MSR event followed by rapid solid-state diffusion. • Milling time before MSR correlates well with effective heat of formation. • Some synthesized material was densified by spark plasma sintering. - Abstract: The cerium silicides, Ce{sub 5}Si{sub 3}, Ce{sub 3}Si{sub 2}, CeSi, CeSi{sub 2−y}, and CeSi{sub 2−x}, have been prepared from the elements by mechanochemical processing in a planetary ball mill. Preparation of the cerium silicide Ce{sub 5}Si{sub 4} was unsuccessfully attempted and potential reasons for this are discussed. Temperature and pressure of the milling vial were monitored in situ to gain insight into the mechanochemical reaction kinetics, which include a mechanically-induced self-propagating reaction (MSR). Some prepared powders were consolidated by spark plasma sintering to high density. Starting materials, as-milled powders, and consolidated samples were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results obtained help elucidate key questions in mechanochemical processing of intermetallics, showing first phase formation similar to thin films, MSR ignition times that are composition- and milling speed-dependent, and sensitivity of stable compound formation on the impact pressure. The results demonstrate mechanochemical synthesis as a viable technique for rare earth silicides.

  6. Composition shift in liquid-recirculation refrigerating systems: an experimental investigation for the pure fluid R134a and the mixture R32/134a

    Energy Technology Data Exchange (ETDEWEB)

    Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT

    1999-09-01

    The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.

  7. 13 CFR 134.708 - What is the standard of review?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  8. 13 CFR 134.715 - Can a Judge reconsider his decision?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...

  9. A new oxidimetric reagent: potassium dichromate in a strong phosphoric acid medium--VII. Photometric titration of vanadium(IV) and of cerium(III) alone and in mixtures with iroN(II).

    Science.gov (United States)

    Rao, G G; Rao, P K

    1967-01-01

    Vanadium(IV) can be accurately titrated with potassium dichromate in media containing phosphoric acid of 3-12M concentration: the change in absorption of vanadium(IV) is followed in the region 660 mmicro using a red filter. It is more convenient to carry out the titration in 3M phosphoric acid because at higher concentrations chloride, nitrate, cerium(III) and manganese(II) may interfere. Photoelcetric titration is more convenient than potentiometric because the former can be made in a 3M phosphoric acid medium, whereas the latter is possible only in 12M phosphoric acid. The simultaneous differential photometric titration of iron(II) and vanadium(IV) is also possible. Conditions have been found for the photometric titration of cerium(III) and of cerium(III) plus iron(II). The titration is carried out (at 450 mmicro or with a blue filter) in about 10.5M phosphoric acid. Application of the method to a cerium mineral is considered.

  10. {sup 134}Cs in heather seed plants grown with and without mycorrhiza

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)

    1988-08-01

    Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

  11. Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

    International Nuclear Information System (INIS)

    Zhu Cong; Guo Jiangfeng

    2008-01-01

    Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

  12. Absolute transition probabilities for 559 strong lines of neutral cerium

    Energy Technology Data Exchange (ETDEWEB)

    Curry, J J, E-mail: jjcurry@nist.go [National Institute of Standards and Technology, Gaithersburg, MD 20899-8422 (United States)

    2009-07-07

    Absolute radiative transition probabilities are reported for 559 strong lines of neutral cerium covering the wavelength range 340-880 nm. These transition probabilities are obtained by scaling published relative line intensities (Meggers et al 1975 Tables of Spectral Line Intensities (National Bureau of Standards Monograph 145)) with a smaller set of published absolute transition probabilities (Bisson et al 1991 J. Opt. Soc. Am. B 8 1545). All 559 new values are for lines for which transition probabilities have not previously been available. The estimated relative random uncertainty of the new data is +-35% for nearly all lines.

  13. Activity standardization of 134Cs and 137Cs

    International Nuclear Information System (INIS)

    Sochorová, Jana; Auerbach, Pavel

    2014-01-01

    The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed

  14. The effect of post-treatment time and temperature on cerium-based conversion coatings on Al 2024-T3

    Energy Technology Data Exchange (ETDEWEB)

    Heller, Daimon K [Missouri University of Science and Technology, 101 Straumanis Hall, 401 West 16th Street, Rolla, MO 65409 (United States)], E-mail: dkhvwb@mst.edu; Fahrenholtz, William G. [Missouri University of Science and Technology, 101 Straumanis Hall, 401 West 16th Street, Rolla, MO 65409 (United States)], E-mail: billf@mst.edu; O' Keefe, Matthew J. [Missouri University of Science and Technology, 101 Straumanis Hall, 401 West 16th Street, Rolla, MO 65409 (United States)

    2010-02-15

    Corrosion performance, morphology, and electrochemical characteristics of cerium-based conversion coatings on Al 2024-T3 were examined as a function of phosphate post-treatment time and temperature. Corrosion resistance improved after post-treatment in 2.5 wt.% NH{sub 4}H{sub 2}PO{sub 4} for times up to 10 min or temperatures up to 85 deg. C. Electrochemical impedance spectroscopy and polarization testing correlated to neutral salt spray corrosion performance. Hydrated cerium oxide and peroxide species present in the as-deposited coatings were transformed to CePO{sub 4}.H{sub 2}O for post-treatments at longer times and/or higher temperatures. Based on these results, processes active during post-treatment are kinetically dependent and strongly influenced by the post-treatment time and temperature.

  15. Contribution to research on the metabolism of fission product. Studies on the physico-chemical state and the metabolic fate of radio-cerium solution; Contribution a l'etude du metabolisme des produits de fission. Recherches sur l'etat physico-chimique et le devenir metabolique des solutions de radiocerium

    Energy Technology Data Exchange (ETDEWEB)

    Aeberhardt, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1961-07-01

    This paper describes a study of the physico-chemical state of radio-cerium in dilute solutions on the tracer scale, as a function of the pH of the solution. The way in which this radioelement is transported in the blood is studied in vitro and in vivo, with reference to the ionic or colloidal state of the radio-cerium used. The distribution of cerium amongst the various components of the blood is studied by a new method of blood fractionation and by paper electrophoresis. Evidence of a cerium globulin connection is shown in the case of ionic cerium. A study of the initial distribution of radio-cerium in rats, after intravenous administration of ionic or colloidal solutions, shows considerable differences according to the physico-chemical state of the cerium injected. (author) [French] Ce travail presente une etude de l'etat physico-chimique du radiocerium en solutions diluees a l'echelle des indicateurs, en fonction du pH de la solution. En fonction de l'etat ionique ou colloidal du radiocerium utilise, le mode de transport de ce radioelement dans le sang est etudie in vitro et in vivo. La distribution du cerium entre les differents constituants du sang est etudiee par une methode nouvelle de fractionnement du sang et par electrophorese sur papier. L'existence d'une liaison cerium-globuline est mise en evidence dans le cas du cerium ionique. L'etude de la distribution initiale du radiocerium, chez le rat apres administration par voie veineuse de solutions ionique ou colloidale, montre des differences importantes en fonction de l'etat physico-chimique du cerium injecte. (auteur)

  16. Cerium dioxide as a new reactive sorbent for fast degradation of parathion methyl and some other organophosphates

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Kuráň, P.; Kormunda, M.; Štengl, Václav; Matys Grygar, Tomáš; Došek, M.; Šťastný, M.; Ederer, J.; Pilařová, V.; Vrtoch, L.

    2014-01-01

    Roč. 32, č. 4 (2014), s. 360-370 ISSN 1002-0721 Institutional support: RVO:61388980 Keywords : cerium dioxide * carbonate precursor * lanthanides * organophosphate pesticide * parathion methyl * chemical warfare agents Subject RIV: CA - Inorganic Chemistry Impact factor: 1.261, year: 2014

  17. Plant uptake of 134Cs in relation to soil properties and time

    International Nuclear Information System (INIS)

    Massas, I.; Skarlou, V.; Haidouti, C.

    2002-01-01

    134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants

  18. Chemiluminescence behavior based on oxidation reaction of rhodamine B with cerium(IV) in sulfuric acid medium

    International Nuclear Information System (INIS)

    Ma Yongjun; Jin Xiaoyong; Zhou Min; Zhang Ziyu; Teng Xiulan; Chen Hui

    2003-01-01

    The chemiluminescence (CL) of the rhodamine B (RhB)-cerium(IV) system was investigated by flow-injection. Rhodamine B was suggested to be a suitable chemiluminescent reagent in acidic conditions. When the concentration of rhodamine B was 100 mg l -1 and cerium sulfate was 1.6 mmol l -1 in sulfuric acid, the chemiluminescent intensity was found to be highest by using 0.3 mol l -1 sulfuric acid as a carrier solution. The particular chemiluminescent system could tolerate such distinct acidic environments that it was utilized for detecting many compounds that are stable in acidic solutions. Furthermore, by virtue of IR, UV-Vis and luminescence spectroscopic measurements, the chemiluminescent behavior of rhodamine B was studied and a possible mechanism for this chemiluminescent reaction was proposed. The emitter was affirmed to be a radical species due to one of the oxidation products of RhB; the chemiluminescent emissive wavelength was about 425 nm

  19. Chemiluminescence behavior based on oxidation reaction of rhodamine B with cerium(IV) in sulfuric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Ma Yongjun; Jin Xiaoyong; Zhou Min; Zhang Ziyu; Teng Xiulan; Chen Hui

    2003-08-18

    The chemiluminescence (CL) of the rhodamine B (RhB)-cerium(IV) system was investigated by flow-injection. Rhodamine B was suggested to be a suitable chemiluminescent reagent in acidic conditions. When the concentration of rhodamine B was 100 mg l{sup -1} and cerium sulfate was 1.6 mmol l{sup -1} in sulfuric acid, the chemiluminescent intensity was found to be highest by using 0.3 mol l{sup -1} sulfuric acid as a carrier solution. The particular chemiluminescent system could tolerate such distinct acidic environments that it was utilized for detecting many compounds that are stable in acidic solutions. Furthermore, by virtue of IR, UV-Vis and luminescence spectroscopic measurements, the chemiluminescent behavior of rhodamine B was studied and a possible mechanism for this chemiluminescent reaction was proposed. The emitter was affirmed to be a radical species due to one of the oxidation products of RhB; the chemiluminescent emissive wavelength was about 425 nm.

  20. Effect of Pressure on the Ferromagnetic Cerium Compound CeCu9Sn4

    International Nuclear Information System (INIS)

    Ishii, Y.; Mori, N.; Hedo, M.; Uwatoko, Y.

    2003-01-01

    Electrical resistivity measurements under hydrostatic pressure up to 2.2 GPa was carried out for a ferromagnetic ternary cerium compound CeCu 9 Sn 4 . The ferromagnetic transition temperature increases with increasing pressure up to 0.8 GPa and then decreases with increasing pressure above 1 GPa. Origins of this pressure dependence may be the competition between magnetic interaction in the c-plane and along the c-direction. (author)

  1. Ab initio MCHF structural calculations of Mg-like cerium

    Science.gov (United States)

    Wajid, Abdul; Jabeen, S.; Husain, Abid

    2018-05-01

    Energy levels and emission line wavelengths of high-Z materials are useful for impurity diagnostics in the next generation fusion devices. For this here we have calculated E1, M2 transitions, oscillator strengths, and transition probabilities for transitions among the terms belonging to the 2p63s2, 2p63s3p, 2p63p2 and 2p63s3d for the Magnesium like cerium (Ce XLVII) using the GRASP2K package based on the fully relativistic multi-configuration Dirac-Fock method. The electron correlation effects, Breit interaction and quantum electrodynamics effects to the atomic state wave functions and the corresponding energies have been taken into account.

  2. The influence of operational parameters on the performance of an undivided zinc–cerium flow battery

    International Nuclear Information System (INIS)

    Leung, P.K.; Ponce de Leon, C.; Walsh, F.C.

    2012-01-01

    Highlights: ► The performance of an undivided zinc–cerium flow battery under different conditions of temperature, concentration and electrolyte flow rate, was evaluated. ► Mixed electrolytes were considered; methanesulfonate and sulfate anions were tested. ► In a 30 min charge/discharge at 20 mA cm −2 , charge and energy efficiencies were 82% and 72%, respectively. ► After 4 h charge, the conversion of Ce(III) to Ce(IV) became less efficient with the oxygen evolution reaction becoming more favored. ► After a larger number of cycles the carbon felt electrode was electro- and chemically-oxidized by Ce(IV) leading to degradation of the positive electrode. - Abstract: An undivided zinc–cerium redox flow battery was studied under a wide range of operational conditions, including: (i) electrolyte composition; the concentrations of ([Zn 2+ ], [Ce 3+ ] and [H + ]), (ii) current density (0–80 mA cm −2 ), (iii) electrolyte flow linear velocity (0.64–7.0 cm s −1 ) and (iv) temperature (20–60 °C). The charge efficiency increased at higher current densities and at higher electrolyte flow velocities. Unlike the divided zinc–cerium system, the charge–discharge performance decreased at higher temperature, since oxygen evolution became increasingly favored at the positive electrode. The use of a low acid concentration led to a poor conversion of Ce(III) to Ce(IV) ions during the discharge cycle. Mixed electrolytes containing methanesulfonate and sulfate anions have been evaluated at a high Ce(III) ion concentration, e.g. 0.4 mol dm −3 . After charging the battery for 4 h, the conversion of Ce(III) to Ce(IV) ions became less efficient over time due to a greater fraction of the current being used in oxygen evolution. Critical aspects for improvements in the battery performance are considered.

  3. Effect of polyvinylpyrrolidone on cerium oxide nanoparticle characteristics prepared by a facile heat treatment technique

    Directory of Open Access Journals (Sweden)

    Anwar Ali Baqer

    Full Text Available An aqueous medium composed of polyvinylpyrrolidone (PVP and cerium nitrates at calcination temperature was utilised in the production of cerium oxide (CeO2 semiconductor nanoparticles. A variety of analytical approaches was utilized to examine the structural, morphological and optical characteristics of the resulting nanoparticles. Differential thermal (DTA and thermogravimetric (TGA analyses, indicated that the best calcination temperatures for achieving CeO2 nanoparticle production were more than 485 °C. The results from Fourier-transform infrared (FTIR verified the formation of a crystalline structure after calcination procedures were performed to remove residual organic compounds. Additionally, results from X-ray diffraction (XRD analysis confirmed the cubic fluorite structure of the CeO2 produced. Samples were also analysed by energy dispersive spectroscopy (EDXA which indicated the existence of O and Ce in the samples. Field emission scanning electron microscopy (FESEM was used in the characterisation of nanoparticle morphological features. Transmission electron microscopy (TEM was employed to estimate typical nanoparticle and distribution within sample. This analysis indicated that mean particle sizes were inversely correlated with PVP concentration, with nanoparticle sizes ranging between 12 ± 7 nm at 0.03 g/mL PVP and 6 ± 2 nm at 0.05 g/mL PVP. These results corroborated those obtained by XRD analysis. A UV–vis spectrophotometer was utilised in the demonstration of optical properties and to examine the band gap energy of samples. The potential UV-shielding properties of the nanoparticles were demonstrated by the observed blue shift of the estimated optical energy band, i.e. from 3.35 to 3.43 eV, whilst PL spectra results indicated that decreasing particle size was associated with diminishing photoluminescence intensity. Keywords: Cerium oxide nanoparticles, Heat treatment technique, Structural properties, Optical

  4. Low Temperature Synthesis and Properties of Gadolinium-Doped Cerium Oxide Nanoparticles

    DEFF Research Database (Denmark)

    Machado, Marina F. S.; P. R. Moraes, Leticia; Monteiro, Natalia K.

    2017-01-01

    Gadolinium-doped cerium oxide (GDC) is an attractive ceramic material for solid oxide fuel cells (SOFCs) both as the electrolyte or in composite electrodes. The Ni/GDC cermet can be tuned as a catalytic layer, added to the conventional Ni/yttria-stabilized zirconia (YSZ), for the internal steam...... sintering temperature needed to obtain a fully dense ceramic body, which can result in undesired reactions with YSZ. In this study, a green chemistry route for the synthesis of 10 mol% GDC nanoparticles is proposed. Such a low temperature synthesis provides control over particle size and sinterability...

  5. Low Temperature Synthesis and Properties of Gadolinium-Doped Cerium Oxide Nanoparticles

    DEFF Research Database (Denmark)

    Machado, M. F. S.; Moraes, L. P. R.; Monteiro, N. K.

    2017-01-01

    Gadolinium-doped cerium oxide (GDC) is an attractive ceramic material for solid oxide fuel cells (SOFCs) both as the electrolyte and in composite electrodes operating at low and intermediate temperatures. GDC exhibits high oxygen ion conductivity at a wide range of temperatures and displays a high...... resistance to carbon deposition when hydrocarbons are used as fuels. However, an inconvenience of ceria-based oxides is the high sintering temperature needed to obtain a fully dense ceramic body. In this study, a green chemistry route for the synthesis of 10 mol% GDC nanoparticles is proposed. The aqueous...

  6. The different aspects of magnetism in cerium compounds

    International Nuclear Information System (INIS)

    Sereni, J. G.

