WorldWideScience

Sample records for centrifugo deslizante pcd

  1. Toxic waste treatment with sliding centrifugal plasma reactor; Tratamiento de residuos toxicos con reactores de plasma centrifugo deslizante (PCD)

    Energy Technology Data Exchange (ETDEWEB)

    Pacheco, J.; Pacheco, M.; Valdivia, R.; Ramos, F.; Duran, M.; Hidalgo, M.; Cruz, A.; Martinez, J. C.; Martinez, R.; De la Cruz, S.; Flores, T.; Vidal, E.; Escobar, S. [ININ, Carretera Mexico-Toluca s/n, Ocoyoacac 52750, Estado de Mexico (Mexico); Garduno, M.; Garcia, M.; Portillo, J.; Torres, C.; Estrada, N.; Velazquez, S.; Vasquez, C. [Instituto Tecnologico de Toluca, Av. Instituto Tecnologico s/n, Ex-Rancho la Virgen, Metepec 52140, Estado de Mexico (Mexico)

    2008-07-01

    The aim is to develop technology for hazardous waste treatment, including the building and putting into operation of a prototype based on a sliding centrifugal plasma technology to demonstrate its ability to degradation taking in account the existing environmental standards. (Author)

  2. Premature centromere division (PCD): a dominantly inherited cytogenetic anomaly.

    Science.gov (United States)

    Madan, K; Lindhout, D; Palan, A

    1987-10-01

    We describe a family with an increased frequency of cells with premature centromere division (PCD) of all chromosomes in four phenotypically normal individuals. This familial PCD phenomenon is apparently different from the well-described PCD of the X chromosome and from the centromere splitting in cells of patients with Roberts syndrome. Implications for genetic counseling are discussed.

  3. Estudio de Algoritmos 2-Deslizantes Aplicados al Control de Pilas de Combustible

    Directory of Open Access Journals (Sweden)

    Cristian Kunusch

    2008-07-01

    Full Text Available Resumen: En este trabajo se hace un estudio comparativo de tres diferentes técnicas de control por modo deslizante de segundo orden, aplicadas al problema específico del control de respiración de una pila de combustible PEM. Los algoritmos diseñados se contrastan por simulación utilizando el modelo completo del sistema, poniendo particular énfasis en la respuesta transitoria y la robustez frente a perturbaciones. Palabras clave: Pilas de Combustible, Control no lineal, Modo Deslizante

  4. Controlador en Modo Deslizante para Sistemas Fotovoltaicos Conectados a la Red Eléctrica

    Directory of Open Access Journals (Sweden)

    D. Arcos

    2012-11-01

    Full Text Available Se describe el análisis, modelamiento y diseño de un lazo de control para sistemas fotovoltaicos (PV conectados a la red eléctrica. Se aborda el modelado de un panel fotovoltaico; el diseño de un convertidor elevador (Boost y su lazo de control mediante un controlador proporcional-integral PI de corriente y un controlador en modo deslizante; y finalmente el diseño de un inversor DC-AC de una fase. Se realiza una descripción de la dinámica del convertidor Boost y de las ecuaciones para el diseño del controlador en modo deslizante y del inversor de una sola fase. El sistema propuesto ha sido simulado utilizando las herramientas de la librería SimPowerSystems de Matlab/Simulink.

  5. New types of drilling tools fit with PCD elements

    Directory of Open Access Journals (Sweden)

    Koníèek Jiøí

    1997-09-01

    Full Text Available One of the most significant developments in drilling technology over the last years has been the introduction of polycrystalline diamond (PCD as macro-cutting elements in the rotary drill application. This paper gives a summary of core bits and cutter bits, produced by Pramet Šumperk Co., which are fit with these PCD elements. Some results, obtained with these types of cutter bits by drilling in mines of Ostrava-Karviná Basin, are also presented.

  6. Diseño de un observador y un controlador de velocidad de un motor DC por modos deslizantes

    Directory of Open Access Journals (Sweden)

    Jesse Mauricio Beltrán Soto

    2014-07-01

    Full Text Available En este artículo se presenta una estructura de estimación y control de estados mediante modos deslizantes para un modelo lineal. Se presenta un sistema mecánico de un Motor DC, al cual se le diseñaran un observador y un controlador deslizante de primer y segundo orden. Los resultados se comparan con un diseño de un PID. Los dos diseños se prueban ante cambios de referencia, perturbaciones y ruido.

  7. Secagem de proteina texturizada de soja em leito estatico e deslizante

    OpenAIRE

    Javier Telis Romero

    1988-01-01

    Resumo: A secagem de proteína texturizada de soja (PTS), em leito estático e em leito deslizante, foi estudada neste trabalho. Os autores verificaram que, para as condições usadas, a temperatura é o parâmetro que mais influencia a secagem do material. Durante as experiências em leito estático variou-se a vazão de ar (G), a temperatura do ar (T) e a espessura do leito (E). Desse estudo, dois períodos de velocidades de secagem decrescente foram observados e representados por uma equação do tip...

  8. Diseño y Análisis de Control con Modos Deslizantes para Sistemas con Predictores de Asignación Finita de Polos

    Directory of Open Access Journals (Sweden)

    Acosta Pedro

    2010-04-01

    Full Text Available Resumen: Se presenta una forma de controlar sistemas con retardo en la entrada o en la salida utilizando modos deslizantes y predictores tipo Smith, conocidos como asignación finita de polos. La utilización de predictores elimina el castañeteo en la superficie deslizante debido al retardo. Se introduce un método de diseño de la superficie deslizante para estos predictores, se analiza el método propuesto y las posibles dificultades a resolver debido a incertidumbres en la estimación de los parámetros. Por último se presentan ejemplos numéricos para ilustrar el método y algunos aspectos del análisis desarrollado. Palabras Clave: predictor, modos deslizantes, castañeteo, robustez, asignación finita de polos, incertidumbres, perturbaciones

  9. Control mediante modos deslizantes en tiempo discreto para el seguimiento de trayectorias de un robot móvil1

    Directory of Open Access Journals (Sweden)

    P.A. Niño-Suárez

    2007-10-01

    Full Text Available Resumen: En este trabajo se presenta una estrategia de control en tiempo discreto para el seguimiento de trayectorias de un robot móvil tipo (2,0 controlado remotamente. La estrategia de control se desarrolló mediante un enfoque de modos deslizantes, considerando el modelo discreto exacto del vehículo en el cual se incluyen los efectos del retardo de transporte causado por la propagación de las señales sobre una red de comunicación. El esquema de control garantiza el seguimiento de trayectorias predeterminadas obteniéndose convergencia asintótica de los errores de seguimiento. La estrategia propuesta es evaluada mediante una serie de resultados por simulación. Palabras clave: Robot móvil, retardos de transporte, control en tiempo discreto, modos deslizantes

  10. BioPCD - A Language for GUI Development Requiring a Minimal Skill Set.

    Science.gov (United States)

    Alvare, Graham Gm; Roche-Lima, Abiel; Fristensky, Brian

    2012-11-01

    BioPCD is a new language whose purpose is to simplify the creation of Graphical User Interfaces (GUIs) by biologists with minimal programming skills. The first step in developing BioPCD was to create a minimal superset of the language referred to as PCD (Pythonesque Command Description). PCD defines the core of terminals and high-level nonterminals required to describe data of almost any type. BioPCD adds to PCD the constructs necessary to describe GUI components and the syntax for executing system commands. BioPCD is implemented using JavaCC to convert the grammar into code. BioPCD is designed to be terse and readable and simple enough to be learned by copying and modifying existing BioPCD files. We demonstrate that BioPCD can easily be used to generate GUIs for existing command line programs. Although BioPCD was designed to make it easier to run bioinformatics programs, it could be used in any domain in which many useful command line programs exist that do not have GUI interfaces.

  11. Control Libre de Modelo basado en Modos Deslizantes Integrales para Robots Submarinos Subactuados1

    Directory of Open Access Journals (Sweden)

    R. Raygosa-Barahona

    2015-07-01

    Full Text Available Resumen: Se propone la combinación de una ley de control libre de modelo dinámico, en conjunto con una ley de guiado cinemático, para el seguimiento de trayectorias actuadas de un vehículo robo‘tico submarino subactuado. El sistema en lazo cerrado da lugar a modos deslizantes integrales, libres de castañeo, que garantizan la estabilidad exponencial local del seguimiento de las coordenadas actuadas con dinámica interna estable, bajo condiciones fáciles de encontrar en la práctica. La metodología del diseño se basa en una manipulación cuidadosa del modelo cuasilagrangiano de vehículos submarinos y de una ley de control que es independiente del modelo y sus parámetros, asumiendo acceso total del estado. Simulaciones comparativas considerando el PID convencional ilustran la factibilidad del control en las condiciones establecidas ante incertidumbres paramétricas y del modelo. Abstract: A combination of a model-free control law at the dynamic level and a guidance law at the kinematic level is proposed for the tracking of an underactuated underwater robot vehicle. The closed-loop system gives rise to chattering-free integral sliding modes for local exponential tracking of actuated coordinates, while ensuring a global stable internal dynamics under certain conditions easy to meet in practice. The design methodology relies on a careful manipulation of the quasi-lagrangian model of the underwater vehicle with a control law that is independent of dynamic model and its parameters assuming full access to the state. Comparative simulations versus a PID show the feasibility and robust behavior under parametric and model uncertainties. Palabras clave: Control Libre de Modelo, Modos Deslizantes Integrales, Sistemas Subactuados, Vehículo Submarino, Keywords: Model-Free Control, Integral Sliding Mode Control, Underactuated Systems, Underwater Vehicles.

  12. Bacterial evolution in PCD and CF patients follows the same mutational steps

    DEFF Research Database (Denmark)

    Madsen Sommer, Lea Mette; Alanin, Mikkel Christian; Marvig, Rasmus L.

    2016-01-01

    Infections with Pseudomonas aeruginosa increase morbidity in primary ciliary dyskinesia (PCD) and cystic fibrosis (CF) patients. Both diseases are associated with a defect of the mucociliary clearance; in PCD caused by non-functional cilia, in CF by changed mucus. Whole genome sequencing of P....... aeruginosa isolates from CF patients has shown that persistence of clonal lineages in the airways is facilitated by genetic adaptation. It is unknown whether this also applies to P. aeruginosa airway infections in PCD. We compared within-host evolution of P. aeruginosa in PCD and CF patients. P. aeruginosa...... isolates from 12 PCD patients were whole genome sequenced and phenotypically characterised. Ten out of 12 PCD patients were infected with persisting clone types. We identified convergent evolution in eight genes, which are also important for persistent infections in CF airways: genes related to antibiotic...

  13. Implementación digital de un controlador deslizante en un PMSM con frecuencia de conmutación fija

    OpenAIRE

    Repecho del Corral, Víctor; Biel Solé, Domingo; Arias Pujol, Antoni

    2016-01-01

    Este artículo describe la implementación de un control de corriente en modo deslizante para una máquina síncrona de imanes permanentes. El estudio se centra en los fenómenos que aparecen cuando los controladores diseñados desde un punto de vista continuo se deben muestrear debido a implementaciones basadas en µprocesador. El trabajo desarrolla una metodología que permite recuperar el comportamiento en tiempo continuo de los controladores en el entorno muestreado. La técnica de implementación,...

  14. The use of the antimicrobial peptide piscidin (PCD)-1 as a novel anti-nociceptive agent.

    Science.gov (United States)

    Chen, Wu-Fu; Huang, Shi-Ying; Liao, Chang-Yi; Sung, Chun-Sung; Chen, Jyh-Yih; Wen, Zhi-Hong

    2015-06-01

    The antimicrobial peptide piscidin (PCD)-1 has been reported to have antibacterial and immunomodulatory functions. Here, we investigated the anti-neuropathic properties of PCD-1, in order to determine its potential as a compound to alleviate pain. Treatment with PCD-1 suppressed the inflammatory proteins COX-2 and iNOS in murine macrophage (RAW264.7) and microglial (BV2) cell lines stimulated by lipopolysaccharide (LPS). For studies of the effect of PCD-1 in vivo, mononeuropathy in rats was induced by chronic constriction injury (CCI), and the resulting anti-nociceptive behaviors were compared between CCI controls and CCI rats given intrathecal injections of PCD-1. Much like gabapentin, PCD-1 exerts anti-nociceptive effects against thermal hyperalgesia, with a median effective dose (ED50) of 9.5 μg in CCI rats. In CCI rats, PCD-1 exerted effects against mechanical and cold allodynia, thermal hyperalgesia, and weight-bearing deficits. Furthermore, CCI-mediated activation of microglia and astrocytes in the dorsal horn of the lumbar spinal cord were decreased by PCD-1. In addition, PCD-1 suppressed up-regulation of interleukin-1β (IL-1β) and phosphorylated mammalian target of rapamycin (phospho-mTOR) in CCI rats. Finally, CCI-induced down-regulation of transforming growth factor-β1 (TGF-β1) in rats was attenuated by injection of PCD-1. Taken together, the present findings demonstrate that the marine antimicrobial peptide PCD-1 has anti-nociceptive effects, and thus may have potential for development as an alternative pain-alleviating agent. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Control por Modos Deslizantes y Planitud Diferencial de un Convertidor de CD/CD Boost: Resultados Experimentales

    Directory of Open Access Journals (Sweden)

    R. Silva-Ortigoza

    2008-10-01

    Full Text Available Resumen: En este trabajo se presenta el control del convertidor de potencia de CD a CD Boost. En este sistema existen dos problemas de control, a saber; la regulación alrededor de un punto de equilibrio y la de seguimiento de trayectoria del voltaje de salida. Nosotros enfocamos nuestra atención al segundo problema de control. Debido a las propiedades de fase que satisface este convertidor, para realizar la tarea de seguimiento de trayectoria se diseña un controlador indirecto basado en modos deslizantes en combinación con planitud diferencial, el cual permite el seguimiento de trayectoria de la variable de fase no mínima (voltaje basado en el seguimiento de trayectoria de la variable de fase mínima (corriente. La síntesis de este controlador se realiza con la ayuda de una tarjeta de adquisición de datos National Instruments™ PCI-6025E junto con el software de aplicación MATLAB®-Simulink®. Se aplica este controlador al prototipo del convertidor Boost desarrollado y se obtienen resultados experimentales satisfactorios. Palabras clave: Control Indirecto, Convertidor de CD/CD Boost, Modos Deslizantes, Planitud Diferencial, Seguimiento de Trayectoria

  16. Applications of emerging transmission electron microscopy technology in PCD research and diagnosis.

    Science.gov (United States)

    Shoemark, Amelia

    2017-01-01

    Primary Ciliary Dyskinesia (PCD) is a heterogeneous genetic condition characterized by dysfunction of motile cilia. Patients suffer from chronic infection and inflammation of the upper and lower respiratory tract. Diagnosis of PCD is confirmed by identification of a hallmark defect of ciliary ultrastructure or by identification of biallelic pathogenic mutations in a known PCD gene. Since the first description of PCD in 1976, assessment of ciliary ultrastructure by transmission electron microscopy (TEM) has been central to diagnosis and research. Electron tomography is a technique whereby a series of transmission electron micrographs are collected at different angles and reconstructed into a single 3D model of a specimen. Electron tomography provides improved spatial information and resolution compared to a single micrograph. Research by electron tomography has revealed new insight into ciliary ultrastructure and consequently ciliary function at a molecular and cellular level. Gene discovery studies in PCD have utilized electron tomography to define the structural consequences of variants in cilia genes. Modern transmission electron microscopes capable of electron tomography are increasingly being installed in clinical laboratories. This presents the possibility for the use of tomography technique in a diagnostic setting. This review describes the electron tomography technique, the contribution tomography has made to the understanding of basic cilia structure and function and finally the potential of the technique for use in PCD diagnosis.

  17. Development of a Staggered PCD End Mill for Carbon Fiber Reinforced Plastic

    Directory of Open Access Journals (Sweden)

    Guangjun Liu

    2017-03-01

    Full Text Available This work presents a PCD (polycrystalline diamond end mill with a new staggered structure for the milling of CFRP (carbon fiber reinforced plastic. The magnitude and direction of cutting force is decreased and changed by side-edge re-configuration of the structure. The flute and insert pocket of the staggered PCD end mill are designed considering the tool’s stiffness and welding process. The milling process and machining defects of the staggered PCD end mill are analyzed, and the structural parameters of the staggered PCD end mill are determined. The staggered PCD end mill is fabricated by the process of wire cutting, NC (Numerical Control machining, high-frequency induction brazing, welding, grinding and passivation. Milling tests of multidirectional CFRP with the staggered PCD end mill is conducted on CNC (Computerized Numerical Control milling machine. The milling force is measured by a dynamometer. A range analysis of the numerical results of milling force is conducted after milling test, and the influence of milling parameters on milling force is analyzed. A regression model of the milling force is built and verified by experiment. The effects of fiber cutting angle on milling force are obtained through milling CFRP with different fiber orientation angles.

  18. Abnormal Sperm Development in pcd3J-/- Mice: the Importance of Agtpbp1 in Spermatogenesis

    Science.gov (United States)

    Kim, Nameun; Xiao, Rui; Choi, Hojun; Kim, Jin-Hoi; Sang-Jun, Uhm; Chankyu, Park

    2011-01-01

    Homozygous Purkinje cell degeneration (pcd) mutant males exhibit abnormal sperm development. Microscopic examination of the testes from pcd3J-/- mice at postnatal days 12, 15, 18 and 60 revealed histological differences, in comparison to wild-type mice, which were evident by day 18. Greatly reduced numbers of spermatocytes and spermatids were found in the adult testes, and apoptotic cells were identified among the differentiating germ cells after day 15. Our immunohistological analysis using an antihuman AGTPBP1 antibody showed that AGTPBP1 was expressed in spermatogenic cells between late stage primary spermatocytes and round spermatids. A global gene expression analysis from the testes of pcd3J-/- mice showed that expression of cyclin B3 and de-ubiquitinating enzymes USP2 and USP9y was altered by >1.5-fold compared to the expression levels in the wild-type. Our results suggest that the pcd mutant mice have defects in spermatogenesis that begin with the pachytene spermatocyte stage and continue through subsequent stages. Thus, Agtpbp1, the gene responsible for the pcd phenotype, plays an important role in spermatogenesis and is important for survival of germ cells at spermatocytes stage onward. PMID:21110128

  19. Application of the comet assay in studies of programmed cell death (PCD in plants

    Directory of Open Access Journals (Sweden)

    Maria Charzyńska

    2014-01-01

    Full Text Available Programmed cell death (PCD in plants is an intensively investigated process. One of the main characteristics of PCD in both animal and plant organisms is the non-random, internucleosomal fragmentation of nuclear DNA, usually analysed using total DNA gel electrophoresis or TUNEL method. In this paper we present application of the "comet assay" (Single Cell Gel Electrophoresis for detection of nDNA degradation in studies of PCD during plant life cycle. We analyzed three types of tissue: anther tapetum, endosperm and mesophyll which were prepared in different ways to obtain a suspension of viable cells (without cell walls. The comet assay gives a possibility of examination of the nDNA degradation in individual cell. This method is significant for studies of the plant tissue differentiation and senescence especially in the cases when it is not possible to isolate large number of cells at the same developmental stage.

  20. Unveiling interactions among mitochondria, caspase-like proteases, and the actin cytoskeleton during plant programmed cell death (PCD.

    Directory of Open Access Journals (Sweden)

    Christina E N Lord

    Full Text Available Aponogeton madagascariensis produces perforations over its leaf surface via programmed cell death (PCD. PCD begins between longitudinal and transverse veins at the center of spaces regarded as areoles, and continues outward, stopping several cells from these veins. The gradient of PCD that exists within a single areole of leaves in an early stage of development was used as a model to investigate cellular dynamics during PCD. Mitochondria have interactions with a family of proteases known as caspases, and the actin cytoskeleton during metazoan PCD; less is known regarding these interactions during plant PCD. This study employed the actin stain Alexa Fluor 488 phalloidin, the actin depolymerizer Latrunculin B (Lat B, a synthetic caspase peptide substrate and corresponding specific inhibitors, as well as the mitochondrial pore inhibitor cyclosporine A (CsA to analyze the role of these cellular constituents during PCD. Results depicted that YVADase (caspase-1 activity is higher during the very early stages of perforation formation, followed by the bundling and subsequent breakdown of actin. Actin depolymerization using Lat B caused no change in YVADase activity. In vivo inhibition of YVADase activity prevented PCD and actin breakdown, therefore substantiating actin as a likely substrate for caspase-like proteases (CLPs. The mitochondrial pore inhibitor CsA significantly decreased YVADase activity, and prevented both PCD and actin breakdown; therefore suggesting the mitochondria as a possible trigger for CLPs during PCD in the lace plant. To our knowledge, this is the first in vivo study using either caspase-1 inhibitor (Ac-YVAD-CMK or CsA, following which the actin cytoskeleton was examined. Overall, our findings suggest the mitochondria as a possible upstream activator of YVADase activity and implicate these proteases as potential initiators of actin breakdown during perforation formation via PCD in the lace plant.

  1. The relationship between vacuolation and initiation of PCD in rice (Oryza sativa) aleurone cells

    Science.gov (United States)

    Zheng, Yan; Zhang, Heting; Deng, Xiaojiang; Liu, Jing; Chen, Huiping

    2017-01-01

    Vacuole fusion is a necessary process for the establishment of a large central vacuole, which is the central location of various hydrolytic enzymes and other factors involved in death at the beginning of plant programmed cell death (PCD). In our report, the fusion of vacuoles has been presented in two ways: i) small vacuoles coalesce to form larger vacuoles through membrane fusion, and ii) larger vacuoles combine with small vacuoles when small vacuoles embed into larger vacuoles. Regardless of how fusion occurs, a large central vacuole is formed in rice (Oryza sativa) aleurone cells. Along with the development of vacuolation, the rupture of the large central vacuole leads to the loss of the intact plasma membrane and the degradation of the nucleus, resulting in cell death. Stabilizing or disrupting the structure of actin filaments (AFs) inhibits or promotes the fusion of vacuoles, which delays or induces PCD. In addition, the inhibitors of the vacuolar processing enzyme (VPE) and cathepsin B (CathB) block the occurrence of the large central vacuole and delay the progression of PCD in rice aleurone layers. Overall, our findings provide further evidence for the rupture of the large central vacuole triggering the PCD in aleruone layers.

  2. Flavonoids and darkness lower PCD in senescing Vitis vinifera suspension cell cultures.

    Science.gov (United States)

    Bertolini, Alberto; Petrussa, Elisa; Patui, Sonia; Zancani, Marco; Peresson, Carlo; Casolo, Valentino; Vianello, Angelo; Braidot, Enrico

    2016-10-26

    Senescence is a key developmental process occurring during the life cycle of plants that can be induced also by environmental conditions, such as starvation and/or darkness. During senescence, strict control of genes regulates ordered degradation and dismantling events, the most remarkable of which are genetically programmed cell death (PCD) and, in most cases, an upregulation of flavonoid biosynthesis in the presence of light. Flavonoids are secondary metabolites that play multiple essential roles in development, reproduction and defence of plants, partly due to their well-known antioxidant properties, which could affect also the same cell death machinery. To understand further the effect of endogenously-produced flavonoids and their interplay with different environment (light or dark) conditions, two portions (red and green) of a senescing grapevine callus were used to obtain suspension cell cultures. Red Suspension cell Cultures (RSC) and Green Suspension cell Cultures (GSC) were finally grown under either dark or light conditions for 6 days. Darkness enhanced cell death (mainly necrosis) in suspension cell culture, when compared to those grown under light condition. Furthermore, RSC with high flavonoid content showed a higher viability compared to GSC and were more protected toward PCD, in accordance to their high content in flavonoids, which might quench ROS, thus limiting the relative signalling cascade. Conversely, PCD was mainly occurring in GSC and further increased by light, as it was shown by cytochrome c release and TUNEL assays. Endogenous flavonoids were shown to be good candidates for exploiting an efficient protection against oxidative stress and PCD induction. Light seemed to be an important environmental factor able to induce PCD, especially in GSC, which lacking of flavonoids were not capable of preventing oxidative damage and signalling leading to senescence.

  3. Prótesis ocular estética con movimiento: propuesta de diseño de una Superficie de Apoyo Deslizante (SAD)

    OpenAIRE

    Colombo Pulgarín, Juan Camilo

    2011-01-01

    Este proyecto se fundamenta en una propuesta de diseño de un dispositivo médico ocular, de carácter no invasivo, que facilita la movilidad de una prótesis ocular estética, alojada en la cavidad anoftálmica de un paciente -- El producto logrado consiste en una interfaz, deslizante por un lado y antideslizante por el otro, la cual se instala por delante de la prótesis, en contacto con la parte interior del párpado, con el fin de minimizar la fricción que existe allí, y que impide la movilidad d...

  4. SISTEMA DE CONTROL EN MODO DESLIZANTE PARA REGULAR LA POSICIÓN Y LA VELOCIDAD DE UN MOTOR DE CORRIENTE DIRECTA

    OpenAIRE

    Cornieles, Ernesto

    2015-01-01

    En el presente trabajo se aplica la teoría de un Sistema de Control en Modo Deslizante, para regular la posición y velocidad de un motor de corriente directa. El desarrollo matemático que permitió diseñar un panel donde el sistema de control se ha expresado a través de instrumentos virtuales en el diagrama de bloques del software de LabView®, que permite manipular variables en tiempo real gracias a la tarjeta de adquisición de datos DAQ6024E de la National Instruments. Todos los datos ingresa...

  5. Construcción de silos con encofrados deslizantes - Santa Cruz de Tenerife – España

    Directory of Open Access Journals (Sweden)

    Barrios Martínez, M.

    1976-10-01

    Full Text Available These cereal and oil-cake silos are made up of 10 exterior cylindrical cells, with an inner diameter of 6 m and a height of 31.88 m. The cells are joined together by means of walls whereby four additional octagonal cells are created. Out of these, three are subdivided into four cells and the fourth forms the central silo. Below this unit there is a corridor for the emptying of the silos. The work has been carried out with a travelling form with the following characteristics: mixed with regard to shape and materials; stiff, since the top platforms are connected; and it has a constant cross-section as the dimensions of the silos remain the same throughout the whole height. The form was lifted by means of elevation devices, controlled by a centralized hydraulic mechanism. In view of the characteristics of the travelling form, the concrete used ¡n the work had to fulfill several very special conditions, notably different from these applying to the concrete that is normally used for fixed forms. For this reason, it was submitted to a great number of studies and tests until the requirements had been met. The construction was finished in record time: in the first place, because a detailed programme had been worked out in advance, consisting of a diagram of bars and preference network and secondly, because continuous concreting was applied with day and night shifts, whebery the foreseen two and a half months for finishing the silos were reduced to 12 days.Estos silos, destinados a almacenamiento de cereales y borujo, están formados por 10 celdas exteriores cilíndricas, de 6 m de diámetro interior y 31,88 m de altura, que se unen entre sí por medio de muros, dando lugar a cuatro celdas adicionales de forma octogonal. De éstas, tres están subdivididas en cuatro interceldas, quedando la cuarta como silo central. Debajo del conjunto se ha dispuesto una galería para el vaciado de los silos. La obra se ha realizado con un encofrado deslizante

  6. Machinability of Al-SiC metal matrix composites using WC, PCD and MCD inserts

    Energy Technology Data Exchange (ETDEWEB)

    Beristain, J.; Gonzalo, O.; Sanda, A.