    1999-01-01

    Different factors related to the formation of the Cerium magnetic ground state are analyzed from its electronic structure, following a decreasing scale of energy. The studied behaviours include from nonmagnetic states, like those with valence instability, to different magnetic phase diagrams. The competition between the Kondo effect, which screens the magnetic moments and the magnetic interactions, that tends to order them is also described. In the ordered phase boundary the phenomena related to the incipient magnetisms are analyzed and related to deviations from the Fermi liquid behaviour and divergences of the thermodynamic parameters when the temperature tend to zero. Some experimental techniques are described and the difference between thermodynamical and control parameters analyzed. Particular attention is paid to the effect of pressure and ligand substitution. (Author) 22 refs

  7. Cerium intermetallics with TiNiSi-type structure

    Energy Technology Data Exchange (ETDEWEB)

    Janka, Oliver; Niehaus, Oliver; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ. CNRS (UPR 9048), Pessac (France). Inst. de Chimie de la Matiere Condensee de Bordeaux (ICMCB)

    2016-08-01

    Intermetallic compounds with the equiatomic composition CeTX that crystallize with the orthorhombic TiNiSi-type structure can be synthesized with electron-rich transition metals (T) and X = Zn, Al, Ga, Si, Ge, Sn, As, Sb, and Bi. The present review focusses on the crystal chemistry and chemical bonding of these CeTX phases and on their physical properties, {sup 119}Sn and {sup 121}Sb Moessbauer spectra, high-pressure effects, hydrogenation reactions and the formation of solid solutions in order to elucidate structure-property relationships. This paper is the final one of a series of four reviews on equiatomic intermetallic cerium compounds [Part I: Z. Naturforsch. 2015, 70b, 289; Part II: Z. Naturforsch. 2015, 70b, 695; Part III: Z. Naturforsch. 2016, 71b, 165].

  8. Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes.

    Science.gov (United States)

    Garnier, Jérôme; Warnant, Jérôme; Lacroix-Desmazes, Patrick; Dufils, Pierre-Emmanuel; Vinas, Jérôme; van Herk, Alex

    2013-10-01

    Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl acrylate as a hydrophobic monomer and acrylic acid (AA) and/or 2-acrylamido-2-methylpropane sulfonic acid (AMPS) as hydrophilic monomers. After characterizing the adsorption of these macro-RAFT agents at the cerium oxide surface by UV-visible spectrometry, emulsion copolymerization reactions of styrene and methyl acrylate were then carried out in the presence of the surface-modified nanoceria. Dynamic Light Scattering and cryo-Transmission Electron Microscopy were employed to confirm the hybrid structure of the final CeO2/polymer latexes, and proved that the presence of acrylic acid units in amphiphatic macro-RAFT agents enabled an efficient formation of hybrid structures, while the presence of AMPS units, when combined with AA units, resulted in a better distribution of cerium oxide nanoclusters between latex particles. Copyright © 2013 Elsevier Inc. All rights reserved.

  9. Effectiveness of Cerium Nitrate-Silver Sulfadiazine in the Treatment of Facial Burns: A Multicenter, Randomized, Controlled Trial

    NARCIS (Netherlands)

    Oen, I.M.M.H.; van Baar, M.E.; Middelkoop, E.; Nieuwenhuis, M.K.

    2012-01-01

    Background: The face is a very frequent site of burn injuries. This multicenter, randomized, controlled trial thus investigates the effectiveness of cerium nitrate-silver sulfadiazine in the treatment of facial burns compared with silver sulfadiazine. Methods: Adult patients with acute facial burns

  10. The removal of gaseous impurities from the primary circuit in high temperature reactors with cerium-mischmetal-getters

    International Nuclear Information System (INIS)

    Heinen, R.

    1986-11-01

    The use of getters to remove tritium and other gaseous impurities (especially H 2 , N 2 and CO) from helium circuits in nuclear reactors has been investigated. The loading capcity of beds, containing small cerium-mischmetal chips has been tested for several typical conditions. The results show that it is possible to use getters to purify inert gas streams for given boundary conditions. High CO-levels, however, lead to a poisoning (passivation) of the getter material. The effect of poisoning is cumulative. A mathematical model describes the behavior of CO in this kind of getter. Safety tests under possible accident conditions were made with the highly reactive cerium-mischmetal chips. The results show that there isn't a critical problem in using this material in the form of a chemical reactive getter bed near a nuclear reactor in the investigated range of accident conditions. (orig.) [de

  11. Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.

    Science.gov (United States)

    Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al

    2015-03-25

    Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.

  12. Inhaled Diesel Emissions Generated with Cerium Oxide Nanoparticle Fuel Additive Induce Adverse Pulmonary and Systemic Effects

    Science.gov (United States)

    Snow, Samantha J.; McGee, John; Miller, Desinia B.; Bass, Virginia; Schladweiler, Mette C.; Thomas, Ronald F.; Krantz, Todd; King, Charly; Ledbetter, Allen D.; Richards, Judy; Weinstein, Jason P.; Conner, Teri; Willis, Robert; Linak, William P.; Nash, David; Wood, Charles E.; Elmore, Susan A.; Morrison, James P.; Johnson, Crystal L.; Gilmour, Matthew Ian; Kodavanti, Urmila P.

    2014-01-01

    Diesel exhaust (DE) exposure induces adverse cardiopulmonary effects. Cerium oxide nanoparticles added to diesel fuel (DECe) increases fuel burning efficiency but leads to altered emission characteristics and potentially altered health effects. Here, we evaluated whether DECe results in greater adverse pulmonary effects compared with DE. Male Sprague Dawley rats were exposed to filtered air, DE, or DECe for 5 h/day for 2 days. N-acetyl glucosaminidase activity was increased in bronchial alveolar lavage fluid (BALF) of rats exposed to DECe but not DE. There were also marginal but insignificant increases in several other lung injury biomarkers in both exposure groups (DECe > DE for all). To further characterize DECe toxicity, rats in a second study were exposed to filtered air or DECe for 5 h/day for 2 days or 4 weeks. Tissue analysis indicated a concentration- and time-dependent accumulation of lung and liver cerium followed by a delayed clearance. The gas-phase and high concentration of DECe increased lung inflammation at the 2-day time point, indicating that gas-phase components, in addition to particles, contribute to pulmonary toxicity. This effect was reduced at 4 weeks except for a sustained increase in BALF γ-glutamyl transferase activity. Histopathology and transmission electron microscopy revealed increased alveolar septa thickness due to edema and increased numbers of pigmented macrophages after DECe exposure. Collectively, these findings indicate that DECe induces more adverse pulmonary effects on a mass basis than DE. In addition, lung accumulation of cerium, systemic translocation to the liver, and delayed clearance are added concerns to existing health effects of DECe. PMID:25239632

  13. Biomineralization-Inspired Synthesis of Cerium-Doped Carbonaceous Nanoparticles for Highly Hydroxyl Radical Scavenging Activity

    Science.gov (United States)

    Zou, Shenqiang; Zhu, Xiaofang; Zhang, Lirong; Guo, Fan; Zhang, Miaomiao; Tan, Youwen; Gong, Aihua; Fang, Zhengzou; Ju, Huixiang; Wu, Chaoyang; Du, Fengyi

    2018-03-01

    Cerium oxide nanoparticles recently have received extensive attention in biomedical applications due to their excellent anti-oxidation performance. In this study, a simple, mild, and green approach was developed to synthesize cerium-doped carbonaceous nanoparticles (Ce-doped CNPs) using bio-mineralization of bull serum albumin (BSA) as precursor. The resultant Ce-doped CNPs exhibited uniform and ultrasmall morphology with an average size of 14.7 nm. XPS and FTIR results revealed the presence of hydrophilic group on the surface of Ce-doped CNPs, which resulted in excellent dispersity in water. The CCK-8 assay demonstrated that Ce-doped CNPs possessed favorable biocompatibility and negligible cytotoxicity. Using H2O2-induced reactive oxygen species (ROS) as model, Ce-doped CNPs showed highly hydroxyl radical scavenging capability. Furthermore, flow cytometry and live-dead staining results indicated that Ce-doped CNPs protected cells from H2O2-induced damage in a dose-dependent effect, which provided a direct evidence for anti-oxidative performance. These findings suggest that Ce-doped CNPs as novel ROS scavengers may provide a potential therapeutic prospect in treating diseases associated with oxidative stress.

  14. 42 CFR 410.134 - Provider qualifications.

    Science.gov (United States)

    2010-10-01

    ... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...

  15. Processing of Pakistani carbonatites for separation of cerium from adjacent rare earths

    International Nuclear Information System (INIS)

    Akram, M.; Qazi, N.K.; Khan, M.F.; Hasan, G.H.; Ahmed, N.; Chughtai, N.A.

    2003-01-01

    % (v/v) for the ratio 1:4. The optimum extraction and stripping times being 30 minutes for each. The rare earths concentrate (i.e. REs salt) produced using the optimum parameters contained approx. 50% REO (w/w). For separation of cerium from adjacent rare earths, the rare earths concentrate was effectively dissolved in 10% HCl at 60 deg. C after 3hrs stirring. The chloride solution was oxidized with sodium hypochlorite at pH 3-4 to form precipitates of Ce(OH)/sub 4/ and Ln(OH)/sub 3/. These precipitates when filtered and leached with 3% HCl gave Ce(OH)/sub 4/ Cake containing -80% of cerium present in the concentrate. The cake contained mainly cerium with <5% other rare earths. The trivalent rare earths were soluble in HCl which separated as LnCl/sub 3/ in filtrate. Cerium was isolated in the form of ceric salt from the adjacent rare earths. (author)

  16. Steric and electronic effects of 1,3-disubstituted cyclopentadienyl ligands on metallocene derivatives of Cerium, Titanium, Manganese, and Iron

    Energy Technology Data Exchange (ETDEWEB)

    Sofield, Chadwick Dean [Univ. of California, Berkeley, CA (United States)

    2000-05-01

    Sterically demanding 1,3-disubstituted cyclopentadienyl ligands were used to modify the physical properties of the corresponding metallocenes. Sterically demanding ligands provided kinetic stabilization for trivalent cerium compounds. Tris(di-t-butylcyclopentadienyl)cerium was prepared and anion competition between halides and cyclopentadienyl groups which had complicated synthesis of the tris(cyclopentadienyl)compound was qualitatively examined. Bis(di-t-butylcyclopentadienyl)cerium methyl was prepared and its rate of decomposition, by ligand redistribution, to tris(di-t-butylcyclopentadienyl)cerium was shown to be slower than the corresponding rate for less sterically demanding ligands. Asymmetrically substituted ligands provided a symmetry label for examination of chemical exchange processes. Tris[trimethylsilyl(t-butyl)cyclopentadienyl]cerium was prepared and the rate of interconversion between the C1 and C3 isomers was examined. The enthalpy difference between the two distereomers is 7.0 kJ/mol. The sterically demanding cyclopentadienyl ligands ansa-di-t-butylcyclopentadiene (Me2Si[(Me3C)2C5H3]2), ansa-bis(trimethylsilyl)cyclopentadiene (Me2Si[(Me3Si)2C5H3]2) and tetra-t-butylfulvalene and metallocene derivatives of the ligands were prepared and their structures were examined by single crystal X-ray crystallography. The effect that substituents on the cyclopentadienyl ring have on the pi-electron system of the ligand was examined through interaction between ligand and metal orbitals. A series of 1,3-disubstituted manganocenes was prepared and their electronic states were determined by solid-state magnetic susceptibility, electron paramagnetic resonance, X-ray crystallography, and variable temperature UV-vis spectroscopy. Spin-equilibria in [(Me3C)2C5H3]2Mn and [(Me3

  17. 19 CFR 122.134 - When airline does not have in-bond liquor storeroom.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...

  18. Stabilized zirconia with cerium and neodymium addition

    International Nuclear Information System (INIS)

    Andrade, I.M. de; Pessoa, R.C.; Nasar, M.C.; Nasar, R.S.; Rodriques, M.K.C.; Oliveira, J.F.

    2006-01-01

    Zr 0,9 Ce 0,05 Nd 0,05 O 1,975 system was synthesized with the use of the Pechini method. The polymeric resin was calcined at 350 deg C/3 h and analysed by FTIR that show bands relative to organic. Radicals esther type. The TGA curve indicated the polymeric decomposition occurring from 30 deg C to 740 deg C. DTA analysis show a exothermic peak in 100 deg C due to loss of water of material. From 500 deg C to 800 deg C was observed a intense peak due to polymer decomposition and the zirconia crystallization. The calcined powder from 350 deg C/3 h e 30 min to 900 deg/3 h were analysed by XRD that show the crystalline phase formation with the increase of temperature. The X-ray diffraction pattern show the presence of two phases, such as tetragonal and cubic of zirconia demonstrating that neodymium and cerium additions led to zirconia stabilization. (author)

  19. The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters

    International Nuclear Information System (INIS)

    Szentkuti, L.; Breitrueck, H.; Giese, W.

    1976-01-01

    he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)

  20. In-situ irradiation of cerium precursors in TEM to study nanocrystal formation

    Science.gov (United States)

    Asghar, Muhammad Sajid Ali; Sabri, Mohammed Mohammed; Tian, Zijian; Möbus, Günter

    2017-09-01

    Three of the most commonly used precursor chemicals for wet-chemical nano-ceria synthesis are examined by means of direct dry electron irradiation in TEM. Transformation reactions of micron-size carbonate, chloride, and nitrate grains into nanocrystallites (internal or external) are recorded in situ. Progress of possible redox-changes of cerium is tracked by EELS. We find a straight local oxidation reaction for carbonates, but external nanorod formation by condensation in the case of chlorides, while nitrates show a multi-stage complex redox behaviour.

  1. The systems cerium(3) (samarium) nitrate-quinoline nitrate-water

    International Nuclear Information System (INIS)

    Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

    1982-01-01

    Using the method of cross sections at 25 and 50 deg C the solubility in the systems cerium (3) nitrate-quinoline nitrate-water and samarium nitrate-quinoline nitrate-water has been studied. It is established that in the systems during chemical interaction of components congruently melting compounds of the composition: Ce(NO 3 ) 2 x2[C 9 H 7 NxHNO 3 ]x6H 2 O and Sm(NO 3 ) 3 x2[C 9 H 7 NxHNO 3 ]x2H 2 O are formed. New solid phases are separated preparatively and are subjected to chemical, differential thermal and IR spectroscopic analyses. The investigation results are compared with similar ones for nitrates of other representatives of lanthanide group

  2. 10 CFR 60.134 - Design of seals for shafts and boreholes.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...

  3. 13 CFR 134.712 - What are the limitations on new evidence?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  4. 13 CFR 134.709 - When will a Judge dismiss an appeal?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  5. 13 CFR 134.706 - What are the service and filing requirements?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

  6. Antagomirs Targeting MicroRNA-134 Increase Limk1 Levels After Experimental Seizures in Vitro and in Vivo

    Directory of Open Access Journals (Sweden)

    Jiahang Sun

    2017-09-01

    Full Text Available Background: MiR-134 is enriched in dendrites of hippocampal neurons and plays crucial roles in the progress of epilepsy. The present study aims to investigate the effects of antagomirs targeting miroRNA-134 (Ant-134 on limk1 expression and the binding of miR-134 and limk1 in experimental seizure. Methods: Status epilepticus (SE rat model was established by lithium chloride-pilocarpine injection and was treated with Ant-134 by intracerebroventricular injection. Low Mg2+-exposed primary neurons were used as an in vitro model of SE. The expression of miR-134 was determined using real-time PCR. Protein expressions of limk1 and cofilin were determined by Western blotting. Luciferase reporter assay was used to examine the binding between miR-134 and limk1 3’-untranslated region. Results: The expression of miR-134 was markedly enhanced in hippocampus of the SE rats and low Mg2+-exposed neurons. Ant-134 increased the expression of limk1 and reduced the expression of cofilin in the SE hippocampus and Low Mg2+-exposed neurons. In addition, luciferase reporter assay confirmed that miR-134 bound limk1 3’-UTR. MiR-134 overexpression inhibited limk1 mRNA and protein expressions in neurons. Conclusion: Blockage of miR-134 upregulates limk1 expression and downregulated cofilin expression in hippocampus of the SE rats. This mechanism may contribute to the neuroprotective effects of Ant-134.

  7. Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system

    International Nuclear Information System (INIS)

    Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari

    2012-01-01

    Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.

  8. SU-E-T-279: Dose Enhancement Effect Due to Cerium Oxide Nanoparticles Employed as Radiation Protectants

    Energy Technology Data Exchange (ETDEWEB)

    Ouyang, Z; Altundal, Y; Sajo, E [Univ Massachusetts Lowell, Lowell, MA (United States); Ngwa, W [Univ Massachusetts Lowell, Lowell, MA (United States); Brigham and Women’s Hospital, Dana Farber Cancer Institute, Harvard Medical, Boston, MA (United States)

    2015-06-15

    Purpose: The goal of radiotherapy is to maximize radiation dose to diseased cells while minimizing radiation damage to normal tissues. In order to minimize damage to normal tissues, cerium oxide nanoparticles (nanoceria) are currently considered as a radioprotectant. However, some studies have reported concerns that nanoceria can also lead to radiotherapy dose enhancement due to the high atomic number of cerium, especially when used in conjunction with kV energy and brachytherapy sources. In this study, this concern is investigated to determine if the concentrations of nanoceria employed in in-vivo studies to confer radioprotection can engender a significant dose enhancement. Methods: Radiation with energies ranging from 50kVp to 140kVp is investigated in this work along with brachytherapy sources Pd-103 and I-125. A previously established theoretical model is used to calculate the dose enhancement factor (DEF). In this model, each cell is assumed to be a voxel of size (10 µm, 10 µm, 10 µm) with nanoceria homogeneously distributed among them. Electron energy loss formula of Cole is used to calculate energy (and hence dose) deposited by photoelectrons and Auger electrons in each tissue voxel due to irradiation of nanoceria. The DEF is defined as the ratio of the dose with and without nanoparticles. Results: DEF calculation results are smaller than 1.02 with dosages of nanoceria smaller than 0.645 mg/g, which is shown to be sufficiently protective by some previous in-vitro and in-vivo experiments. The brachytherapy sources show higher DEF’s than kVp radiations. DEF peaks are consistent with K shell and L shell energies of cerium, 40 keV and 6 keV, respectively. Conclusion: The results show that for sufficiently radioprotective concentrations of nanoceria, there will be minimal DEF when used in conjunction with clinically applicable kV energy radiotherapy sources or brachytherapy sources.

  9. The effect of cerium valence states at cerium oxide nanoparticle surfaces on cell proliferation

    KAUST Repository

    Naganuma, Tamaki

    2014-05-01

    Understanding and controlling cell proliferation on biomaterial surfaces is critical for scaffold/artificial-niche design in tissue engineering. The mechanism by which underlying integrin ligates with functionalized biomaterials to induce cell proliferation is still not completely understood. In this study, poly-l-lactide (PL) scaffold surfaces were functionalized using layers of cerium oxide nanoparticles (CNPs), which have recently attracted attention for use in therapeutic application due to their catalytic ability of Ce4+ and Ce3+ sites. To isolate the influence of Ce valance states of CNPs on cell proliferation, human mesenchymal stem cells (hMSCs) and osteoblast-like cells (MG63) were cultured on the PL/CNP surfaces with dominant Ce4+ and Ce3+ regions. Despite cell type (hMSCs and MG63 cells), different surface features of Ce4+ and Ce3+ regions clearly promoted and inhibited cell spreading, migration and adhesion behavior, resulting in rapid and slow cell proliferation, respectively. Cell proliferation results of various modified CNPs with different surface charge and hydrophobicity/hydrophilicity, indicate that Ce valence states closely correlated with the specific cell morphologies and cell-material interactions that trigger cell proliferation. This finding suggests that the cell-material interactions, which influence cell proliferation, may be controlled by introduction of metal elements with different valence states onto the biomaterial surface. © 2014 Elsevier Ltd.

  10. Sulfur Bridged Multidentate Ligands Based on (Bipyridyl-(Bi-1,3,4-Thiadiazolyl Conjugates

    Directory of Open Access Journals (Sweden)

    M. Teresa Clasadonte

    2003-03-01

    Full Text Available The synthesis of a series of mixed (bipyridyl/(bi1,3,4-thiadiazolyl ligands, derived from the condensation of 2-mercapto-5-methylthio-1,3,4-thiadiazole or 5-mercapto-5'-methylthio-2,2'-bi-1,3,4-thiadiazole with 2,6-bis(chloromethylpyridine or 6,6’-bis(chloromethyl-2,2’-bipyridine (compounds L1–L4, and of 2,5-dimercapto-1,3,4-thiadiazole or 5,5'-dimercapto-2,2'-di-1,3,4-thiadiazole with picolyl chloride hydrochloride or 6-chloromethyl-6'-methyl-2,2'-bipyridine (compounds L5–L8 in the presence of triethylamine is described. All new compounds have been characterized by FAB (+ spectrometry and NMR spectroscopy. 13C-NMR spectra are crucial to firmly establish the thiol structure of the title ligands.

  11. Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134.

    Science.gov (United States)

    Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Chang, Yao-Wen; Nakamura, Takuro; Yanaka, Miyuki; Kato, Yukinari

    2018-07-01

    The epidermal growth factor receptor (EGFR) is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb), which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7%) to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375-394 amino acids of EGFR) neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377- RGDSFTHTPP -386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

  12. Oxidation behaviour and electrical properties of cobalt/cerium oxide composite coatings for solid oxide fuel cell interconnects

    DEFF Research Database (Denmark)

    Harthøj, Anders; Holt, Tobias; Møller, Per

    2015-01-01

    This work evaluates the performance of cobalt/cerium oxide (Co/CeO2) composite coatings and pure Co coatings to be used for solid oxide fuel cell (SOFC) interconnects. The coatings are electroplated on the ferritic stainless steels Crofer 22 APU and Crofer 22H. Coated and uncoated samples...

  13. Germination and early plant development of ten plant species exposed to titanium dioxide and cerium oxide nanoparticles

    Science.gov (United States)

    Ten agronomic plant species were exposed to different concentrations of nano titanium dioxide (nTiO2) or nano cerium oxide (nCeO2) (0, 250, 500 and 1000 mg/L) to examine potential effects on germination and early seedling development. We modified a standard test protocol develop...

  14. Electron paramagnetic resonance of V4+ in the lanthanum and cerium orthophosphates

    International Nuclear Information System (INIS)

    Lima, J.C. de.

    1983-11-01

    The Electron Paramagnetic Resonance (EPR) spectrum of V 4+ was investigated in polycrystalline samples of lanthanum orthophosphate (LaPO 4 ) and cerium orthophosphate (CePO 4 ) doped with 0.2 wt % vanadium pentoxide (V 2 O 5 ). Measurements were performed at room temperature and 9.5 GHz. In LaPO 4 , two non-equivalent axial sites were inferred from the EPR spectra. The most stable of these two sites is probably substitutional. In CePO 4 , a single axial spectrum was observed. It was attributed to V 4+ in substitutional sites. A central, wide line was also seen; it was attributed to ferromagnetic clusters of vanadium ions. Photoacoustic absorption spectra were also recorded for the two compounds. The EPR and photoacoustic absorption data, when analyzed using the molecular orbital theory, show that for both lanthanum orthophosphate and cerium orthophosphate the ground orbital (d sub(x) 2 sub(-y) 2) of the unpainred electron is purely ionic, while the excited orbitals d sub(xy) and d sub(xz,yz) are partly covalent. The degree of covalency is higher for the d sub(xy) orbital. Finally, it should be pointed out that part of the theory used for the interpretation of the EPR and photoacoustic absorption spectra (study of the ligand field splitting of a d orbital in a site of distorted capped antiprism structure) was developed by the author in the present work and is therefore an original contribution. (Author) [pt

  15. 33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

  16. Comparison of the air oxidation behaviors of Zircaloy-4 implanted with yttrium and cerium ions at 500 deg. C

    International Nuclear Information System (INIS)

    Chen, X.W.; Bai, X.D.; Xu, J.; Zhou, Q.G.; Chen, B.S.

    2002-01-01

    As a valuable process for surface modification of materials, ion implantation is eminent to improve mechanical properties, electrochemical corrosion resistance and oxidation behaviors of varieties of materials. To investigate and compare the oxidation behaviors of Zircaloy-4, implantation of yttrium ion and cerium ion were respectively employed by using an MEVVA source at the energy of 40 keV with a dose ranging from 1x10 16 to 1x10 17 ions/cm 2 . Subsequently, weight gain curves of the different specimens including as-received Zircaloy-4 and Zircaloy-4 specimens implanted with the different ions were measured after oxidation in air at 500 deg. C for 100 min. It was obviously found that a significant improvement was achieved in the oxidation behaviors of implanted Zircaloy-4 compared with that of the as-received Zircaloy-4, and the oxidation behavior of cerium-implanted Zircaloy-4 was somewhat better than that of yttrium-implanted specimen. To obtain the valence and the composition of the oxides in the scale, X-ray photoemission spectroscopy was used in the present study. Glancing angle X-ray diffraction, employed to analyze the phase transformation in the oxide films, showed that the addition of yttrium transformed the phase from monoclinic zirconia to tetragonal zirconia, yet the addition of cerium transformed the phase from monoclinic zirconia to hexagonal zirconia. In the end, the mechanism of the improvement of the oxidation behavior was discussed

  17. Hydroxamic acid interactions with solvated cerium hydroxides in the flotation of monazite and bastnäsite—Experiments and DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Sarvaramini, A., E-mail: amin.sarvaramini.1@ulaval.ca; Azizi, D., E-mail: dariush.azizi.1@ulaval.ca; Larachi, F., E-mail: faical.larachi@gch.ulaval.ca

    2016-11-30

    Highlights: • Experimental and DFT studies of hydroxamic acid adsorption on monazite and bastnäsite. • Highest bastnäsite and monazite floatability observed at pH 7–9. • First solvation layer of cerium hydroxides consisted of up to 10 water molecules. • Solvated Ce(OH){sub 2}{sup +} and Ce(OH){sup 2+} cations interact with up to 3 collector anions. • Interaction of zero-charge solvated Ce(OH){sub 3} involves up to 2 collector anions. - Abstract: Density functional theory (DFT) simulations and experiments were performed to clarify the interaction mechanisms between hydroxamic acid collectors and cerium hydroxides during the flotation of bastnäsite and monazite minerals. These minerals showed considerable floatability at moderately alkaline pH which was related to the adsorption of hydroxamic acids on their surfaces as confirmed by vibrational spectroscopic and zeta potential measurements. DFT simulations showed that at moderately alkaline pH, the interactions between solvated Ce(OH){sup 2+} and Ce(OH){sub 2}{sup +} and heptyl-hydroxamic acid (HHA) anions resulted in the formation of, respectively, [Ce(OH)(HHA){sub x}(H{sub 2}O){sub y}]{sup 2−x} (x[y = ] = 1[6],2[3],3[1]) and [Ce(OH){sub 2}(HHA){sub x}(H{sub 2}O){sub y}]{sup 1−x} (x[y = ] = 1[5],2[1],3[0]) complexes. The collector anions were found to interact directly through formation of two covalent bonds between their two polar-head oxygen atoms and cerium in the hydroxide complexes. However, formation of such new bonds resulted in breakage of a few covalent/electrostatic bonds between cerium and water molecules initially present in the first hydration shell of the rare-earth metal cation. Building up in the electric double layer of the semi-soluble minerals, these complexes, and by extension, those from other rare-earth elements belonging to monazite and bastnäsite, are speculated to play a role in the interactions between rare-earth minerals and hydroxamic acid collectors.

  18. X-ray spectrum emitted by a laser-produced cerium plasma in the 7.5 to 12 A wavelength range

    International Nuclear Information System (INIS)

    Doron, R.; Behar, E.; Fraenkel, M.; Mandelbaum, P.; Schwob, J.L.; Zigler, A.

    2001-01-01

    A highly stripped cerium (Z = 58) plasma is produced by irradiating a solid cerium target with an intense short laser pulse. The X-ray spectrum emitted from the plasma is recorded in the 7.5-12 A wavelength range using a flat RAP crystal spectrometer. Ab-initio calculations using the RELAC relativistic computer code, as well as isoelectronic trends deduced from previous works, together with spectra obtained under different laser beam focusing conditions, are all employed for the identification of the spectral lines and features emitted by various ions from Fe-like Ce 32+ to As-like Ce 25+ . The technique of comparing spectra obtained using different laser intensities is also employed to confirm or to resolve some ambiguous identifications of spectral features in the spectrum of a laser-produced lanthanum plasma studied in a previous work. (orig.)

  19. X-ray spectrum emitted by a laser-produced cerium plasma in the 7.5 to 12 A wavelength range

    Energy Technology Data Exchange (ETDEWEB)

    Doron, R.; Behar, E.; Fraenkel, M.; Mandelbaum, P.; Schwob, J.L.; Zigler, A. [Hebrew Univ., Jerusalem (Israel). Racah Inst. of Physics; Faenov, A.Ya.; Pikuz, T.A. [Multicharged Ion Spectra Data Center, VNIIFTRI, Mendeleevo (Russian Federation)

    2001-01-01

    A highly stripped cerium (Z = 58) plasma is produced by irradiating a solid cerium target with an intense short laser pulse. The X-ray spectrum emitted from the plasma is recorded in the 7.5-12 A wavelength range using a flat RAP crystal spectrometer. Ab-initio calculations using the RELAC relativistic computer code, as well as isoelectronic trends deduced from previous works, together with spectra obtained under different laser beam focusing conditions, are all employed for the identification of the spectral lines and features emitted by various ions from Fe-like Ce{sup 32+} to As-like Ce{sup 25+}. The technique of comparing spectra obtained using different laser intensities is also employed to confirm or to resolve some ambiguous identifications of spectral features in the spectrum of a laser-produced lanthanum plasma studied in a previous work. (orig.)

  20. Transfer factors of 134Cs for olive and orange trees grown on different soils

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.

    1999-01-01

    Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  1. The evolution mechanism of the dislocation loops in irradiated lanthanum doped cerium oxide

    International Nuclear Information System (INIS)

    Miao, Yinbin; Aidhy, Dilpuneet; Chen, Wei-Ying; Mo, Kun; Oaks, Aaron; Wolf, Dieter; Stubbins, James F.

    2014-01-01

    Cerium dioxide, a non-radioactive surrogate of uranium dioxide, is useful for simulating the radiation responses of uranium dioxide and mixed oxide fuel (MOX). Controlled additions of lanthanum can also be used to form various levels of lattice oxide or anion vacancies. In previous transmission electron microscopy (TEM) experimental studies, the growth rate of dislocation loops in irradiated lanthanum doped ceria was reported to vary with lanthanum concentration. This work reports findings of the evolution mechanisms of the dislocation loops in cerium oxide with and without lanthanum dopants based on a combination of molecular statics and molecular dynamics simulations. These dislocation loops are found to be b=1/3〈111〉 interstitial type Frank loops. Calculations of the defect energy profiles of the dislocation loops with different structural configurations and radii reveal the basis for preference of nucleation as well as the driving force of growth. Frenkel pair evolution simulations and displacement cascade overlaps simulations were conducted for a variety of lanthanum doping conditions. The nucleation and growth processes of the Frank loop were found to be controlled by the mobility of cation interstitials, which is significantly influenced by the lanthanum doping concentration. Competition mechanisms coupled with the mobility of cation point defects were discovered, and can be used to explain the lanthanum effects observed in experiments

  2. Synthesis of cerium and nickel doped titanium nanofibers for hydrolysis of sodium borohydride.

    Science.gov (United States)

    Tamboli, Ashif H; Gosavi, S W; Terashima, Chiaki; Fujishima, Akira; Pawar, Atul A; Kim, Hern

    2018-07-01

    A recyclable titanium nanofibers, doped with cerium and nickel doped was successfully synthesized by using sol-gel and electrospinning method for hydrogen generation from alkali free hydrolysis of NaBH 4 . The resultant nanocomposite was characterized to find out the structural and physical-chemical properties by a series of analytical techniques such as FT-IR (Fourier transform infrared spectroscopy), XRD (X-ray diffraction), SEM (scanning electron microscope), EDX (energy-dispersive X-ray spectroscopy),N 2 adsorption-desorption and BET (Brunauer-Emmett-Teller), etc. The results revealed that cerium and nickel nanoparticles were homogeneously distributed on the surface of the TiO 2 nanofibers due to having similar oxidation state and atomic radium of TiO 2 nanofibers with CeO 2 and NiO for the effective immobilization of metal ions. The NiO doped catalyst showed superior catalytic performance towards the hydrolysis reaction of NaBH 4 at room temperature. These catalysts have ability to produce 305 mL of H 2 within the time of 160 min at room temperature. Additionally, reusability test revealed that the catalyst is active even after five runs of hydrolytic reaction, implying the as-prepared NiO doped TiO 2 nanofibers could be considered as a potential candidate catalyst for portable hydrogen fuel system such as PEMFC (proton exchange membrane fuel cells). Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. Adsorbate shape selectivity: Separation of the HF/134a azeotrope over carbogenic molecular sieve

    Energy Technology Data Exchange (ETDEWEB)

    Hong, A.; Mariwala, R.K.; Kane, M.S.; Foley, H.C. [Univ. of Delaware, Nework, DE (United States)

    1995-03-01

    Experimental evidence is provided for adsorptive shape selectivity in the separation of the azeotrope between HF and 1,1,1,2-tetrafluoroethane (134a) over pyrolyzed poly(furfuryl alcohol)-derived carbogenic molecular sieve (PPFA-CMS). The separation can be accomplished over coconut charcoal or Carbosieve G on the basis of the differences in the extent of equilibrium adsorption of HF and 134a. On these adsorbents 134a is more strongly bound than HF, thus it elutes much more slowly from the bed. The heat of adsorption for 134a in the vicinity of 200 C on Carbosieve G is {approximately}8.8 kcal/mol. In contrast, when the same azeotropic mixture is separated over PPFA-CMS prepared at 500 C, 134a is not adsorbed. As a result 134a elutes from the bed first, followed by HF. The reversal is brought about by the narrower pore size and pore size distribution of the PPFA-CMS versus that for Carbosieve G. Thus the separation over PPFA-CMS is an example of adsorbate shape selectivity and represents a limiting case of kinetic separation.