    2014-04-01

    The aim of this work is the study of the machinability of aluminium-silicon carbide Metal Matrix Composites (MMC) in turning operations. The cutting tools used were hard metal (WC) with and without coating, different grades and geometries of Poly-Crystalline Diamond (PCD) and Mono-Crystalline Diamond (MCD). The work piece material was AMC225xe, composed of aluminium-copper alloy AA 2124 and 25% wt of SiC, being the size of the SiC particles around 3 {mu}m. Experiments were conducted at various cutting speeds and cutting parameters in facing finishing operations, measuring the surface roughness, cutting forces and tool wear. The worn surface of the cutting tool was examined by Scanning Electron Microscope (SEM). It was observed that the Built Up Edge (BUE) and stuck material is higher in the MCD tools than in the PCD tools. The BUE acts as a protective layer against abrasive wear of the tool. (Author)

  7. Energy saving avoiding the centrifugal motor-compressors air vents discharge to the surrounding atmosphere; Ahorro de energia evitando venteo de aire a la atmosfera en motocompresores centrifugos

    Energy Technology Data Exchange (ETDEWEB)

    Serrano, Alex [Compressor Controls Corporation, Houston, TX (United States)

    1996-12-31

    The motor-compressors are a key part of the industrial processes. The reliability and efficient operation of a compressor is critical. The surge phenomenon is a threat in the reliability of a compressor and therefore for the process. Surge, in a centrifugal compressor is defined as a dramatic flow and pressure drop, including back-flow. This is always a significant process disturbance. Continuous surge results into costly process shutdowns and mechanical damages. To prevent surge, and control the discharge pressure with simple or obsolete controls it is needed to vent air to the surrounding atmosphere. This form of control is very inefficient and costly. An advanced control with leading technology, besides providing an economical value preventing surge damages, offers substantial energy saving reducing or eliminating the venting of air to the atmosphere. [Espanol] Los motocompresores son un aparte clave de los procesos industriales. La confiable y eficiente operacion de un compresor es critica. El fenomeno de surge es una amenaza a la confiabilidad de un compresor y por lo tanto del proceso. El surge en un compresor centrifugo es definido como una dramatica caida de flujo y presion, incluyendo flujo inverso. Esto es siempre un significante disturbio del proceso. El surge continuo resulta en costosos paros de proceso y danos mecanicos. Para prevenir el surge y controlar la presion de descarga con controles simples u obsoletos, es necesario ventear aire a la atmosfera. Esta forma de control es muy ineficiente y costosa. Un control avanzado con tecnologia de punta ademas de proveer valor economico previniendo danos por surge, provee sustanciales ahorros de energia reduciendo o eliminando el venteo de aire a la atmosfera.

  8. Comparison Between Cemented Carbide and PCD Tools on Machinability of a High Silicon Aluminum Alloy

    Science.gov (United States)

    Soares, R. B.; de Jesus, A. M. P.; Neto, R. J. L.; Chirita, B.; Rosa, P. A. R.; Reis, A.

    2017-09-01

    The high content of silicon of aluminum casting alloys challenges the tool life of conventional cemented carbide inserts, and polycrystalline diamond (PCD) tools appear as an interesting material to machine these alloys because they improve substantially the durability of cutting tools and consequently the productivity of machining. However, the surface roughness, cutting forces and chip morphology are equally important factors in machining evaluation. Therefore, an experimental study is performed aiming at comparing the performance of cemented carbide and PCD tools taking into account cutting forces, surface roughness and chip morphology, under dry longitudinal turning, performed for the AlSi9Cu3 alloy produced by permanent mold casting process. Different chip breaker geometries were also considered, and their influence on the referred parameters was also investigated. Analysis of variance was employed to study the different contributions of inserts, cutting speed, feed rate, depth of cut and their interactions in machinability performance. The results show low cutting forces and better results for surface roughness for uncoated cemented carbide tools, with simpler chip breakers and flat rake face PCD tool, but an efficient chip control was obtained for inserts with small grooves with high cutting forces and power consumption. Nevertheless, the feed rate and depth of cut have the highest influence on the machinability performance of the alloy under investigation.

  9. Robust control decentralized by sliding ways of electrical of power multi-machines systems; Control robusto descentralizado por modos deslizantes de sistemas electricos de potencia multimaquinas

    Energy Technology Data Exchange (ETDEWEB)

    Huerta Avila, Hector

    2008-09-15

    electrica. El controlador debe ser robusto ante variaciones parametricas que se pueden presentar por incertidumbre en los modelos, envejecimiento de los componentes de los generadores y algunas otras causas fisicas. Otro factor a considerar es que los modelos de sistemas multimaquinas son de alto orden, por lo cual se dificulta el diseno de controladores y la implementacion de los mismos en el sistema. Entonces, es conveniente disenar controles descentralizados que puede facilitar la tarea de diseno e implementacion de los mismos. Este trabajo propone tres nuevas tecnicas robustas para sistemas no lineales. La primera esta basada en la metodologia de control por bloques y modos deslizantes integrales; esta combinacion permite aplicar modos deslizantes integrales en cada bloque del sistema, rechazando las perturbaciones existentes en cada bloque. La segunda tecnica propone el diseno de una variedad deslizante a partir del modelo hamiltoniano de sistemas no lineales, misma que sera utilizada para un control por modos deslizantes. La tercera tecnica propone la aplicacion de modos deslizantes en cada bloque de un sistema no lineal controlable por bloques, mediante la utilizacion de la funcion de Lyapunov de ese bloque. Posteriormente se disenan cuatro esquemas de control descentralizado para sistemas electricos de potencia multimaquinas. Los cuatro esquemas propuestos son robustos ante las perturbaciones mencionadas. Ademas, estos controladores se pueden implementar en cualquier sistema electrico de potencia con n generadores, m lineas y k cargas.

  10. Machinability of Al-SiC metal matrix composites using WC, PCD and MCD inserts

    Directory of Open Access Journals (Sweden)

    Beristain, Jokin

    2014-03-01

    Full Text Available The aim of this work is the study of the machinability of aluminium-silicon carbide Metal Matrix Composites (MMC in turning operations. The cutting tools used were hard metal (WC with and without coating, different grades and geometries of Poly-Crystalline Diamond (PCD and Mono-Crystalline Diamond (MCD. The work piece material was AMC225xe, composed of aluminium-copper alloy AA 2124 and 25% wt of SiC, being the size of the SiC particles around 3 μm. Experiments were conducted at various cutting speeds and cutting parameters in facing finishing operations, measuring the surface roughness, cutting forces and tool wear. The worn surface of the cutting tool was examined by Scanning Electron Microscope (SEM. It was observed that the Built Up Edge (BUE and stuck material is higher in the MCD tools than in the PCD tools. The BUE acts as a protective layer against abrasive wear of the tool.El objetivo de este trabajo es el estudio de la maquinabilidad del material compuesto de matriz metálica aluminio-carburo de silicio en operaciones de torneado. Las herramientas de corte utilizadas han sido de metal duro con y sin recubrimiento, diferentes grados de diamante policristalino (PCD y diamante monocristalino (MCD. El material mecanizado ha sido AMC225xe, compuesto de la aleación de aluminio AA 2124 con un 25% en peso de partículas de SiC con un tamaño medio de 3 μm. Los experimentos se han realizado con diferentes velocidades de corte en una operación de refrentado, midiendo la rugosidad superficial, las fuerzas y el desgaste de la herramienta. La superficie desgastada de la herramienta ha sido examinada en el microscopio electrónico (SEM. Se ha observado que el filo recrecido y el material adherido son mayores en el caso de las herramientas de MCD que en las de PCD. El filo recrecido actúa como una capa protectora contra la abrasión.

  11. Criteria for the greater rehabilitation of a centrifugal compressor rotor of a process plant; Criterios para la rehabilitacion mayor de un rotor de compresor centrifugo de planta de proceso

    Energy Technology Data Exchange (ETDEWEB)

    Bertin, Galo; Felix, Jorge A.; Quijano, Octavio [Especialistas en Turbopartes, S.A. de C.V., Queretaro, Queretaro (Mexico)

    2007-11-15

    In this paper are included the main criteria to consider in the greater rehabilitation of a centrifugal compressor rotor, that has as an aim to count on a reliable rotor, fulfilling with the original design of the equipment and with norms and international standards. Also, the main causes of damage that occur in the rotors of this type in the process plants are presented. [Spanish] En el presente trabajo se incluyen los principales criterios a considerar en la rehabilitacion mayor de un rotor de compresor centrifugo, que tienen como finalidad contar con un rotor confiable, cumpliendo con el diseno original del equipo y con normas y estandares internacionales. Asi mismo, se presentan las principales causas de dano que ocurren en los rotores de este tipo en las plantas de proceso.

  12. Mapping of the Sca1 and pcd genes on mouse chromosome 13 provides evidence that they are different genes

    Energy Technology Data Exchange (ETDEWEB)

    Servadio, A.; McCall, A.; Zoghbi, H. [Baylor College of Medicine, Houston, TX (United States); Eicher, E.M. [Jackson Laboratory, Bar Harbor, ME (United States)

    1995-10-10

    It is well established that large chromosomal segments have remained intact during the evolution of different mammalian species. Thus, mapping information for a gene in mammalian species facilitates mapping the same gene in another mammalian species. In addition, phenotypically similar diseases that map to linkage conserved regions in two species may be caused by mutations in the same gene. Spinocerebellar ataxia type 1 (SCA1) is a dominantly inherited human disorder characterized by progressive ataxia, dysarthria, and dysmetria. SCA1 maps to the short arm of human chromosome (Chr) 6 in the 6p23-p22 region. SCA1 is caused by the expansion of an unstable CAG repeat located within the coding region of a novel protein, ataxin-1, Purkinje cell degeneration (pcd) is a recessively inherited mouse disorder characterized by a moderate ataxia, usually noted by 3-4 weeks of age. Progressive degeneration of Purkinje cells is the underlying pathogenesis in this disorder. The pcd gene was assigned to mouse Chr 13 because it showed linkage to extra toes (Xt) and pearl (pe). Some doubt about this assignment existed, however, because the calculated genetic distance between pcd and Xt was 32 cM and that between pcd and pe was 18 cM. If pcd is located in Chr 13, its placement relative to Xt and pe suggests that it would be located in the region that shares linkage homology with the region that shares linkage homology with the region of human Chr 6 that contains SCA1. Here, we present data that confirm the assignment of pcd to Chr 13, map the mouse Sca1 gene to Chr 13, and eliminate Sca1 as a candidate gene for pcd. 11 refs., 1 tab.

  13. A discreet control of sliding ways of an induction motor; Control discreto de modos deslizantes de un motor de induccion

    Energy Technology Data Exchange (ETDEWEB)

    Rivera Dominguez, Jorge

    2001-12-15

    A control of sliding ways in discreet time for non-linear discreet systems is designed, also the technique of the control by histograms for non-linear discreet systems was developed, and an observer of reduced order was developed for non-linear electromechanical discreet systems. All these techniques are applied to a non-linear discreet model of an induction motor that was found here, that posses electrical and mechanical dynamics, in which the load pair is considered an unknown disturbance. With complete measurements of the states are satisfied the pursuing of the rotor velocity and the amplitude of the magnetic flux of the rotor, where the unknown load does not affect the velocity regulation. Next, an observer of reduced order is implemented where the velocity and current measurements are employed to consider the load pair and the flows that are very difficult to measure. The proposed method has a design and stability procedure of direct analyses, conserving a simple structure of the control law. The simulations predict that the system is robust with respect to several types of load pairs. The responses of velocity and amplitude of the rotor flow and the entrance references evolved very well. These references have a linear dynamics of second order with time constants that can be chosen by the motor user. The practical aspects for a future digital implementation of the control law are considered, including the velocity and currents sensors, the preparation of signals, the transformation of the current in the frame of stationary reference, PWM and inverter modules, which were seen in detail. The experimental results are left as a future work. [Spanish] Se disena un control de modos deslizantes en tiempo discreto para sistemas discretos no lineales, tambien se desarrollo la tecnica del control por bloques para sistemas discretos no lineales, y un observador de orden reducido fue desarrollado para sistemas discretos electromecanicos no lineales. Todas estas tecnicas

  14. Plataforma virtual de péndulo sobre carro deslizante para la enseñanza del control automático

    Directory of Open Access Journals (Sweden)

    Oscar Rodriguez D

    2013-09-01

    Full Text Available En este artículo se presenta el desarrollo de un sistema de plataforma virtual para la enseñanza del control automático basado en el péndulo invertido sobre carro deslizante, el cual se desarrolla herramientas didácticas sobre un prototipo virtual, simulando el modelo no lineal en matlab y presentado en un entorno amigable basado en easy-java. Para el diseño de los controladores, se tienen en cuenta dos aspectos principales como los son el “swing up” (llevar el péndulo a posición vertical y el balanceo (mantener el péndulo en la posición vertical. La interfaz al usuario busca facilitar el aprendizaje de los conceptos básicos de un sistema de control automático para estudiantes de pregrado y posgrado, buscando minimizar costos y tiempo en la enseñanza e implementación de sistemas de control.

  15. Effect of spatio-energy correlation in PCD due to charge sharing, scatter, and secondary photons

    Science.gov (United States)

    Rajbhandary, Paurakh L.; Hsieh, Scott S.; Pelc, Norbert J.

    2017-03-01

    Charge sharing, scatter and fluorescence events in a photon counting detector (PCD) can result in multiple counting of a single incident photon in neighboring pixels. This causes energy distortion and correlation of data across energy bins in neighboring pixels (spatio-energy correlation). If a "macro-pixel" is formed by combining multiple small pixels, it will exhibit correlations across its energy bins. Charge sharing and fluorescence escape are dependent on pixel size and detector material. Accurately modeling these effects can be crucial for detector design and for model based imaging applications. This study derives a correlation model for the multi-counting events and investigates the effect in virtual non-contrast and effective monoenergetic imaging. Three versions of 1 mm2 square CdTe macro-pixel were compared: a 4×4 grid, 2×2 grid, or 1×1 composed of pixels with side length 250 μm, 500 μm, or 1 mm, respectively. The same flux was applied to each pixel, and pulse pile-up was ignored. The mean and covariance matrix of measured photon counts is derived analytically using pre-computed spatio-energy response functions (SERF) estimated from Monte Carlo simulations. Based on the Cramer-Rao Lower Bound, a macro-pixel with 250×250 μm2 sub-pixels shows 2.2 times worse variance than a single 1 mm2 pixel for spectral imaging, while its penalty for effective monoenergetic imaging is <10% compared to a single 1 mm2 pixel.

  16. Regulation of Biofilm Formation by Hfq is Influenced by Presence of Plasmid pCD1 in Yersinia Pestis Biovar Microtus

    Directory of Open Access Journals (Sweden)

    Huiying Yang

    2017-10-01

    Full Text Available Yersinia pestis synthesizes the attached biofilms in the flea gut to promotethe flea-borne transmission of this deadly pathogen. Bellows et al. reported that the posttranscriptional regulator Hfq inhibites biofilm formation in apCD1− derivative of Y. pestis CO92, however, we found that Hfq stimulates biofilm production in a microtus strain of Y. pestis with the typical plasmids, including pCD1. When we cured pCD1 from this strain, the biofilm phenotype was in accordance with that reported by Bellows et al., indicating that the unknown pCD1-associated factors modulating the regulatory pathways of Y. pestis biofilm formation. Further gene regulation experiments using relevant pCD1+ Y. pestis strains disclose that Hfq positively regulates the expression of hmsHFRS and hmsT encoding a diguanylate cyclase while negatively regulates the expression of hmsP encoding the sole phosphodiesterase. However, Hfq has no regulatory effect on the expression of hmsCDE at the mRNA and protein levels. Our results suggest that we should be cautious to make conclusion from results based on the pCD1-cured Y. pestis.

  17. The Development of Open Water-lubricated Polycrystalline Diamond (PCD) Thrust Bearings for Use in Marine Hydrokinetic (MHK) Energy Machines

    Energy Technology Data Exchange (ETDEWEB)

    Cooley, Craig, H.; Khonsari, Michael,, M; Lingwall, Brent

    2012-11-28

    Polycrstalline diamond (PCD) bearings were designed, fabricated and tested for marine-hydro-kinetic (MHK) application. Bearing efficiency and life were evaluated using the US Synthetic bearing test facility. Three iterations of design, build and test were conducted to arrive at the best bearing design. In addition life testing that simulated the starting and stopping and the loading of real MHK applications were performed. Results showed polycrystalline diamond bearings are well suited for MHK applications and that diamond bearing technology is TRL4 ready. Based on life tests results bearing life is estimated to be at least 11.5 years. A calculation method for evaluating the performance of diamond bearings of round geometry was also investigated and developed. Finally, as part of this effort test bearings were supplied free of charge to the University of Alaska for further evaluation. The University of Alaska test program will subject the diamond bearings to sediment laden lubricating fluid.

  18. Determinación de la Posición Angular de Motor de Reluctancia Conmutada MFR132.5 con Estimador de Horizonte Deslizante

    Directory of Open Access Journals (Sweden)

    Ariel O. Cepero Díaz

    2014-10-01

    Full Text Available Resumen: La determinación de la posición angular instantánea del rotor es parte integral del control en los accionamientos de Motores de Reluctancia Conmutada (MRC. La medición directa de esta variable adiciona complejidad y costo al sistema y no siempre da buenos resultados. Esto ha motivado el desarrollo y prueba de estimadores de la posición angular del rotor que utilicen solamente las mediciones de las variables eléctricas del MRC. En este trabajo se presentan dos variantes del Estimador de Horizonte Deslizante (MHE para estimar la velocidad y la posición angular del rotor del MRC MFR 132.5, empleando dos modelos distintos del motor, uno de caja blanca y otro de caja gris. Se muestran los resultados de la simulación de los estimadores diseñados para estimar la velocidad y la posición angular del rotor durante el arranque hasta haber activado consecutivamente todas las fases y para estimar estas variables cuando el motor trabaja regularmente y aparecen perturbaciones en el torque de la carga, considerando en ambos casos un error en la estimación de la posición angular de partida y la presencia de ruidos en las mediciones. Los resultados demuestran que este tipo de estimadores realiza estimaciones satisfactorias del estado del motor, aún ante la presencia de perturbaciones en el torque de la carga, siendo mejores cuando se utiliza un modelo gris del sistema. Copyright © 2014 CEA. Publicado por Elsevier España, S.L. Todos los derechos reservados. Abstract: The measure of the instant angular position of the rotor is integral part of the control of Switching Reluctance Motors (SRM drivers. The direct measurement of this variable adds complexity and cost to the system and it doesn’t give good results sometimes. That has motivated the development and test of estimators for the rotor angular position that only use the measurements of the electrical variables of the SRM. In this work are presented two

  19. Exogenous Trehalose Largely Alleviates Ionic Unbalance, ROS Burst and PCD Occurrence Induced by High Salinity in Arabidopsis Seedlings

    Directory of Open Access Journals (Sweden)

    Lei eYang

    2014-10-01

    Full Text Available Trehalose (Tre has been reported to play a critical role in plant response to salinity and the involved mechanisms remain to be investigated in detail. Here, the putative roles of Tre in regulation of ionic balance, cellular redox state, cell death were studied in Arabidopsis under high salt condition. Our results found that the salt-induced restrictions on both vegetative and reproductive growth in salt-stressed plants were largely alleviated by exogenous supply with Tre. The microprobe analysis of ionic dynamics in the leaf and stem of florescence highlighted the Tre ability to retain K and K/Na ratio in plant tissues to improve salt tolerance. The flow cytometric (FCM assay of cellular levels of ROS (reactive oxygen species and PCD (programmed cell death displayed that Tre was able to antagonized salt-induced damages in redox state and cell death and sucrose did not play the same role with Tre. By comparing ionic distribution in leaf and IS (inflorescence stem, we found that Tre was able to restrict Na transportation to IS from leaves since that the ratio of Na accumulation in leaves relative to IS was largely improved due to Tre. The marked decrease of Na ion and improved sucrose level in IS might account for the promoted floral growth when Tre was included in the saline solution. At the same time, endogenous soluble sugars and antioxidant enzyme activities in the salt-stressed plants were also elevated by Tre to counteract high salt stress. We concluded that Tre could improve Arabidopsis salt resistance with respect to biomass accumulation and floral transition in the means of regulating plant redox state, cell death and ionic distribution.

  20. Control activo de vibraciones en estructuras tipo edificio sometidas a sismos utilizando múltiple retroalimentación positiva de la posición y modos deslizantes

    Directory of Open Access Journals (Sweden)

    Josué Enríquez-Zárate

    2014-01-01

    Full Text Available Este trabajo considera el análisis estructural y dinámico de un a estructura tipo edificio de tres pisos con un absorbedor de v ibraciones pasivo/activo. La base de la estructura se perturba con un gene rador de vibraciones, proporcionando fuerzas de excitación y ru ido emulando transporte terrestre, trenes subterráneos y sismos, c omunes en la Ciudad de México. Se considera un registro sísmico real de magnitud 8.1Mw, conteniendo algunas frecuencias resonantes de l a estructura. La estructura mecánica se modela con la metodolog ía de Euler-Lagrange y se valida con técnicas de análisis modal exper imental. El esquema de control activo se diseña para atenuar la respuesta vibratoria del sistema, ocasionada por las fuerzas armónicas qu e actúan en la base, empleando múltiple retroalimentación posit iva de la posición y control por modos deslizantes para mejorar la robust ez del sistema en lazo cerrado y atenuar tres modos de vibració n. Resultados en simulación y experimentales describen el desempeñ o del sistema completo.

  1. Molecular and enzymatic characterization of two enzymes BmPCD and BmDHPR involving in the regeneration pathway of tetrahydrobiopterin from the silkworm Bombyx mori.

    Science.gov (United States)

    Li, Wentian; Gong, Meixia; Shu, Rui; Li, Xin; Gao, Junshan; Meng, Yan

    2015-08-01

    Tetrahydrobiopterin (BH4) is an essential cofactor of aromatic amino acid hydroxylases and nitric oxide synthase so that BH4 plays a key role in many biological processes. BH4 deficiency is associated with numerous metabolic syndromes and neuropsychological disorders. BH4 concentration in mammals is maintained through a de novo synthesis pathway and a regeneration pathway. Previous studies showed that the de novo pathway of BH4 is similar between insects and mammals. However, knowledge about the regeneration pathway of BH4 (RPB) is very limited in insects. Several mutants in the silkworm Bombyx mori have been approved to be associated with BH4 deficiency, which are good models to research on the RPB in insects. In this study, homologous genes encoding two enzymes, pterin-4a-carbinolamine dehydratase (PCD) and dihydropteridine reductase (DHPR) involving in RPB have been cloned and identified from B. mori. Enzymatic activity of DHPR was found in the fat body of wild type silkworm larvae. Together with the transcription profiles, it was indicated that BmPcd and BmDhpr might normally act in the RPB of B. mori and the expression of BmDhpr was activated in the brain and sexual glands while BmPcd was expressed in a wider special pattern when the de novo pathway of BH4 was lacked in lemon. Biochemical analyses showed that the recombinant BmDHPR exhibited high enzymatic activity and more suitable parameters to the coenzyme of NADH in vitro. The results in this report give new information about the RPB in B. mori and help in better understanding insect BH4 biosynthetic networks. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Effects of number of cagemates on home cage ethanol drinking during proximal cagemate drinking (PCD) procedures in male and female CD-1 mice.

    Science.gov (United States)

    Tomie, Arthur; Samuel, Allison Gayle; Sprung, Dana Michelle; Malul, Yael; Yu, Lei

    2015-03-03

    The present experiment evaluated the effects of the Number of Cagemates (0 vs 1 vs 2) on home cage ethanol drinking during Proximal Cagemate Drinking (PCD) procedures in Male and Female CD-1 mice. Continuous-access home cage 2-bottle (ethanol vs. water) free-choice procedures were employed. PCD procedures eliminate the distracting effects of direct physical contact between Drinkers and their Cagemates on ethanol drinking by imposing a translucent plastic barrier strip between them. If direct physical contact distracts from drinking, then one Cagemate would drink more ethanol and more water than two Cagemates housed together on the same side of the barrier. This would be the case even if two Cagemates stimulated more ethanol drinking in the Drinker housed on the other side of the barrier, due to the social stimulation effects of additional Cagemates. Results revealed that the ethanol intake of Female Drinkers was directly related to the number of Cagemates on the other side of the barrier strip, but this social stimulation effect was not observed in Male Drinkers. For Male Cagemates and Female Cagemates, the single Cagemate provided elevated ethanol intake and elevated water intake relative to the ethanol intake and water intake of each Cagemate in the two Cagemates condition. The data revealed that direct physical contact between Cagemates reduced their ethanol intake, even while stimulating ethanol intake of the Drinker on the other side of the barrier, indicating that the effects of social stimulation on ethanol drinking are not entirely due to effects of modeling or peer pressure. The PCD procedures allow the evaluation of effects of a broad range of social factors on home cage ethanol drinking in mice. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Microcomputer based sliding regime discrete control for synchronous AC motors Control discreto por microordenador basado en regímenes deslizantes para motores de corriente alterna síncronos

    Directory of Open Access Journals (Sweden)

    Eduardo Palomar–Lever

    2007-12-01

    Full Text Available The basic ideas to design discrete algorithms used to calculate unmeasured mechanical or electrical variables, in order to control electrical motors in mechanical systems are presented. The main point of the paper is to simplify the algorithms by using a linear discrete time model without any variable limitations and to reduce the computing capacity requirements of the controller. Limited references, based on the discrete sliding mode for the exception of the influences of variable limitations, are proposed and designed. The main advantage of the controller presented in this paper is that a large control error does not bestow any problems. In such a case, the system always works in an area without the limitations. Original observation algorithms of both position and rotational velocity for exterior permanent magnet synchronous motors are designed. A computer simulation was performed and the results are presented, showing high dynamic accuracy.Se presentan las ideas básicas para diseñar algoritmos discretos para calcular las variables mecánicas o eléctricas, no medidas sino estimadas, para controlar motores eléctricos en sistemas mecánicos. El objetivo principal de este artículo es simplificar los algoritmos usando un modelo de tiempo discreto lineal sin ninguna limitación en las variables y reducir los requisitos de capacidad informática del controlador. Las referencias limitadas, basadas en el modo deslizante discreto para la excepción de las influencias de limitaciones de las variables, se proponen y diseñan. La ventaja principal del controlador presentada en este artículo es que un error de control grande no causa ningún problema. En dicho caso, el sistema trabaja siempre en un área sin limitaciones. Se diseñan los algoritmos de la observación originales de la posición y de la velocidad rotatoria para el imán permanente exterior de motores síncronos. Se llevó a cabo una simulación en computadora y se presentan los

  4. Avaliação eletromiográfica dos músculos da mastigação, da movimentação mandibular e do posicionamento condilar de pacientes desdentados totais com disfunção temporomandibular, antes e após a instalação de próteses totais com pistas deslizantes de Nóbilo

    OpenAIRE

    Rogério Fávaro Pavão

    2007-01-01

    O objetivo deste trabalho foi estudar as medidas dos movimentos da mandíbula, o posicionamento dos côndilos nas fossas mandibulares, os sinais e sintomas de disfunção temporomandibular e a atividade eletromiográfica em pacientes desdentados totais, antes e após a instalação das próteses totais com pistas deslizantes de Nóbilo. Foram selecionados nove pacientes portadores de próteses totais superior e inferior, com presença de sinais e sintomas de disfunção temporomandibular e com comprometime...

  5. The N protein of Tomato spotted wilt virus (TSWV) is associated with the induction of programmed cell death (PCD) in Capsicum chinense plants, a hypersensitive host to TSWV infection.

    Science.gov (United States)

    Lovato, Fernanda Antinolfi; Inoue-Nagata, Alice Kazuko; Nagata, Tatsuya; de Avila, Antônio Carlos; Pereira, Luiz Alfredo Rodrigues; Resende, Renato Oliveira

    2008-11-01

    In sweet pepper, the Tsw gene, originally described in Capsicum chinense, has been widely used as an efficient gene for inducing a hypersensitivity response (HR) derived Tomato spotted wilt virus (TSWV) resistance. Since previously reported studies suggested that the TSWV-S RNA mutation(s) are associated with the breakdown of Tsw mediated TSWV resistance in peppers, the TSWV genes N (structural nucleocapsid protein) and NS(S) (non-structural silencing suppressor protein) were cloned into a Potato virus X (PVX)-based expression vector, and inoculated into the TSWV-resistant C. chinense genotype, PI 159236, to identify the Tsw-HR viral elicitor. Typical HR-like chlorotic and necrotic lesions followed by leaf abscission were observed only in C. chinense plants inoculated with the PVX-N construct. Cytopathological analyses of these plants identified fragmented genomic DNA, indicative of programmed cell death (PCD), in mesophyll cell nuclei surrounding PVX-N-induced necrotic lesions. The other constructs induced only PVX-like symptoms without HR-like lesions and there were no microscopic signs of PCD. The mechanism of TSWV N-gene HR induction is apparently species specific as the N gene of a related tospovirus, Tomato chlorotic spot virus, was not a HR elicitor and did not cause PCD in infected cells.