  4. Anomalous plastic flow of cerium near the isomorphic phase transformations under high hydrostatic pressure

    International Nuclear Information System (INIS)

    Witczak, Z.; Goncharova, V.A.

    1999-01-01

    Compression tests have been carried out on cerium specimens at room temperature (0.27 T m ) under high hydrostatic pressures up to 1.2 GPa. A strong increase of the yield strength was observed for both isomorphic γ and α phases at pressures approaching the γ ↔ α isomorphic phase transformations. That increase was in good agreement with the theory of dislocations when the dependence of elastic properties and a lattice parameter of cerium on pressure was applied to calculate the effect of pressure on the yield stress controlled by the edge dislocations. An anomalous strong decrease of the yield stress was observed in both γ and α phases in the vicinity of both γ ↔ α phase transformations. That phenomenon was explained as an effect of pressure induced new phase atoms through spreading the cores of edge dislocations. A complete disappearance of work hardening in both γ and α phases was also observed in the wide range of pressures. The influence of hydrostatic pressure on the energy of grain boundaries of both phases was considered to be responsible for that property. The ratio of the grain boundary energy to the Peierls energy is suggested to be a criterion of the work hardening ability of f.c.c. polycrystals

  5. Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.

    Science.gov (United States)

    Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin

    2017-01-01

    The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  6. [Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].

    Science.gov (United States)

    Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei

    2017-05-01

    Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.

  7. Micro-precipitation of Americium by Cerium Hydroxide for alpha spectrometry

    International Nuclear Information System (INIS)

    Wankhede, Sonal M.; Kumar, Suja A.; Sawant, Pramilla D.

    2018-01-01

    Estimation of trace amount of actinides in any biological and/or environmental sample is done by radiochemical separation followed by alpha spectrometry. Alpha-spectrometric determination of actinides requires thin, homogeneous and nearly weightless sample sources. The most widely used method for preparation of actinides for alpha spectrometry involves electro deposition of the alpha emitters using stainless steel planchetts (cathode) and platinum rod (anode). This procedure is time consuming, requires relatively elaborate equipment, and is expensive. Micro-precipitation technique using hydrofluoric acid (HF) is also reliable and already standardized at Bioassay Laboratory (Wankhede, 2016). However, it uses hazardous chemical such as HF, hence, in the present study, cerium hydroxide micro-precipitation technique was standardized

  8. Structure and Electronic Properties of Cerium Orthophosphate: Theory and Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, Nicole; Mun, B. Simon; Ray, Hannah; Ross Jr, Phillip; Neaton, Jeffrey; De Jonghe, Lutgard

    2010-07-27

    Structural and electronic properties of cerium orthophosphate (CePO{sub 4}) are calculated using density functional theory (DFT) with the local spin-density approximation (LSDA+U), with and without gradient corrections (GGA-(PBE)+U), and compared to X-ray diffraction and photoemission spectroscopy measurements. The density of states is found to change significantly as the Hubbard parameter U, which is applied to the Ce 4f states, is varied from 0 to 5 eV. The calculated structural properties are in good agreement with experiment and do not change significantly with U. Choosing U = 3 eV for LDSA provides the best agreement between the calculated density of states and the experimental photoemission spectra.

  9. Chlorination and Carbochlorination of Cerium Oxide

    International Nuclear Information System (INIS)

    Esquivel, Marcelo; Bohe, Ana; Pasquevich, Daniel

    2000-01-01

    The chlorination and carbochlorination of cerium oxide were studied by thermogravimetry under controlled atmosphere (TG) in the 700 0 C 950 0 C temperature range.Both reactants and products were analyzed by X-ray diffraction (RX), scanning electronic microscopy (SEM) and energy dispersive spectroscopy (EDS). Thermodynamic calculations were performed by computer assisted software.The chlorination starts at a temperature close to 800 0 C.This reaction involves the simultaneous formation and evaporation of CeCl3.Both processes control the reaction rate and their kinetic may not be easily separated.The apparent chlorination activation energy in the 850 0 C-950 0 C temperature range is 172 to 5 kJ/ mole.Carbon transforms the CeO2-Cl2 into a more reactive system: CeO2-C-Cl2, where the effects of the carbon content, total flow rate and temperature were analyzed.The carbochlorination starting temperature is 700 0 C.This reaction is completed in one step controlled by mass transfer with an apparent activation energy of 56 to 5 kJ/mole in the 850 0 C-950 0 C temperature range

  10. Chocolate active

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    There is a table of current radioactivity values for various foods and mushrooms. A special accent is on milk and chocolate. Chocolate sorts with more powdered milk are more active. Finally there is a chapter on radionucleides contained in the Chernobyl fallout, other than cesium 137, cesium 134 and strontium 90. The amounts of ruthenium 106, antimony 125, cerium 144, silver 110 m, cesium 134, strontium 90 and plutonium 239 relative to cesium 137 in soil samples in autumn 1987 are given. Special emphasis is on ruthenium 'hot particles' and on plutonium. (qui)

  11. Structure and activity of tellurium-cerium oxide acrylonitrile catalysts

    International Nuclear Information System (INIS)

    Bart, J.C.J.; Giordano, N.

    1982-01-01

    Ammoxidation of propylene to acrylonitrile (ACN) was investigated over various silica-supported (Te,Ce)O catalysts at 360 and 440 0 C. The binary oxide system used consists of a single nonstoichiometric fluorite-type phase α-(Ce,Te)O 2 up to about 80 mole% TeO 2 and a tellurium-saturated solid solution β-(Ce,Te)O 2 at higher tellurium concentrations. The ACN yield varies almost linearly with the tellurium content of (Ce,Te)O 2 . The β-(Ce,Te)O 2 phase is the most active component of the system (propylene conversion and ACN selectivity at 440 C of 76.7 and 74%, respectively) and is slightly more selective to ACN than α-Te0 2 . Tellurium reduces the overoxidation properties of cerium and selective oxidation occurs through Te(IV)-bonded oxygen

  12. Antioxidant and antigenotoxic properties of CeO2 NPs and cerium sulphate: Studies with Drosophila melanogaster as a promising in vivo model.

    Science.gov (United States)

    Alaraby, Mohamed; Hernández, Alba; Annangi, Balasubramanyam; Demir, Esref; Bach, Jordi; Rubio, Laura; Creus, Amadeu; Marcos, Ricard

    2015-01-01

    Although in vitro approaches are the most used for testing the potential harmful effects of nanomaterials, in vivo studies produce relevant information complementing in vitro data. In this context, we promote the use of Drosophila melanogaster as a suitable in vivo model to characterise the potential risks associated to nanomaterials exposure. The main aim of this study was to evaluate different biological effects associated to cerium oxide nanoparticles (Ce-NPs) and cerium (IV) sulphate exposure. The end-points evaluated were egg-to-adult viability, particles uptake through the intestinal barrier, gene expression and intracellular reactive oxygen species (ROS) production by haemocytes, genotoxicity and antigenotoxicity. Transmission electron microscopy images showed internalisation of Ce-NPs by the intestinal barrier and haemocytes, and significant expression of Hsp genes was detected. In spite of these findings, neither toxicity nor genotoxicity related to both forms of cerium were observed. Interestingly, Ce-NPs significantly reduced the genotoxic effect of potassium dichromate and the intracellular ROS production. No morphological malformations were detected after larvae treatment. This study highlights the importance of D. melanogaster as animal model in the study of the different biological effects caused by nanoparticulated materials, at the time that shows its usefulness to study the role of the intestinal barrier in the transposition of nanomaterials entering via ingestion.

  13. Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134

    Directory of Open Access Journals (Sweden)

    Mika K. Kaneko

    2018-07-01

    Full Text Available The epidermal growth factor receptor (EGFR is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb, which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7% to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375–394 amino acids of EGFR neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377-RGDSFTHTPP−386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

  14. Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

    International Nuclear Information System (INIS)

    Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.

    1993-08-01

    The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)

  15. 13 CFR 134.711 - Will the Judge permit discovery and oral hearings?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...

  16. 13 CFR 134.705 - What are the requirements for an appeal petition?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  17. Spectrophotometric study of the complexes of cerium and uranides with diethylenetetraaminepentaacetic acid (DTPA); Contribution a l'etude de la complexation du cerium et des uranides par l'acide diethylenetetraminepentaacetique (DTPA)

    Energy Technology Data Exchange (ETDEWEB)

    Hafez, M B [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1968-03-01

    A spectrophotometric determination was made of the complexes of cerium and uranides in their different degrees of oxidation with diethylenetriaminepentaacetic acid (DTPA). Two physico-chemical states, the ionic and hydrolysis ones, were considered. In the former case, we studied the influence of the pH on the formation of the complex, and whenever the complexes were stable, we determined the molecular ratio and calculated their stability constants. In the latter case, we studied the conditions of solubilization of the precipitate by formation of complexes soluble in water as a function of pH, age of the precipitate and time of precipitate-chelate contact. (authors) [French] Etude spectrophotometrique de la complexation du cerium et des uranides (uranium, neptunium, plutonium et americium) dans leurs differents etats d'oxydation par l'acide diethylenetriaminepentaacetique (DTPA). Deux etats physicochimiques ont retenu notre attention, l'etat ionique et l'etat precipite d'hydrolyse. Dans le premier cas, nous avons etudie l'influence du pH sur la formation du complexe, et dans tous les cas ou le complexe est stable, nous avons determine le rapport moleculaire (5) [element]/[chelatant] du complexe forme et nous avons calcule leurs constantes de stabilite. Dans le deuxieme cas, l'etat de precipite d'hydrolyse, nous avons etudie les conditions de solubilisation du precipite, par formation du complexe, en fonction du pH, de l'age du precipite et du temps de contact precipite - chelatant. (auteurs)

  18. Kinetics and mechanism of reduction of cerium(IV) by ascorbic acid

    International Nuclear Information System (INIS)

    Bhatt, K.; Nand, K.C.

    1979-01-01

    The reduction of cerium(IV) has been studied in sulfuric acid medium using ascorbic acid as the reductant. The rate is found to be function of both Ce(IV) and AH 2 concentrations. Sulfuric acid retards the rate and the inverse order with respect to sulfuric acid is unity. The addition of chloride, bisulfate and sulfate of sodium show negative salt effect and an increase in the dielectric constant of the medium shows an accelerating effect on the reaction rate. Arrhenius parameters have been evaluated. A mechanism involving intermediate formation of ascorbate radical (AH) is proposed and the derived rate law agrees well with the experimental observations. (author)

  19. The properties of protective oxide scales containing cerium on alloy 800H in oxidizing and oxidizing/sulphidizing environments

    NARCIS (Netherlands)

    Haanappel, V.A.C.; Haanappel, V.A.C.; Fransen, T.; Geerdink, Bert; Gellings, P.J.; Stroosnijder, M.F.

    1991-01-01

    The corrosion protection of oxide scales formed by electrophoretic deposition in a cerium-containing sol on Alloy 800H, a 32Ni-20Cr steel, followed by firing in air at 1123 K was studied in oxidizing and mixed oxidizing/sulphidizing environments at elevated temperatures. In particular, the influence

  20. Difference of EGCg adhesion on cell surface between Staphylococcus aureus and Escherichia coli visualized by electron microscopy after novel indirect staining with cerium chloride.

    Science.gov (United States)

    Nakayama, Motokazu; Shigemune, Naofumi; Tsugukuni, Takashi; Tokuda, Hajime; Miyamoto, Takahisa

    2011-07-01

    We developed a novel method using indirect staining with cerium chloride for visualization of the catechin derivative epigallocatechin gallate (EGCg) on the surface of particles, i.e., polystyrene beads and bacterial cells, by electron microscopy. The staining method is based on the fact that in an alkaline environment, EGCg produces hydrogen peroxide, and then hydrogen peroxide reacts with cerium, resulting in a cerium hydroperoxide precipitate. This precipitate subsequently reacts with EGCg to produce larger deposits. The amount of precipitate is proportional to the amount of EGCg. Highly EGCg-sensitive Staphylococcus aureus and EGCg-resistant Escherichia coli were treated with EGCg under various pH conditions. Transmission electron microscopy observation showed that the amount of deposits on S. aureus increased with an increase in EGCg concentration. After treating bacterial cells with 0.5mg/mL EGCg (pH 6.0), attachment of EGCg was significantly lower to E. coli than to S. aureus. This is the first report that shows differences in affinity of EGCg to the cell surfaces of Gram-positive and -negative bacteria by electron microscopy. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. One-step synthesis and characterizations of cerium oxide nanoparticles in an ambient temperature via Co-precipitation method

    Science.gov (United States)

    Pujar, Malatesh S.; Hunagund, Shirajahammad M.; Desai, Vani R.; Patil, Shivaprasadgouda; Sidarai, Ashok H.

    2018-04-01

    We report the simple Co-precipitation method for the synthesis of Cerium oxide (CeO2) nanoparticles (NPs) in an ambient temperature. We have taken the Cerium (III) nitrate hexahydrate (Ce(NO3)3.6H2O) and Sodium hydroxide (NaOH) as the precursors. The obtained NPs were analyzed using the UV-Vis spectrophotometer, Fourier transform infrared spectroscopy (FT-IR) and X-ray diffraction (XRD). The obtained results signify that UV-Vis spectrum exhibited a well-defined absorption peak at 274 nm and the estimated energy gap (Eg) is 4.05 eV. The FT-IR analysis provides the supporting evidence for the presence of bonding of O-H, nitrates, alcohols and O-Ce-O vibrations. The XRD result reveals that the synthesized CeO2 NPs was crystallite with cubic phase structure and the estimated average crystallite size of CeO2 NPs using Scherer's and W-H method was significantly different due to their assumptions. Further, it is purposed to study their photocatalytic biological activities.

  2. Thermodynamic characteristics of sorption extraction and chromatographic separation of anionic complexes of erbium and cerium with Trilon B on weakly basic anionite

    Science.gov (United States)

    Cheremisina, O. V.; Ponomareva, M. A.; Sagdiev, V. N.

    2016-03-01

    The adsorption of anionic complexes of erbium with Trilon B on D-403 anionite is studied at ionic strengths of 1 and 2 mol/kg (NaNO3) and temperatures of 298 and 343 K. The values of the stability constants of complex ions of REE with Trilon B and the Gibbs energies of complexation are calculated. The values of the Gibbs energy and the enthalpy and entropy of ion exchange are determined. Using the obtained thermo-dynamic and sorption characteristics, the possible separation of anionic complexes of erbium and cerium with Trilon B is demonstrated via frontal ion-exchange chromatography. A series of sorption capacities of anionic complexes of cerium, yttrium, and erbium is presented using the values of the Gibbs energy of ion exchange.

  3. Nuclear fuel technology - Determination of uranium in solutions, uranium hexafluoride and solids - Part 2: Iron(II) reduction/cerium(IV) oxidation titrimetric method

    International Nuclear Information System (INIS)

    2004-01-01

    This first edition of ISO 7097-1 together with ISO 7097-2:2004 cancels and replaces ISO 7097:1983, which has been technically revised, and ISO 9989:1996. ISO 7097 consists of the following parts, under the general title Nuclear fuel technology - Determination of uranium in solutions, uranium hexafluoride and solids: Part 1: Iron(II) reduction/potassium dichromate oxidation titrimetric method; Part 2: Iron(II) reduction/cerium(IV) oxidation titrimetric method. This part 2. of ISO 7097 describes procedures for determination of uranium in solutions, uranium hexafluoride and solids. The procedures described in the two independent parts of this International Standard are similar: this part uses a titration with cerium(IV) and ISO 7097-1 uses a titration with potassium dichromate

  4. Pyrazolates advance cerium chemistry: a CeIII/CeIV redox equilibrium with benzoquinone.

    Science.gov (United States)

    Werner, Daniel; Deacon, Glen B; Junk, Peter C; Anwander, Reiner

    2017-05-16

    Two stable cerium(iv) 3,5-dialkylpyrazolate complexes are presented, namely dimeric [Ce(Me 2 pz) 4 ] 2 (Me 2 pz = 3,5-dimethylpyrazolate) and monomeric Ce(tBu 2 pz) 4 (tBu 2 pz = 3,5-di-tert-butylpyrazolate) along with their trivalent counterparts [Ce(Me 2 pz) 3 ] and [Ce(tBu 2 pz) 3 ] 2 . All complexes were obtained from protonolysis reactions employing the silylamide precursors Ce[N(SiHMe 2 ) 2 ] 4 and Ce[N(SiMe 3 ) 2 ] 3 . Treatment of homoleptic Ce IV and Ce III Me 2 pz complexes with 1,4-hydroquinone (H 2 hq) or 1,4-benzoquinone (bq), respectively, ultimately gave the same trimetallic Ce III species via a cerium redox equilibrium. The Ce III complex Ce 3 (Me 2 pz) 5 (pchd) 2 (L) (pchd = 1,4-bis(3,5-dimethylpyrazol-1-yl)cyclohex-2,5-diene-1,4-diolato; L = Me 2 pzH or (thf) 2 ) results from a di-1,4-pyrazolyl attack on pre-coordinated bq. The reduction of bq by [Ce(Me 2 pz) 3 (thf)] 2 , and re-oxidation by the resulting Ce IV species was supported by UV-vis spectroscopic investigations. Comparisons with the redox-innocent complexes [Ln(Me 2 pz) 3 (thf)] 2 (Ln = La and Pr) revealed far less selective reactions with bq, giving hexametallic and octametallic rare-earth metal side products containing 2-Me 2 pz substituted hq ligands.

  5. The biological effects of subacute inhalation of diesel exhaust following addition of cerium oxide nanoparticles in atherosclerosis-prone mice

    NARCIS (Netherlands)

    Cassee, Flemming R.; Campbell, Arezoo; Boere, A. John F.; McLean, Steven G.; Duffin, Rodger; Krystek, Petra; Gosens, Ilse; Miller, Mark R.

    Bacground: Cerium oxide (CeO 2) nanoparticles improve the burning efficiency of fuel, however, little is known about health impacts of altered emissions from the vehicles. Methods: Atherosclerosis-prone apolipoprotein E knockout (ApoE -/-) mice were exposed by inhalation to diluted exhaust (1.7mg/m

  6. Heat transfer performance during condensation of R-134a inside helicoidal tubes

    International Nuclear Information System (INIS)

    Al-Hajeri, M.H.; Koluib, A.M.; Mosaad, M.; Al-Kulaib, S.

    2007-01-01

    This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m 2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant

  7. 'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta

    Energy Technology Data Exchange (ETDEWEB)

    Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)

    1988-07-01

    Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)

  8. Determination of Cs-134 and Cs-137 rain water samples

    International Nuclear Information System (INIS)

    Lima, M.F.; Mazzilli, B.

    1988-01-01

    In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt

  9. Causes of seasonal variations of Cs-134/137 activity concentrations in surface air; Ursachen der jahreszeitlichen Schwankungen der Aktivitaetskonzentrationen von Cs-134/137 in der bodennahen Luft

    Energy Technology Data Exchange (ETDEWEB)

    Hoetzl, H. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Winkler, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz

    1993-12-31

    In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called `Stagnationsindex`. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [Deutsch] Zur Klaerung der an verschiedenen Orten Europas in den Wintermonaten beobachteten Maxima der Cs-134/137-Aktivitaetskonzentrationen in der bodennahen Luft wurde von Oktober 1991 bis November 1992 ein Messgrogramm mit relativ kurzen Zeitintervallen fuer die Aerosolsammlung (48-72 Stunden) durchgefuehrt. Gleichzeitig wurden lokale meteorologische Parameter miterfasst. Die statistische Auswertung der Messergebnisse lieferte eine hochsignifikante positive Korrelation zwischen der Aktivitaetskonzentration von Cs-137 und dem sog. Stagnationsindex. Auf Grund dieses Zusammenhangs lassen sich die saisonalen Schwankungen der Cs-134/137-Luftkonzentrationen mit dem haeufigen Auftreten von austauscharmen Wetterlagen in den Herbst- und Wintermonaten erklaeren. (orig.)

  10. Resolution of the uncertainties in the radiative forcing of HFC-134a

    International Nuclear Information System (INIS)

    Forster, Piers M. de F; Burkholder, J.B.; Clerbaux, C.; Coheur, P.F.; Dutta, M.; Gohar, L.K.; Hurley, M.D.; Myhre, G.; Portmann, R.W.; Shine, K.P.; Wallington, T.J.; Wuebbles, D.

    2005-01-01

    HFC-134a (CF 3 CH 2 F) is the most rapidly growing hydrofluorocarbon in terms of atmospheric abundance. It is currently used in a large number of household refrigerators and air-conditioning systems and its concentration in the atmosphere is forecast to increase substantially over the next 50-100 years. Previous estimates of its radiative forcing per unit concentration have differed significantly ∼25%. This paper uses a two-step approach to resolve this discrepancy. In the first step six independent absorption cross section datasets are analysed. We find that, for the integrated cross section in the spectral bands that contribute most to the radiative forcing, the differences between the various datasets are typically smaller than 5% and that the dependence on pressure and temperature is not significant. A 'recommended' HFC-134a infrared absorption spectrum was obtained based on the average band intensities of the strongest bands. In the second step, the 'recommended' HFC-134a spectrum was used in six different radiative transfer models to calculate the HFC-134a radiative forcing efficiency. The clear-sky instantaneous radiative forcing, using a single global and annual mean profile, differed by 8%, between the 6 models, and the latitudinally-resolved adjusted cloudy sky radiative forcing estimates differed by a similar amount. We calculate that the radiative forcing efficiency of HFC-134a is 0.16+/-0.02Wm -2 ppbv -1

  11. Photocatalytic Degradation of Malachite Green Using Nano-sized cerium-iron Oxide

    Directory of Open Access Journals (Sweden)

    K. L. Ameta

    2014-05-01

    Full Text Available Nano-sized cerium-iron oxide nanoparticles has been synthesized, characterized and explored as an efficient photocatalyst for the photocatalytic degradation of malachite green. The effects of different variables on degradation of dye were optimized such as the pH of the dye solution, dye concentration, amount of photocatalyst and light intensity. About 91% degradation of dye of 2×10-5 M concentration was observed after 2 hours at 8.5 pH and 600 Wm-2 light intensity. The reason for the high catalytic activity of the synthesized nanoparticles is ascribed to the high surface area which determines the active sites of the catalyst and accelerates the photocatalytic degradation.

  12. An investigation of the use of cerium and polyhedral oligomeric silsesquioxanes for the protection of polymeric epoxy compounds in the low Earth orbit environment

    Science.gov (United States)

    Piness, Jessica Miriam

    with the epoxy-amine matrix. A sedimented layer of the most incompatible POSS moiety was observed at the bottom of bars at the highest loading level of 5 wt% POSS. It was concluded that POSS could form a sedimented layer in this epoxy during cure. Epoxy amine materials containing POSS derivatives were tested by exposure to atomic oxygen at NASA Glenn Research Center with each POSS derivative present in separate samples at 2.5 wt% loading levels. Mass loss did not decrease against an unfilled control and glassification was not observed, leading to the conclusion that POSS could not be effectively concentrated at a surface to reduce degradation given the methods used. Taking this into account, the study transitioned into seeking ways to integrate highly UV absorbent cerium compounds with POSS. This part of the study is reported in Chapter IV. It was anticipated that POSS with a polar pendant group would interact through intermolecular forces with cerium (IV) oxide and produce a suspension that could be cured at the surface of polymers. However, in every experiment, the cerium (IV) oxide was not dispersed. However, a homogeneous dispersion of a cerium-containing compound was achieved by combining trisilanol phenyl POSS with cerium (III) nitrate hexahydrate. NMR and mass spectrometry showed that the mixture of Cerium nitrate and trisilanol phenyl POSS did not result in the formation of a chemical compound but FTIR studies indicated the presence of hydrogen bonding between the POSS silanols and cerium-associated water. The resulting material was termed "CePOSS". CePOSS was more UV absorbent in the UVc region than POSS or other cerium compounds as measured by solution UV-vis spectroscopy. In addition, CePOSS could be mixed into a POSS-epoxy coating, after pre-blending with poly(ethylene glycol) POSS, to produce films that were essentially opaque in the UV region below a wavelength of about 300 nm, and transparent in the visible region above 300 nm. The discovery of a 'window

  13. Microstructure, texture evolution and magnetic properties of strip-casting non-oriented 6.5 wt.% Si electrical steel doped with cerium

    Energy Technology Data Exchange (ETDEWEB)

    Li, Hao-Ze, E-mail: lhzqq83@163.com; Liu, Hai-Tao; Liu, Zhen-Yu, E-mail: zyliu@mail.neu.edu.cn; Wang, Guo-Dong

    2015-05-15

    A 0.3 mm thick non-oriented 6.5 wt.% Si electrical steel sheet doped with cerium is produced by twin-roll strip casting, hot rolling, warm rolling and annealing. A detailed study of the cerium precipitates in the as-cast strip, microstructure and texture evolution at different processing stages is carried out by electron probe micro-analysis, optical microscopy, X-ray diffraction and electron backscattered diffraction analysis. Grain interior distributing precipitates identified as Ce-oxides, Ce-oxysulfides and Ce-phosphides, and boundary distributing Ce-oxides and Ce-phosphides are observed in the as-cast strip. The initial as-cast strip is characterized by a much finer solidification microstructure and dominated by obvious < 001 >//ND texture through the strip thickness. After hot and warm rolling, inhomogeneous microstructure containing large amounts of in-grain shear bands is characterized by mixed < 110 >//RD and < 111 >//ND textures. The texture of the annealed sheet with a relatively large average grain size is far more optimized by the domination of the beneficial cube, rotated cube, (001)< 120 > to (001)< 130 > and Goss texture components, and the elimination of the detrimental γ-fiber texture, leading to a superior magnetic induction and improved iron loss. - Highlights: • An Fe–6.5 wt.% Si as-cast strip doped with cerium was produced. • A thin warm rolled sheet with limited edge cracks was obtained. • Microstructure and texture evolution at each stage were investigated. • Strong λ-fiber and Goss recrystallization textures were formed. • The magnetic properties of the annealed sheet were significantly improved.

  14. Study of gels of molybdenum with cerium in the preparation of generators of 99Mo-99mTc

    International Nuclear Information System (INIS)

    Moraes, Vanessa; Marczewski, Barbara; Dias, Carla Roberta; Osso Junior, Joao Alberto

    2005-01-01

    99m Tc has ideal nuclear properties for organ imaging in nuclear medicine, and it is obtained from the 99 Mo- 99m Tc generator. Four different types of generators are available: chromatographic that uses 99 Mo from fission of uranium; MEK solvent extraction; Tc 2 O 7 sublimation; gel chromatographic. This work presents the preparation of gel generators of molybdenum with cerium and characterization of the gels: mass ratio between molybdenum and cerium, structure, size of particles and elution percentage of 99m Tc after irradiating the gels. Eight gels were prepared at the same temperature of 50 deg C with concentrations of NaOH of 2 and 4 mol/L, mass ratio of 0.31 and 0.38 and final pH of 3.5 and 4.5. The analysis of the results proved that these gels are not adequate for preparation of the generators of 99 Mo- 99m Tc, since the elution percentages are low, when compared with the gel of molybdenum with zirconium.(author)

  15. Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

    Energy Technology Data Exchange (ETDEWEB)

    Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D

    1993-08-01

    The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)

  16. Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age

    International Nuclear Information System (INIS)

    Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.

    2004-01-01

    In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)

  17. Bio-sensing applications of cerium oxide nanoparticles: Advantages and disadvantages.

    Science.gov (United States)

    Charbgoo, Fahimeh; Ramezani, Mohammad; Darroudi, Majid

    2017-10-15

    Cerium oxide nanoparticles (CNPs) contain several properties such as catalytic activity, fluorescent quencher and electrochemical, high surface area, and oxygen transfer ability, which have attracted considerable attention in developing high-sensitive biosensors. CNPs can be used as a whole sensor or a part of recognition or transducer element. However, reports have shown that applying these nanoparticles in sensor design could remarkably enhance detection sensitivity. CNP's outstanding properties in biosensors which go from high catalytic activity and surface area to oxygen transfer and fluorescent quenching capabilities are also highlighted. Herein, we discuss the advantages and disadvantages of CNPs-based biosensors that function through various detection modes including colorimetric, electrochemistry, and chemoluminescent regarding the detection of small organic chemicals, metal ions and biomarkers. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. 13 CFR 134.714 - When must the Judge issue his or her decision?

    Science.gov (United States)

    2010-01-01

    ... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  19. Neutron Inelastic Scattering on 134Xe at En = 5 - 8 MeV

    Science.gov (United States)

    Kidd, Mary; Tornow, Werner; Finch, Sean; Krishichayan, Fnu; Bhike, Megha

    2017-09-01

    Neutrinoless double-beta decay (0 νββ) studies are both the best way to determine the Majorana nature of the neutrino and determine its effective mass. The two main experiments searching for 0 νββ -decay of 136Xe (Q value = 2457.8 keV) are Kamland-Zen and EXO-200. Though both experiments have enriched 136Xe targets, these targets still contain significant quantities of 134Xe. Recently, a new nuclear level was discovered in 134Xe that decays to the ground state emitting a 2485.7 keV gamma ray. The γ-ray production cross section for this branch was found to be on the order of 10 mb for incident neutron energies of 2.5-4.5 MeV. Here, we have extended the investigation of this level to higher incident neutron energies, and further explore the potential neutron-induced backgrounds on both 134Xe and 136Xe for extended neutron energies. We will report our preliminary results for neutron inelastic scattering on 134Xe in applications to 0 νββ decay searches. NSF PHY-1614348, DE-FG02-97ER41033.

  20. Performance and energy saving analysis of a refrigerator using hydrocarbon mixture (HC-R134a) as working fluid

    Science.gov (United States)

    Mohtar, M. N.; Nasution, H.; Aziz, A. A.

    2015-12-01

    The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a

  1. 43 CFR 13.4 - Terms of permit.

    Science.gov (United States)

    2010-10-01

    ... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...

  2. Protection by Thermal and Chemical Activation with Cerium Salts of the Alloy AA2017 in Aqueous Solutions of NaCl

    Science.gov (United States)

    Bethencourt, Manuel; Botana, Francisco Javier; Cano, María José; González-Rovira, Leandro; Marcos, Mariano; Sánchez-Amaya, José María

    2012-01-01

    A wide variety of anticorrosive treatments for aluminum alloys that can be employed as "green" alternatives to those based on Cr(VI) are currently under development. This article reports a study of the morphological and anticorrosive characteristics of surface layers formed on the Al-Cu alloy AA2017 by immersion treatment in baths of cerium salt, accelerated by increased temperature and the employment of hydrogen peroxide. Scanning electron microscopy (SEM)/X-ray energy dispersive spectroscopy (XEDS) studies of the samples treated have demonstrated the existence of a heterogeneous layer formed by a film of aluminum oxide/hydroxide on the matrix, and a series of dispersed islands of cerium over the cathodic intermetallics. The protective efficacy has been evaluated using electrochemical techniques, linear polarizations (LP) and electrochemical impedance spectroscopy (EIS), and salt spray tests. The results obtained indicate that the layer provided good resistance to corrosion in media with chlorides, and the method gives a considerable reduction of the time required for the immersion treatments.

  3. Adsorption of *sp134*Cs onto two different types of roof materials

    International Nuclear Information System (INIS)

    Quenild, C.; Tveten, U.

    1983-01-01

    The report relates to a subproject under a Nordic project called ''Large reactor accidents - consequences and mitigating actions''. Natural decontamination of two types of roof material, typical of Norwegian and Swedish buildings, was examined. The roofs were contaminated with *sp134*Cs. After two days with 7 mm precipitation, the remaining activity on the tar-paper roof was 97% and on the steel roof 29%. After 8 months the remaining activity was 61% on the tar-paper roof and 22% on the steel roof. In spring *sp134*Cs was spread upon an 8 cm thick layer of fresh snow on an additional tar-paper roof. After 3 montsh and 191 mm precipitation the remaining activity was 59%. All results are based upon *sp134*Cs in collected run-off water.(Auth.)

  4. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Energy Technology Data Exchange (ETDEWEB)

    Janoš, Pavel, E-mail: pavel.janos@ujep.cz [Faculty of the Environment, University of Jan Evangelista Purkyně, Králova Výšina 7, 400 96 Ústí nad Labem (Czech Republic); Henych, Jiří [Faculty of the Environment, University of Jan Evangelista Purkyně, Králova Výšina 7, 400 96 Ústí nad Labem (Czech Republic); Institute of Inorganic Chemistry AS CR v.v.i., 25068 Řež (Czech Republic); Pelant, Ondřej; Pilařová, Věra; Vrtoch, Luboš [Faculty of the Environment, University of Jan Evangelista Purkyně, Králova Výšina 7, 400 96 Ústí nad Labem (Czech Republic); Kormunda, Martin [Faculty of Sciences, University of Jan Evangelista Purkyně, České Mládeže 8, 400 96 Ústí nad Labem (Czech Republic); Mazanec, Karel [Military Research Institute, Veslařská 230, 637 00 Brno (Czech Republic); and others

    2016-03-05

    Highlights: • Four synthetic routes were compared to prepare the nanoceria-based reactive sorbents. • The sorbents prepared by homogeneous hydrolysis destroy efficiently the soman and VX nerve agents. • Toxic organophosphates are converted to less-dangerous products completely within a few minutes. • Surface non-stoichiometry and −OH groups promote the destruction by the S{sub N}2 mechanism. - Abstract: Four different synthetic routes were used to prepare active forms of cerium oxide that are capable of destroying toxic organophosphates: a sol–gel process (via a citrate precursor), homogeneous hydrolysis and a precipitation/calcination procedure (via carbonate and oxalate precursors). The samples prepared via homogeneous hydrolysis with urea and the samples prepared via precipitation with ammonium bicarbonate (with subsequent calcination at 500 °C in both cases) exhibited the highest degradation efficiencies towards the extremely dangerous nerve agents soman (O-pinacolyl methylphosphonofluoridate) and VX (O-ethyl S-[2-(diisopropylamino)ethyl] methylphosphonothioate) and the organophosphate pesticide parathion methyl. These samples were able to destroy more than 90% of the toxic compounds in less than 10 min. The high degradation efficiency of cerium oxide is related to its complex surface chemistry (presence of surface −OH groups and surface non-stoichiometry) and to its nanocrystalline nature, which promotes the formation of crystal defects on which the decomposition of organophosphates proceeds through a nucleophilic substitution mechanism that is not dissimilar to the mechanism of enzymatic hydrolysis of organic phosphates by phosphotriesterase.