  6. Centrifugo-pneumatic sedimentation, re-suspension and transport of microparticles.

    Science.gov (United States)

    Zhao, Y; Schwemmer, F; Zehnle, S; von Stetten, F; Zengerle, R; Paust, N

    2015-11-07

    Microparticles are widely used as solid phase for affinity-based separation. Here, we introduce a new method for automated handling of microparticles in centrifugal microfluidics that is not restricted by the particle size and requires neither auxiliary means such as magnets nor coating of microfluidic structures. All steps are initiated and controlled by the speed of rotation only. It is based on storage and "on demand" release of pneumatic energy within tunable time frames: a slow release of the pneumatic energy triggers a first fluidic path through which the supernatant above the sedimented particles is removed. An abrupt release triggers a second path which allows for liquid routing and transport of the re-suspended particles. Re-suspension of particles is thereby achieved by quickly changing the speed of rotation. We demonstrate the exchange of the particle carrier medium with a supernatant removal efficiency of more than 99.5% and a particle loss below 4%. Re-suspension and subsequent transport of suspended particles show a particle loss below 7%. The method targets the automation of particle-based assays e.g. DNA extractions and immunoassays. It is compatible with monolithic integration and suitable for mass production technologies e.g. thermoforming or injection moulding.

  7. O gestor e a PcD: reflexões sobre aprendizagens e competências na construção da diversidade nas organizações The disabled person (dp and the manager: reflections on learning and competencies in the construction of diversity in organizations

    Directory of Open Access Journals (Sweden)

    Claudia Serrano

    2011-08-01

    Full Text Available Esta pesquisa teve como objetivo estudar a experiência de gestores na inclusão de pessoas com deficiência PcDs em suas equipes. A intenção foi identificar e analisar os processos de aprendizagem e as competências desenvolvidas pelos gestores para lidar com o universo da PcD, a partir dos modelos teóricos de Sandberg 2000 , Cheetham e Chivers 1996, 2005 e Cox e Baele 1997 . Seguindo os pressupostos do paradigma interpretativista e do estudo qualitativo básico MERRIAM, 2002 , foram analisadas as experiências de inclusão de seis gestores e seis PcDs a eles subordinadas, com deficiências moderadas a severas, em cinco empresas paulistas, multinacionais, dos segmentos editorial, energia, tecnologia diesel, agronegócios e automotivo. O principal instrumento de coleta de dados foi entrevistas em profundidade, complementadas por análise documental e observações diretas. A análise dos dados revelou que, para os gestores, o ato de incluir está mais relacionado à questão da justiça social do que à ideia de empoderamento da PcD. Tal interpretação os levou a priorizar o desenvolvimento de dois tipos de competências: comportamentais e de éticas e valores. O principal processo de aprendizagem identificado para o desenvolvimento dessas competências foi o experiencial, o que levou os gestores a revisar seus conceitos, questionar e modificar suas crenças e, em consequência dessa reflexão, repensar sua forma de gerenciar. Os resultados pretendem contribuir para a discussão sobre o tema a partir de uma nova perspectiva: o gestor como agente de inclusão.This research aimed to study the experience of managers in the inclusion of persons with disabilities (DP in their teams. The intention was to identify and analyze the processes of learning and skills developed by managers to deal with the universe of DP, based on theoretical models of Sandberg (2000, Cheetham and Chivers (1996, 2005 and Cox and Baele (1997. Following the assumptions of

  8. Aventuras da Significação: Bakhtin e Eco à procura do signo deslizante

    Directory of Open Access Journals (Sweden)

    Humberto Ivan Keske

    2008-12-01

    Full Text Available The present work operatons on the possibility of articulation between the conception of enunciation context introduced by Bakhtin and Voloshinov (1997 and the notion of text produced by Umberto Eco (1986. With this goal in mind, a dialogue between some elements presented by both Bakhtin and Voloshinov (1997 and Eco (1986 will be attempted, in order to re-adress the issue of transformation of textual meaning caused by change in enunciation context. From the intertext process and from context influence emerge different narratives which interlace themselves to compose the multiplicity of tissues that complete, collide, confront and veil themselves for the establishing, construction and updating of one or several meanings.

  9. Fluidic automation of nitrate and nitrite bioassays in whole blood by dissolvable-film based centrifugo-pneumatic actuation

    DEFF Research Database (Denmark)

    Nwankire, Charles E.; Chan, Di-Sien S.; Gaughran, Jennifer

    2013-01-01

    This paper demonstrates the full centrifugal microfluidic integration and automation of all liquid handling steps of a 7-step fluorescence-linked immunosorbent assay (FLISA) for quantifying nitrate and nitrite levels in whole blood within about 15 min. The assay protocol encompasses the extraction...... of metered plasma, the controlled release of sample and reagents (enzymes, co-factors and fluorescent labels), and incubation and detection steps. Flow control is implemented by a rotationally actuated dissolvable film (DF) valving scheme. In the valves, the burst pressure is primarily determined...

  10. Optical system to study temperature influenced chemical and mechanical changes to the PCD structure

    CSIR Research Space (South Africa)

    Masina, B

    2010-09-01

    Full Text Available in temperature until steady state 0 20 40 60 80 100 0.0 0.2 0.4 0.6 0.8 1.0 N or m al iz ed T em pe ra tu re Microseconds Model prediction © CSIR 2010 Slide 9 We expect a rapid rise in temperature until steady state 0 20 40 60 80 100 0....0 0.2 0.4 0.6 0.8 1.0 N or m al iz ed T em pe ra tu re Microseconds Model prediction Experimental data 0 10 20 30 40 50 60 70 450 500 550 600 650 700 750 P ea K t em pe ra tu re (K el vi n) Minutes © CSIR 2010...

  11. Surface Quality of Staggered PCD End Mill in Milling of Carbon Fiber Reinforced Plastics

    Directory of Open Access Journals (Sweden)

    Guangjun Liu

    2017-02-01

    Full Text Available Machined surface quality determines the reliability, wear resistance and service life of carbon fiber reinforced plastic (CFRP workpieces. In this work, the formation mechanism of the surface topography and the machining defects of CFRPs are proposed, and the influence of milling parameters and fiber cutting angles on the surface quality of CFRPs is obtained, which can provide a reference for extended tool life and good surface quality. Trimming and slot milling tests of unidirectional CFRP laminates are performed. The surface roughness of the machined surface is measured, and the influence of milling parameters on the surface roughness is analyzed. A regression model for the surface roughness of CFRP milling is established. A significance test of the regression model is conducted. The machined surface topography of milling CFRP unidirectional laminates with different fiber orientations is analyzed, and the effect of fiber cutting angle on the surface topography of the machined surface is presented by using a digital super depth-of-field microscope and scanning electron microscope (SEM. To study the influence of fiber cutting angle on machining defects, the machined topography under different fiber orientations is analyzed. The slot milling defects and their formation mechanism under different fiber cutting angles are investigated.

  12. Identification and characterization of novel defence and PCD signalling components in Arabidopsis

    DEFF Research Database (Denmark)

    Xie, Wenjun

    plants have homologues of SSD6, but none of these have been formally reported. Besides, there are two closely related proteins in Arabidopsis, SSH1 and SSH2, which were also studied in the project. The second gene, SSD12 was confirmed to encode PRLIP2. PRLIP2 contains a signature pentapeptide motif...

  13. Computer simulating for oil fields with artificial elevation method by electrical submersible pump; Simulacao computacional para pocos de petroleo com metodo de elevacao artificial por bombeio centrifugo submerso

    Energy Technology Data Exchange (ETDEWEB)

    Batista, Evellyne da Silva; Maitelli, Andre Laurindo [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil); Costa, Rutacio de Oliveira [PETROBRAS S.A., Natal, RN (Brazil). Unidade de Negocio RN/CE; Barbosa, Tiago de Souza [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. de Engenharia de Computacao

    2008-07-01

    The architecture heterogeneities and petrophysical properties of carbonate reservoirs result from a combination of platform morphology, related depositional environments, relative sea level changes and diagenetic events. The reservoir layering built for static and dynamic modelling purposes should reflect the key heterogeneities (depositional or diagenetic) which govern the fluid flow patterns. The layering needs to be adapted to the goal of the modelling, ranging from full field computations of hydrocarbon volumes, to sector-based fine-scale simulations to test the recovery improvement. This paper illustrates various reservoir layering types, including schemes dominated by depositional architecture, and those more driven by the diagenetic overprint. The examples include carbonate platform reservoirs from different stratigraphic settings (Tertiary, Cretaceous, Jurassic and Permian) and different regions (Europe, Africa and Middle East areas). This review shows how significant stratigraphic surfaces (such as sequence boundaries or maximum flooding) with their associated facies shifts, can be often considered as key markers to constrain the reservoir layering. Conversely, how diagenesis (dolomitization and karst development), resulting in units with particular poroperm characteristics, may significantly overprint the primary reservoir architecture by generating flow units which cross-cut depositional sequences. To demonstrate how diagenetic processes can create reservoir bodies with geometries that cross-cut the depositional fabric, different types of dolomitization and karst development are illustrated. (author)

  14. CONTROLADOR POR MODOS DESLIZANTES DE SEGUNDA ORDEM APLICADO A UM COMPENSADOR SÍNCRONO ESTÁTICO DE DISTRIBUIÇÃO

    OpenAIRE

    Maurício Mendes da Silva

    2015-01-01

    Nos últimos anos se viu que a escassez dos combustíveis fosseis se torna cada vez mais importante o aprimoramento das energias renováveis, tais como: micro hidro geração, energia solar, energia eólica e outras. A razão para tal importância se deve a consolidação do que é chamado futuro em termos de geração de energia, sendo este baseado na descentralização da geração de energia através de redes interligadas de pequenos centros geradores/consumidores. A nível de distribuição,...

  15. Induzione delle Heat shock proteins (Hsp), Programmed Cell Death (PCD) e analisi proteomica di campioni vegetali sottoposti a stress abiotici

    OpenAIRE

    Montanari, Stefania

    2010-01-01

    Plants are constantly under stress, this may negatively affect their development and growth. The effects of stress can be visible as the reduction in rate of growth, and not evident as changes in gene expression and cellular metabolism. Many crops (especially cereals) are sensitive to salts during the development, retarding germination and plant development, and later affecting seed and/or biomass production. In this work, the effects of abiotic stress, particularly salts stress, he...

  16. Purkinje Cell Degeneration in pcd Mice Reveals Large Scale Chromatin Reorganization and Gene Silencing Linked to Defective DNA Repair*

    Science.gov (United States)

    Baltanás, Fernando C.; Casafont, Iñigo; Lafarga, Vanesa; Weruaga, Eduardo; Alonso, José R.; Berciano, María T.; Lafarga, Miguel

    2011-01-01

    DNA repair protects neurons against spontaneous or disease-associated DNA damage. Dysfunctions of this mechanism underlie a growing list of neurodegenerative disorders. The Purkinje cell (PC) degeneration mutation causes the loss of nna1 expression and is associated with the postnatal degeneration of PCs. This PC degeneration dramatically affects nuclear architecture and provides an excellent model to elucidate the nuclear mechanisms involved in a whole array of neurodegenerative disorders. We used immunocytochemistry for histone variants and components of the DNA damage response, an in situ transcription assay, and in situ hybridization for telomeres to analyze changes in chromatin architecture and function. We demonstrate that the phosphorylation of H2AX, a DNA damage signal, and the trimethylation of the histone H4K20, a repressive mark, in extensive domains of genome are epigenetic hallmarks of chromatin in degenerating PCs. These histone modifications are associated with a large scale reorganization of chromatin, telomere clustering, and heterochromatin-induced gene silencing, all of them key factors in PC degeneration. Furthermore, ataxia telangiectasia mutated and 53BP1, two components of the DNA repair pathway, fail to be concentrated in the damaged chromatin compartments, even though the expression levels of their coding genes were slightly up-regulated. Although the mechanism by which Nna1 loss of function leads to PC neurodegeneration is undefined, the progressive accumulation of DNA damage in chromosome territories irreversibly compromises global gene transcription and seems to trigger PC degeneration and death. PMID:21700704

  17. Purkinje cell degeneration in pcd mice reveals large scale chromatin reorganization and gene silencing linked to defective DNA repair.

    Science.gov (United States)

    Baltanás, Fernando C; Casafont, Iñigo; Lafarga, Vanesa; Weruaga, Eduardo; Alonso, José R; Berciano, María T; Lafarga, Miguel

    2011-08-12

    DNA repair protects neurons against spontaneous or disease-associated DNA damage. Dysfunctions of this mechanism underlie a growing list of neurodegenerative disorders. The Purkinje cell (PC) degeneration mutation causes the loss of nna1 expression and is associated with the postnatal degeneration of PCs. This PC degeneration dramatically affects nuclear architecture and provides an excellent model to elucidate the nuclear mechanisms involved in a whole array of neurodegenerative disorders. We used immunocytochemistry for histone variants and components of the DNA damage response, an in situ transcription assay, and in situ hybridization for telomeres to analyze changes in chromatin architecture and function. We demonstrate that the phosphorylation of H2AX, a DNA damage signal, and the trimethylation of the histone H4K20, a repressive mark, in extensive domains of genome are epigenetic hallmarks of chromatin in degenerating PCs. These histone modifications are associated with a large scale reorganization of chromatin, telomere clustering, and heterochromatin-induced gene silencing, all of them key factors in PC degeneration. Furthermore, ataxia telangiectasia mutated and 53BP1, two components of the DNA repair pathway, fail to be concentrated in the damaged chromatin compartments, even though the expression levels of their coding genes were slightly up-regulated. Although the mechanism by which Nna1 loss of function leads to PC neurodegeneration is undefined, the progressive accumulation of DNA damage in chromosome territories irreversibly compromises global gene transcription and seems to trigger PC degeneration and death.

  18. Analysis of the reliability of the centrifugal pumping system on the Northeast pole platforms in the Campos basin; Analise de confiabilidade do sistema de bombeio centrifugo das plataformas do polo nordeste da bacia de Campos

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Luiz; Bardy, Mariana [Principia Engenharia de Informatica, Salvador, BA (Brazil); Simoes Filho, Salvador [PETROBRAS, Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES). Div. de Engenharia Basica Industrial; Neves, Edinei [PETROBRAS, Campos, RJ (Brazil). Exploracao e Producao

    1999-12-01

    The results of the statistical analysis of useful life data for the Submersible Centrifugal Pumping (BCS) sets installed in the wells in the Northeast Pole of the Campos Basin are given in this work. The objective is to analyze the data compiled with a view to determine the failure rate distributions for the various system components. These are important for the reliability analysis of the BCS systems and to predict the expected number of equipment acquisitions over a yearly period. In addition, suggestions are made aimed at improving the operational reliability of the systems analyzed. (author)

  19. Cell wall integrity, genotoxic injury and PCD dynamics in alfalfa saponin-treated white poplar cells highlight a complex link between molecule structure and activity.

    Science.gov (United States)

    Paparella, Stefania; Tava, Aldo; Avato, Pinarosa; Biazzi, Elisa; Macovei, Anca; Biggiogera, Marco; Carbonera, Daniela; Balestrazzi, Alma

    2015-03-01

    In the present work, eleven saponins and three sapogenins purified from Medicago sativa were tested for their cytotoxicity against highly proliferating white poplar (Populus alba L.) cell suspension cultures. After preliminary screening, four saponins with different structural features in terms of aglycone moieties and sugar chains (saponin 3, a bidesmoside of hederagenin; saponins 4 and 5, monodesmoside and bidesmoside of medicagenic acid respectively, and saponin 10, a bidesmoside of zanhic acid) and different cytotoxicity were selected and used for further investigation on their structure-activity relationship. Transmission Electron Microscopy (TEM) analyses provided for the first time evidence of the effects exerted by saponins on plant cell wall integrity. Exposure to saponin 3 and saponin 10 resulted into disorganization of the outer wall layer and the effect was even more pronounced in white poplar cells treated with the two medicagenic acid derivatives, saponins 4 and 5. Oxidative burst and nitric oxide accumulation were common hallmarks of the response of white poplar cells to saponins. When DNA damage accumulation and DNA repair profiles were evaluated by Single Cell Gel Electrophoresis, induction of single and double strand breaks followed by effective repair was observed within 24h. The reported data are discussed in view of the current issues dealing with saponin structure-activity relationship. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Analysis of the potential ambient degradation and in the Hydrographic Basin of Pequeno River in São José dos Pinhais/PR, by the PCD - Physical Conservationist Diagnosis

    Directory of Open Access Journals (Sweden)

    Anderson Mendes CHUEH

    2005-12-01

    Full Text Available This article aims at applying the methodology of Physical- Conservationist Diagnosis (FCD, and from this methodology and from some adaptations we want to demonstrate the results obtained in the quantitative analysis of the potential of degradation of natural resources from the hydrographic basin of “Rio Pequeno” (Pequeno River. The area of the study is located in São José dos Pinhais/PR; this basin is located in the border of the expansion from Metropolitan Area of Curitiba (MAC - and has the conflict between the possibilities and the occupation needs and soil use.

  1. Identification of Prostate Cancer Prognostic Markers

    Science.gov (United States)

    2014-10-01

    GABARAPL2 and LC3-I (to pcDNA-6 +siControl and normalized to actin). pcD NA -6 + siC ont rol pcD NA -6 + siG ate 16a pcD NA -6- GA BA RA PL2 +s iCo ntr...ol pcD NA 6-G AB AR AP L+s iGa te1 6a pcD NA 6 + siC ont rol pcD NA 6 + siG ate 16a pcD NA 6-G AB AR AP L2 +si Co ntr ol pcD NA -6- GA BA RA PL

  2. Primary ciliary dyskinesia presenting with spontaneous pneumothorax: Case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Jia Hou, MD, PhD

    2017-01-01

    Conclusions: Pneumothorax might be one of the complications of the PCD. Combination therapy including ICS+ LA beta2 agonist and carbocistein could be a potential therapy to reduce the frequency of acute exacerbations and delay progression of PCD.

  3. Lung function in patients with primary ciliary dyskinesia: a cross-sectional and 3-decade longitudinal study

    DEFF Research Database (Denmark)

    Marthin, June K; Petersen, Nadia; Skovgaard, Lene T

    2010-01-01

    Early diagnosis and treatment is considered important to prevent lung damage in primary ciliary dyskinesia (PCD).......Early diagnosis and treatment is considered important to prevent lung damage in primary ciliary dyskinesia (PCD)....

  4. Social innovation for People-Centred Development

    DEFF Research Database (Denmark)

    Hulgård, Lars; P.K., Shajahan

    2013-01-01

    Social innovation is closely related to the people-centred development (PCD) framework of knowledge production. The discussion of PCD in this chapter particularly expands on the feature of empowerment and socio-political mobilization of people in social innovation......Social innovation is closely related to the people-centred development (PCD) framework of knowledge production. The discussion of PCD in this chapter particularly expands on the feature of empowerment and socio-political mobilization of people in social innovation...

  5. CCDC39 is required for assembly of inner dynein arms and the dynein regulatory complex and for normal ciliary motility in humans and dogs

    DEFF Research Database (Denmark)

    Merveille, Anne-Christine; Davis, Erica E; Becker-Heck, Anita

    2011-01-01

    -assembly factors of axonemal dyneins, but these mutations account for only about 50% of cases of PCD. We exploited the unique properties of dog populations to positionally clone a new PCD gene, CCDC39. We found that loss-of-function mutations in the human ortholog underlie a substantial fraction of PCD cases...

  6. Morphological classification of plant cell deaths

    NARCIS (Netherlands)

    Doorn, van W.G.; Beers, E.P.; Dangl, J.L.; Franklin-Tong, V.E.; Woltering, E.J.

    2011-01-01

    Programmed cell death (PCD) is an integral part of plant development and of responses to abiotic stress or pathogens. Although the morphology of plant PCD is, in some cases, well characterised and molecular mechanisms controlling plant PCD are beginning to emerge, there is still confusion about the

  7. Plant programmed cell death, ethylene and flower senescence

    NARCIS (Netherlands)

    Woltering, E.J.; Jong, de A.; Hoeberichts, F.A.; Iakimova, E.T.; Kapchina, V.

    2005-01-01

    Programmed cell death (PCD) applies to cell death that is part of the normal life of multicellular organisms. PCD is found throughout the animal and plant kingdoms; it is an active process in which a cell suicide pathway is activated resulting in controlled disassembly of the cell. Most cases of PCD

  8. An international registry for primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Werner, Claudius; Lablans, Martin; Ataian, Maximilian

    2016-01-01

    Primary ciliary dyskinesia (PCD) is a rare autosomal recessive disorder leading to chronic upper and lower airway disease. Fundamental data on epidemiology, clinical presentation, course and treatment strategies are lacking in PCD. We have established an international PCD registry to realise an u...

  9. Heat shock protein 70 inhibits shrinkage-induced programmed cell death via mechanisms independent of effects on cell volume-regulatory membrane transport proteins

    DEFF Research Database (Denmark)

    Nylandsted, J; Jäättelä, M; Hoffmann, E K

    2004-01-01

    Cell shrinkage is a ubiquitous feature of programmed cell death (PCD), but whether it is an obligatory signalling event in PCD is unclear. Heat shock protein 70 (Hsp70) potently counteracts PCD in many cells, by mechanisms that are incompletely understood. In the present investigation, we found...

  10. 10 conference and Latin American turbomachinery exhibition; 10 congreso y exposicion latinoamericana de turbomaquinaria

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-11-15

    This conference was done to promote the exchange of experiences among specialists, users, manufactures and research institutions in the field of the turbomachinery. To spread the last researches and developments focus to the design and maintenance of steam, gas and hydraulic turbines, axial compressors and centrifugal pumps, fans, electric motors, auxiliary equipment and cogeneration. [Spanish] Este congreso se realizo con el fin de promover el intercambio de experiencias entre especialistas, usuarios, fabricantes e institutos de investigacion en el campo de la turbomaquinaria. Divulgar las ultimas investigaciones y desarrollos enfocados al diseno y mantenimiento de turbinas de vapor, de gas e hidraulicas, compresores axiales y centrifugos, bombas, ventiladores, motores electricos, equipos auxiliares y cogeneracion.

  11. Self-consuming innate immunity in Arabidopsis

    DEFF Research Database (Denmark)

    Hofius, Daniel; Mundy, John; Petersen, Morten

    2009-01-01

    Programmed cell death (PCD) associated with the pathogen-induced hypersensitive response (HR) is a hallmark of plant innate immunity. HR PCD is triggered upon recognition of pathogen effector molecules by host immune receptors either directly or indirectly via effector modulation of host targets....... However, it has been unclear by which molecular mechanisms plants execute PCD during innate immune responses. We recently examined HR PCD in autophagy-deficient Arabidopsis knockout mutants (atg) and find that PCD conditioned by one class of plant innate immune receptors is suppressed in atg mutants...... with innate immune responses in eukaryotes as well as of prodeath functions for the autophagy pathway in plants....

  12. The role of mitochondria in yeast programmed cell death

    Directory of Open Access Journals (Sweden)

    Nicoletta eGuaragnella

    2012-07-01

    Full Text Available Mammalian apoptosis and yeast programmed cell death (PCD share a variety of features including ROS production, protease activity and a major role played by mitochondria. In view of this, and of the distinctive characteristics differentiating yeast and multicellular organism PCD, the mitochondrial contribution to cell death in the genetically tractable yeast Saccharomyces cerevisiae has been intensively investigated. In this mini-review we report whether and how yeast mitochondrial function and proteins belonging to oxidative phosphorylation, protein trafficking into and out of mitochondria, and mitochondrial dynamics, play a role in PCD. Since in PCD many processes take place over time, emphasis will be placed on an experimental model based on acetic acid induced PCD (AA-PCD which has the unique feature of having been investigated as a function of time. As will be described there are at least two AA-PCD pathways each with a multifaceted role played by mitochondrial components, in particular by cytochrome c.

  13. The root hair assay facilitates the use of genetic and pharmacological tools in order to dissect multiple signalling pathways that lead to programmed cell death.

    Directory of Open Access Journals (Sweden)

    Joanna Kacprzyk

    Full Text Available The activation of programmed cell death (PCD is often a result of complex signalling pathways whose relationship and intersection are not well understood. We recently described a PCD root hair assay and proposed that it could be used to rapidly screen genetic or pharmacological modulators of PCD. To further assess the applicability of the root hair assay for studying multiple signalling pathways leading to PCD activation we have investigated the crosstalk between salicylic acid, autophagy and apoptosis-like PCD (AL-PCD in Arabidopsis thaliana. The root hair assay was used to determine rates of AL-PCD induced by a panel of cell death inducing treatments in wild type plants treated with chemical modulators of salicylic acid synthesis or autophagy, and in genetic lines defective in autophagy or salicylic acid signalling. The assay demonstrated that PCD induced by exogenous salicylic acid or fumonisin B1 displayed a requirement for salicylic acid signalling and was partially dependent on the salicylic acid signal transducer NPR1. Autophagy deficiency resulted in an increase in the rates of AL-PCD induced by salicylic acid and fumonisin B1, but not by gibberellic acid or abiotic stress. The phenylalanine ammonia lyase-dependent salicylic acid synthesis pathway contributed only to death induced by salicylic acid and fumonisin B1. 3-Methyladenine, which is commonly used as an inhibitor of autophagy, appeared to influence PCD induction in all treatments suggesting a possible secondary, non-autophagic, effect on a core component of the plant PCD pathway. The results suggest that salicylic acid signalling is negatively regulated by autophagy during salicylic acid and mycotoxin-induced AL-PCD. However, this crosstalk does not appear to be directly involved in PCD induced by gibberellic acid or abiotic stress. This study demonstrates that the root hair assay is an effective tool for relatively rapid investigation of complex signalling pathways leading to

  14. Abdominal wall healing in incisional hernia using different biomaterials in rabbits

    Directory of Open Access Journals (Sweden)

    Ana Letícia Gomes Aramayo

    2013-04-01

    Full Text Available PURPOSE: To investigate abdominal wound healing using specific biomaterials in incisional hernias. METHODS: Incisional hernias were produced in 40 rabbits, after that they were reoperated with or without the use of meshes: PREMILENE® (PPL, ULTRAPRO® (UP, PROCEED® (PCD or repairing without mesh (TRANSPALB. After 30 days a macroscopic and microscopic study of the part withdrawn from the abdominal wall was performed. RESULTS: Macroscopic: adhesion Area: PPL> UP and PCD (p = 0.031. Vascularization: PPL> UP and PCD (p = 0.001. PPL groups (p = 0.032 and PCD (p PPL, UP and TRANSPALB (p = 0.010; eosinophils: PPL> UP, and TRANSPALB PCD (p = 0.010; granulation tissue: PPL and PCD> UP and TRANSPALB (p TRANSPALB (p UP (p = 0.009 and TRANSPALB (p TRANSPALB (p PCD and TRANSPALB (p <0.001. CONCLUSION: All types of meshes caused the formation of adhesions. The UP and PCD groups showed lower area and vascularization of the adhesions. The PPL and PCD groups showed higher meshes shrinkage and there was a predominance of acute inflammatory process in the PCD group.