  5. Implementation of R134a Thermophysical Properties for MARS Application

    Energy Technology Data Exchange (ETDEWEB)

    Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-05-15

    MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.

  6. Kinetics of bromide catalysed oxidation of dextrose by cerium (IV) in aqueous sulphuric acid solution

    International Nuclear Information System (INIS)

    Sharma, J.; Sah, M.P.

    1994-01-01

    Kinetics of bromide catalysed oxidation of dextrose by Ce IV in aqueous sulphuric acid medium show first order dependence each in dextrose and cerium(IV). The reaction rate decreases on increasing the concentration of hydrogen ion. The increase in [HSO 4 - ] or [SO 4 2- ] decreases the rate. The bromide ion shows positive catalytic effect on the reaction rate. The value of activation energy has been calculated and a suitable mechanism confirming to the kinetic data is proposed. (author). 3 refs., 3 tabs

  7. Thermoluminescence and sintering of ultra-pure {alpha} alumina doped with zirconium, thorium, calcium or cerium; Thermoluminescence et frittage de l'alumine {alpha} ultra-pure dopee par le zirconium, le thorium, le calcium, ou le cerium

    Energy Technology Data Exchange (ETDEWEB)

    Ferey, F

    2002-01-01

    Thermoluminescence is a technique of identification of the point defects that appear in a solid consecutively to its fabrication. The synthesis parameters of {alpha}-alumina that will be taken into account here are the atmosphere during thermal treatment (oxidising or reducing), and the effect of the dopants: zirconium, thorium, calcium or cerium. The aim of this work is to correlate the point defects to the reactivity of the powder, especially its sintering. The TL mechanisms of the dosimetric peak of {alpha}-alumina, around 200 deg C, were clarified: the trap is an aggregate of 2 point defects (V{sub al}-V{sub O}), and the recombination centre is Cr{sup 3+}. The sensibilizing effect observed for thorium, or for cerium under reducing atmosphere, is attributed to the presence of a large emission band in the blue-green domain. Chromium is the main impurity at the origin of the E' peak (360 deg C) of {alpha}-alumina. It is acting as trap and also as recombination centre. A mechanism of transfer of energy between Cr{sup 3+} and Ti{sup 4+} is also presented in order to explain the increase of the TL intensity of the E' peak when doping by a tetravalent cation. In the case of doping by calcium, TL allows the revelation of the phase CaAl{sub 12}O{sub 19}. A quenching was observed for {alpha}Al{sub 2}O{sub 3}:Ca and {alpha}Al{sub 2}O{sub 3}:Ce under reducing atmosphere. It is attributed to oxygen vacancies for the doping by calcium, and to the presence of Ce{sup 3+} for the doping by cerium. The alumina prepared under reducing conditions exhibit a perturbation of kinetics during sintering, and also abnormal grain growth in doped samples. This unusual kinetic is explained by a decrease in the concentration of aluminium vacancies under reducing atmosphere, conducting indirectly to a greater segregation of Si{sup 4+} at the grain boundaries, and to the formation of a liquid phase at the surface of grains. This phenomenon is amplified in the case of doping by

  8. Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)

    International Nuclear Information System (INIS)

    Norfaizal Mohamed; Nita Salina Abu Bakar; Zal Uyun Wan Mahmood; Nur Hidaya Dmuliany Mohd Sidek; Zaharudin Ahmad

    2010-01-01

    Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)

  9. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 ke...

  10. All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)

    2014-12-15

    We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.

  11. 40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.

    Science.gov (United States)

    2010-07-01

    ... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...

  12. Determination of Cerium (IV) Using Rhodamine 6G Fluorescence Quenching

    Science.gov (United States)

    Zhao, Zh.; Sheng, L.; Su, B.; Tao, C.; Jing, W.

    2017-11-01

    The interaction between rhodamine 6G (Rh6G) and cerium sulfate was studied by the fluorescence quenching method. In a sulfuric acid medium, the interaction of Ce(IV) with Rh6G results in Rh6G fluorescence quenching. The maximum excitation wavelength (λex) and the maximum emission wavelength (λem) are 530 nm and 555 nm, respectively. A good linearity between the relative fl uorescence intensity (ΔF) and Ce(IV) was observed in the range 0.12-1.08 μg/mL. The detection limit was 1.4 × 10-3 μg/mL. The optimum reaction conditions, influencing factors, and effect of coexisting substances were investigated in the experiment. We found that the concentration of Rh6G was 3.2 × 10-6 mol/L, and the fl uorescence intensity was maximum.

  13. Development and design application of cerium (IV) decontamination process

    International Nuclear Information System (INIS)

    Bray, L.A.; Seay, J.M.

    1988-01-01

    A simple and effective method was developed for decontamination of high-level waste canisters. This method of chemical decontamination is applicable to a wide variety of contaminated equipment found in the nuclear industry. Conceptual design of the cerium [Ce(IV)] decontamination process equipment has been completed for the West Valley Demonstration project (WVDP) vitrification facility. This remote equipment, which is the first engineering scale application of this technology, will remove surface contamination from stainless-steel (SS) containers containing high-level waste (HLW) glass prior to placing them into temporary storage and ultimate shipment to a U.S. Department of Energy (DOE) repository for disposal. The objective of the development and design study was to identify an effective chemical process and to design equipment to decontaminate the HLW glass canisters to limits that meet U.S. DOE requirements. The equipment includes canister-capping and smear stations in addition to the decontamination module and associated services

  14. Development and design application of cerium (IV) decontamination process

    International Nuclear Information System (INIS)

    Bray, L.A.; Seay, J.M.

    1988-10-01

    A simple and effective method was developed for decontamination of high-level waste canisters. This method of chemical decontamination is applicable to a wide variety of contaminated equipment found in the nuclear industry. Conceptual design of the cerium [Ce(IV)] decontamination process equipment has been completed for the West Valley Demonstration Project (WVDP) vitrification facility. This remote equipment, which is the first engineering scale application of this technology, will remove surface contamination from stainless-steel (SS) containers containing high-level waste (HLW) glass prior to placing them into temporary storage and ultimate shipment to a US Department of Energy (DOE) repository for disposal. The objective of the development and design study was to identify an effective chemical process and to design equipment to decontaminate the HLW glass canisters to limits that meet USDOE requirements. The equipment includes canister-capping and smear stations in addition to the decontamination module and associated services. 2 refs., 1 fig

  15. Structure, dielectric and electrical properties of cerium doped barium zirconium titanate ceramics

    International Nuclear Information System (INIS)

    Feng Hongjun; Hou Jungang; Qu Yuanfang; Shan Dan; Yao Guohua

    2012-01-01

    Highlights: ► Rare-earth doped barium zirconate titanate (BZT) ceramics, Ba(Zr 0.25 Ti 0.75 )O 3 + xCeO 2 , (x = 0–1.5 at%) were obtained by a solid state reaction route. ► Morphological analysis on sintered samples by scanning electron microscopy shows that the addition of rare-earth ions affects the growth of the grain and remarkably changes the grain morphology. ► The effect of rare-earth addition to BZT on dielectric and electrical properties is analyzed, demonstrating that the samples with x = 0.4 and x = 0.6 could be semiconducting in air atmosphere. - Abstract: Rare-earth doped barium zirconium titanate (BZT) ceramics, Ba(Zr 0.25 Ti 0.75 )O 3 + xCeO 2 , (x = 0–1.5 at%) were obtained by a solid state reaction route. Perovskite-like single-phase compounds were confirmed from X-ray diffraction data and the lattice parameters were refined by the Rietveld method. It is found that, integrating with the lattice parameters and the distortion of crystal lattice, there is an alternation of substitution preference of cerium ions for the host cations in perovskite lattice. Morphological analysis on sintered samples by scanning electron microscopy shows that the addition of rare-earth ions affects the growth of the grain and remarkably changes the grain morphology. The effect of rare-earth addition to BZT on dielectric and electrical properties is analyzed. High values of dielectric tunability are obtained for cerium doped BZT. Especially, the experimental results on the effect of the contents of rare-earth addition on the resistivity of BZT ceramics were investigated, demonstrating that the samples with x = 0.4 and x = 0.6 could be semiconducting in air atmosphere.

  16. Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole

    International Nuclear Information System (INIS)

    Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.

    2015-01-01

    Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.

  17. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium; Estudio de la oxidacion ciclica de los aceros inoxidables AISI 309 T 253 MA, con pequenas adiciones de Cerio

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)

    1998-12-31

    It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  18. Separation of 134Cs and 137Cs from 125I solution for medical applications

    International Nuclear Information System (INIS)

    Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy

    2015-01-01

    While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.

  19. Experimental study of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator

    International Nuclear Information System (INIS)

    Wongwises, Somchai; Chimres, Nares

    2005-01-01

    This work presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). A refrigerator designed to work with HFC-134a with a gross capacity of 239 l is used in the experiment. The consumed energy, compressor power and refrigerant temperature and pressure at the inlet and outlet of the compressor are recorded and analysed as well as the distributions of temperature at various positions in the refrigerator. The refrigerant mixtures used are divided into three groups: the mixture of three hydrocarbons, the mixture of two hydrocarbons and the mixture of two hydrocarbons and HFC-134a. The experiments are conducted with the refrigerants under the same no load condition at a surrounding temperature of 25 deg. C. The results show that propane/butane 60%/40% is the most appropriate alternative refrigerant to HFC-134a

  20. Synthesis and performance of cerium oxide as anode materials for lithium ion batteries by a chemical precipitation method

    International Nuclear Information System (INIS)

    Liu, Haowen; Le, Qi

    2016-01-01

    In this present work, chemical precipitation method was employed for preparing cerium oxide. XRD, SEM, TEM, TGA/DTA and BET were used to investigate the structure, shape and formation mechanism, respectively. No impurities were detected. It was found that alcohol had obvious effection on the growth of the final sample. The shape of the precursor was retained after calcined at 500 °C. This result led to the possibility of an easy scale up to a commercial process. EIS and charge–discharge tests were carried out by using the as-prepared CeO_2 as an anode material for lithium ion batteries. Specially, the initial discharge specific capacity of the rhombus CeO_2 was about 529 mAh g"−"1 and stabilized reversibly at about 374 mAh g"−"1 after 50 cycles. It showed a promising usage as anode materials in lithium ion battery. - Highlights: • Chemical precipitation method was employed for the synthesis of cerium oxide. • Alcohol has obvious effection on the growth of the final sample. • The rhombus CeO_2 showed the better electrochemical properties as anode of lithium ion batteries.

  1. Synthesis and performance of cerium oxide as anode materials for lithium ion batteries by a chemical precipitation method

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Haowen, E-mail: liuhwchem@hotmail.com; Le, Qi

    2016-06-05

    In this present work, chemical precipitation method was employed for preparing cerium oxide. XRD, SEM, TEM, TGA/DTA and BET were used to investigate the structure, shape and formation mechanism, respectively. No impurities were detected. It was found that alcohol had obvious effection on the growth of the final sample. The shape of the precursor was retained after calcined at 500 °C. This result led to the possibility of an easy scale up to a commercial process. EIS and charge–discharge tests were carried out by using the as-prepared CeO{sub 2} as an anode material for lithium ion batteries. Specially, the initial discharge specific capacity of the rhombus CeO{sub 2} was about 529 mAh g{sup −1} and stabilized reversibly at about 374 mAh g{sup −1} after 50 cycles. It showed a promising usage as anode materials in lithium ion battery. - Highlights: • Chemical precipitation method was employed for the synthesis of cerium oxide. • Alcohol has obvious effection on the growth of the final sample. • The rhombus CeO{sub 2} showed the better electrochemical properties as anode of lithium ion batteries.

  2. Morphine Preconditioning Downregulates MicroRNA-134 Expression Against Oxygen-Glucose Deprivation Injuries in Cultured Neurons of Mice.

    Science.gov (United States)

    Meng, Fanjun; Li, Yan; Chi, Wenying; Li, Junfa

    2016-07-01

    Brain protection by narcotics such as morphine is clinically relevant due to the extensive use of narcotics in the perioperative period. Morphine preconditioning induces neuroprotection in neurons, but it remains uncertain whether microRNA-134 (miR-134) is involved in morphine preconditioning against oxygen-glucose deprivation-induced injuries in primary cortical neurons of mice. The present study examined this issue. After cortical neurons of mice were cultured in vitro for 6 days, the neurons were transfected by respective virus vector, such as lentiviral vector (LV)-miR-control-GFP, LV-pre-miR-134-GFP, LV-pre-miR-134-inhibitor-GFP for 24 hours; after being normally cultured for 3 days again, morphine preconditioning was performed by incubating the transfected primary neurons with morphine (3 μM) for 1 hour, and then neuronal cells were exposed to oxygen-glucose deprivation (OGD) for 1 hour and oxygen-glucose recovery for 12 hours. The neuronal cells survival rate and the amount of apoptotic neurons were determined by MTT assay or TUNEL staining at designated time; and the expression levels of miR-134 were detected using real-time reverse transcription polymerase chain reaction at the same time. The neuronal cell survival rate was significantly higher, and the amount of apoptotic neurons was significantly decreased in neurons preconditioned with morphine before OGD than that of OGD alone. The neuroprotection induced by morphine preconditioning was partially blocked by upregulating miR-134 expression, and was enhanced by downregulating miR-134 expression. The expression of miR-134 was significantly decreased in morphine-preconditioned neurons alone without transfection. By downregulating miR-134 expression, morphine preconditioning protects primary cortical neurons of mice against injuries induced by OGD.

  3. Evaluation of self-healing ability in protective coatings modified with combinations of layered double hydroxides and cerium molibdate nanocontainers filled with corrosion inhibitors

    International Nuclear Information System (INIS)

    Montemor, M.F.; Snihirova, D.V.; Taryba, M.G.; Lamaka, S.V.; Kartsonakis, I.A.; Balaskas, A.C.; Kordas, G.C.; Tedim, J.; Kuznetsova, A.; Zheludkevich, M.L.; Ferreira, M.G.S.

    2012-01-01

    Nowadays, there is a strong demand on the search of thinner, but more effective organic coatings for corrosion protection of metallic substrates, like galvanised steel, used in the automotive industry. In order to guarantee effective corrosion protection of these coatings, and because chromate-based pigments cannot be used, one of the most attractive strategies consists on the modification of the organic matrix with nano-additives filled with corrosion inhibitors, which can be released to the active sites. In this work, two different nano-additives are explored as potential self-healing materials for the development of active protective coatings. These additives are layered double hydroxides and cerium molybdate hollow nanospheres loaded with mercaptobenzothiazole, as a corrosion inhibitor. These additives were added to epoxy primers, individually, or combining the two nanoadditives in the same layer. The electrochemical behaviour and the potential of self-healing ability were studied by electrochemical impedance spectroscopy, scanning vibrating electrode technique and scanning ion-selective electrode technique. The results reveal that both types of nanocontainers can provide effective corrosion inhibition on artificial induced defects, at different stages of the degradation process. Moreover, the results also show that there is a synergistic effect concerning corrosion inhibition and self-healing potential when a mixture of the two nanocontainers is used. The mechanism of self healing is presented and discussed in terms of effect of organic inhibitor and role of the nanocontainers, including effect of cerium ions released from cerium molibdate nanoparticles.

  4. Cerium(IV) Tellurite Halides [Ce 2 Te 7 O 17 ]X 2 (X = Cl or Br ): The First Cerium-Containing Cationic Frameworks

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jian [Department of Civil; amp, Environmental Engineering & amp, Earth Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, 156 Fitzpatrick Hall, Notre; Diwu, Juan [Department of Civil; amp, Environmental Engineering & amp, Earth Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, 156 Fitzpatrick Hall, Notre; Cross, Justin N. [Department of Civil; amp, Environmental Engineering & amp, Earth Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, 156 Fitzpatrick Hall, Notre; Villa, Eric M. [Department of Civil; amp, Environmental Engineering & amp, Earth Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, 156 Fitzpatrick Hall, Notre; Albrecht-Schmitt, Thomas E. [Department of Chemistry

    2012-09-13

    Two isotypic cerium tellurite halides with the formulas [Ce2Te7O17]Cl2 and [Ce2Te7O17]Br2 have been synthesized hydrothermally via the reactions of CeCl3 and CeBr3 with TeO2. The structures of these compounds feature a cationic inorganic framework. The CeIV dimers are bound by a novel 3D Te7O176– building unit, forming an unusual hexagonal-bipyramidal environment around CeIV.

  5. Redox-active cerium oxide nanoparticles protect human dermal fibroblasts from PQ-induced damage

    Directory of Open Access Journals (Sweden)

    Claudia von Montfort

    2015-04-01

    Full Text Available Recently, it has been published that cerium (Ce oxide nanoparticles (CNP; nanoceria are able to downregulate tumor invasion in cancer cell lines. Redox-active CNP exhibit both selective pro-oxidative and antioxidative properties, the first being responsible for impairment of tumor growth and invasion. A non-toxic and even protective effect of CNP in human dermal fibroblasts (HDF has already been observed. However, the effect on important parameters such as cell death, proliferation and redox state of the cells needs further clarification. Here, we present that nanoceria prevent HDF from reactive oxygen species (ROS-induced cell death and stimulate proliferation due to the antioxidative property of these particles.

  6. Boric Acid as an Accelerator of Cerium Surface Treatment on Aluminum

    Directory of Open Access Journals (Sweden)

    K. Cruz-Hernández

    2014-01-01

    Full Text Available Aluminum pieces are often used in various industrial processes like automotive and aerospace manufacturing, as well as in ornamental applications, so it is necessary to develop processes to protect these materials, processes that can be industrialized to protect the aluminum as well or better than chromate treatments. The purpose of this research is to evaluate boric acid as an accelerator by optimizing its concentration in cerium conversion coatings (CeCC with 10-minute immersion time with a concentration of 0.1 g L−1 over aluminum to protect it. The evaluation will be carried out by measuring anticorrosion properties with electrochemical techniques (polarization resistance, Rp, polarization curves, PC, and electrochemical impedance spectroscopy, EIS in NaCl 3.5% wt. aqueous solution and surface characterization with scanning electron microscopy (SEM.

  7. Synthesis of novel 2,5-disubstituted-1,3,4-selenadiazoles from fatty acid hydrazides

    Directory of Open Access Journals (Sweden)

    Himani Varshney

    2018-01-01

    Full Text Available A series of novel unsaturated hydroxy and non-hydroxy fatty acid residue substituted 1,3,4-selenadiazoles were described here. These derivatives were synthesized from the reaction of fatty acid hydrazide 1(a–d with acetyl chloride in the presence of anhydrous sodium carbonate in tetrahydrofuran and water at 0 °C, to form N′-acetyl undec-10-enoic hydrazide 2a, N′-acetyl-(9Z-octadec-9-enoic hydrazide 2b, N′-acetyl-(9Z, 12R-12-hydroxy-9-enoic hydrazide 2c, and N′-acetyl-(9R, 12Z-9-hydroxy-12-enoic hydrazide 2d. Then these hydrazines (dicarbonyl compound on reaction with Woollin’s reagent (WR in toluene led to the corresponding 2-(dec-9′-enyl-5-methyl-1,3,4-selenadiazole 3a, 2-[(8′Z-heptadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3b, 2-[(8′Z, 11′R-11′-hydroxy-octadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3c, and 2-[(8′R, 11′Z-8′-hydroxy-octadec-11′-enyl]-5-methyl-1,3,4-selenadiazole 3d, respectively. These synthesized compounds were characterized on the basis of IR, 1H NMR, 13C NMR, mass spectra and elemental analysis results.

  8. Fabrication of Al5083 surface composites reinforced by CNTs and cerium oxide nano particles via friction stir processing

    Energy Technology Data Exchange (ETDEWEB)

    Hosseini, S.A. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Ranjbar, Khalil, E-mail: k_ranjbar@scu.ac.ir [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Dehmolaei, R. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Amirani, A.R. [12th Ghaem Street, Bld. Hashemzadeh, Shahrak Golestan, Tehran (Iran, Islamic Republic of)

    2015-02-15

    Highlights: • Using friction stir processing, an effect of CNTs and CeO{sub 2} reinforcements on mechanical and corrosion properties of Al5083 alloy is reported. • The strength of Al5083 was increased by 42%, its matrix grain size reduced five times, and hardness was doubled by the incorporation of CNTs-CeO{sub 2} mixture in the volume ratio of 75-25 respectively. • Unlike the CNTs, incorporation of nanosized CeO{sub 2} particles resulted in remarkable increase in pitting resistance of the alloy. - Abstract: In the present investigation, friction stir processing (FSP) was utilized to incorporate Multi Walled Carbon Nano Tubes (MWCNT) and nanosized cerium oxide particles into the matrix of Al5083 alloy to form surface reinforced composites. The effect of these nanosized reinforcements either separately or in the combined form, on microstructural modification, mechanical properties and corrosion resistance of FSPed Al5083 surface composites was studied. A threaded cylindrical hardened steel tool was used with the rotation speeds of 600 and 800 rpm and travel speeds of 35 and 45 mm/min and a tilt angle of 5°. Mechanical properties and corrosion resistance of FSPed samples were evaluated and compared with the base alloy. The maximum tensile strength and hardness value were achieved for the hybrid composite containing a mixture of CNTs and cerium oxide in the volume ratio of 75-25, respectively, whereas a significant increase in pitting resistance of the base alloy was obtained when cerium oxide alone was incorporated. The corrosion behavior of the samples was investigated by potentiodynamic polarization tests and assessed in term of pitting potential and passivation range. Microstructural analysis carried out by using optical and electron microscopes showed that reinforcements are well dispersed inside the nugget zone (NZ), and remarkable grain refinement is gained. The study was aimed to fabricate surface composites with improved mechanical properties and

  9. Simple preparation of fluorescent composite films based on cerium and europium doped LaF3 nanoparticles

    Science.gov (United States)

    Secco, Henrique de L.; Ferreira, Fabio F.; Péres, Laura O.

    2018-03-01

    The combination of materials to form hybrids with unique properties, different from those of the isolated components, is a strategy used to prepare functional materials with improved properties aiming to allow their application in specific fields. The doping of lanthanum fluoride with other rare earth elements is used to obtain luminescent particles, which may be useful to the manufacturing of electronic devices' displays and biological markers, for instance. The application of the powder of nanoparticles has limitations in some fields; to overcome this, the powder may be incorporated in a suitable polymeric matrix. In this work, lanthanum fluoride nanoparticles, undoped and doped with cerium and europium, were synthesized through the co-precipitation method in aqueous solution. Aiming the formation of solid state films, composites of nanoparticles in an elastomeric matrix, the nitrile rubber (NBR), were prepared. The flexibility and the transparency of the matrix in the regions of interest are advantages for the application of the luminescent composites. The composites were applied as films using the casting and the spin coating techniques and luminescent materials were obtained in the samples doped with europium and cerium. Scanning electron microscopy images showed an adequate dispersion of the particles in the matrix in both film formation techniques. Aggregates of the particles were detected in the samples which may affect the uniformity of the emission of the composites.

  10. Lanthanum and cerium co-modified Ni/SiO2 catalyst for CO methanation from syngas

    Science.gov (United States)

    Gong, Dandan; Li, Shuangshuang; Guo, Shaoxia; Tang, Honggui; Wang, Hong; Liu, Yuan

    2018-03-01

    Sintering of active metal nanoparticles (NPs) and carbon deposition is critical problems for many metal catalysts, such as nickel based catalysts for generating methane from syngas. To improve the resistance to the sintering and carbon deposition, a new scheme was proposed in this work. Lanthanum and cerium co-modified Ni/SiO2 catalysts were synthesized by using perovskite type oxide of La1-xCexNiO3 loaded on SiO2 as the precursor. In a nanocrystallite of La1-xCexNiO3, ions of nickel, lanthanum and cerium are evenly mixed at atomic level and confined in the nanocrystallite, therefore, Ni NPs and the two promoters of La2O3 and CeO2 should be in close contact and highly dispersed on SiO2 after reduction. The catalysts were characterized by using XRD, TEM, BET, H2-TPD, XPS, TG and Raman techniques. Compared with the mono-promoted catalysts, the bi-promoted La0.75Ce0.25NiO3/SiO2 showed much better resistance to carbon deposition, higher resistance to sintering and higher activity for CO methanation, which are attributed to co-eliminating effect of the two promoters for the deposited carbon, confinement of the interacted two promoters for Ni NPs and the higher dispersion of Ni NPs derived from the smaller size of La0.75Ce0.25NiO3.

  11. Study of gels of molybdenum with cerium in the preparation of generators of {sup 99}Mo-{sup 99m}Tc

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, Vanessa; Marczewski, Barbara; Dias, Carla Roberta; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia

    2005-10-15

    {sup 99m} Tc has ideal nuclear properties for organ imaging in nuclear medicine, and it is obtained from the {sup 99}Mo-{sup 99m} Tc generator. Four different types of generators are available: chromatographic that uses {sup 99}Mo from fission of uranium; MEK solvent extraction; Tc{sub 2}O{sub 7} sublimation; gel chromatographic. This work presents the preparation of gel generators of molybdenum with cerium and characterization of the gels: mass ratio between molybdenum and cerium, structure, size of particles and elution percentage of {sup 99m} Tc after irradiating the gels. Eight gels were prepared at the same temperature of 50 deg C with concentrations of NaOH of 2 and 4 mol/L, mass ratio of 0.31 and 0.38 and final pH of 3.5 and 4.5. The analysis of the results proved that these gels are not adequate for preparation of the generators of {sup 99}Mo-{sup 99m} Tc, since the elution percentages are low, when compared with the gel of molybdenum with zirconium.(author)

  12. Dynamics of cesium-134 and biomass in treated and untreated turkey oak leaf-litter bags

    International Nuclear Information System (INIS)

    Croom, J.M.; Ragsdale, H.L.

    1978-01-01

    Litter bags were prepared from leaves harvested in late fall from turkey oak trees (Quercus laevis) tagged with 134 Cs. Untreated bags and bags treated by soaking in 1000 ppM HgCl 2 were placed in the field on Dec. 7, 1974. Five bags of each treatment were retrieved at 7-, 14-, and 30-day intervals as the experiment progressed. Treated bags remained free of visible fungal hyphae growth for 12 weeks. Untreated bags had lost more weight but less 134 Cs than treated bags after 14 and 56 days, respectively. After 9 months, untreated bags had lost 33% weight and 90% 134 Cs. Although 134 Cs is rapidly leached from litter (ecological half-life approximately equal to 12 weeks), some is retained by fungal hyphae on leaf-litter surfaces. This mechanism of mineral retention in the litter layer could represent adaptation at the ecosystem level for nutrient conservation

  13. Neutron-induced Backgrounds in 134Xe for Large-Scale Neutrinoless Double-Beta Decay Experiments

    Science.gov (United States)

    Moriguchi, Nina; Kidd, Mary; Tornow, Werner

    2016-09-01

    136Xe is used in large neutrinoless double-beta (0 νββ) decay experiments, such as KamLAND- Zen and EXO 200. Though highly purified, 136Xe still contains a significant amount of 134Xe. Recently, a new nuclear energy level was found in 134Xe. If 134Xe decays from this proposed excited state, it will emit a 2485.7 keV gamma ray. Because this energy lies near the region of interest of 136Xe νββ decay experiments (Q value 2457.8 keV), it could make a significant contribution to the background. A purified gaseous sample of 134Xe will be irradiated with neutrons of an incident energy of 4.0 MeV at Triangle Universities Nuclear Laboratory and monitored with high-purity germanium detectors. The spectra obtained from these detectors will be analyzed for the presence of the 2581 keV gamma ray. We will report on the status of this experiment. Future plans include expanding this measurement to higher initial neutron energies. Tennesse Tech University CISE Grant program.

  14. 13 CFR 134.618 - How are awards paid?

    Science.gov (United States)

    2010-01-01

    ... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...

  15. New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

    2017-08-15

    A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

  16. Development of two-stage compression heat pump for hot water supply in commercial use. Research of compatibility with alternative refrigerant, HFC-134a; Gyomuyo nidan asshukushiki kyuto heat pump no kaihatsu. Daitai reibai HFC-134a no tekiyosei kensho

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)

    1996-03-01

    Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.

  17. Antioxidant Cerium Oxide Nanoparticles in Biology and Medicine

    Directory of Open Access Journals (Sweden)

    Bryant C. Nelson

    2016-05-01

    Full Text Available Previously, catalytic cerium oxide nanoparticles (CNPs, nanoceria, CeO2-x NPs have been widely utilized for chemical mechanical planarization in the semiconductor industry and for reducing harmful emissions and improving fuel combustion efficiency in the automobile industry. Researchers are now harnessing the catalytic repertoire of CNPs to develop potential new treatment modalities for both oxidative- and nitrosative-stress induced disorders and diseases. In order to reach the point where our experimental understanding of the antioxidant activity of CNPs can be translated into useful therapeutics in the clinic, it is necessary to evaluate the most current evidence that supports CNP antioxidant activity in biological systems. Accordingly, the aims of this review are three-fold: (1 To describe the putative reaction mechanisms and physicochemical surface properties that enable CNPs to both scavenge reactive oxygen species (ROS and to act as antioxidant enzyme-like mimetics in solution; (2 To provide an overview, with commentary, regarding the most robust design and synthesis pathways for preparing CNPs with catalytic antioxidant activity; (3 To provide the reader with the most up-to-date in vitro and in vivo experimental evidence supporting the ROS-scavenging potential of CNPs in biology and medicine.

  18. Comparisons of plutonium, thorium, and cerium tellurite sulfates.

    Science.gov (United States)

    Lin, Jian; Cross, Justin N; Diwu, Juan; Meredith, Nathan A; Albrecht-Schmitt, Thomas E

    2013-04-15

    The hydrothermal reaction of PuCl3 or CeCl3 with TeO2 in the presence of sulfuric acid under the comparable conditions results in the crystallization of Pu(TeO3)(SO4) or Ce2(Te2O5)(SO4)2, respectively. Pu(TeO3)(SO4) and its isotypic compound Th(TeO3)(SO4) are characterized by a neutral layer structure with no interlamellar charge-balancing ions. However, Ce2(Te2O5)(SO4)2 possesses a completely different dense three-dimensional framework. Bond valence calculation and UV-vis-NIR spectra indicate that the Ce compound is trivalent whereas the Pu and Th compounds are tetravalent leading to the formation of significantly different compounds. Pu(TeO3)(SO4), Th(TeO3)(SO4), and Ce2(Te2O5)(SO4)2 represent the first plutonium/thorium/cerium tellurite sulfate compounds. Our study strongly suggests that the chemistries of Pu and Ce are not the same, and this is another example of the failure of Ce as a surrogate.

  19. Assessment of propane/commercial butane mixtures as possible alternatives to R134a in domestic refrigerators

    International Nuclear Information System (INIS)

    Fatouh, M.; El Kafafy, M.

    2006-01-01

    The possibility of using hydrocarbon mixtures as working fluids to replace R134a in domestic refrigerators has been evaluated through a simulation analysis in the present work. The performance characteristics of domestic refrigerators were predicted over a wide range of evaporation temperatures (-35 to -10 o C) and condensation temperatures (40-60 deg. C) for various working fluids such as R134a, propane, commercial butane and propane/iso-butane/n-butane mixtures with various propane mass fractions. The performance characteristics of the considered domestic refrigerator were identified by the coefficient of performance (COP), volumetric cooling capacity, cooling capacity, condenser capacity, input power to compressor, discharge temperature, pressure ratio and refrigerant mass flow rate. The results showed that pure propane could not be used as a drop in replacement for R134a in domestic refrigerators because of its high operating pressures and low COP. Commercial butane yields many desirable characteristics but requires a compressor change. The coefficient of performance of the domestic refrigerator using a ternary hydrocarbon mixture with propane mass fractions from 0.5 to 0.7 is higher than that of R134a. Comparison among the considered working fluids confirmed that the average refrigerant mass flow rate of the propoane/commercial butane mixture is 50% lower than that of R134a. Also, the results indicated that R134a and the propoane/commercial butane mixture with 60% propane mass concentration have approximately the same values of saturation pressure, compressor discharge temperature, condenser heat load, input power, cooling capacity and volumetric cooling capacity. However, the pressure ratio of the hydrocarbon mixture with 60% propane is lower than that of R134a by about 11.1%. Finally, the reported results confirmed that the propane/iso-butane/n-butane mixture with 60% propane is the best drop in replacement for R134a in domestic refrigerators under normal

  20. An experimental evaluation of the greenhouse effect in the substitution of R134a with CO2

    International Nuclear Information System (INIS)

    Aprea, C.; Greco, A.; Maiorino, A.

    2012-01-01

    This paper addresses the problem of R314a substitution with a natural refrigerant fluid. Attention is devoted to the evaluation of the environmental impact, in terms of greenhouse effect. R134a and R744 (CO 2 ) are compared to one another. The hydrofluorocarbon R134a has a large direct warming impact (GWP), whereas the R744 contribution is negligible. The greenhouse effect is determined by the experimental evaluation of the TEWI index (Total Equivalent Warming Impact) that takes into account both direct and indirect contributions to global warming. This paper compares a commercial R134a refrigeration plant and a prototype R744 system working in a trans-critical cycle. The experimental results clearly show that the latter has a larger TEWI than the system operating with R134a. The indirect contribution to global warming provided by R744 is always greater than that of R134a. This contribution prevails in most cases. Only few operating conditions corresponding to a refrigerating plant working as a classical split system benefits, in terms of greenhouse effect, of the substitution of R134a with R744. -- Highlights: ► A comparison between a classical vapour compression plant and a trans-critical cycle. ► Evaluation of the greenhouse effect in R134a substitution with R744. ► Evaluation of direct and indirect contribution to global warming. ► Minimization of the global warming impact of a R744 transcritical cycle.