  15. Do mitochondria play a role in remodelling lace plant leaves during programmed cell death?

    Science.gov (United States)

    Lord, Christina E N; Wertman, Jaime N; Lane, Stephanie; Gunawardena, Arunika H L A N

    2011-06-06

    Programmed cell death (PCD) is the regulated death of cells within an organism. The lace plant (Aponogeton madagascariensis) produces perforations in its leaves through PCD. The leaves of the plant consist of a latticework of longitudinal and transverse veins enclosing areoles. PCD occurs in the cells at the center of these areoles and progresses outwards, stopping approximately five cells from the vasculature. The role of mitochondria during PCD has been recognized in animals; however, it has been less studied during PCD in plants. The following paper elucidates the role of mitochondrial dynamics during developmentally regulated PCD in vivo in A. madagascariensis. A single areole within a window stage leaf (PCD is occurring) was divided into three areas based on the progression of PCD; cells that will not undergo PCD (NPCD), cells in early stages of PCD (EPCD), and cells in late stages of PCD (LPCD). Window stage leaves were stained with the mitochondrial dye MitoTracker Red CMXRos and examined. Mitochondrial dynamics were delineated into four categories (M1-M4) based on characteristics including distribution, motility, and membrane potential (ΔΨm). A TUNEL assay showed fragmented nDNA in a gradient over these mitochondrial stages. Chloroplasts and transvacuolar strands were also examined using live cell imaging. The possible importance of mitochondrial permeability transition pore (PTP) formation during PCD was indirectly examined via in vivo cyclosporine A (CsA) treatment. This treatment resulted in lace plant leaves with a significantly lower number of perforations compared to controls, and that displayed mitochondrial dynamics similar to that of non-PCD cells. Results depicted mitochondrial dynamics in vivo as PCD progresses within the lace plant, and highlight the correlation of this organelle with other organelles during developmental PCD. To the best of our knowledge, this is the first report of mitochondria and chloroplasts moving on transvacuolar

  16. Do mitochondria play a role in remodelling lace plant leaves during programmed cell death?

    Directory of Open Access Journals (Sweden)

    Lane Stephanie

    2011-06-01

    Full Text Available Abstract Background Programmed cell death (PCD is the regulated death of cells within an organism. The lace plant (Aponogeton madagascariensis produces perforations in its leaves through PCD. The leaves of the plant consist of a latticework of longitudinal and transverse veins enclosing areoles. PCD occurs in the cells at the center of these areoles and progresses outwards, stopping approximately five cells from the vasculature. The role of mitochondria during PCD has been recognized in animals; however, it has been less studied during PCD in plants. Results The following paper elucidates the role of mitochondrial dynamics during developmentally regulated PCD in vivo in A. madagascariensis. A single areole within a window stage leaf (PCD is occurring was divided into three areas based on the progression of PCD; cells that will not undergo PCD (NPCD, cells in early stages of PCD (EPCD, and cells in late stages of PCD (LPCD. Window stage leaves were stained with the mitochondrial dye MitoTracker Red CMXRos and examined. Mitochondrial dynamics were delineated into four categories (M1-M4 based on characteristics including distribution, motility, and membrane potential (ΔΨm. A TUNEL assay showed fragmented nDNA in a gradient over these mitochondrial stages. Chloroplasts and transvacuolar strands were also examined using live cell imaging. The possible importance of mitochondrial permeability transition pore (PTP formation during PCD was indirectly examined via in vivo cyclosporine A (CsA treatment. This treatment resulted in lace plant leaves with a significantly lower number of perforations compared to controls, and that displayed mitochondrial dynamics similar to that of non-PCD cells. Conclusions Results depicted mitochondrial dynamics in vivo as PCD progresses within the lace plant, and highlight the correlation of this organelle with other organelles during developmental PCD. To the best of our knowledge, this is the first report of

  17. Low-dose lung cancer screening with photon-counting CT: a feasibility study

    Science.gov (United States)

    Symons, Rolf; Cork, Tyler E.; Sahbaee, Pooyan; Fuld, Matthew K.; Kappler, Steffen; Folio, Les R.; Bluemke, David A.; Pourmorteza, Amir

    2017-01-01

    To evaluate the feasibility of using a whole-body photon-counting detector (PCD) CT scanner for low-dose lung cancer screening compared to a conventional energy integrating detector (EID) system. Radiation dose-matched EID and PCD scans of the COPDGene 2 phantom were acquired at different radiation dose levels (CTDIvol: 3.0, 1.5, and 0.75 mGy) and different tube voltages (120, 100, and 80 kVp). EID and PCD images were compared for quantitative Hounsfield unit (HU) accuracy, noise levels, and contrast-to-noise ratios (CNR) for detection of ground-glass nodules (GGN) and emphysema. The PCD HU accuracy was better than EID for water at all scan parameters. PCD HU stability for lung, GGN and emphysema regions were superior to EID and PCD attenuation values were more reproducible than EID for all scan parameters (all P  cancer screening while maintaining diagnostic quality.

  18. On Programmed Cell Death in Plasmodium falciparum: Status Quo

    Directory of Open Access Journals (Sweden)

    Dewaldt Engelbrecht

    2012-01-01

    Full Text Available Conflicting arguments and results exist regarding the occurrence and phenotype of programmed cell death (PCD in the malaria parasite Plasmodium falciparum. Inconsistencies relate mainly to the number and type of PCD markers assessed and the different methodologies used in the studies. In this paper, we provide a comprehensive overview of the current state of knowledge and empirical evidence for PCD in the intraerythrocytic stages of P. falciparum. We consider possible reasons for discrepancies in the data and offer suggestions towards more standardised investigation methods in this field. Furthermore, we present genomic evidence for PCD machinery in P. falciparum. We discuss the potential adaptive or nonadaptive role of PCD in the parasite life cycle and its possible exploitation in the development of novel drug targets. Lastly, we pose pertinent unanswered questions concerning the PCD phenomenon in P. falciparum to provide future direction.

  19. On Programmed Cell Death in Plasmodium falciparum: Status Quo

    Science.gov (United States)

    Engelbrecht, Dewaldt; Durand, Pierre Marcel; Coetzer, Thérèsa Louise

    2012-01-01

    Conflicting arguments and results exist regarding the occurrence and phenotype of programmed cell death (PCD) in the malaria parasite Plasmodium falciparum. Inconsistencies relate mainly to the number and type of PCD markers assessed and the different methodologies used in the studies. In this paper, we provide a comprehensive overview of the current state of knowledge and empirical evidence for PCD in the intraerythrocytic stages of P. falciparum. We consider possible reasons for discrepancies in the data and offer suggestions towards more standardised investigation methods in this field. Furthermore, we present genomic evidence for PCD machinery in P. falciparum. We discuss the potential adaptive or nonadaptive role of PCD in the parasite life cycle and its possible exploitation in the development of novel drug targets. Lastly, we pose pertinent unanswered questions concerning the PCD phenomenon in P. falciparum to provide future direction. PMID:22287973

  20. Postcoital Dysphoria: Prevalence and Psychological Correlates

    Directory of Open Access Journals (Sweden)

    Robert D. Schweitzer, PhD

    2015-12-01

    Conclusions: The findings confirm that PCD is under‐recognized and under‐researched. There appears to be no relationship between PCD and intimacy in close relationships. Further research is necessary to understand the subjective experience of PCD and to inform the development of a reliable measure. Schweitzer RD, O'Brien J, and Burri A. Postcoital dysphoria: Prevalence and psychological correlates. Sex Med 2015;3:229–237.

  1. Cri du chat syndrome and primary ciliary dyskinesia: a common genetic cause on chromosome 5p.

    Science.gov (United States)

    Shapiro, Adam J; Weck, Karen E; Chao, Kay C; Rosenfeld, Margaret; Nygren, Anders O H; Knowles, Michael R; Leigh, Margaret W; Zariwala, Maimoona A

    2014-10-01

    Cri du chat syndrome (CdCS) and primary ciliary dyskinesia (PCD) are rare diseases that present with frequent respiratory symptoms. PCD can be caused by hemizygous DNAH5 mutation in combination with a 5p segmental deletion attributable to CdCS on the opposite chromosome. Chronic oto-sino-pulmonary symptoms or organ laterality defects in CdCS should prompt an evaluation for PCD. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. La Coherencia de Políticas para el Desarrollo en los ámbitos subestatales. Reflexiones a la luz del caso del País Vasco

    Directory of Open Access Journals (Sweden)

    Unceta, K.

    2017-05-01

    Full Text Available The debate on Policy Coherence for Development (PCD has mostly been associated to States. However, the growing importance acquired by local and regional governments in promoting development and cooperation policies, and the need of a multilevel governance to meet the challenges of development, emphasize the interest of analysing the PCD from a wider perspective including the sub-state level. Considering these issues, this paper focuses on the study of the PCD in the Basque Country, based on a research study carried out about this subject. As a conclusion, relevant considerations that may be interesting to promote the analysis on PCD at sub-state level are pointed out.

  3. A designated centre for people with disabilities operated by Brothers of Charity Southern Services, Cork

    LENUS (Irish Health Repository)

    Casey, Jillian P

    2015-01-01

    Primary ciliary dyskinesia (PCD) is a rare autosomal recessive disorder characterised by abnormal ciliary motion and impaired mucociliary clearance, leading to recurrent respiratory infections, sinusitis, otitis media and male infertility. Some patients also have laterality defects. We recently reported the identification of three disease-causing PCD genes in the Irish Traveller population; RSPH4A, DYX1C1 and CCNO. We have since assessed an additional Irish Traveller family with a complex phenotype involving PCD who did not have any of the previously identified PCD mutations.

  4. Diagnosis problems of paraneoplastic cerebellar degeneration

    Directory of Open Access Journals (Sweden)

    N.A. Shnaider

    2014-01-01

    Full Text Available Paraneoplastic cerebellar degeneration (PCD is a rare form of the paraneoplastic neurological syndrome (PNS. PCD is an autoimmune disease of the central nervous system (CNS affecting the Purkinje cells and possibly other cells of the cerebellum. PCD is characterized by a rapid onset resulting in disability for a few days or weeks; a slow progredient increase in cerebellar symptomatology is observed less often. PCD develops in 1–3% of cancer patients; its fraction accounts for 25% of all forms of PNS. The mean incidence rate of PCD is about 2 cases per 1,000 cancer patients. PCD develops in patients with cancer of the ovary, uterus and fallopian tubes, with small cell lung cancer and Hodgkin's lymphoma. The incidence rate among females is 3 times higher than that among males. Females aged 50–65 years are most likely to suffer from PCD. PCDs are divided into four main subgroups that differ in terms of prognosis and range of associated antineuronal antibodies. In the last decade, different classes of anti-onconeuronal antibodies associated with PCD have been described; 9 of them have been best studied. Anti-Yo and anti-Hu antibodies are most frequently detected upon PCD. PCD can be also diagnosed without anti-onconeuronal antibodies associated with it or their titer in the blood can be low. Differential diagnosis of PCD is complex and is conducted for a wide range of CNS diseases. No single approach to treating PCD currently exists. Surgical removal of the tumor, the source of production of anti-onconeuronal antigens, followed by radiotherapy and/or chemotherapy, does not solve the problem completely, but may reduce severity of the clinical manifestations of PCD or stabilize the pathological process. This explains the need for rapid and profound search for a tumor in patients suspected with PCD. The authors described a clinical case of an acute debut of PCD in 47-year-old female, 6 months after which, the patient was diagnosed with breast

  5. The effect of paclitaxel alone and in combination with cycloheximide on the frequency of premature centromere division in vitro

    Directory of Open Access Journals (Sweden)

    Bajić V.

    2010-01-01

    Full Text Available Premature centromere division (PCD can be viewed as a manifestation of chromosome instability. In order to evaluate the ability of Paclitaxel (Ptx and Cycloheximide (Cy to induce PCD we used a cytokinesis block micronucleus assay (CBMN, fluorescent in situ hybridization (FISH, and the chromosome aberration (CA assay in human peripheral blood lymphocytes. Results showed that Ptx can induce PCD alone or in combination with Cy. These findings call us to pay more attention to PCD as a parameter of genotoxicity in the pre-clinical research of mono and/or combinational therapies for cancer treatment.

  6. Programmed cell death in aging.

    Science.gov (United States)

    Tower, John

    2015-09-01

    Programmed cell death (PCD) pathways, including apoptosis and regulated necrosis, are required for normal cell turnover and tissue homeostasis. Mis-regulation of PCD is increasingly implicated in aging and aging-related disease. During aging the cell turnover rate declines for several highly-mitotic tissues. Aging-associated disruptions in systemic and inter-cell signaling combined with cell-autonomous damage and mitochondrial malfunction result in increased PCD in some cell types, and decreased PCD in other cell types. Increased PCD during aging is implicated in immune system decline, skeletal muscle wasting (sarcopenia), loss of cells in the heart, and neurodegenerative disease. In contrast, cancer cells and senescent cells are resistant to PCD, enabling them to increase in abundance during aging. PCD pathways limit life span in fungi, but whether PCD pathways normally limit adult metazoan life span is not yet clear. PCD is regulated by a balance of negative and positive factors, including the mitochondria, which are particularly subject to aging-associated malfunction. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. An in vivo root hair assay for determining rates of apoptotic-like programmed cell death in plants

    Directory of Open Access Journals (Sweden)

    Hogg Bridget V

    2011-12-01

    Full Text Available Abstract In Arabidopsis thaliana we demonstrate that dying root hairs provide an easy and rapid in vivo model for the morphological identification of apoptotic-like programmed cell death (AL-PCD in plants. The model described here is transferable between species, can be used to investigate rates of AL-PCD in response to various treatments and to identify modulation of AL-PCD rates in mutant/transgenic plant lines facilitating rapid screening of mutant populations in order to identify genes involved in AL-PCD regulation.

  8. Pigmented contact dermatitis to p-paraphenylenediamine in a textile factory worker

    Directory of Open Access Journals (Sweden)

    Mrinal Gupta

    2017-10-01

    Full Text Available Pigmented contact dermatitis (PCD is a noneczematous variant of contact dermatitis, characterized clinically by hyperpigmentation with little or no signs of dermatitis. The commonly implicated agents causing PCD include cosmetics like fragrances, lipsticks and kumkum, preservatives, optical whiteners, benzyl salicylate and metallic compounds like nickel sulphate and nickel oxide. We present a case of PCD in a 45-year old textile factory worker, who presented with gradually progressive asymptomatic hyperpigmentation of the face which started after he started working in a textile factory. Patch test revealed sensitization to p-Paraphenylenediamine, thereby confirming the diagnosis of PCD to p-Paraphenylenediamine.

  9. New Ross Community Hospital, Hospital Road, New Ross, Wexford.

    LENUS (Irish Health Repository)

    Casey, Jillian P

    2015-01-01

    Primary ciliary dyskinesia (PCD) is a rare autosomal recessive disorder characterised by abnormal ciliary motion and impaired mucociliary clearance, leading to recurrent respiratory infections, sinusitis, otitis media and male infertility. Some patients also have laterality defects. We recently reported the identification of three disease-causing PCD genes in the Irish Traveller population; RSPH4A, DYX1C1 and CCNO. We have since assessed an additional Irish Traveller family with a complex phenotype involving PCD who did not have any of the previously identified PCD mutations.

  10. A designated centre for people with disabilities operated by Brothers of Charity Services Galway, Galway

    LENUS (Irish Health Repository)

    Casey, Jillian P

    2015-01-01

    Primary ciliary dyskinesia (PCD) is a rare autosomal recessive disorder characterised by abnormal ciliary motion and impaired mucociliary clearance, leading to recurrent respiratory infections, sinusitis, otitis media and male infertility. Some patients also have laterality defects. We recently reported the identification of three disease-causing PCD genes in the Irish Traveller population; RSPH4A, DYX1C1 and CCNO. We have since assessed an additional Irish Traveller family with a complex phenotype involving PCD who did not have any of the previously identified PCD mutations.

  11. A case report of primary ciliary dyskinesia, laterality defects and developmental delay caused by the co-existence of a single gene and chromosome disorder.

    LENUS (Irish Health Repository)

    Casey, Jillian P

    2015-01-01

    Primary ciliary dyskinesia (PCD) is a rare autosomal recessive disorder characterised by abnormal ciliary motion and impaired mucociliary clearance, leading to recurrent respiratory infections, sinusitis, otitis media and male infertility. Some patients also have laterality defects. We recently reported the identification of three disease-causing PCD genes in the Irish Traveller population; RSPH4A, DYX1C1 and CCNO. We have since assessed an additional Irish Traveller family with a complex phenotype involving PCD who did not have any of the previously identified PCD mutations.

  12. pH-sensitivity of YFP provides an intracellular indicator of programmed cell death

    Directory of Open Access Journals (Sweden)

    Purcel Sydney B

    2010-11-01

    Full Text Available Abstract Background Programmed cell death (PCD is an essential process for the life cycle of all multicellular organisms. In higher plants however, relatively little is known about the cascade of genes and signalling molecules responsible for the initiation and execution of PCD. To aid with the discovery and analysis of plant PCD regulators, we have designed a novel cell death assay based on low cytosolic pH as a marker of PCD. Results The acidification that occurs in the cytosol during plant PCD was monitored by way of the extinction of YFP fluorescence at low pH. This fluorescence was recovered experimentally when bringing the intracellular pH back to 7, demonstrating that there was no protein degradation of YFP. Because it uses YFP, the assay is none-destructive, does not interfere with the PCD process and allows time-lapse studies to be carried out. In addition, changes of sub-cellular localisation can be visualised during PCD using the protein of interest fused to RFP. Coupled to a transient expression system, this pH-based assay can be used to functionally analyse genes involved in PCD, using point mutations or co-expressing PCD regulators. Transfecting mBAX and AtBI-1in onion epidermal cells showed that the pH shift is downstream of PCD suppression by AtBI-1. In addition, this method can be used to score PCD in tissues of stably transformed transgenic lines. As proof of principle, we show the example of YFP extinction during xylogenesis in Arabidopsis. This demonstrates that the assay is applicable to PCD studies in a variety of tissues. Conclusions The observation that YFP fluorescence is lost during the plant PCD process provides a new tool to study the genetic regulation and cell biology of the process. In addition, plant cell biologists should make a note of this effect of PCD on YFP fluorescence to avoid misinterpretation of their data and to select a pH insensitive reporter if appropriate. This method represents an efficient and

  13. Involvement of Proline Oxidase (PutA) in Programmed Cell Death of Xanthomonas

    Science.gov (United States)

    Wadhawan, Surbhi; Gautam, Satyendra; Sharma, Arun

    2014-01-01

    Xanthomonas campestris strains have been reported to undergo programmed cell death (PCD) in a protein rich medium. Protein hydrolysates used in media such as nutrient broth comprise of casein digest with abundance of proline and glutamate. In the current study, X. campestris pv. campestris (Xcc) cells displayed PCD when grown in PCD inducing medium (PIM) containing casein tryptic digest. This PCD was also observed in PCD non-inducing carbohydrate rich medium (PNIM) fortified with either proline or proline along with glutamate. Surprisingly, no PCD was noticed in PNIM fortified with glutamate alone. Differential role of proline or glutamate in inducing PCD in Xcc cells growing in PNIM was studied. It was found that an intermediate product of this oxidation was involved in initiation of PCD. Proline oxidase also called as proline utilization A (PutA), catalyzes the two step oxidation of proline to glutamate. Interestingly, higher PutA activity was noticed in cells growing in PIM, and PCD was found to be inhibited by tetrahydro-2-furoic acid, a competitive inhibitor of this enzyme. Further, PCD was abolished in Xcc ΔputA strain generated using a pKNOCK suicide plasmid, and restored in Xcc ΔputA strain carrying functional PutA in a plasmid vector. Xanthomonas cells growing in PIM also displayed increased generation of ROS, as well as cell filamentation (a probable indication of SOS response). These filamented cells also displayed enhanced caspase-3-like activity during in situ labeling using a fluorescent tagged caspase-3 inhibitor (FITC-DEVD-FMK). The extent of PCD associated markers such as DNA damage, phosphatidylserine externalization and membrane depolarization were found to be significantly enhanced in wild type cells, but drastically reduced in Xcc ΔputA cells. These findings thus establish the role of PutA mediated proline oxidation in regulating death in stressed Xanthomonas cells. PMID:24788936

  14. Xylanse-Induced cell death events in detached tobacco leaves

    NARCIS (Netherlands)

    Yordanova, Z.P.; Kapchina-Toteva, V.M.; Woltering, E.J.; Batchvarova, R.B.; Yakimova, E.T.

    2009-01-01

    Plant-pathogen interactions are associated with plant defense mechanism known as hypersensitive response (HR), which is a form of programmed cell death (PCD). In the present work we have tested the potency of chemicals, proven as PCD inhibitors in other systems, to prevent the spread of cell death

  15. Knockout of Arabidopsis accelerated-cell-death11 encoding a sphingosine transfer protein causes activation of programmed cell death and defense

    DEFF Research Database (Denmark)

    Brodersen, Peter; Petersen, Morten; Pike, Helen M

    2002-01-01

    by avirulent pathogens. Global transcriptional changes during programmed cell death (PCD) and defense activation in acd11 were monitored by cDNA microarray hybridization. The PCD and defense pathways activated in acd11 are salicylic acid (SA) dependent, but do not require intact jasmonic acid or ethylene...

  16. Primary ciliary dyskinesia: a consensus statement on diagnostic and treatment approaches in children

    NARCIS (Netherlands)

    Barbato, A.; Frischer, T.; Kuehni, C. E.; Snijders, D.; Azevedo, I.; Baktai, G.; Bartoloni, L.; Eber, E.; Escribano, A.; Haarman, E.; Hesselmar, B.; Hogg, C.; Jorissen, M.; Lucas, J.; Nielsen, K. G.; O'Callaghan, C.; Omran, H.; Pohunek, P.; Strippoli, M.-P. F.; Bush, A.

    2009-01-01

    Primary ciliary dyskinesia (PCD) is associated with abnormal ciliary structure and function, which results in retention of mucus and bacteria in the respiratory tract, leading to chronic oto-sino-pulmonary disease, situs abnormalities and abnormal sperm motility. The diagnosis of PCD requires the

  17. Primary carnitine deficiency and pivalic acid exposure causing encephalopathy and fatal cardiac events

    DEFF Research Database (Denmark)

    Rasmussen, Jan; Nielsen, Olav W; Lund, Allan M

    2013-01-01

    Several episodes of sudden death among young Faroese individuals have been associated with primary carnitine deficiency (PCD). Patients suffering from PCD have low carnitine levels and can present with metabolic and/or cardiac complications. Pivalic acid exposure decreases carnitine levels...

  18. Metacaspase-8 Modulates Programmed Cell Death Induced by Ultraviolet Light and H2O2 in Arabidopsis

    NARCIS (Netherlands)

    He, R.; Drury, G.E.; Rotari, V.I.; Gordon, A.; Willer, M.; Farzaneh, T.; Woltering, E.J.; Gallois, P.

    2008-01-01

    Programmed cell death (PCD) is a genetically controlled cell death that is regulated during development and activated in response to environmental stresses or pathogen infection. The degree of conservation of PCD across kingdoms and phylum is not yet clear; however, whereas caspases are proteases

  19. Differential diagnosis of plasma cell dyscrasias in rheumatological practice

    Directory of Open Access Journals (Sweden)

    V I Vasilyev

    2010-01-01

    Conclusion. Many clinical and laboratory manifestations of primary PCD and RD are similar and only the absence of classical laboratory markers of autoimmune disease, as well as the presence of serum monoclonal immunoglobulins and urinary Bence Jones protein suggest the presence of PCD, both primary PCDs and those with RD.

  20. Relationship between petal abscission and programmed cell death in Prunus yedoensis and Delphinium belladonna

    NARCIS (Netherlands)

    Yamada, T.; Ichimura, K.; Doorn, van W.G.

    2007-01-01

    Depending on the species, the end of flower life span is characterized by petal wilting or by abscission of petals that are still fully turgid. Wilting at the end of petal life is due to programmed cell death (PCD). It is not known whether the abscission of turgid petals is preceded by PCD. We

  1. A longitudinal evaluation of hearing and ventilation tube insertion in patients with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Andersen, Tobias Nicolai; Alanin, Mikkel Christian; von Buchwald, Christian

    2016-01-01

    INTRODUCTION: Primary ciliary dyskinesia (PCD) is an autosomal recessive genetic disease, which primarily manifests with oto-sino-pulmonary symptoms. Otitis media with effusion (OME) is common from early childhood. The existing literature on OME management in PCD is conflicting. The goals of the ...

  2. The coiled-coil domain containing protein CCDC40 is essential for motile cilia function and left-right axis formation

    DEFF Research Database (Denmark)

    Becker-Heck, Anita; Zohn, Irene E; Okabe, Noriko

    2011-01-01

    Primary ciliary dyskinesia (PCD) is a genetically heterogeneous autosomal recessive disorder characterized by recurrent infections of the respiratory tract associated with the abnormal function of motile cilia. Approximately half of individuals with PCD also have alterations in the left-right org...

  3. Study protocol, rationale and recruitment in a European multi-centre randomized controlled trial to determine the efficacy and safety of azithromycin maintenance therapy for 6 months in primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Kobbernagel, Helene Elgaard; Buchvald, Frederik F; Haarman, Eric G

    2016-01-01

    in PCD. The secondary objectives are to evaluate the efficacy of azithromycin on lung function, ventilation inhomogeneity, hearing impairment, and symptoms (respiratory, sinus, ears and hearing) measured on a PCD-specific health-related quality of life instrument, and to assess the safety of azithromycin...

  4. Differential diagnosis of plasma cell dyscrasias in rheumatological practice

    Directory of Open Access Journals (Sweden)

    V I Vasilyev

    2010-12-01

    Conclusion. Many clinical and laboratory manifestations of primary PCD and RD are similar and only the absence of classical laboratory markers of autoimmune disease, as well as the presence of serum monoclonal immunoglobulins and urinary Bence Jones protein suggest the presence of PCD, both primary PCDs and those with RD.

  5. Anti-Apoptotic Machinery Protects the Necrotrophic Fungus Botrytis cinerea from Host-Induced Apoptotic-Like Cell Death during Plant Infection

    Science.gov (United States)

    Shlezinger, Neta; Minz, Anna; Gur, Yonatan; Hatam, Ido; Dagdas, Yasin F.; Talbot, Nicholas J.; Sharon, Amir

    2011-01-01

    Necrotrophic fungi are unable to occupy living plant cells. How such pathogens survive first contact with living host tissue and initiate infection is therefore unclear. Here, we show that the necrotrophic grey mold fungus Botrytis cinerea undergoes massive apoptotic-like programmed cell death (PCD) following germination on the host plant. Manipulation of an anti-apoptotic gene BcBIR1 modified fungal response to PCD-inducing conditions. As a consequence, strains with reduced sensitivity to PCD were hyper virulent, while strains in which PCD was over-stimulated showed reduced pathogenicity. Similarly, reduced levels of PCD in the fungus were recorded following infection of Arabidopsis mutants that show enhanced susceptibility to B. cinerea. When considered together, these results suggest that Botrytis PCD machinery is targeted by plant defense molecules, and that the fungal anti-apoptotic machinery is essential for overcoming this host-induced PCD and hence, for establishment of infection. As such, fungal PCD machinery represents a novel target for fungicides and antifungal drugs. PMID:21876671

  6. Metabolic anatomy of paraneoplastic cerebellar degeneration

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.E.; Posner, J.B.; Sidtis, J.J.; Moeller, J.R.; Strother, S.C.; Dhawan, V.; Rottenberg, D.A.

    1988-06-01

    Eleven patients with acquired cerebellar degeneration (10 of whom had paraneoplastic cerebellar degeneration (PCD)) were evaluated using neuropsychological tests and /sup 18/F-fluorodeoxyglucose/positron emission tomography to (1) quantify motor, cognitive, and metabolic abnormalities; (2) determine if characteristic alterations in the regional cerebral metabolic rate for glucose (rCMRGlc) are associated with PCD; and (3) correlate behavioral and metabolic measures of disease severity. Eighteen volunteer subjects served as normal controls. Although some PCD neuropsychological test scores were abnormal, these results could not, in general, be dissociated from the effects of dysarthria and ataxia. rCMRGlc was reduced in patients with PCD (versus normal control subjects) in all regions except the brainstem. Analysis of patient and control rCMRGlc data using a mathematical model of regional metabolic interactions revealed two metabolic pattern descriptors, SSF1 and SSF2, which distinguished patients with PCD from normal control subjects; SSF2, which described a metabolic coupling between cerebellum, cuneus, and posterior temporal, lateral frontal, and paracentral cortex, correlated with quantitative indices of cerebellar dysfunction. Our inability to document substantial intellectual impairment in 7 of 10 patients with PCD contrasts with the 50% incidence of dementia in PCD reported by previous investigators. Widespread reductions in PCD rCMRGlc may result from the loss of cerebellar efferents to thalamus and forebrain structures, a reverse cerebellar diaschisis.

  7. Multicenter analysis of body mass index, lung function, and sputum microbiology in primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Maglione, Marco; Bush, Andrew; Nielsen, Kim G

    2014-01-01

    BACKGROUND: No studies longitudinally, simultaneously assessed body mass index (BMI) and spirometry in primary ciliary dyskinesia (PCD). METHODS: We determined BMI and spirometry in 158 PCD children and adolescents from London, UK (n = 75), Naples, Italy (n = 23) and Copenhagen, Denmark (n = 60) ...

  8. Senescence and programmed cell death : substance or semantics?

    NARCIS (Netherlands)

    Doorn, van W.G.; Woltering, E.J.

    2004-01-01

    The terms senescence and programmed cell death (PCD) have led to some confusion. Senescence as visibly observed in, for example, leaf yellowing and petal wilting, has often been taken to be synonymous with the programmed death of the constituent cells. PCD also obviously refers to cells, which show

  9. Mild fetal cerebral ventriculomegaly as a prenatal sonographic marker for Kartagener syndrome

    NARCIS (Netherlands)

    M.W. Wessels (Marja); N.S. den Hollander (Nicolette); P.J. Willems (Patrick)

    2003-01-01

    textabstractPrimary ciliary dyskinesia (PCD), also referred to as immotile-cilia syndrome or Kartagener syndrome, is a group of genetic disorders caused by defective cilia leading to chronic sinupulmonary infection, situs inversus and reduced fertility. Some PCD patients also have cerebral

  10. Development of a High Efficiency Compressor/Expander for an Air Cycle Air Conditioning System.

    Science.gov (United States)

    1982-11-15

    bearing, lb PHUB - Hub pressure (initial guess), psia RLG - Rotor length 1 ’B-2 RPM - Rotational speed, RPM R - Gas constant, lb -ft/lb - R CP - Specific...Compressor discharge port pressure ratio (PCD/PC2).:- CDP - Compressor pressure change, PCD-PCl PHUB - Pressure in compressor hub (acting on base of vanes

  11. Collecting clinical data in primary ciliary dyskinesia- challenges and opportunities [version 2; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Israel Amirav

    2016-10-01

    Full Text Available Rationale: Primary ciliary dyskinesia (PCD is under diagnosed and underestimated. Most clinical research has used some form of questionnaires to capture data but none has been critically evaluated particularly with respect to its end-user feasibility and utility. Objective: To critically appraise a clinical data collection questionnaire for PCD used in a large national PCD consortium in order to apply conclusions in future PCD research. Methods: We describe the development, validation and revision process of a clinical questionnaire for PCD and its evaluation during a national clinical PCD study with respect to data collection and analysis, initial completion rates and user feedback. Results: 14 centers participating in the consortium successfully completed the revised version of the questionnaire for 173 patients with various completion rates for various items. While content and internal consistency analysis demonstrated validity, there were methodological deficiencies impacting completion rates and end-user utility. These deficiencies were addressed resulting in a more valid questionnaire. Conclusions: Our experience may be useful for future clinical research in PCD. Based on the feedback collected on the questionnaire through analysis of completion rates, judgmental analysis of the content, and feedback from experts and end users, we suggest a practicable framework for development of similar tools for various future PCD research.

  12. Violacein Induces Death of Resistant Leukaemia Cells via Kinome Reprogramming, Endoplasmic Reticulum Stress and Golgi Apparatus Collapse

    NARCIS (Netherlands)

    Queiroz, Karla C. S.; Milani, Renato; Ruela-de-Sousa, Roberta R.; Fuhler, Gwenny M.; Justo, Giselle Z.; Zambuzzi, Willian F.; Duran, Nelson; Diks, Sander H.; Spek, C. Arnold; Ferreira, Carmen V.; Peppelenbosch, Maikel P.

    2012-01-01

    It is now generally recognised that different modes of programmed cell death (PCD) are intimately linked to the cancerous process. However, the mechanism of PCD involved in cancer chemoprevention is much less clear and may be different between types of chemopreventive agents and tumour cell types

  13. DNA degradation and nuclear degeneration during programmed cell death in petals of Antirrhinum, Argyranthemum, and Petunia

    NARCIS (Netherlands)

    Yamada, T.; Ichimura, K.; Doorn, van W.G.

    2006-01-01

    Programmed cell death (PCD) was studied in the petals of Antirrhinum majus, Argyranthemum frutescens, and Petunia hybrida, using DNA degradation and changes in nuclear morphology as parameters. The petals exhibit loss of turgor (wilting) as a visible symptom of PCD. DNA degradation, as shown on

  14. Histone Deacetylase Is Required for GA-Induced Programmed Cell Death in Maize Aleurone Layers.

    Science.gov (United States)

    Hou, Haoli; Zheng, Xueke; Zhang, Hao; Yue, Mengxia; Hu, Yan; Zhou, Hong; Wang, Qing; Xie, Chengshen; Wang, Pu; Li, Lijia

    2017-11-01

    Recent discoveries have shown that epigenetic regulation is an integral part of phytohormone-mediated processes. The phytohormone gibberellin (GA) triggers a series of events in cereal aleurone cells that lead to programmed cell death (PCD), but the signaling cascade mediating GA-induced PCD in cereal aleurone layers remains largely unknown. Here, we showed that histone deacetylase (HDAC) activity gradually increased relative to histone acetyltransferase (HAT) activity, leading to a global decrease in histone H3 and H4 acetylation levels during PCD of maize (Zea mays) embryoless aleurone layers after 3 d of treatment with GA. HDAC inhibition prevented GA-induced PCD in embryoless aleurone cells, whereas HAT inhibition resulted in PCD even in the absence of GA. Hydrogen peroxide concentrations increased in GA- or HAT inhibitor-treated aleurone cells due to reduced levels of reactive oxygen species scavengers. Hydrogen peroxide-treated aleurone cells showed no changes in the activity or expression of HATs and HDACs. We show that it is possible to predict whether epigenetic modification enzymes serve as a regulator of the GA-triggered PCD signaling pathway in maize aleurone layers. Taken together, these findings reveal that HDAC activity is required for GA-induced PCD in maize aleurone layers and regulates PCD via the reactive oxygen species-mediated signal transduction pathway. © 2017 American Society of Plant Biologists. All Rights Reserved.

  15. Anti-apoptotic machinery protects the necrotrophic fungus Botrytis cinerea from host-induced apoptotic-like cell death during plant infection.

    Directory of Open Access Journals (Sweden)

    Neta Shlezinger

    2011-08-01

    Full Text Available Necrotrophic fungi are unable to occupy living plant cells. How such pathogens survive first contact with living host tissue and initiate infection is therefore unclear. Here, we show that the necrotrophic grey mold fungus Botrytis cinerea undergoes massive apoptotic-like programmed cell death (PCD following germination on the host plant. Manipulation of an anti-apoptotic gene BcBIR1 modified fungal response to PCD-inducing conditions. As a consequence, strains with reduced sensitivity to PCD were hyper virulent, while strains in which PCD was over-stimulated showed reduced pathogenicity. Similarly, reduced levels of PCD in the fungus were recorded following infection of Arabidopsis mutants that show enhanced susceptibility to B. cinerea. When considered together, these results suggest that Botrytis PCD machinery is targeted by plant defense molecules, and that the fungal anti-apoptotic machinery is essential for overcoming this host-induced PCD and hence, for establishment of infection. As such, fungal PCD machinery represents a novel target for fungicides and antifungal drugs.

  16. Dynamic hydrolase activities precede hypersensitive tissue collapse in tomato seedlings

    NARCIS (Netherlands)

    Sueldo, D.; Ali, A.; Misas-Villamil, J.; Colby, T.; Tameling, W.I.L.; Joosten, M.H.A.J.; Hoorn, van der R.

    2014-01-01

    Hydrolases such as subtilases, vacuolar processing enzymes (VPEs) and the proteasome play important roles during plant programmed cell death (PCD). We investigated hydrolase activities during PCD using activity-based protein profiling (ABPP), which displays the active proteome using probes that

  17. Morphological classification of plant cell deaths

    DEFF Research Database (Denmark)

    van Doorn, W.G.; Beers, E.P.; Dangl, J.L.

    2011-01-01

    tissue and organ formation and elimination, whereas necrosis is typically found under abiotic stress. Some examples of plant PCD cannot be ascribed to either major class and are therefore classified as separate modalities. These are PCD associated with the hypersensitive response to biotrophic pathogens...

  18. Programmed cell death and apoptosis in aging and life span regulation.

    Science.gov (United States)

    Shen, Jie; Tower, John

    2009-12-01

    Increasing evidence suggests an important role for programmed cell death (PCD) pathways in aging phenotypes across species. PCD is critical to the homeostasis of tissues maintained by cell division, for example, the blood and the lining of the gut. During aging, accumulated cellular damage and non-optimal systemic signaling can cause too little cell death (hyperproliferation and cancer), or too much cell death (tissue atrophy and ectopic cell death), thereby limiting tissue function and life span. For these reasons PCD pathways are promising targets for interventions in aging and aging-related diseases: reactivation of PCD may be beneficial in clearing cancerous and senescent cells, whereas inhibiting PCD may help prevent muscle atrophy and nervous system degeneration.

  19. Shocks from pacemaker cardioverter defibrillators increase with amiodarone in patients at high risk for sudden cardiac death.

    Science.gov (United States)

    Shinde, Abhijit A; Juneman, Elizabeth B; Mitchell, Brian; Pierce, Mary K; Gaballa, Mohamed A; Goldman, Steven; Thai, Hoang

    2003-01-01

    The efficacy of amiodarone used in combination with a pacemaker cardioverter defibrillator (PCD) to decrease episodes of ventricular tachycardia and subsequent PCD shocks is not clear. We examined a retrospective registry of 82 patients with PCD implantation to define the efficacy of amiodarone treatment. We compared patients treated with amiodarone (for 24 consecutive months without interruption) versus no amiodarone. In patients treated with amiodarone there was a 3-fold increase (p = 0.02) in PCD shocks; in patients not on beta-blockers, amiodarone resulted in a 6-fold increase (p 30% on amiodarone and patients amiodarone had more PCD shocks than those not treated. These findings are unexpected and merit a prospective study.

  20. Lace plant ethylene receptors, AmERS1a and AmERS1c, regulate ethylene-induced programmed cell death during leaf morphogenesis.

    Science.gov (United States)

    Rantong, Gaolathe; Evans, Rodger; Gunawardena, Arunika H L A N

    2015-10-01

    The lace plant, Aponogeton madagascariensis, is an aquatic monocot that forms perforations in its leaves as part of normal leaf development. Perforation formation occurs through developmentally regulated programmed cell death (PCD). The molecular basis of PCD regulation in the lace plant is unknown, however ethylene has been shown to play a significant role. In this study, we examined the role of ethylene receptors during perforation formation. We isolated three lace plant ethylene receptors AmERS1a, AmERS1b and AmERS1c. Using quantitative PCR, we examined their transcript levels at seven stages of leaf development. Through laser-capture microscopy, transcript levels were also determined in cells undergoing PCD and cells not undergoing PCD (NPCD cells). AmERS1a transcript levels were significantly lower in window stage leaves (in which perforation formation and PCD are occurring) as compared to all other leaf developmental stages. AmERS1a and AmERS1c (the most abundant among the three receptors) had the highest transcript levels in mature stage leaves, where PCD is not occurring. Their transcript levels decreased significantly during senescence-associated PCD. AmERS1c had significantly higher transcript levels in NPCD compared to PCD cells. Despite being significantly low in window stage leaves, AmERS1a transcripts were not differentially expressed between PCD and NPCD cells. The results suggested that ethylene receptors negatively regulate ethylene-controlled PCD in the lace plant. A combination of ethylene and receptor levels determines cell fate during perforation formation and leaf senescence. A new model for ethylene emission and receptor expression during lace plant perforation formation and senescence is proposed.

  1. Centrality of host cell death in plant-microbe interactions.

    Science.gov (United States)

    Dickman, Martin B; Fluhr, Robert

    2013-01-01

    Programmed cell death (PCD) is essential for proper growth, development, and cellular homeostasis in all eukaryotes. The regulation of PCD is of central importance in plant-microbe interactions; notably, PCD and features associated with PCD are observed in many host resistance responses. Conversely, pathogen induction of inappropriate cell death in the host results in a susceptible phenotype and disease. Thus, the party in control of PCD has a distinct advantage in these battles. PCD processes appear to be of ancient origin, as indicated by the fact that many features of cell death strategy are conserved between animals and plants; however, some of the details of death execution differ. Mammalian core PCD genes, such as caspases, are not present in plant genomes. Similarly, pro- and antiapoptotic mammalian regulatory elements are absent in plants, but, remarkably, when expressed in plants, successfully impact plant PCD. Thus, subtle structural similarities independent of sequence homology appear to sustain operational equivalence. The vacuole is emerging as a key organelle in the modulation of plant PCD. Under different signals for cell death, the vacuole either fuses with the plasmalemma membrane or disintegrates. Moreover, the vacuole appears to play a key role in autophagy; evidence suggests a prosurvival function for autophagy, but other studies propose a prodeath phenotype. Here, we describe and discuss what we know and what we do not know about various PCD pathways and how the host integrates signals to activate salicylic acid and reactive oxygen pathways that orchestrate cell death. We suggest that it is not cell death as such but rather the processes leading to cell death that contribute to the outcome of a given plant-pathogen interaction.

  2. Diseño e implementación de un sistema de control de vuelo para un vehículo aéreo no tripulado tipo cuadricóptero

    Directory of Open Access Journals (Sweden)

    Brian Mauricio Lara Sosa

    2017-07-01

    Full Text Available Contexto: La industria aeroespacial ha tenido bastante auge y así mismo el desarrollo y aplicación a los sistemas autónomos, propiciando desarrollos importantes en su implementación, y sistemas de control. Método: En este trabajo se presenta el desarrollo y la implementación de un vehículo aéreo no tripulado, tipo quadricóptero, se inicia con el análisis matemático de los sistemas de vehículos aéreos encontrando el modelo dinámico; el modelado del prototipo se basa en las ecuaciones Euler LaGrange. Posteriormente, se realiza el diseño de la estructura y el desarrollo de los sistemas de control basado en modos deslizantes; se aplica la ley de control basada en modos deslizantes en el sistema implementado que utiliza solamente información de pitch, roll y elevación. Resultados: Se implementó un prototipo de vehículo aéreo no tripulado tipo quadricóptero, y se implementó el sistema de control, donde se obtuvo un adecuado seguimiento de la referencia. Conclusiones: La adecuada selección de los elementos para la implementación del prototipo permite poder implementar diferentes estrategias de control, para este caso demostrando el adecuado trabajo de los modos deslizantes para la estabilización en dos ejes del quadricóptero.

  3. Algunos indicios arqueológicos de perduraciones de elementos religiosos epipaleolíticos hasta el III milenio BC en el este de Asturias

    Directory of Open Access Journals (Sweden)

    Pablo ARIAS CABAL

    2009-10-01

    Full Text Available Cualquier intento de reconstruir la religión de las sociedades prehistóricas supone internarnos en un terreno deslizante y sembrado de obstáculos, como señala acertadamente A. Leroi-Gourhan1. A las enormes dificultades que plantea el abordar hechos espirituales por medio de las técnicas arqueológicas se le une, salvo en el caso de unos pocos grupos protohistóricos, la absoluta inexistencia de nexos culturales entre nosotros y las comunidades que tratamos de estudiar.

  4. Esquema basado en Wavelet para la reducción de ruido online en señales industriales

    OpenAIRE

    Antonio Cedeño Pozo; Rafael Trujillo Codorniú

    2014-01-01

    En este trabajo se propone un esquema para la reducción de ruido gaussiano online basado en wavelet con ventanas deslizantes para ser utilizado en señales industriales. Este tipo de técnicas se utilizan cuando la señal debe ser tratada a medida que se obtienen las muestras, funcionalidad necesaria en aplicaciones con requerimientos de tiempo real, por ejemplo en sistemas SCADA. El algoritmo introducido en el presente trabajo se diferencia de algoritmos similares en que: en primer término util...

  5. Factores de riesgo de accidentes en la edad geriátrica Risk factors for accidents in geriatric age

    OpenAIRE

    Manolo Gómez Juanola; Jorge Luis Conill Godoy; Juan César Pulido Ramos; Alexis Pérez Carvajal; Idalmis Cantún

    2004-01-01

    Se realizó un estudio prospectivo, longitudinal y descriptivo con elementos analíticos, para evaluar los factores de riesgo de accidentes en los ancianos, durante el período de julio 2000 a junio 2001. La muestra quedó conformada por un universo de 101 gerontes, de los consultorios médicos 13 y 32, del municipio Mantua. Se aplicó el cálculo porcentual y X2 con nivel de ajuste ed a = 0,01 y a = 0,05. Dentro de los factores ambientales, en el área urbana predominaron: piso del baño deslizante (...

  6. Characterization of FeDREB1 promoter involved in cold- and drought-inducible expression from common buckwheat (Fagopyrum esculentum).

    Science.gov (United States)

    Fang, Z W; Xu, X Y; Gao, J F; Wang, P K; Liu, Z X; Feng, B L

    2015-07-17

    C-repeat-binding factor (CBF)/dehydration-responsive element (DREB) transcription factors play key roles in plant stress responses. However, little information is available on the regulation of CBF/DREB expression. In this study, we isolated and characterized the FeDREB1 promoter sequence from the common buckwheat accession Xinong 9976. To identify the upstream region of the FeDREB1 gene required for promoter activity, we constructed a series of FeDREB1 promoter deletion derivatives. Each deletion construct was analyzed through Agrobacterium-mediated transient transformation in tobacco leaves treated with 4°C cold or drought stress. Promoter-beta-glucuronidase fusion assays revealed that the pCD1 (-270 bp) deletion in the upstream region of FeDREB1 could activate expression of the GUS gene at 4°C. The pCD1 (-270 bp), pCD2 (-530 bp), and pCD3 (-904 bp) deletion induced low-level GUS expression under drought stress. However, the pCD4 (-1278 bp) deletion clearly activated GUS gene expression. Our results suggest that sections pCD1 (-270 bp) and pCD4 (-1278 bp) in the FeDREB1 gene promoter are new sources of induced promoters for adversity-resistance breeding in plant genetic engineering.

  7. The operative management of children with complex perianal Crohn's disease.

    Science.gov (United States)

    Seemann, Natashia M; King, Sebastian K; Elkadri, Abdul; Walters, Thomas; Fish, Joel; Langer, Jacob C

    2016-12-01

    Perianal Crohn's disease (PCD) can affect both quality of life and psychological wellbeing. A subset of pediatric patients with complex PCD require surgical intervention, although appropriate timing and treatment regimens remain unclear. This study aimed to describe a large pediatric cohort in a tertiary center to determine the range of surgical management in children with complex PCD. A retrospective review of children requiring operative intervention for PCD over 13 years (2002-2014) was performed. PCD was divided into simple and complex based on the type of surgical procedure, and the two groups were compared. The 57 children were divided into two groups: the simple group (N=43) underwent abscess drainage ± seton insertion alone, and the complex group (N=14) underwent loop ileostomy ± more extensive surgery. In the complex group, females were more predominant (57% of complex vs 30% of simple), and the average age at diagnosis was lower. Anti-TNF therapy was utilized in 79.1% of simple and 100% of complex PCD. All 14 complex patients underwent a defunctioning ileostomy, with 7 requiring further operations (subtotal colectomy=4, proctocolectomy ± anal sparing=5, plastic surgery reconstruction with perineal flap/graft=4). Complex PCD represents a small but challenging subset of patients in which major surgical intervention may be necessary to alleviate the symptoms of this debilitating condition. retrospective case study with no control group - level IV. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Amphotericin B induces apoptosis-like programmed cell death in Naegleria fowleri and Naegleria gruberi.

    Science.gov (United States)

    Cárdenas-Zúñiga, Roberto; Silva-Olivares, Angélica; Villalba-Magdaleno, José D' Artagnan; Sánchez-Monroy, Virginia; Serrano-Luna, Jesús; Shibayama, Mineko

    2017-07-01

    Naegleria fowleri and Naegleria gruberi belong to the free-living amoebae group. It is widely known that the non-pathogenic species N. gruberi is usually employed as a model to describe molecular pathways in this genus, mainly because its genome has been recently described. However, N. fowleri is an aetiological agent of primary amoebic meningoencephalitis, an acute and fatal disease. Currently, the most widely used drug for its treatment is amphotericin B (AmB). It was previously reported that AmB has an amoebicidal effect in both N. fowleri and N. gruberi trophozoites by inducing morphological changes that resemble programmed cell death (PCD). PCD is a mechanism that activates morphological, biochemical and genetic changes. However, PCD has not yet been characterized in the genus Naegleria. The aim of the present work was to evaluate the typical markers to describe PCD in both amoebae. These results showed that treated trophozoites displayed several parameters of apoptosis-like PCD in both species. We observed ultrastructural changes, an increase in reactive oxygen species, phosphatidylserine externalization and a decrease in intracellular potassium, while DNA degradation was evaluated using the TUNEL assay and agarose gels, and all of these parameters are related to PCD. Finally, we analysed the expression of apoptosis-related genes, such as sir2 and atg8, in N. gruberi. Taken together, our results showed that AmB induces the morphological, biochemical and genetic changes of apoptosis-like PCD in the genus Naegleria.

  9. Control of adult neurogenesis by programmed cell death in the mammalian brain.

    Science.gov (United States)

    Ryu, Jae Ryun; Hong, Caroline Jeeyeon; Kim, Joo Yeon; Kim, Eun-Kyoung; Sun, Woong; Yu, Seong-Woon

    2016-04-21

    The presence of neural stem cells (NSCs) and the production of new neurons in the adult brain have received great attention from scientists and the public because of implications to brain plasticity and their potential use for treating currently incurable brain diseases. Adult neurogenesis is controlled at multiple levels, including proliferation, differentiation, migration, and programmed cell death (PCD). Among these, PCD is the last and most prominent process for regulating the final number of mature neurons integrated into neural circuits. PCD can be classified into apoptosis, necrosis, and autophagic cell death and emerging evidence suggests that all three may be important modes of cell death in neural stem/progenitor cells. However, the molecular mechanisms that regulate PCD and thereby impact the intricate balance between self-renewal, proliferation, and differentiation during adult neurogenesis are not well understood. In this comprehensive review, we focus on the extent, mechanism, and biological significance of PCD for the control of adult neurogenesis in the mammalian brain. The role of intrinsic and extrinsic factors in the regulation of PCD at the molecular and systems levels is also discussed. Adult neurogenesis is a dynamic process, and the signals for differentiation, proliferation, and death of neural progenitor/stem cells are closely interrelated. A better understanding of how adult neurogenesis is influenced by PCD will help lead to important insights relevant to brain health and diseases.

  10. Role of the insulin/Tor signaling network in starvation-induced programmed cell death in Drosophila oogenesis

    Science.gov (United States)

    Pritchett, T L; McCall, K

    2012-01-01

    Amino-acid starvation leads to an inhibition of cellular proliferation and the induction of programmed cell death (PCD) in the Drosophila ovary. Disruption of insulin signaling has been shown to inhibit the progression of oogenesis, but it is unclear whether this phenotype mimics starvation. Here, we investigate whether the insulin-mediated phosphoinositide kinase-3 pathway regulates PCD in mid oogenesis. We reasoned that under well-fed conditions, disruption of positive components of the insulin signaling pathway within the germline would mimic starvation and produce degenerating egg chambers. Surprisingly, mutants did not mimic starvation but instead produced many abnormal egg chambers in which the somatic follicle cells disappeared and the germline persisted. These abnormal egg chambers did not show an induction of caspases and lysosomes like that observed in wild-type (WT) degenerating egg chambers. Egg chambers from insulin signaling mutants were resistant to starvation-induced PCD, indicating that a complete block in insulin-signaling prevents the proper response to starvation. However, target of rapamycin (Tor) mutants did show a phenotype that mimicked WT starvation-induced PCD, indicating an insulin independent regulation of PCD via Tor signaling. These results suggest that inhibition of the insulin signaling pathway is not sufficient to regulate starvation-induced PCD in mid oogenesis. Furthermore, starvation-induced PCD is regulated by Tor signaling converging with the canonical insulin signaling pathway. PMID:22240900

  11. Polishing of dental porcelain by polycrystalline diamond.

    Science.gov (United States)

    Nakamura, Yoshiharu; Sato, Hideaki; Ohtsuka, Masaki; Hojo, Satoru

    2010-01-01

    Polycrystalline diamond (PCD) exhibits excellent abrasive characteristics and is commonly used as loose grains for precision machining of hard ceramics and other materials that are difficult to grind and polish. In the present study, we investigated using bonded PCD for polishing dental porcelain, for which a lustrous surface is difficult to obtain by polishing. We compared the surface texture and characteristics of dental porcelain after polishing with bonded PCD with that obtained using bonded monocrystalline diamond (MCD), which is commonly used for this purpose. Polishing was performed at various pressures and rotational speeds on a custom-built polishing apparatus using bonded PCD or MCD with grain sizes of 3.92 μm on specimens consisting of VITA Omega 900 dentin porcelain after firing and then glazing to a specified surface roughness. The surface roughness of the polished porcelain and the abrasion quantity in terms of its polishing depth were measured, and its surface texture and characteristics were investigated. At low polishing pressures, PCD yielded a finer polished surface than MCD. The polishing depth after polishing for 20-30 min was approximately 2-3 μm with PCD and 1-2 μm with MCD. The polished surface was more uniform and smooth with PCD than with MCD.

  12. Non-apoptotic cell death in animal development.

    Science.gov (United States)

    Kutscher, Lena M; Shaham, Shai

    2017-08-01

    Programmed cell death (PCD) is an important process in the development of multicellular organisms. Apoptosis, a form of PCD characterized morphologically by chromatin condensation, membrane blebbing, and cytoplasm compaction, and molecularly by the activation of caspase proteases, has been extensively investigated. Studies in Caenorhabditis elegans, Drosophila, mice, and the developing chick have revealed, however, that developmental PCD also occurs through other mechanisms, morphologically and molecularly distinct from apoptosis. Some non-apoptotic PCD pathways, including those regulating germ cell death in Drosophila, still appear to employ caspases. However, another prominent cell death program, linker cell-type death (LCD), is morphologically conserved, and independent of the key genes that drive apoptosis, functioning, at least in part, through the ubiquitin proteasome system. These non-apoptotic processes may serve as backup programs when caspases are inactivated or unavailable, or, more likely, as freestanding cell culling programs. Non-apoptotic PCD has been documented extensively in the developing nervous system, and during the formation of germline and somatic gonadal structures, suggesting that preservation of these mechanisms is likely under strong selective pressure. Here, we discuss our current understanding of non-apoptotic PCD in animal development, and explore possible roles for LCD and other non-apoptotic developmental pathways in vertebrates. We raise the possibility that during vertebrate development, apoptosis may not be the major PCD mechanism.

  13. Diagnosis of primary ciliary dyskinesia

    Directory of Open Access Journals (Sweden)

    Mary Anne Kowal Olm

    2015-06-01

    Full Text Available Primary ciliary dyskinesia (PCD is a genetic disorder of ciliary structure or function. It results in mucus accumulation and bacterial colonization of the respiratory tract which leads to chronic upper and lower airway infections, organ laterality defects, and fertility problems. We review the respiratory signs and symptoms of PCD, as well as the screening tests for and diagnostic investigation of the disease, together with details related to ciliary function, ciliary ultrastructure, and genetic studies. In addition, we describe the difficulties in diagnosing PCD by means of transmission electron microscopy, as well as describing patient follow-up procedures.