  1. Concentration of 134Cs and 137Cs in Malaysian palm products

    International Nuclear Information System (INIS)

    Yii Mei Wo; Nor Aza Hassan; Narizan Sanusi

    2008-08-01

    Until today, countries importing food products from Malaysia, in region such as Indian Continental, Middle East, Central Europe and Central America still require the products to be tested for the radioactive contamination particularly for 134 Cs and 137 Cs. Information extracted from 3371 analytical results observed on isotopic concentration for 134 Cs and 137 Cs in the exported Malaysia origins palm products between years 2002 until 2007 had been summarized and reported in this work. Data shown that the concentration level of the concerned radio nuclides are below the minimum detectable activity and also well below maximum permissible limits adopted by Malaysian Government and also the international bodies. (Author)

  2. Selective recognition of monohydrogen phosphate by fluorescence enhancement of a new cerium complex

    International Nuclear Information System (INIS)

    Ganjali, Mohammad Reza; Hosseini, Morteza; Memari, Zahra; Faridbod, Farnoush; Norouzi, Parviz; Goldooz, Hassan; Badiei, Alireza

    2011-01-01

    Highlights: ► Finding a new fluorescent enhancing chemosensor for phosphate ions. ► Synthesis of a new complex (bis(8-hydroxy quinoline-5-solphonate) cerium(III) chloride (Ce(QS) 2 Cl)) as a practical fluorescent probe. ► Analysis of phosphate content in three kinds of fertilizers, mixed fertilizer (N–P–K), triple super phosphate (TSP), and single super phosphate (SSP) (from Zarrin Kood Co., Tehran, Iran). - Abstract: Bis(8-hydroxy quinoline-5-solphonate) cerium(III) chloride (Ce(QS) 2 Cl) (L) was synthesized and then used as a novel fluorescent sensor for anion recognition. Preliminarily study showed that fluorescence of L enhanced selectively in the presence of HPO 4 2− ion. This enhancement is attributed to a 1:1 complex formation between L and HPO 4 2− anion. The association constant of 1:1 complex of L-HPO 4 2− was calculated as 3.0 × 10 6 . Thus, L was utilized as a basis for a selective detection of HPO 4 2− anion in solution. The linear response range of the proposed fluorescent chemo-sensor covers a concentration range of HPO 4 2− from 3.3 × 10 −7 to 5.0 × 10 −6 mol L −1 with a detection limit of 2.5 × 10 −8 mol L −1 . L showed selective and sensitive fluorescence enhancement response toward HPO 4 2− ion in comparison with I 3 − , NO 3 − , CN − , CO 3 2− , Br − , Cl − , F − , H 2 PO 4 − and SO 4 2− ions. It was probably attributed to the higher stability of the inorganic complex between HPO 4 2− ion and L. The method was successfully applied for analysis of phosphate ions in some fertilizers samples.

  3. Recombinant human parathyroid hormone related protein 1-34 and 1-84 and their roles in osteoporosis treatment.

    Directory of Open Access Journals (Sweden)

    Hua Wang

    Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.

  4. The Magnetic Response of Europium Implanted in Cerium and in Platinum as Investigated by the PAC-Method

    International Nuclear Information System (INIS)

    Zeitz, W.-D.; Unterricker, S.; Schneider, F.; Samokhvalov, V.; Potzger, K.; Weber, A.; Dietrich, M.

    2004-01-01

    The magnetic response of europium in γ-cerium and in platinum was studied by applying the perturbed angular correlation spectroscopy. The probe nuclei were 147 Eu(11/2 - ) and 149 Eu(11/2 - ). The response in γ-Ce was determined by the electronic S = J = 7/2 ground state of divalent Eu. In Pt, on the other hand, Eu is trivalent (J = 0 ground state). Here the magnetic contributions originate from Van Vleck terms of the whole multiplet system.

  5. Determination of curie content and 134/137cesium ratios by gamma spectroscopy of high burnup plutonium-aluminum fuel assemblies

    International Nuclear Information System (INIS)

    Haggard, D.L.; Tanner, J.E.

    1997-06-01

    Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure 134/137 Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. 134/137 Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from 134 Cs and the 662 keV peak from 137 Cs/ 137m Ba. Assembly No. 2 134/137 Cs ratio measured on 4-15-92 was 0.19. The measured 134/137 Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of 134 Cs and 137 Cs. The measured 134/137 Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of 134 Cs and 8620--11646 curies of 137 Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies 134 Cs and 8973 curies 137 Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured 134 Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured 137 Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material

  6. Effect of Cerium(IV)-Surfactant Reaction in Foam Decontamination

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Han Beom; Jung, Chong-Hun; Yoon, In-Ho; Kim, Chorong; Choi, Wang-Kyu [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    Using foams allows the decommissioning of complex shaped facilities. The decontamination foam comprises at least one surfactant to generate the foam and one or more chemical reactants to achieve the dissolution of the contaminants at the solid surface. In order to improve the efficiency of decontamination foam, the present study attempts to find the optimum condition of chemical reagents to the foaming solution. The corrosion rate of radioactive nuclides contaminated stainless steel metal is very important factor for the foam decontamination process. The goal of this study is to develop the decontamination process for contaminated stainless steel in medium of nitric acid. Stainless steel needs a strong oxidizing agent such as Ce(IV) ion and the effects of cerium(IV). Surfactant interaction involved in foam decontamination and finally the improvement brought by formulation science. The formulation of foams loaded with strong oxidizing reagents such as Ce(IV) is an important factor. The enhanced decontamination properties of nitric acid with Ce(IV) additive on stainless steel is well known in liquid mediums. stainless steel metal is an important aspect in the foam decontamination process.

  7. Catalytic properties and biomedical applications of cerium oxide nanoparticles

    KAUST Repository

    Walkey, Carl D.; Das, Soumen C.; Seal, Sudipta; Erlichman, Joseph S.; Heckman, Karin L.; Ghibelli, Lina; Traversa, Enrico; McGinnis, James F.; Self, William Thomas

    2014-01-01

    Cerium oxide nanoparticles (nanoceria) have shown promise as catalytic antioxidants in the test tube, cell culture models and animal models of disease. However given the reactivity that is well established at the surface of these nanoparticles, the biological utilization of nanoceria as a therapeutic still poses many challenges. Moreover the form that these particles take in a biological environment, such as the changes that can occur due to a protein corona, are not well established. This review aims to summarize the existing literature on biological use of nanoceria, and to raise questions about what further study is needed to apply this interesting catalytic material to biomedical applications. These questions include: 1) How does preparation, exposure dose, route and experimental model influence the reported effects of nanoceria in animal studies? 2) What are the considerations to develop nanoceria as a therapeutic agent in regards to these parameters? 3) What biological targets of reactive oxygen species (ROS) and reactive nitrogen species (RNS) are relevant to this targeting, and how do these properties also influence the safety of these nanomaterials?

  8. Effect of Cerium(IV)-Surfactant Reaction in Foam Decontamination

    International Nuclear Information System (INIS)

    Yang, Han Beom; Jung, Chong-Hun; Yoon, In-Ho; Kim, Chorong; Choi, Wang-Kyu

    2015-01-01

    Using foams allows the decommissioning of complex shaped facilities. The decontamination foam comprises at least one surfactant to generate the foam and one or more chemical reactants to achieve the dissolution of the contaminants at the solid surface. In order to improve the efficiency of decontamination foam, the present study attempts to find the optimum condition of chemical reagents to the foaming solution. The corrosion rate of radioactive nuclides contaminated stainless steel metal is very important factor for the foam decontamination process. The goal of this study is to develop the decontamination process for contaminated stainless steel in medium of nitric acid. Stainless steel needs a strong oxidizing agent such as Ce(IV) ion and the effects of cerium(IV). Surfactant interaction involved in foam decontamination and finally the improvement brought by formulation science. The formulation of foams loaded with strong oxidizing reagents such as Ce(IV) is an important factor. The enhanced decontamination properties of nitric acid with Ce(IV) additive on stainless steel is well known in liquid mediums. stainless steel metal is an important aspect in the foam decontamination process

  9. Catalytic properties and biomedical applications of cerium oxide nanoparticles

    KAUST Repository

    Walkey, Carl D.

    2014-11-10

    Cerium oxide nanoparticles (nanoceria) have shown promise as catalytic antioxidants in the test tube, cell culture models and animal models of disease. However given the reactivity that is well established at the surface of these nanoparticles, the biological utilization of nanoceria as a therapeutic still poses many challenges. Moreover the form that these particles take in a biological environment, such as the changes that can occur due to a protein corona, are not well established. This review aims to summarize the existing literature on biological use of nanoceria, and to raise questions about what further study is needed to apply this interesting catalytic material to biomedical applications. These questions include: 1) How does preparation, exposure dose, route and experimental model influence the reported effects of nanoceria in animal studies? 2) What are the considerations to develop nanoceria as a therapeutic agent in regards to these parameters? 3) What biological targets of reactive oxygen species (ROS) and reactive nitrogen species (RNS) are relevant to this targeting, and how do these properties also influence the safety of these nanomaterials?

  10. Properties of protective oxide scales containing cerium on Incoloy 800H in oxidizing and sulfidizing environments. I. Constant-extension-rate study of mechanical properties

    NARCIS (Netherlands)

    Haanappel, V.A.C.; Fransen, T.; Geerdink, Bert; Gellings, P.J.

    1988-01-01

    The mechanical properties of ceramic coatings containing cerium oxide, prepared by the sol-gel method and used to protect Incoloy 800H against aggressive environments, are reported. Deformation and cracking behavior in oxidizing and sulfidizing environments has been investigated by

  11. Amorphous saturated Cerium-Tungsten-Titanium oxide nanofibers catalysts for NOx selective catalytic reaction

    DEFF Research Database (Denmark)

    Dankeaw, Apiwat; Gualandris, Fabrizio; Silva, Rafael Hubert

    2018-01-01

    experiments at the best working conditions (dry and in absence of SO2) are performed to characterize the intrinsic catalytic behavior of the new catalysts. At temeprature lower than 300 °C, superior NOx conversion properties of the amorphous TiOx nanofibers over the crystallized TiO2 (anatase) nanofibers......Herein for the first time, Ce0.184W0.07Ti0.748O2-δ nanofibers are prepared by electrospinning to serve as catalyst in the selective catalytic reduction (SCR) process. The addition of cerium is proven to inhibit crystallization of TiO2, yielding an amorphous TiOx-based solid solution stable up...... temperatures (catalysts in a wide range...

  12. Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece

    International Nuclear Information System (INIS)

    Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.

    1994-01-01

    The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)

  13. Soil to plant transfer of 134Cs for olive and orange trees after four years' experimentation

    International Nuclear Information System (INIS)

    Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.

    1998-01-01

    The transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) were calculated within a long-term glass-house pot experiment which was started in 1994. The effect of the soil characteristics on 134 Cs uptake was also studied using two soils with different physical and chemical properties. Both evergreen trees exhibited a similar behavior in the two soils, showing that a higher or lower uptake is not crop specific. The capacity of the trees for 134 Cs absorption through the roots seems to be significantly influenced by the soil type. The transfer factors were very low in the calcareous heavy soil and much higher in the acid light soil (up to 10 times for olives and 40 for the edible part of oranges). The difference in the TFs is higher between the two soils than between the two tree species. 134 Cs concentration kept increasing in the orange trees up to the 4th year of growth, while it seems to reach an equilibrium, with no further increase, in the olive trees. Although the behavior of the two tree species is similar, the difference in the final processed product is extreme. A significant amount of 134 Cs was observed in olives grown in the light-acid soil whereas no transfer to the olive oil was detected. On the other hand, the edible part of the oranges showed the highest 134 Cs of nearly all the plant parts

  14. UV absorption by cerium oxide nanoparticles/epoxy composite thin films

    International Nuclear Information System (INIS)

    Dao, Ngoc Nhiem; Luu, Minh Dai; Nguyen, Quang Khuyen; Kim, Byung Sun

    2011-01-01

    Cerium oxide (CeO 2 ) nanoparticles have been used to modify properties of an epoxy matrix in order to improve the ultra-violet (UV) absorption property of epoxy thin films. The interdependence of mechanical properties, UV absorption property and the dispersed concentration of CeO 2 nanoparticles was investigated. Results showed that, by increasing the dispersed concentration of CeO 2 nanoparticles up to 3 wt%, tensile modulus increases while two other mechanical properties, namely tensile strength and elongation, decrease. The UV absorption peak and the absorption edges of the studied thin films were observed in the UV-Vis absorption spectra. By incorporating CeO 2 nanoparticles into the epoxy matrix, an absorption peak appears at around 318 nm in UV-Vis spectra with increasing CeO 2 concentration from 0.1 to 1.0 wt%. Scanning electron microscopy (SEM) images revealed that a good dispersion of nanoparticles in the epoxy matrix by an ultrasonic method was achieved

  15. Mobility of superficially applied caesium-134 and strontium-85 in apple branches under precipitation-free conditions

    International Nuclear Information System (INIS)

    Bengtsson, G.B.

    1992-01-01

    The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)

  16. Uptake of radiocesium by three plants grown in 134Cs contaminated soil under pot experiment condition

    International Nuclear Information System (INIS)

    Zheng Jiemin; Li Hongyan; Niu Tianxin; Chen Ziyuan; Tang Shirong

    2009-01-01

    Pot experiment was conducted to investigate the accumulation dynamics of 134 Cs in shoots of Rumex acetosa, Rumex hastatus and Helianthus annuus grown in 134 Cs contaminated soil under greenhouse condition. Results showed that shoot biomass of H. annuus was significantly higher than that of R. acetosa and R. hastatus; among 3 plant species, 13 '4Cs specific activity in shoots was the highest in H. annuus after treatment for 50 days, however after treatment for 70 days, that in R. acetosa was the highest. Bioaccumulation ratio reached 1.5, 1.4 and 1.3 in R. acetosa, R. hastatus and H. annuus at the end of experiment, respectively, and the former two plants kept with trend of continuously increasing during the experiment period. Three plants were tolerant to 134 Cs contaminated slil and capable to translocate 134 Cs from soil to plants. Among them, H. annuus removed greatest 134 Cs amount in the above ground part, and R. acetosa, R. hastatus showed higher tranclocation factor of Cs than H. annuus. Three plants are promising for phytoremediation of soil contaminated with radiocesium, and also could be used for phytoremediation of radiocesium and heavy metals complex contamination, potentially. (authors)

  17. 10 CFR 63.134 - Monitoring and testing waste packages.

    Science.gov (United States)

    2010-01-01

    ....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...

  18. Calibration of the SH134-20 Standard Gain Horn

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...

  19. Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions

    Science.gov (United States)

    Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.

    2014-01-01

    HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438

  20. Effect of ultrasound treatment on the morpho-structural and luminescent characteristics of cerium doped yttrium silicate phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Muresan, L.E., E-mail: laura_muresan2003@yahoo.com [“Raluca Ripan” Institute for Research in Chemistry, Babeş Bolyai University, Fântânele 30, 400294 Cluj-Napoca (Romania); Cadis, A.I.; Perhaita, I. [“Raluca Ripan” Institute for Research in Chemistry, Babeş Bolyai University, Fântânele 30, 400294 Cluj-Napoca (Romania); Silipas, D.T. [National Institute for R& D of Isotopic and Molecular Technologies, Donath 67-103, 400293 Cluj-Napoca (Romania); Tudoran, L. Barbu [Electronic Microscopy Centre, Babeş Bolyai University, Clinicilor 37, 400006 Cluj-Napoca (Romania)

    2015-08-15

    Highlights: • Y{sub 2}SiO{sub 5}:Ce is prepared by gel combustion in ultrasound conditions (US). • Morpho-structural characteristics are revealed based on FTIR, SEM, XRD, BET. • Incorporation of Ce{sup 3+} in X1/X2 type centers depends on preparative conditions. • US treatment increases the luminescent performances up to 151%. - Abstract: Cerium activated yttrium silicate (Y{sub 2}SiO{sub 5}:Ce) phosphors were prepared by gel-combustion, using yttrium–cerium nitrate as oxidizer, aspartic acid as fuel and TEOS as source of silicon. Two modalities for samples preparation were approached namely: the classical gel-combustion and sonication gel-combustion. The ultrasound treatment during the gelling stage has a positive effect on the structural and luminescent characteristics of the final product. Therefore, a well crystallized single X2–Y{sub 2}SiO{sub 5} phase phosphor was obtained at 1200 °C. Based on FT-IR and XRD investigations, conversion of X1 to X2–Y{sub 2}SiO{sub 5} phases is observed as the firing temperature is varied (1100 °C, 1200 °C, 1300 °C 1400 °C). The ultrasound treatment leads to smaller particle size and enhances the luminescent performances up to 151% in comparison with samples prepared by classical way.