  14. Inducible cell death in plant immunity

    DEFF Research Database (Denmark)

    Hofius, Daniel; Tsitsigiannis, Dimitrios I; Jones, Jonathan D G

    2006-01-01

    Programmed cell death (PCD) occurs during vegetative and reproductive plant growth, as typified by autumnal leaf senescence and the terminal differentiation of the endosperm of cereals which provide our major source of food. PCD also occurs in response to environmental stress and pathogen attack......, and these inducible PCD forms are intensively studied due their experimental tractability. In general, evidence exists for plant cell death pathways which have similarities to the apoptotic, autophagic and necrotic forms described in yeast and metazoans. Recent research aiming to understand these pathways...

  15. Model P Wave Multipathing at Regional Distances in Southeast Asia

    Science.gov (United States)

    2008-06-09

    third promising distance is around 27◦ − 28◦ near the D cusp in which PCD/DE rays arrive with a large time separation relative to PEF , though with...first is an PEF wave that turns beneath the 660 with a ray parameter of 9.1 s/deg; about 1.3 s later a PCD arrival that turns above the 660 with a...depth to the 660 km is slightly larger than in IASP91 and so the PCD phase arrives in advance of PEF . However, each peak is smeared and

  16. Cytokinins résumé: their signaling and role in programmed cell death in plants.

    Science.gov (United States)

    Kunikowska, A; Byczkowska, A; Doniak, M; Kaźmierczak, A

    2013-06-01

    Cytokinins (CKs) are a large group of plant hormones which play a crucial role in many physiological processes in plants. One of the interesting functions of CKs is the control of programmed cell death (PCD). It seems that all CKs-dependent phenomena including PCD are accompanied by special multi-step phosphorelay signaling pathway. This pathway consists of three elements: histidine kinase receptors (HKs), histidine phosphotransfer proteins (HPs) and response regulators (RRs). This review shows the résumé of the latest knowledge about CKs signaling pathways in many physiological processes in plants with special attention paid to PCD process.

  17. Relações entre significado do trabalho e percepção de suporte para pessoas com deficiência em organizações brasileiras

    OpenAIRE

    Tette, Raissa Pedrosa Gomes; Carvalho-Freitas, Maria Nivalda de; Oliveira, Marcos Santos de

    2014-01-01

    Mediante a obrigatoriedade de contratação de pessoas com deficiência advinda com a Lei de Cotas, o processo de inclusão de pessoas com deficiência (PcD) nas organizações brasileiras tem sido permeado por desafios, tanto para as empresas quanto para as próprias PcD. Este trabalho foi desenvolvido com o propósito de verificar a influência da percepção de suporte social e de suporte organizacional no significado do trabalho para PcD. As investigações foram realizadas com uma amostra de 169 pesso...

  18. A multi-wavelength (u.v. to visible) laser system for early detection of oral cancer

    Science.gov (United States)

    Najda, S. P.; Perlin, P.; Leszczyński, M.; Slight, T. J.; Meredith, W.; Schemmann, M.; Moseley, H.; Woods, J. A.; Valentine, R.; Kalra, S.; Mossey, P.; Theaker, E.; Macluskey, M.; Mimnagh, G.; Mimnagh, W.

    2015-03-01

    A multi-wavelength (360nm - 440nm), real-time Photonic Cancer Detector (PCD) optical system based on GaN semiconductor laser technology is outlined. A proof of concept using blue laser technology for early detection of cancer has already been tested and proven for esophageal cancer. This concept is expanded to consider a wider range of wavelengths and the PCD will initially be used for early diagnosis of oral cancers. The PCD creates an image of the oral cavity (broad field white light detection) and maps within the oral cavity any suspicious lesions with high sensitivity using a narrow field tunable detector.

  19. BCL-2, Ca, and Apoptosis in Breast Cancer

    National Research Council Canada - National Science Library

    Machen, Terry

    1998-01-01

    The central hypothesis of this project is that bcl-2 controls PCD and oncogenesis by altering Ca permeability by the ER/nuclear membranes, mitochondria and/or plasma membrane of mammary epithelial cells...

  20. R. Strauss: Symphonia domestica, Op. 53 / David Nice

    Index Scriptorium Estoniae

    Nice, David

    1994-01-01

    Uuest heliplaadist "R. Strauss: Symphonia domestica, Op. 53. National Youth Orchestra of Great Britain / Christopher Seaman. Pickwick IMP Classics CD PCD 1080; Selected comparisons: SNO, Järvi (3/88) Chandos CHAN 8572"

  1. Calcium and reactive oxygen species in regulation of the mitochondrial permeability transition and of programmed cell death in yeast.

    Science.gov (United States)

    Carraro, Michela; Bernardi, Paolo

    2016-08-01

    Mitochondria-dependent programmed cell death (PCD) in yeast shares many features with the intrinsic apoptotic pathway of mammals. With many stimuli, increased cytosolic [Ca(2+)] and ROS generation are the triggering signals that lead to mitochondrial permeabilization and release of proapoptotic factors, which initiates yeast PCD. While in mammals the permeability transition pore (PTP), a high-conductance inner membrane channel activated by increased matrix Ca(2+) and oxidative stress, is recognized as part of this signaling cascade, whether a similar process occurs in yeast is still debated. The potential role of the PTP in yeast PCD has generally been overlooked because yeast mitochondria lack the Ca(2+) uniporter, which in mammals allows rapid equilibration of cytosolic Ca(2+) with the matrix. In this short review we discuss the nature of the yeast permeability transition and reevaluate its potential role in the effector phase of yeast PCD triggered by Ca(2+) and oxidative stress. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Noninvasive detection of programmed cell loss with 99mTc-labeled annexin A5 in heart failure

    NARCIS (Netherlands)

    Kietselaer, Bas L J H; Reutelingsperger, Chris P M; Boersma, Hendrikus H; Heidendal, Guido A K; Liem, Ing Han; Crijns, Harry J G M; Narula, Jagat; Hofstra, Leo

    UNLABELLED: Apoptosis, or programmed cell death (PCD), contributes to the decline in ventricular function in heart failure. Because apoptosis comprises a programmed cascade of events, it is potentially reversible, and timely intervention should delay the development of cardiomyopathy.

  3. ORF Sequence: NC_005813 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rsinia pestis biovar Medievalis str. 91001] MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR ... NC_005813 gi|45478586 >gi|45478587|ref|NP_995414.1| hypothetical protein pCD98 [Ye

  4. ORF Sequence: NC_005813 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rsinia pestis biovar Medievalis str. 91001] MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR ... NC_005813 gi|45478566 >gi|45478566|ref|NP_995393.1| hypothetical protein pCD71 [Ye

  5. Carnitine levels in 26,462 individuals from the nationwide screening program for primary carnitine deficiency in the Faroe Islands

    DEFF Research Database (Denmark)

    Rasmussen, Jan; Nielsen, Olav W; Janzen, Nils

    2014-01-01

    BACKGROUND: Primary carnitine deficiency (PCD) is an autosomal recessive disorder of fatty acid oxidation and has been associated to episodes of sudden death in the Faroe Islands. Data are presented from the nationwide population based Faroese screening program to find people with low carnitine...... levels indicating PCD. METHODS: Whole blood samples from dried blood spots were analysed by tandem mass spectrometry with and without butylation. Genetic analyses were performed in all people with non-butylated free carnitine (fC0) below 7 μmol/L. RESULTS: 55 % (n = 26,462) of the entire population...... was screened and 89 PCD patients were identified, yielding an overall prevalence of 1:297 of PCD in the Faroe Islands. Carnitine levels were positively correlated to age in both males and females (p difference in mean carnitine...

  6. Progression of lung disease in primary ciliary dyskinesia: is spirometry less accurate than CT?

    Science.gov (United States)

    Maglione, Marco; Bush, Andrew; Montella, Silvia; Mollica, Carmine; Manna, Angelo; Esposito, Antonietta; Santamaria, Francesca

    2012-05-01

    Despite its extensive use, there is no evidence that spirometry is useful in the assessment of progression of lung disease in primary ciliary dyskinesia (PCD). We hypothesize that high-resolution computed tomography (HRCT) is a better indicator of PCD lung disease progression than spirometry. We retrospectively evaluated two paired spirometry and HRCT examinations from 20 PCD patients (age, 11.6 years; range, 6.5-27.5 years). The evaluations were performed in stable state and during unstable lung disease. HRCT scans were scored blind by two raters. Compared to the first assessment, at the second evaluation spirometry did not change while HRCT scores significantly worsened (P spirometry. In PCD, structural lung disease may worsen despite spirometry being stable. Copyright © 2011 Wiley Periodicals, Inc.

  7. Quantitative proteomic analysis of Streptomyces coelicolor development demonstrates that onset of secondary metabolism coincides with hyphae differentiation

    DEFF Research Database (Denmark)

    Manteca, Angel; Sanchez, Jesus; Jung, Hye Ryung

    2010-01-01

    Streptomyces species produce many clinically important secondary metabolites, including antibiotics and antitumourals. They have a complex developmental cycle that makes this bacterium a multicellular prokaryotic model including programmed cell death (PCD) phenomena. There are two differentiated...

  8. Cross-talk of nitric oxide and reactive oxygen species in plant programed cell death

    Directory of Open Access Journals (Sweden)

    Yiqin eWang

    2013-08-01

    Full Text Available In plants, programed cell death (PCD is an important mechanism to regulate multiple aspects of growth and development, as well as to remove damaged or infected cells during responses to environmental stresses and pathogen attacks. Under biotic and abiotic stresses, plant cells exhibit a rapid synthesis of nitric oxide (NO and a parallel accumulation of reactive oxygen species (ROS. Frequently, these responses trigger a PCD process leading to an intrinsic execution of plant cells. The accumulating evidence suggests that both NO and ROS play key roles in PCD. These redox active small molecules can trigger cell death either independently or synergistically. Here we summarize the recent progress on the cross-talk of NO and ROS signals in the hypersensitive response (HR, leaf senescence and other kinds of plant PCD caused by diverse cues.

  9. Cross-talk of nitric oxide and reactive oxygen species in plant programed cell death.

    Science.gov (United States)

    Wang, Yiqin; Loake, Gary J; Chu, Chengcai

    2013-01-01

    In plants, programed cell death (PCD) is an important mechanism to regulate multiple aspects of growth and development, as well as to remove damaged or infected cells during responses to environmental stresses and pathogen attacks. Under biotic and abiotic stresses, plant cells exhibit a rapid synthesis of nitric oxide (NO) and a parallel accumulation of reactive oxygen species (ROS). Frequently, these responses trigger a PCD process leading to an intrinsic execution of plant cells. The accumulating evidence suggests that both NO and ROS play key roles in PCD. These redox active small molecules can trigger cell death either independently or synergistically. Here we summarize the recent progress on the cross-talk of NO and ROS signals in the hypersensitive response, leaf senescence, and other kinds of plant PCD caused by diverse cues.

  10. Predominance of anaerobic bacterial community over aerobic community contribute to intensify ‘oxygen minimum zone’ in the eastern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Gonsalves, M.J.B.D.; Paropkari, A.L.; Fernandes, C.E.G.; LokaBharathi, P.A.; KrishnaKumari, L.; Fernando, V.; Nampoothiri, G.

    -Rafter plankton counting chamber using Olympus microscope. The phytoplankton cell density (PCD) was expressed as numbers x 10 3 cells l -1 . Generic and species identification were done according to various keys (Lebour, 1978; Constance et al., 1985; Tomas...

  11. 76 FR 70695 - Taking and Importing Marine Mammals: U.S. Navy Training in 12 Range Complexes and U.S. Air Force...

    Science.gov (United States)

    2011-11-15

    ... mailing of paper, disk, or CD-ROM comments should be addressed to Michael Payne, Chief, Permits... Cherry Point (CHPT) Range Complex, the Naval Surface Warfare Center Panama City Division (NSWC PCD), the...

  12. Longitudinal study of lung function in a cohort of primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Ellerman, A; Bisgaard, H

    1997-01-01

    patients entering as children (forced vital capacity (FVC) 70 versus 85% predicted; forced expiratory volume in one second (FEV1) 59 versus 72% pred). The lung damage did not relate to the type of ciliary dyskinesia. During the subsequent surveillance of the groups for a median of 14 and 7 yrs......Patients with primary ciliary dyskinesia (PCD) have pronounced stasis of their respiratory secretions and therefore recurrent lower airway infections, which raises concerns for the development of lung function. Twenty four patients with PCD have been studied prospectively with a standardized regime...... in our clinic for 2-16 yrs with clinic visits, including spirometry 2-4 times per year, daily physiotherapy and monthly sputum cultures with subsequent specific antibiotic treatment. Lung function was significantly lower in the 12 PCD patients entering the cohort as adults when compared to the PCD...

  13. A plant alternative to animal caspases: subtilisin-like proteases

    National Research Council Canada - National Science Library

    Vartapetian, A B; Tuzhikov, A I; Chichkova, N V; Taliansky, M; Wolpert, T J

    2011-01-01

    ...(s) structurally unrelated yet possessing caspase specificity have functions in plant PCD. Here, we review recent data showing that some caspase-like activities are attributable to the plant subtilisin-like proteases, saspases and phytaspases...

  14. Primary Ciliary Dyskinesia: An Update on Clinical Aspects, Genetics, Diagnosis, and Future Treatment Strategies

    Directory of Open Access Journals (Sweden)

    Virginia Mirra

    2017-06-01

    Full Text Available Primary ciliary dyskinesia (PCD is an orphan disease (MIM 244400, autosomal recessive inherited, characterized by motile ciliary dysfunction. The estimated prevalence of PCD is 1:10,000 to 1:20,000 live-born children, but true prevalence could be even higher. PCD is characterized by chronic upper and lower respiratory tract disease, infertility/ectopic pregnancy, and situs anomalies, that occur in ≈50% of PCD patients (Kartagener syndrome, and these may be associated with congenital heart abnormalities. Most patients report a daily year-round wet cough or nose congestion starting in the first year of life. Daily wet cough, associated with recurrent infections exacerbations, results in the development of chronic suppurative lung disease, with localized-to-diffuse bronchiectasis. No diagnostic test is perfect for confirming PCD. Diagnosis can be challenging and relies on a combination of clinical data, nasal nitric oxide levels plus cilia ultrastructure and function analysis. Adjunctive tests include genetic analysis and repeated tests in ciliary culture specimens. There are currently 33 known genes associated with PCD and correlations between genotype and ultrastructural defects have been increasingly demonstrated. Comprehensive genetic testing may hopefully screen young infants before symptoms occur, thus improving survival. Recent surprising advances in PCD genetic designed a novel approach called “gene editing” to restore gene function and normalize ciliary motility, opening up new avenues for treating PCD. Currently, there are no data from randomized clinical trials to support any specific treatment, thus, management strategies are usually extrapolated from cystic fibrosis. The goal of treatment is to prevent exacerbations, slowing the progression of lung disease. The therapeutic mainstay includes airway clearance maneuvers mainly with nebulized hypertonic saline and chest physiotherapy, and prompt and aggressive administration of

  15. CCDC65 mutation causes primary ciliary dyskinesia with normal ultrastructure and hyperkinetic cilia.

    Directory of Open Access Journals (Sweden)

    Amjad Horani

    Full Text Available BACKGROUND: Primary ciliary dyskinesia (PCD is a genetic disorder characterized by impaired ciliary function, leading to chronic sinopulmonary disease. The genetic causes of PCD are still evolving, while the diagnosis is often dependent on finding a ciliary ultrastructural abnormality and immotile cilia. Here we report a novel gene associated with PCD but without ciliary ultrastructural abnormalities evident by transmission electron microscopy, but with dyskinetic cilia beating. METHODS: Genetic linkage analysis was performed in a family with a PCD subject. Gene expression was studied in Chlamydomonas reinhardtii and human airway epithelial cells, using RNA assays and immunostaining. The phenotypic effects of candidate gene mutations were determined in primary culture human tracheobronchial epithelial cells transduced with gene targeted shRNA sequences. Video-microscopy was used to evaluate cilia motion. RESULTS: A single novel mutation in CCDC65, which created a termination codon at position 293, was identified in a subject with typical clinical features of PCD. CCDC65, an orthologue of the Chlamydomonas nexin-dynein regulatory complex protein DRC2, was localized to the cilia of normal nasal epithelial cells but was absent in those from the proband. CCDC65 expression was up-regulated during ciliogenesis in cultured airway epithelial cells, as was DRC2 in C. reinhardtii following deflagellation. Nasal epithelial cells from the affected individual and CCDC65-specific shRNA transduced normal airway epithelial cells had stiff and dyskinetic cilia beating patterns compared to control cells. Moreover, Gas8, a nexin-dynein regulatory complex component previously identified to associate with CCDC65, was absent in airway cells from the PCD subject and CCDC65-silenced cells. CONCLUSION: Mutation in CCDC65, a nexin-dynein regulatory complex member, resulted in a frameshift mutation and PCD. The affected individual had altered cilia beating patterns, and

  16. Using microfluidics to study programmed cell death: A new approach

    DEFF Research Database (Denmark)

    Mark, Christina; Zor, Kinga; Heiskanen, Arto

    This project focuses on applying microfluidic tissue culture for electrochemical or optical measurements during programmed cell death (PCD) in barley aleurone layer to increase understanding of the underlying mechanisms of PCD in plants. Microfluidic tissue culture enables in vitro experiments...... a double-fluorescent probe-system also used by Fath et al5. Future challenges include integrating both these systems into a microfluidic device for plant tissue culture....

  17. Are U.S. Schools Filling the Gap With Programs that Promote Weight Stigma?

    Centers for Disease Control (CDC) Podcasts

    2017-12-21

    In this edition of PCD Sound Bites, author Erica Kenney, ScD, answers questions about her study, which looked at how frequently U.S. schools used evidence-based obesity prevention programs and how often schools implement programs that may unintentionally worsen weight stigma among students.  Created: 12/21/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 12/21/2017.

  18. Hybrid spectral CT reconstruction

    Science.gov (United States)

    Clark, Darin P.

    2017-01-01

    Current photon counting x-ray detector (PCD) technology faces limitations associated with spectral fidelity and photon starvation. One strategy for addressing these limitations is to supplement PCD data with high-resolution, low-noise data acquired with an energy-integrating detector (EID). In this work, we propose an iterative, hybrid reconstruction technique which combines the spectral properties of PCD data with the resolution and signal-to-noise characteristics of EID data. Our hybrid reconstruction technique is based on an algebraic model of data fidelity which substitutes the EID data into the data fidelity term associated with the PCD reconstruction, resulting in a joint reconstruction problem. Within the split Bregman framework, these data fidelity constraints are minimized subject to additional constraints on spectral rank and on joint intensity-gradient sparsity measured between the reconstructions of the EID and PCD data. Following a derivation of the proposed technique, we apply it to the reconstruction of a digital phantom which contains realistic concentrations of iodine, barium, and calcium encountered in small-animal micro-CT. The results of this experiment suggest reliable separation and detection of iodine at concentrations ≥ 5 mg/ml and barium at concentrations ≥ 10 mg/ml in 2-mm features for EID and PCD data reconstructed with inherent spatial resolutions of 176 μm and 254 μm, respectively (point spread function, FWHM). Furthermore, hybrid reconstruction is demonstrated to enhance spatial resolution within material decomposition results and to improve low-contrast detectability by as much as 2.6 times relative to reconstruction with PCD data only. The parameters of the simulation experiment are based on an in vivo micro-CT experiment conducted in a mouse model of soft-tissue sarcoma. Material decomposition results produced from this in vivo data demonstrate the feasibility of distinguishing two K-edge contrast agents with a spectral

  19. Drosophila caspases involved in developmentally regulated programmed cell death of peptidergic neurons during early metamorphosis.

    Science.gov (United States)

    Lee, Gyunghee; Wang, Zixing; Sehgal, Ritika; Chen, Chun-Hong; Kikuno, Keiko; Hay, Bruce; Park, Jae H

    2011-01-01

    A great number of obsolete larval neurons in the Drosophila central nervous system are eliminated by developmentally programmed cell death (PCD) during early metamorphosis. To elucidate the mechanisms of neuronal PCD occurring during this period, we undertook genetic dissection of seven currently known Drosophila caspases in the PCD of a group of interneurons (vCrz) that produce corazonin (Crz) neuropeptide in the ventral nerve cord. The molecular death program in the vCrz neurons initiates within 1 hour after pupariation, as demonstrated by the cytological signs of cell death and caspase activation. PCD was significantly suppressed in dronc-null mutants, but not in null mutants of either dredd or strica. A double mutation lacking both dronc and strica impaired PCD phenotype more severely than did a dronc mutation alone, but comparably to a triple dredd/strica/dronc mutation, indicating that dronc is a main initiator caspase, while strica plays a minor role that overlaps with dronc's. As for effector caspases, vCrz PCD requires both ice and dcp-1 functions, as they work cooperatively for a timely removal of the vCrz neurons. Interestingly, the activation of the Ice and Dcp-1 is not solely dependent on Dronc and Strica, implying an alternative pathway to activate the effectors. Two remaining effector caspase genes, decay and damm, found no apparent functions in the neuronal PCD, at least during early metamorphosis. Overall, our work revealed that vCrz PCD utilizes dronc, strica, dcp-1, and ice wherein the activation of Ice and Dcp-1 requires a novel pathway in addition to the initiator caspases.

  20. Programmed cell death: The life ambition of the barley aleurone layer

    DEFF Research Database (Denmark)

    Mark, Christina; Zor, Kinga; Heiskanen, Arto

    We have developed a 24-well multiplate tissue culture system with electrochemical and optical detection techniques for cultivation of immobilised barley aleurone layers. We have applied the system for the purpose of studying the underlying mechanisms of programmed cell death (PCD) in plants. We...... for the purpose of studying the timing of α-amylase production in relation to PCD. These studies will be combined with activity assays and quantitative proteomics studies of α-amylase and other target enzymes....

  1. Predictive factors for successful ultrasound-guided percutaneous drainage in necrotizing pancreatitis.

    Science.gov (United States)

    Guo, Qiang; Li, Ang; Hu, Weiming

    2016-07-01

    Percutaneous catheter drainage (PCD) is now regarded as an initial minimal access technique of step-up approach for necrotizing pancreatitis. Factors that led to surgical intervention after initial management with PCD have rarely been reported. This study was to evaluate the safety and efficacy of ultrasound-guided PCD in patients with necrotizing pancreatitis and identify a subgroup of patients where PCD alone would be effective. We performed a retrospective review of patients with necrotizing pancreatitis who underwent intervention in West China Hospital from January 1, 2009, to March 31, 2013. Patients who underwent initial PCD therapy had lower intra-abdominal bleeding rate (41/235 vs. 1/51, P = 0.002), lower enterocutaneous fistula rate (28/235 vs. 0/51, P = 0.004), and lower mortality rate (46/235 vs. 3/51, P = 0.001) when compared with the patients who underwent operative intervention. The successful PCD group had lower computed tomography (CT) mean density of necrotic fluid collection (18 HU vs. 25 HU, P = 0.01) and higher prevalence of walled-off necrosis (20/35 vs. 5/16, P = 0.04) when compared with failed PCD group. Multivariate analysis of the predictors of surgery showed that only CT mean density of necrotic fluid collection [odd ratio (OR) 1.63, 95 % confidence interval (CI) 1.04-2.94, P = 0.006] was identified as significant factor. CT mean density of necrotic fluid collection and the existence of acute necrotic collection could influence the success rate of PCD.

  2. MO-FG-CAMPUS-IeP1-02: Dose Reduction in Contrast-Enhanced Digital Mammography Using a Photon-Counting Detector

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S; Kang, S; Eom, J [Konyang University, Daejeon (Korea, Republic of)

    2016-06-15

    Purpose: Photon-counting detectors (PCDs) allow multi-energy X-ray imaging without additional exposures and spectral overlap. This capability results in the improvement of accuracy of material decomposition for dual-energy X-ray imaging and the reduction of radiation dose. In this study, the PCD-based contrast-enhanced dual-energy mammography (CEDM) was compared with the conventional CDEM in terms of radiation dose, image quality and accuracy of material decomposition. Methods: A dual-energy model was designed by using Beer-Lambert’s law and rational inverse fitting function for decomposing materials from a polychromatic X-ray source. A cadmium zinc telluride (CZT)-based PCD, which has five energy thresholds, and iodine solutions included in a 3D half-cylindrical phantom, which composed of 50% glandular and 50% adipose tissues, were simulated by using a Monte Carlo simulation tool. The low- and high-energy images were obtained in accordance with the clinical exposure conditions for the conventional CDEM. Energy bins of 20–33 and 34–50 keV were defined from X-ray energy spectra simulated at 50 kVp with different dose levels for implementing the PCD-based CDEM. The dual-energy mammographic techniques were compared by means of absorbed dose, noise property and normalized root-mean-square error (NRMSE). Results: Comparing to the conventional CEDM, the iodine solutions were clearly decomposed for the PCD-based CEDM. Although the radiation dose for the PCD-based CDEM was lower than that for the conventional CEDM, the PCD-based CDEM improved the noise property and accuracy of decomposition images. Conclusion: This study demonstrates that the PCD-based CDEM allows the quantitative material decomposition, and reduces radiation dose in comparison with the conventional CDEM. Therefore, the PCD-based CDEM is able to provide useful information for detecting breast tumor and enhancing diagnostic accuracy in mammography.

  3. Cross-talk of nitric oxide and reactive oxygen species in plant programed cell death

    OpenAIRE

    Yiqin eWang; Loake, Gary J.; Chengcai eChu

    2013-01-01

    In plants, programed cell death (PCD) is an important mechanism to regulate multiple aspects of growth and development, as well as to remove damaged or infected cells during responses to environmental stresses and pathogen attacks. Under biotic and abiotic stresses, plant cells exhibit a rapid synthesis of nitric oxide (NO) and a parallel accumulation of reactive oxygen species (ROS). Frequently, these responses trigger a PCD process leading to an intrinsic execution of plant cells. The accum...

  4. Comparative analysis of perioperative complications between a multicenter prospective cervical deformity database and the Nationwide Inpatient Sample database.

    Science.gov (United States)

    Passias, Peter G; Horn, Samantha R; Jalai, Cyrus M; Poorman, Gregory; Bono, Olivia J; Ramchandran, Subaraman; Smith, Justin S; Scheer, Justin K; Sciubba, Daniel M; Hamilton, D Kojo; Mundis, Gregory; Oh, Cheongeun; Klineberg, Eric O; Lafage, Virginie; Shaffrey, Christopher I; Ames, Christopher P

    2017-11-01

    Complication rates for adult cervical deformity are poorly characterized given the complexity and heterogeneity of cases. To compare perioperative complication rates following adult cervical deformity corrective surgery between a prospective multicenter database for patients with cervical deformity (PCD) and the Nationwide Inpatient Sample (NIS). Retrospective review of prospective databases. A total of 11,501 adult patients with cervical deformity (11,379 patients from the NIS and 122 patients from the PCD database). Perioperative medical and surgical complications. The NIS was queried (2001-2013) for cervical deformity discharges for patients ≥18 years undergoing cervical fusions using International Classification of Disease, Ninth Revision (ICD-9) coding. Patients ≥18 years from the PCD database (2013-2015) were selected. Equivalent complications were identified and rates were compared. Bonferroni correction (pdatabases. A total of 11,379 patients from the NIS database and 122 patiens from the PCD database were identified. Patients from the PCD database were older (62.49 vs. 55.15, pdatabase. The PCD database had an increased risk of reporting overall complications than the NIS (odds ratio: 2.81, confidence interval: 1.81-4.38). Only device-related complications were greater in the NIS (7.1% vs. 1.1%, p=.007). Patients from the PCD database displayed higher rates of the following complications: peripheral vascular (0.8% vs. 0.1%, p=.001), gastrointestinal (GI) (2.5% vs. 0.2%, pdatabases (p>.004). Based on surgicalapproach, the PCD reported higher GI and neurologic complication rates for combined anterior-posterior procedures (pdatabase revealed higher overall and individual complication rates and higher data granularity. The nationwide database may underestimate complications of patients with adult cervical deformity (ACD) particularly in regard to perioperative surgical details owing to coding and deformity generalizations. The surgeon-maintained database

  5. Programmed Cell Death Progresses Differentially in Epidermal and Mesophyll Cells of Lily Petals.

    Directory of Open Access Journals (Sweden)

    Hiroko Mochizuki-Kawai

    Full Text Available In the petals of some species of flowers, programmed cell death (PCD begins earlier in mesophyll cells than in epidermal cells. However, PCD progression in each cell type has not been characterized in detail. We separately constructed a time course of biochemical signs and expression patterns of PCD-associated genes in epidermal and mesophyll cells in Lilium cv. Yelloween petals. Before visible signs of senescence could be observed, we found signs of PCD, including DNA degradation and decreased protein content in mesophyll cells only. In these cells, the total proteinase activity increased on the day after anthesis. Within 3 days after anthesis, the protein content decreased by 61.8%, and 22.8% of mesophyll cells was lost. A second peak of proteinase activity was observed on day 6, and the number of mesophyll cells decreased again from days 4 to 7. These biochemical and morphological results suggest that PCD progressed in steps during flower life in the mesophyll cells. PCD began in epidermal cells on day 5, in temporal synchrony with the time course of visible senescence. In the mesophyll cells, the KDEL-tailed cysteine proteinase (LoCYP and S1/P1 nuclease (LoNUC genes were upregulated before petal wilting, earlier than in epidermal cells. In contrast, relative to that in the mesophyll cells, the expression of the SAG12 cysteine proteinase homolog (LoSAG12 drastically increased in epidermal cells in the final stage of senescence. These results suggest that multiple PCD-associated genes differentially contribute to the time lag of PCD progression between epidermal and mesophyll cells of lily petals.

  6. 16th Annual Expeditionary Warfare Conference: Integrating Future and Present Capabilities

    Science.gov (United States)

    2011-10-27

    withstanding the searing heat and blowing sands of arid deserts, the sub-zero temperatures of the frozen tundra and the torrential rains and constant...Mr. Don Campbell NSWC PCD Mr. John Campbell HQMC Combat Development and Integration Mr. Alan Canfield NSWC PCD Mr. Lee Cantrelle TEKsystems Col JD...Research Mr. Terry Schwieger Alion Science and Technology Mr. Michael Sears EPS Corporation Mr. Steven Segrest The Columbia Group LtCol Kei Sekiguchi

  7. Lipid Peroxide-Derived Short-Chain Carbonyls Mediate Hydrogen Peroxide-Induced and Salt-Induced Programmed Cell Death in Plants1[OPEN

    Science.gov (United States)

    Biswas, Md. Sanaullah; Mano, Jun’ichi

    2015-01-01

    Lipid peroxide-derived toxic carbonyl compounds (oxylipin carbonyls), produced downstream of reactive oxygen species (ROS), were recently revealed to mediate abiotic stress-induced damage of plants. Here, we investigated how oxylipin carbonyls cause cell death. When tobacco (Nicotiana tabacum) Bright Yellow-2 (BY-2) cells were exposed to hydrogen peroxide, several species of short-chain oxylipin carbonyls [i.e. 4-hydroxy-(E)-2-nonenal and acrolein] accumulated and the cells underwent programmed cell death (PCD), as judged based on DNA fragmentation, an increase in terminal deoxynucleotidyl transferase dUTP nick end labeling-positive nuclei, and cytoplasm retraction. These oxylipin carbonyls caused PCD in BY-2 cells and roots of tobacco and Arabidopsis (Arabidopsis thaliana). To test the possibility that oxylipin carbonyls mediate an oxidative signal to cause PCD, we performed pharmacological and genetic experiments. Carnosine and hydralazine, having distinct chemistry for scavenging carbonyls, significantly suppressed the increase in oxylipin carbonyls and blocked PCD in BY-2 cells and Arabidopsis roots, but they did not affect the levels of ROS and lipid peroxides. A transgenic tobacco line that overproduces 2-alkenal reductase, an Arabidopsis enzyme to detoxify α,β-unsaturated carbonyls, suffered less PCD in root epidermis after hydrogen peroxide or salt treatment than did the wild type, whereas the ROS level increases due to the stress treatments were not different between the lines. From these results, we conclude that oxylipin carbonyls are involved in the PCD process in oxidatively stressed cells. Our comparison of the ability of distinct carbonyls to induce PCD in BY-2 cells revealed that acrolein and 4-hydroxy-(E)-2-nonenal are the most potent carbonyls. The physiological relevance and possible mechanisms of the carbonyl-induced PCD are discussed. PMID:26025050

  8. Hybrid spectral CT reconstruction.

    Directory of Open Access Journals (Sweden)

    Darin P Clark

    Full Text Available Current photon counting x-ray detector (PCD technology faces limitations associated with spectral fidelity and photon starvation. One strategy for addressing these limitations is to supplement PCD data with high-resolution, low-noise data acquired with an energy-integrating detector (EID. In this work, we propose an iterative, hybrid reconstruction technique which combines the spectral properties of PCD data with the resolution and signal-to-noise characteristics of EID data. Our hybrid reconstruction technique is based on an algebraic model of data fidelity which substitutes the EID data into the data fidelity term associated with the PCD reconstruction, resulting in a joint reconstruction problem. Within the split Bregman framework, these data fidelity constraints are minimized subject to additional constraints on spectral rank and on joint intensity-gradient sparsity measured between the reconstructions of the EID and PCD data. Following a derivation of the proposed technique, we apply it to the reconstruction of a digital phantom which contains realistic concentrations of iodine, barium, and calcium encountered in small-animal micro-CT. The results of this experiment suggest reliable separation and detection of iodine at concentrations ≥ 5 mg/ml and barium at concentrations ≥ 10 mg/ml in 2-mm features for EID and PCD data reconstructed with inherent spatial resolutions of 176 μm and 254 μm, respectively (point spread function, FWHM. Furthermore, hybrid reconstruction is demonstrated to enhance spatial resolution within material decomposition results and to improve low-contrast detectability by as much as 2.6 times relative to reconstruction with PCD data only. The parameters of the simulation experiment are based on an in vivo micro-CT experiment conducted in a mouse model of soft-tissue sarcoma. Material decomposition results produced from this in vivo data demonstrate the feasibility of distinguishing two K-edge contrast agents with

  9. Hybrid spectral CT reconstruction.

    Science.gov (United States)

    Clark, Darin P; Badea, Cristian T

    2017-01-01

    Current photon counting x-ray detector (PCD) technology faces limitations associated with spectral fidelity and photon starvation. One strategy for addressing these limitations is to supplement PCD data with high-resolution, low-noise data acquired with an energy-integrating detector (EID). In this work, we propose an iterative, hybrid reconstruction technique which combines the spectral properties of PCD data with the resolution and signal-to-noise characteristics of EID data. Our hybrid reconstruction technique is based on an algebraic model of data fidelity which substitutes the EID data into the data fidelity term associated with the PCD reconstruction, resulting in a joint reconstruction problem. Within the split Bregman framework, these data fidelity constraints are minimized subject to additional constraints on spectral rank and on joint intensity-gradient sparsity measured between the reconstructions of the EID and PCD data. Following a derivation of the proposed technique, we apply it to the reconstruction of a digital phantom which contains realistic concentrations of iodine, barium, and calcium encountered in small-animal micro-CT. The results of this experiment suggest reliable separation and detection of iodine at concentrations ≥ 5 mg/ml and barium at concentrations ≥ 10 mg/ml in 2-mm features for EID and PCD data reconstructed with inherent spatial resolutions of 176 μm and 254 μm, respectively (point spread function, FWHM). Furthermore, hybrid reconstruction is demonstrated to enhance spatial resolution within material decomposition results and to improve low-contrast detectability by as much as 2.6 times relative to reconstruction with PCD data only. The parameters of the simulation experiment are based on an in vivo micro-CT experiment conducted in a mouse model of soft-tissue sarcoma. Material decomposition results produced from this in vivo data demonstrate the feasibility of distinguishing two K-edge contrast agents with a spectral

  10. Remodelling of lace plant leaves: antioxidants and ROS are key regulators of programmed cell death.

    Science.gov (United States)

    Dauphinee, Adrian N; Fletcher, Jacob I; Denbigh, Georgia L; Lacroix, Christian R; Gunawardena, Arunika H L A N

    2017-07-01

    Antioxidants and reactive oxygen species are integral for programmed cell death signaling during perforation formation in the lace plant ( Aponogeton madagascariensis ). The lace plant is an excellent model system for studying developmentally regulated programmed cell death (PCD). During early lace plant leaf development, PCD systematically deletes cells resulting in a perforated leaf morphology that is unique in planta. A distinct feature in young lace plant leaves is an abundance of anthocyanins, which have antioxidant properties. The first sign of PCD induction is the loss of anthocyanin pigmentation in cells that are targeted for destruction, which results in a visible gradient of cell death. The cellular dynamics and time course of lace plant PCD are well documented; however, the signals involved in the pathway remain elusive. This study investigates the roles of antioxidants and ROS in developmental PCD signaling during lace plant perforation formation. The involvement of antioxidants and ROS in the pathway was determined using a variety of techniques including pharmacological whole plant experimentation, long-term live cell imaging, the 2,2'-azino-bis-3-ethylbenzothiazoline-6-sulfonic acid anti-radical activity assay, and western blot analysis. Results indicate that antioxidants and ROS are key regulators of PCD during the remodelling of lace plant leaves.

  11. Ultrastructural pathology of primary ciliary dyskinesia: report about 125 cases in Germany

    Directory of Open Access Journals (Sweden)

    Theegarten Dirk

    2011-11-01

    Full Text Available Abstract Background Primary ciliary dyskinesia (PCD is a rare genetically induced disorder of cilia inducing mainly respiratory diseases. Transmission electron microscopy (TEM analysis of ciliary ultrastructure is classically used for diagnosis. We report our experience of TEM investigations in a large series of patients. Methods TEM analysis performed of 742 biopsies from patients with suspected PCD was reviewed retrospectively. Ultrastructural defects were analysized further in 125 cases with changes typical for PCD. Results In 18.1% of patients diagnosis of PCD was made because of morphological alterations, in 68.2% secondary changes were seen. In 13.7% material was not feasible for analysis. Mostly defects of dynein arms were detected in PCD (96.8%. In particular defects of the inner arms (51.2% and combined dynein defects (37.6% were found. Total loss of dynein arms was dominant. Only in 3.2% deficiencies of central structures were found alone. Associated situs inversus or dextracardia was reported clinically in 21.4%. Conclusions TEM analysis is possible in most patients and a useful tool for diagnosis of PCD. Functional and genetic analysis should be done additionally. Registers should be installed to collect all available informations and push further research.

  12. Immunogenicity and Protective Efficacy against Murine Tuberculosis of a Prime-Boost Regimen with BCG and a DNA Vaccine Expressing ESAT-6 and Ag85A Fusion Protein

    Directory of Open Access Journals (Sweden)

    Jia Lu

    2011-01-01

    Full Text Available Heterologous prime-boost regimens utilizing BCG as a prime vaccine probably represent the best hope for the development of novel tuberculosis (TB vaccines. In this study, we examined the immunogenicity and protective efficacy of DNA vaccine (pcD685A expressing the fusion protein of Ag85A and ESAT-6 (r685A and its booster effects in BCG-immunized mice. The recombinant r685A fusion protein stimulated higher level of antigen-specific IFN-γ release in tuberculin skin test- (TST- positive healthy household contacts of active pulmonary TB patients than that in TST-negative population. Vaccination of C57BL/6 mice with pcD685A resulted in significant protection against challenge with virulent Mycobacterium tuberculosis H37Rv when compared with the control group. Most importantly, pcD685A could act as a BCG booster and amplify Th1-type cell-mediated immunity in the lung of BCG-vaccinated mice as shown the increased expression of IFN-γ. The most significant reduction in bacterial load of both spleen and lung was obtained in mice vaccinated with BCG prime and pcD685A DNA booster when compared with BCG or pcD685A alone. Thus, our study indicates that pcD685A may be an efficient booster vaccine against TB with a strong ability to enhance prior BCG immunity.

  13. The fatal effect of tungsten on Pisum sativum L. root cells: indications for endoplasmic reticulum stress-induced programmed cell death.

    Science.gov (United States)

    Adamakis, Ioannis-Dimosthenis S; Panteris, Emmanuel; Eleftheriou, Eleftherios P

    2011-07-01

    Programmed cell death (PCD) is a widespread response of plants against abiotic stress, such as heavy metal toxicity. Tungsten (W) is increasingly considered toxic for plants since it irreversibly affects their growth. Therefore, we investigated whether W could induce some kind of PCD in plants, like other heavy metals do. The morphology of cell and nucleus, the integrity of the cytoskeleton, Evans Blue absorbance and the expression of PCD-related genes were used as indicators of PCD in W-treated roots of Pisum sativum (pea). TEM and fluorescence microscopy revealed mitotic cycle arrest, protoplast shrinkage, disruption of the cytoskeleton and chromatin condensation and peripheral distribution in the nucleus of W-affected cells. Moreover, Evans Blue absorbance in roots increased in relation to the duration of W treatment. These effects were suppressed by inhibitors of the 26S proteasome, caspases and endoplasmic reticulum stress. In addition, silencing of DAD-1 and induction of HSR203J, BiP-D, bZIP28 and bZIP60 genes were also recorded in W-treated pea roots by semi-quantitative RT-PCR. The above observations show that W induces a kind of PCD in pea roots, further substantiating its toxicity for plants. Data imply that endoplasmic reticulum stress-unfolded protein response may be involved in W-induced PCD.

  14. Reassessing apoptosis in plants.

    Science.gov (United States)

    Dickman, Martin; Williams, Brett; Li, Yurong; de Figueiredo, Paul; Wolpert, Thomas

    2017-10-01

    Cell death can be driven by a genetically programmed signalling pathway known as programmed cell death (PCD). In plants, PCD occurs during development as well as in response to environmental and biotic stimuli. Our understanding of PCD regulation in plants has advanced significantly over the past two decades; however, the molecular machinery responsible for driving the system remains elusive. Thus, whether conserved PCD regulatory mechanisms include plant apoptosis remains enigmatic. Animal apoptotic regulators, including Bcl-2 family members, have not been identified in plants but expression of such regulators can trigger or suppress plant PCD. Moreover, plants exhibit nearly all of the biochemical and morphological features of apoptosis. One difference between plant and animal PCD is the absence of phagocytosis in plants. Evidence is emerging that the vacuole may be key to removal of unwanted plant cells, and may carry out functions that are analogous to animal phagocytosis. Here, we provide context for the argument that apoptotic-like cell death occurs in plants.

  15. Lymphedema prevalence and treatment benefits in cancer: impact of a therapeutic intervention on health outcomes and costs.

    Science.gov (United States)

    Brayton, Kimberly M; Hirsch, Alan T; O Brien, Patricia J; Cheville, Andrea; Karaca-Mandic, Pinar; Rockson, Stanley G

    2014-01-01

    Lymphedema is a common complication of cancer therapeutics; its prevalence, treatment outcomes, and costs have been poorly defined. The objective of this study was to examine lymphedema prevalence among cancer survivors and to characterize changes in clinical outcomes and costs associated with a defined therapeutic intervention (use of a pneumatic compression devices [PCD]) in a representative, privately insured population. Retrospective analysis of de-identified health claims data from a large national insurer for calendar years 2007 through 2013. Patients were required to have 12 months of continuous insurance coverage prior to PCD receipt (baseline), as well as a 12-month follow-up period. Analyses were performed for individuals with cancer-related lymphedema (n = 1,065). Lymphedema prevalence was calculated: number of patients with a lymphedema claim in a calendar year divided by total number of enrollees. The impact of PCD use was evaluated by comparing rates of a pre-specified set of health outcomes and costs for the 12 months before and after, respectively, PCD receipt. Lymphedema prevalence among cancer survivors increased from 0.95% in 2007 to 1.24% in 2013. PCD use was associated with decreases in rates of hospitalizations (45% to 32%, pLymphedema is a prevalent medical condition that is often a defining attribute of cancer survivorship. The problem is associated with high health care costs; Treatment (in this instance, use of PCD) is associated with significant decreases in adverse clinical outcomes and costs.

  16. Diagnosis of primary ciliary dyskinesia: summary of the ERS Task Force report

    Science.gov (United States)

    Lucas, Jane S.

    2017-01-01

    Key points Primary ciliary dyskinesia (PCD) is a genetically and clinically heterogeneous disease characterised by abnormal motile ciliary function. There is no “gold standard” diagnostic test for PCD. The European Respiratory Society (ERS) Task Force Guidelines for diagnosing PCD recommend that patients should be referred for diagnostic testing if they have several of the following features: persistent wet cough; situs anomalies; congenital cardiac defects; persistent rhinitis; chronic middle ear disease with or without hearing loss; or a history, in term infants, of neonatal upper and lower respiratory symptoms or neonatal intensive care admission. The ERS Task Force recommends that patients should be investigated in a specialist PCD centre with access to a range of complementary tests: nasal nitric oxide, high-speed video microscopy analysis and transmission electron microscopy. Additional tests including immunofluorescence labelling of ciliary proteins and genetic testing may also help determine the diagnosis. Educational aims This article is intended for primary and secondary care physicians interested in primary ciliary dyskinesia (PCD), i.e. those who identify patients for testing, and those involved in diagnosing and managing PCD patients. It aims: to inform readers about the new European Respiratory Society Task Force Guidelines for diagnosing patients with PCDto enable primary and secondary care physicians to: identify patients who need diagnostic testing; understand the diagnostic tests that their patients will undergo, the results of the tests and their limitations; and ensure that appropriate care is subsequently delivered. PMID:28894478

  17. Management of primary ciliary dyskinesia/Kartagener's syndrome in infertile male patients and current progress in defining the underlying genetic mechanism

    Directory of Open Access Journals (Sweden)

    Yan-Wei Sha

    2014-02-01

    Full Text Available Kartagener's syndrome (KS is an autosomal recessive genetic disease accounting for approximately 50% of the cases of primary ciliary dyskinesia (PCD. As it is accompanied by many complications, PCD/KS severely affects the patient's quality of life. Therapeutic approaches for PCD/KS aim to enhance prevention, facilitate rapid definitive diagnosis, avoid misdiagnosis, maintain active treatment, control infection and postpone the development of lesions. In male patients, sperm flagella may show impairment in or complete absence of the ability to swing, which ultimately results in male infertility. Assisted reproductive technology will certainly benefit such patients. For PCD/KS patients with completely immotile sperm, intracytoplasmic sperm injection may be very important and even indispensable. Considering the number of PCD/KS susceptibility genes and mutations that are being identified, more extensive genetic screening is indispensable in patients with these diseases. Moreover, further studies into the potential molecular mechanisms of these diseases are required. In this review, we summarize the available information on various aspects of this disease in order to delineate the therapeutic objectives more clearly, and clarify the efficacy of assisted reproductive technology as a means of treatment for patients with PCD/KS-associated infertility.

  18. Intramolecular direct oxygen transfer from oxoferryl porphyrin to a sulfide bond.

    Science.gov (United States)

    Ueda, Takunori; Kitagishi, Hiroaki; Kano, Koji

    2014-01-06

    A 1:1 supramolecular complex (met-hemoCD) of 5,10,15,20-tetrakis(4-sulfonatophenyl)porphyrinatoiron(III) (Fe(III)TPPS) with a per-O-methylated β-cyclodextrin dimer having a -SCH2PyCH2S- (Py = pyridin-3,5-diyl) linker (Py3CD) reacted rapidly with hydrogen peroxide or cumene hydroperoxide in an aqueous solution forming two types of hydroperoxo or alkylperoxo intermediates, ROO-Fe(III)(OH(-))PCD and ROO-Fe(III)(Py)PCD, which underwent rapid homolysis to the corresponding ferryloxo species, namely, O═Fe(IV)(OH(-))PCD and O═Fe(IV)(Py)PCD, respectively. For the O═Fe(IV)(OH(-))PCD species, the iron-oxo oxygen facing the linker gradually transferred to the nearby sulfide bond on the linker, forming the sulfoxidized Py3CD (Py3CD-O)/Fe(II)TPPS complex, which then bound dioxygen in air forming an oxy-ferrous complex, O2-Fe(II)TPPS/Py3CD-O. In contrast, the O═Fe(IV)(Py)PCD species, in which the iron-oxo oxygen was located on the opposite side of the sulfide bond on the linker across the porphyrin ring, was reduced to the resting state (met-hemoCD) by the surroundings without any oxidation of the Py3CD linker.

  19. Scoliosis convexity and organ anatomy are related.

    Science.gov (United States)

    Schlösser, Tom P C; Semple, Tom; Carr, Siobhán B; Padley, Simon; Loebinger, Michael R; Hogg, Claire; Castelein, René M

    2017-06-01

    Primary ciliary dyskinesia (PCD) is a respiratory syndrome in which 'random' organ orientation can occur; with approximately 46% of patients developing situs inversus totalis at organogenesis. The aim of this study was to explore the relationship between organ anatomy and curve convexity by studying the prevalence and convexity of idiopathic scoliosis in PCD patients with and without situs inversus. Chest radiographs of PCD patients were systematically screened for existence of significant lateral spinal deviation using the Cobb angle. Positive values represented right-sided convexity. Curve convexity and Cobb angles were compared between PCD patients with situs inversus and normal anatomy. A total of 198 PCD patients were screened. The prevalence of scoliosis (Cobb >10°) and significant spinal asymmetry (Cobb 5-10°) was 8 and 23%, respectively. Curve convexity and Cobb angle were significantly different within both groups between situs inversus patients and patients with normal anatomy (P ≤ 0.009). Moreover, curve convexity correlated significantly with organ orientation (P scoliosis (8 situs inversus and 8 normal anatomy), except for one case, matching of curve convexity and orientation of organ anatomy was observed: convexity of the curve was opposite to organ orientation. This study supports our hypothesis on the correlation between organ anatomy and curve convexity in scoliosis: the convexity of the thoracic curve is predominantly to the right in PCD patients that were 'randomized' to normal organ anatomy and to the left in patients with situs inversus totalis.

  20. Growth and nutritional status, and their association with lung function: a study from the international Primary Ciliary Dyskinesia Cohort.

    Science.gov (United States)

    Goutaki, Myrofora; Halbeisen, Florian S; Spycher, Ben D; Maurer, Elisabeth; Belle, Fabiën; Amirav, Israel; Behan, Laura; Boon, Mieke; Carr, Siobhan; Casaulta, Carmen; Clement, Annick; Crowley, Suzanne; Dell, Sharon; Ferkol, Thomas; Haarman, Eric G; Karadag, Bulent; Knowles, Michael; Koerner-Rettberg, Cordula; Leigh, Margaret W; Loebinger, Michael R; Mazurek, Henryk; Morgan, Lucy; Nielsen, Kim G; Phillipsen, Maria; Sagel, Scott D; Santamaria, Francesca; Schwerk, Nicolaus; Yiallouros, Panayiotis; Lucas, Jane S; Kuehni, Claudia E

    2017-12-01

    Chronic respiratory disease can affect growth and nutrition, which can influence lung function. We investigated height, body mass index (BMI), and lung function in patients with primary ciliary dyskinesia (PCD).In this study, based on the international PCD (iPCD) Cohort, we calculated z-scores for height and BMI using World Health Organization (WHO) and national growth references, and assessed associations with age, sex, country, diagnostic certainty, age at diagnosis, organ laterality and lung function in multilevel regression models that accounted for repeated measurements.We analysed 6402 measurements from 1609 iPCD Cohort patients. Height was reduced compared to WHO (z-score -0.12, 95% CI -0.17 to -0.06) and national references (z-score -0.27, 95% CI -0.33 to -0.21) in male and female patients in all age groups, with variation between countries. Height and BMI were higher in patients diagnosed earlier in life (p=0.026 and pnutrition are affected adversely in PCD patients from early life and are both strongly associated with lung function. If supported by longitudinal studies, these findings suggest that early diagnosis with multidisciplinary management and nutritional advice could improve growth and delay disease progression and lung function impairment in PCD. Copyright ©ERS 2017.

  1. A highly efficient maize nucellus protoplast system for transient gene expression and studying programmed cell death-related processes.

    Science.gov (United States)

    Chen, Jiang; Yi, Qiang; Song, Qiaoheng; Gu, Yong; Zhang, Junjie; Hu, Yufeng; Liu, Hanmei; Liu, Yinghong; Yu, Guowu; Huang, Yubi

    2015-07-01

    Conditions for the isolation and transfection of maize nucellus protoplasts were established. We demonstrated its utilization for protein expression, localization, protein-protein interaction, and the investigation of PCD-related processes. Plant protoplasts are an important and versatile cell system that is widely used in the analysis of gene characterization and diverse signaling pathways. Programmed cell death (PCD) occurs throughout the life of plants from embryogenesis to fertilization. The maize nucellus undergoes typical PCD during development of the embryo sac. The nucellus protoplast shows potential for use in research of PCD-related processes. No studies have reported previously the isolation and transfection of nucellus protoplasts. In this study, conditions for the isolation and transfection of maize nucellus protoplasts were established. The maize protoplast system can be used for protein expression, localization, and protein-protein interaction. We applied this system to investigate PCD-related processes. Quantitative real-time PCR analysis revealed that transient expression of MADS29 in the maize nucellus protoplast increases Cys-protease gene transcript level. In addition, β-glucuronidase and luciferase activity assays showed that MADS29 could enhance the promoter activities of the Cys-protease gene. Thus, we demonstrated the potential of a highly efficient maize nucellus protoplast system for transient gene expression and investigation of PCD-related processes.

  2. Plant programmed cell death from a chromatin point of view.

    Science.gov (United States)

    Latrasse, D; Benhamed, M; Bergounioux, C; Raynaud, C; Delarue, M

    2016-10-01

    Programmed cell death (PCD) is a ubiquitous genetically regulated process consisting of the activation of finely controlled signalling pathways that lead to cellular suicide. PCD can be part of a developmental programme (dPCD) or be triggered by environmental conditions (ePCD). In plant cells, as in animal cells, extensive chromatin condensation and degradation of the nuclear DNA are among the most conspicuous features of cells undergoing PCD. Changes in chromatin condensation could either reflect the structural changes required for internucleosomal fragmentation of nuclear DNA or relate to large-scale chromatin rearrangements associated with a major transcriptional switch occurring during cell death. The aim of this review is to give an update on plant PCD processes from a chromatin point of view. The first part will be dedicated to chromatin conformational changes associated with cell death observed in various developmental and physiological conditions, whereas the second part will be devoted to histone dynamics and DNA modifications associated with critical changes in genome expression during the cell death process. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  3. Calpain-like: A Ca(2+) dependent cystein protease in Entamoeba histolytica cell death.

    Science.gov (United States)

    Monroy, Virginia Sánchez; Flores, Olivia Medel; García, Consuelo Gómez; Maya, Yesenia Chávez; Fernández, Tania Domínguez; Pérez Ishiwara, D Guillermo

    2015-12-01

    Entamoeba histolytica programmed cell death (PCD) induced by G418 is characterized by the release of important amounts of intracellular calcium from reservoirs. Nevertheless, no typical caspases have been detected in the parasite, the PCD phenotype is inhibited by the cysteine protease inhibitor E-64. These results strongly suggest that Ca(2+)-dependent proteases could be involved in PCD. In this study, we evaluate the expression and activity of a specific dependent Ca(2+) protease, the calpain-like protease, by real-time quantitative PCR (RTq-PCR), Western blot assays and a enzymatic method during the induction of PCD by G418. Alternatively, using cell viability and TUNEL assays, we also demonstrated that the Z-Leu-Leu-Leu-al calpain inhibitor reduced the rate of cell death. The results demonstrated 4.9-fold overexpression of calpain-like gene 1.5 h after G418 PCD induction, while calpain-like protein increased almost two-fold with respect to basal calpain-like expression after 3 h of induction, and calpain activity was found to be approximately three-fold higher 6 h after treatment compared with untreated trophozoites. Taken together, these results suggest that this Ca(2+)-dependent protease could be involved in the executory phase of PCD. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Oxidative stress and mitochondrial dysfunctions are early events in narciclasine-induced programmed cell death in tobacco Bright Yellow-2 cells.

    Science.gov (United States)

    Lu, Hongxia; Wan, Qi; Wang, Huahua; Na, Xiaofan; Wang, Xiaomin; Bi, Yurong

    2012-01-01

    Narciclasine (NCS) is a plant growth inhibitor isolated from the secreted mucilage of Narcissus tazetta bulbs. It is a commonly used anticancer agent in animal systems. In this study, we provide evidence to show that NCS also acts as an agent in inducing programmed cell death (PCD) in tobacco Bright Yellow-2 (TBY-2) cell cultures. NCS treatment induces typical PCD-associated morphological and biochemical changes, namely cell shrinkage, chromatin condensation and nuclear DNA degradation. To investigate possible signaling events, we analyzed the production of reactive oxygen species (ROS) and the function of mitochondria during PCD induced by NCS. A biphasic behavior burst of hydrogen peroxide (H(2)O(2)) was detected in TBY-2 cells treated with NCS, and mitochondrial transmembrane potential (MTP) loss occurred after a slight increase. Pre-incubation with antioxidant catalase (CAT) and N-acetyl-L-cysteine (NAC) not only significantly decreased the H(2)O(2) production but also effectively retarded the decrease of MTP and reduced the percentage of cells undergoing PCD after NCS treatment. In conclusion, our results suggest that NCS induces PCD in plant cells; the oxidative stress (accumulation of H(2)O(2)) and the MTP loss play important roles during NCS-induced PCD. Copyright © Physiologia Plantarum 2011.

  5. Aerobic fitness in children and young adults with primary ciliary dyskinesia.

    Directory of Open Access Journals (Sweden)

    Astrid Madsen

    Full Text Available BACKGROUND: Although aerobic fitness is regarded as an overall prognostic measure of morbidity and mortality, its evaluation in the chronic progressive sinopulmonary disease primary ciliary dyskinesia (PCD has been infrequently and inconsistently reported. Here we assessed peak oxygen uptake (VO2peak in a large well-characterized cohort of PCD patients, and explored whether VO2peak was associated with parameters of pulmonary function, self-reported physical limitations, and physical activity level. METHODS: VO2peak, spirometry, diffusing capacity, whole-body plethysmography, and nitrogen multiple breath inert gas washout (N2 MBW were assessed in a cross-sectional, single-occasion study of clinically stable children and young adults with PCD. We used a questionnaire including self-reported physical limitations in everyday life or in vigorous activities, and estimation of weekly hours of strenuous physical activity. VO2peak in PCD patients was compared with that in matched, healthy control subjects and a national reference. RESULTS: Forty-four PCD patients aged 6-29 years exhibited reduced VO2peak compared to healthy controls (P<0.001 and the national reference. VO2peak was abnormal (z-score <-1.96 in 34% of PCD patients. Spirometric values, RV/TLC, and indices of N2 MBW were significantly abnormal, but VO2peak only correlated with FEV1 and DLCO/VA. VO2peak correlated with complaints of moderate or significant limitations in vigorous activities (P = 0.0001, exhibited by 39% of PCD patients. CONCLUSION: One-third of PCD patients exhibited substantially lower aerobic fitness than healthy subjects. Aerobic fitness correlated with FEV1, DLCO/VA and self-reported complaints of limitations in vigorous physical activity. These findings are most likely explained by PCD pulmonary disease and its impact on pulmonary function and physical ability. Considering fitness as an important outcome and including regular strenuous physical activity in PCD

  6. DNAH11 Localization in the Proximal Region of Respiratory Cilia Defines Distinct Outer Dynein Arm Complexes.

    Science.gov (United States)

    Dougherty, Gerard W; Loges, Niki T; Klinkenbusch, Judith A; Olbrich, Heike; Pennekamp, Petra; Menchen, Tabea; Raidt, Johanna; Wallmeier, Julia; Werner, Claudius; Westermann, Cordula; Ruckert, Christian; Mirra, Virginia; Hjeij, Rim; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Praveen, Kavita; Kashef, Mohammad A; Kashef, Sara; Eghtedari, Fardin; Häffner, Karsten; Valmari, Pekka; Baktai, György; Aviram, Micha; Bentur, Lea; Amirav, Israel; Davis, Erica E; Katsanis, Nicholas; Brueckner, Martina; Shaposhnykov, Artem; Pigino, Gaia; Dworniczak, Bernd; Omran, Heymut

    2016-08-01

    Primary ciliary dyskinesia (PCD) is a recessively inherited disease that leads to chronic respiratory disorders owing to impaired mucociliary clearance. Conventional transmission electron microscopy (TEM) is a diagnostic standard to identify ultrastructural defects in respiratory cilia but is not useful in approximately 30% of PCD cases, which have normal ciliary ultrastructure. DNAH11 mutations are a common cause of PCD with normal ciliary ultrastructure and hyperkinetic ciliary beating, but its pathophysiology remains poorly understood. We therefore characterized DNAH11 in human respiratory cilia by immunofluorescence microscopy (IFM) in the context of PCD. We used whole-exome and targeted next-generation sequence analysis as well as Sanger sequencing to identify and confirm eight novel loss-of-function DNAH11 mutations. We designed and validated a monoclonal antibody specific to DNAH11 and performed high-resolution IFM of both control and PCD-affected human respiratory cells, as well as samples from green fluorescent protein (GFP)-left-right dynein mice, to determine the ciliary localization of DNAH11. IFM analysis demonstrated native DNAH11 localization in only the proximal region of wild-type human respiratory cilia and loss of DNAH11 in individuals with PCD with certain loss-of-function DNAH11 mutations. GFP-left-right dynein mice confirmed proximal DNAH11 localization in tracheal cilia. DNAH11 retained proximal localization in respiratory cilia of individuals with PCD with distinct ultrastructural defects, such as the absence of outer dynein arms (ODAs). TEM tomography detected a partial reduction of ODAs in DNAH11-deficient cilia. DNAH11 mutations result in a subtle ODA defect in only the proximal region of respiratory cilia, which is detectable by IFM and TEM tomography.

  7. Heme oxygenase-1 delays gibberellin-induced programmed cell death of rice aleurone layers subjected to drought stress by interacting with nitric oxide

    Directory of Open Access Journals (Sweden)

    Huangming eWu

    2016-01-01

    Full Text Available Cereal aleurone layers undergo a gibberellin (GA-regulated process of programmed cell death (PCD following germination. Heme oxygenase-1 (HO-1 is known as a rate-liming enzyme in the degradation of heme to biliverdin IXα (BV, carbon monoxide (CO, and free iron ions (Fe2+. It is a critical component in plant development and adaptation to environment stresses. Our previous studies confirmed that HO-1 inducer hematin (Ht promotes the germination of rice seeds in drought (20% polyethylene glycol-6000, PEG conditions, but the corresponding effects of HO-1 on the alleviation of germination-triggered PCD in GA-treated rice aleurone layers remain unknown. The present study has determined that GA co-treated with PEG results in lower HO-1 transcript levels and HO activity, which in turn results in the development of vacuoles in aleurone cells, followed by PCD. The pharmacology approach illustrated that up- or down-regulated HO-1 gene expression and HO activity delayed or accelerated GA-induced PCD. Furthermore, the application of the HO-1 inducer hematin and nitric oxide (NO donor sodium nitroprusside (SNP not only activated HO-1 gene expression, HO activity, and endogenous NO content, but also blocked GA-induced rapid vacuolation and accelerated aleurone layers PCD under drought stress. However, both HO-1 inhibitor zinc protoporphyrin IX (ZnPPIX and NO scavenger 2-(4-carboxyphenyl0-4, 4, 5, 5-tetramethylimidazoline-l-oxyl-3-oxide potassium salt (cPTIO reserved the effects of hematin and SNP on rice aleurone layer PCD under drought stress by down-regulating endogenous HO-1 and NO, respectively. The inducible effects of hematin and SNP on HO-1 gene expression, HO activity, and NO content were blocked by cPTIO. Together, these results clearly suggest that HO-1 is involved in the alleviation of GA-induced PCD of drought-triggered rice aleurone layers by associating with NO.

  8. Mitochondrial proteomics of the acetic acid - induced programmed cell death response in a highly tolerant Zygosaccharomyces bailii - derived hybrid strain

    Science.gov (United States)

    Guerreiro, Joana F.; Sampaio-Marques, Belém; Soares, Renata; Coelho, Ana V.; Leão, Cecília; Ludovico, Paula; Sá-Correia, Isabel

    2016-01-01

    Very high concentrations of acetic acid at low pH induce programmed cell death (PCD) in both the experimental model Saccharomyces cerevisiae and in Zygosaccharomyces bailii, the latter being considered the most problematic acidic food spoilage yeast due to its remarkable intrinsic resistance to this food preservative. However, while the mechanisms underlying S. cerevisiae PCD induced by acetic acid have been previously examined, the corresponding molecular players remain largely unknown in Z. bailii. Also, the reason why acetic acid concentrations known to be necrotic for S. cerevisiae induce PCD with an apoptotic phenotype in Z. bailii remains to be elucidated. In this study, a 2-DE-based expression mitochondrial proteomic analysis was explored to obtain new insights into the mechanisms involved in PCD in the Z. bailii derived hybrid strain ISA1307. This allowed the quantitative assessment of expression of protein species derived from each of the parental strains, with special emphasis on the processes taking place in the mitochondria known to play a key role in acetic acid - induced PCD. A marked decrease in the content of proteins involved in mitochondrial metabolism, in particular, in respiratory metabolism (Cor1, Rip1, Lpd1, Lat1 and Pdb1), with a concomitant increase in the abundance of proteins involved in fermentation (Pdc1, Ald4, Dld3) was registered. Other differentially expressed identified proteins also suggest the involvement of the oxidative stress response, protein translation, amino acid and nucleotide metabolism, among other processes, in the PCD response. Overall, the results strengthen the emerging concept of the importance of metabolic regulation of yeast PCD. PMID:28357336

  9. Lymphedema prevalence and treatment benefits in cancer: impact of a therapeutic intervention on health outcomes and costs.

    Directory of Open Access Journals (Sweden)

    Kimberly M Brayton

    Full Text Available Lymphedema is a common complication of cancer therapeutics; its prevalence, treatment outcomes, and costs have been poorly defined. The objective of this study was to examine lymphedema prevalence among cancer survivors and to characterize changes in clinical outcomes and costs associated with a defined therapeutic intervention (use of a pneumatic compression devices [PCD] in a representative, privately insured population.Retrospective analysis of de-identified health claims data from a large national insurer for calendar years 2007 through 2013. Patients were required to have 12 months of continuous insurance coverage prior to PCD receipt (baseline, as well as a 12-month follow-up period. Analyses were performed for individuals with cancer-related lymphedema (n = 1,065. Lymphedema prevalence was calculated: number of patients with a lymphedema claim in a calendar year divided by total number of enrollees. The impact of PCD use was evaluated by comparing rates of a pre-specified set of health outcomes and costs for the 12 months before and after, respectively, PCD receipt. Lymphedema prevalence among cancer survivors increased from 0.95% in 2007 to 1.24% in 2013. PCD use was associated with decreases in rates of hospitalizations (45% to 32%, p<0.0001, outpatient hospital visits (95% to 90%, p<0.0001, cellulitis diagnoses (28% to 22%, p = 0.003, and physical therapy use (50% to 41%, p<0.0001. The average baseline health care costs were high ($53,422 but decreased in the year after PCD acquisition (-$11,833, p<0.0001.Lymphedema is a prevalent medical condition that is often a defining attribute of cancer survivorship. The problem is associated with high health care costs; Treatment (in this instance, use of PCD is associated with significant decreases in adverse clinical outcomes and costs.

  10. Signal and noise characteristics of a CdTe-based photon counting detector: cascaded systems analysis and experimental studies

    Science.gov (United States)

    Ji, Xu; Zhang, Ran; Ge, Yongshuai; Chen, Guang-Hong; Li, Ke

    2017-03-01

    Recent advances in single photon counting detectors (PCDs) are opening up new opportunities in medical imaging. However, the performance of PCDs is not flawless. Problems such as charge sharing may deteriorate the performance of PCD. This work studied the dependence of the signal and noise properties of a cadmium telluride (CdTe)-based PCD on the charge sharing effect and the anti-charge sharing (ACS) capability offered by the PCD. Through both serial and parallel cascaded systems analysis, a theoretical model was developed to trace the origin of charge sharing in CdTe-based PCD, which is primarily related to remote k-fluorescence re-absorption and spatial spreading of charge cloud. The ACS process was modeled as a sub-imaging state prior to the energy thresholding stage, and its impact on the noise power spectrum (NPS) of PCD can be qualitatively determined by the theoretical model. To validate the theoretical model, experimental studies with a CdTe-based PCD system (XC-FLITE X1, XCounter AB) was performed. Two x-ray radiation conditions, including an RQA-5 beam and a 40 kVp beam, were used for the NPS measurements. Both theoretical predictions and experimental results showed that ACS makes the NPS of the CdTe-based PCD flatter, which corresponds to reduced noise correlation length. The flatness of the NPS is further boosted by increasing the energy threshold or reducing the x-ray energy, both of which reduce the likelihood of registering multiple counts from the same incidenting x-ray photon.

  11. Programmed cell death in barley aleurone cells is not directly stimulated by reactive oxygen species produced in response to gibberellin.

    Science.gov (United States)

    Aoki, Nozomi; Ishibashi, Yushi; Kai, Kyohei; Tomokiyo, Reisa; Yuasa, Takashi; Iwaya-Inoue, Mari

    2014-05-01

    The cereal aleurone layer is a secretory tissue that produces enzymes to hydrolyze the starchy endosperm during germination. We recently demonstrated that reactive oxygen species (ROS), produced in response to gibberellins (GA), promoted GAMyb expression, which induces α-amylase expression in barley aleurone cells. On the other hand, ROS levels increase during programmed cell death (PCD) in barley aleurone cells, and GAMyb is involved in PCD of these cells. In this study, we investigated whether the ROS produced in response to GA regulate PCD directly by using mutants of Slender1 (SLN1), a DELLA protein that negatively regulates GA signaling. The wild-type, the sln1c mutant (which exhibits gibberellin-type signaling even in the absence of GA), and the Sln1d mutant (which is gibberellin-insensitive with respect to α-amylase production) all produced ROS in response to GA, suggesting that ROS production in aleurone cells in response to GA is independent of GA signaling through this DELLA protein. Exogenous GA promoted PCD in the wild-type. PCD in sln1c was induced even without exogenous GA (and so without induction of ROS), whereas PCD in Sln1d was not induced in the presence of exogenous GA, even though the ROS content increased significantly in response to GA. These results suggest that PCD in barley aleurone cells is not directly stimulated by ROS produced in response to GA but is regulated by GA signaling through DELLA protein. Copyright © 2014 Elsevier GmbH. All rights reserved.

  12. Mitochondrial proteomics of the acetic acid – induced programmed cell death response in a highly tolerant Zygosaccharomyces bailii – derived hybrid strain

    Directory of Open Access Journals (Sweden)

    Joana F Guerreiro

    2016-01-01

    Full Text Available Very high concentrations of acetic acid at low pH induce programmed cell death (PCD in both the experimental model Saccharomyces cerevisiae and in Zygosaccharomyces bailii, the latter being considered the most problematic acidic food spoilage yeast due to its remarkable intrinsic resistance to this food preservative. However, while the mechanisms underlying S. cerevisiae PCD induced by acetic acid have been previously examined, the corresponding molecular players remain largely unknown in Z. bailii. Also, the reason why acetic acid concentrations known to be necrotic for S. cerevisiae induce PCD with an apoptotic phenotype in Z. bailii remains to be elucidated. In this study, a 2-DE-based expression mitochondrial proteomic analysis was explored to obtain new insights into the mechanisms involved in PCD in the Z. bailii derived hybrid strain ISA1307. This allowed the quantitative assessment of expression of protein species derived from each of the parental strains, with special emphasis on the processes taking place in the mitochondria known to play a key role in acetic acid – induced PCD. A marked decrease in the content of proteins involved in mitochondrial metabolism, in particular, in respiratory metabolism (Cor1, Rip1, Lpd1, Lat1 and Pdb1, with a concomitant increase in the abundance of proteins involved in fermentation (Pdc1, Ald4, Dld3 was registered. Other differentially expressed identified proteins also suggest the involvement of the oxidative stress response, protein translation, amino acid and nucleotide metabolism, among other processes, in the PCD response. Overall, the results strengthen the emerging concept of the importance of metabolic regulation of yeast PCD.

  13. Infezione da Borrelia burgdorferi: descrizione di un caso clinico atipico

    Directory of Open Access Journals (Sweden)

    Gino Ciarrocchi

    2005-06-01

    Full Text Available La borreliosi o Malattia di Lyme (ML è una malattia infettiva multisistemica causata da una spirocheta, Borrelia burgdorferi, trasmessa dal morso di una zecca del genere Ixodes.Viene descritto il caso clinico di una ragazza di venti anni. In un soggiorno estivo sul Monte Amiata, in Toscana, la giovane notò un arrossamento della pelle al fianco sinistro del corpo. Non osservò presenza della zecca nella zona di presumibile inoculo, da cui si sviluppò un eritema migrante (EM ad andamento centrifugo, fino a raggiungere un diametro di circa 10 centimetri. Nei giorni successivi e durante il follow up non sono mai comparsi sintomi collaterali generali riferibili ad astenia, febbricola, artralgie, malessere, né a carico di organi bersaglio. Dopo circa due settimane, persistendo l’EM, sono stati eseguiti esami sierologici specifici per Borrelia burgdorferi. Al riscontro positivo dei test ELISA e western-blot IgG e IgM, il clnico ha prescritto terapia antibiotica a base di Amoxicillina 2g/die per 20 giorni.Dopo 8-10 giorni di terapia è avvenuta la scomparsa completa dell’eritema. Viene mostrato l’andamento dei test sierologici al momento della diagnosi e durante il follow up, per un periodo di circa cinque mesi.

  14. Grupos de simetria : identificação de padrões no património cultural dos Açores

    OpenAIRE

    Teixeira, Ricardo Emanuel Cunha; Costa, Susana Goulart; Moniz, Vera Maria Raposo

    2015-01-01

    Antes de surgir a palavra escrita, a imagem constituiu durante muito tempo o principal veículo de comunicação. Desde a Antiguidade que a repetição de um mesmo motivo tem sido usada nos mais variados contextos, dando lugar a composições de grande beleza estética. Se olharmos com atenção, encontramos com frequência composições deste tipo em monumentos e espaços públicos. Muitas são de natureza matemática e têm por base as isometrias do plano (reflexão, translação, rotação e reflexão deslizante)...

  15. Active vibration control of vehicle suspension systems using sliding modes, differential flatness and generalized proportional-integral control

    Directory of Open Access Journals (Sweden)

    Esteban Chávez Conde

    2011-01-01

    Full Text Available En este artículo se presenta un enfoque de diseño de esquemas de control activo robusto para sistemas de suspensión de vehículos, usando técnicas de control Proporcional-Integral Generalizado, modos deslizantes y planitud diferencial, para atenuar vibraciones indeseables inducidas por perturbaciones de terreno irregular. Se proponen dos esquemas de control: uno de ellos emplea mediciones de posición y de velocidad y el otro requiere únicamente mediciones de posición. Se propone la reconstrucción integral de las derivadas de la salida plana para evitar el uso de sensores de velocidad y de aceleración, así como la información de perturbaciones de terreno desconocidas.

  16. Control no Lineal Robusto de una Máquina para Fabricación de Películas Delgadas

    Directory of Open Access Journals (Sweden)

    Héctor Huerta

    2017-07-01

    Full Text Available Resumen: En este artículo se presenta un esquema de control para una máquina utilizada para fabricación de películas delgadas, con un motor de corriente directa sin escobillas, basada en el método de centrifugación. Se incluye el modelo no lineal del motor sin escobillas, que corresponde a una máquina síncrona trifásica, con los flujos del rotor y las corrientes en el estator, como las dinámicas eléctricas, además de la velocidad en el rotor, como la dinámica mecánica. El objetivo de control es la regulación de la velocidad del rotor. Se utilizó la técnica de control por bloques y así obtener una variedad deslizante. Se eligió la técnica de control por modos deslizantes para garantizar que la variedad elegida sea atractiva y obtener robustez en lazo cerrado. Para completar el esquema de control se incluye un observador para estimar los estados no medibles, en este caso, los flujos del rotor. Se implementó el esquema de control propuesto en la máquina para fabricación de películas delgadas, además de un controlador basado en un PID con ganancias programadas, lo anterior para realizar la comparación de ambas técnicas. El esquema de control por modos deslizantes propuesto presenta ventajas sobre el controlador PID, ya que se obtiene la regulación de la velocidad del rotor, sin error en estado estacionario, considerando variaciones paramétricas. Abstract: This paper presents a control scheme for a machine used to make thin films, with a brushless direct current motor, based on the spin-coating method. The nonlinear brushless motor model is included, which corresponds to a three-phase synchronous machine, with rotor flux linkages and stator currents, as the electric dynamics, and the rotor speed, as the mechanical dynamics. In order to achieve the speed regulation, the block control technique was used to obtain a sliding manifold. The sliding mode control technique was applied to ensure that the chosen manifold is

  17. Fracturas perimplante de fémur tratadas con clavo retrógrado: reporte de un caso y descripción de la técnica quirúrgica.

    Directory of Open Access Journals (Sweden)

    Pablo Ariel Slullitel

    2016-02-01

    Full Text Available Existe un riesgo tácito de fractura peri-implante de fémur en pacientes con antecedente de fractura pertrocantérica de fémur tratados con tornillos deslizantes de cadera (TDC debido al aumento de la expectativa de vida y a las múltiples comorbilidades. Diversas opciones terapéuticas son posibles dependiendo de si se mantiene la osteosíntesis previa o no. Dada la baja prevalencia de estas fracturas, no existe consenso en la bibliografía actual sobre el tratamiento ideal. El objetivo de este trabajo es reportar un caso y describir la técnica quirúrgica de enclavado endomedular retrógrado para el tratamiento de fracturas peri-implante debajo de un TDC.

  18. Primary ciliary dyskinesia: a report from ATS 2001, May 18–23, San Francisco

    Directory of Open Access Journals (Sweden)

    Noone Peadar G

    2001-06-01

    Full Text Available Abstract Primary ciliary dyskinesia (PCD is a genetic disorder of abnormal ciliary structure and function that leads to defective mucociliary clearance, resulting in oto-sino-pulmonary disease, and infertility. The disease is currently under intense investigation by a number of research groups worldwide. At the recent American Thoracic Society meeting in San Francisco in May 2001, two sessions focused on PCD; a symposium session on May 21 with several featured expert speakers was followed by a mini-symposium on Tuesday May 22, with one featured speaker and presentation of nine abstracts covering a range of research topics. Mattias Salathe (University of Miami, USA and Stephen Brody (Washington University, St Louis, USA chaired the symposium session. Presentations focused on the clinical spectrum of PCD, the genetics of PCD, a proteomics approach to detail the structure of cilia, the role of cilia in the embryology of situs laterality, and airway epithelial cell biology. The mini-symposium was chaired by Peadar Noone (University of North Carolina, USA and Malcolm King (University of Alberta, USA and included presentations on the use of PCD as a human disease model, accurate definition of the phenotype using clinical and cell biologic markers, and molecular studies. The latter reports ranged from isolation of a protein involved in ciliary structure and function to genetic studies using linkage analysis and the candidate gene approach. Clinicians and scientists alike displayed considerable interest at both sessions, and there were several lively question–answer sessions.

  19. In vivo programmed cell death of Entamoeba histolytica trophozoites in a hamster model of amoebic liver abscess.

    Science.gov (United States)

    Villalba-Magdaleno, José D'Artagnan; Pérez-Ishiwara, Guillermo; Serrano-Luna, Jesús; Tsutsumi, Víctor; Shibayama, Mineko

    2011-05-01

    Entamoeba histolytica trophozoites can induce host cell apoptosis, which correlates with the virulence of the parasite. This phenomenon has been seen during the resolution of an inflammatory response and the survival of the parasites. Other studies have shown that E. histolytica trophozoites undergo programmed cell death (PCD) in vitro, but how this process occurs within the mammalian host cell remains unclear. Here, we studied the PCD of E. histolytica trophozoites as part of an in vivo event related to the inflammatory reaction and the host-parasite interaction. Morphological study of amoebic liver abscesses showed only a few E. histolytica trophozoites with peroxidase-positive nuclei identified by terminal deoxynucleotidyltransferase enzyme-mediated dUTP nick end labelling (TUNEL). To better understand PCD following the interaction between amoebae and inflammatory cells, we designed a novel in vivo model using a dialysis bag containing E. histolytica trophozoites, which was surgically placed inside the peritoneal cavity of a hamster and left to interact with the host's exudate components. Amoebae collected from bags were then examined by TUNEL assay, fluorescence-activated cell sorting (FACS) and transmission electron microscopy. Nuclear condensation and DNA fragmentation of E. histolytica trophozoites were observed after exposure to peritoneal exudates, which were mainly composed of neutrophils and macrophages. Our results suggest that production of nitric oxide by inflammatory cells could be involved in PCD of trophozoites. In this modified in vivo system, PCD appears to play a prominent role in the host-parasite interaction and parasite cell death.

  20. Successful treatment of chronic lower respiratory tract infection by macrolide administration in a patient with intralobar pulmonary sequestration and primary ciliary dyskinesia

    Directory of Open Access Journals (Sweden)

    Hironobu Tsubouchi

    2015-01-01

    Full Text Available Primary ciliary dyskinesia (PCD is a genetic disease associated with abnormalities in ciliary structure and function. Although recurrent respiratory infection associated with ciliary dysfunction is a common clinical feature, there is no standardized treatment or management of respiratory infection in PCD patients. Here, we report that respiratory infection with PCD and intralobar sequestration (ILS were treated successfully with clarithromycin before the surgical resection of ILS. A 15-year-old non-smoking Japanese woman was admitted for productive cough and dyspnea on exertion. Chest CT scan on admission showed complex cystic LESIONS with air-fluid level in the right lower lobe, and diffuse nodular shadows in the whole lobe of the lung. On flexible bronchoscopy examination, sputum and bronchiolar fluid cultures revealed Staphylococcus aureus (S. aureus. An electron microscopic examination of the cilia showed inner dynein arm deficiency. Administration of clarithromycin improved the lower respiratory tract infection associated with S. aureus. CT angiography after clarithromycin treatment demonstrated an aberrant systemic artery arising from the celiac trunk and supplying the cystic mass lesions that were incorporated into the normal pulmonary parenchyma without their own pleural covering. Based on these results, the patient was diagnosed with PCD and ILS. Because of the clarithromycin treatment, resection of the ILS was performed safely without any complications. Although further observation of clarithromycin treatment is needed, we believe that clarithromycin may be considered one of the agents for treating PCD.

  1. Rheumatic masks of plasma cell dyscrasias

    Directory of Open Access Journals (Sweden)

    Vladimir Ivanovich Vasilyev

    2012-01-01

    Full Text Available Objective: to consider clinical practice problems in the differential diagnosis of different types of plasma cell dyscrasias (PCD. Subjects and methods. Fourteen patients (8 men and 6 women aged 52±12 years, in whom rheumatic diseases (RD were ruled out and who were diagnosed as having primary PCD: different types of myeloma in 7 patients, myeloma + AL-amyloidosis in 2, AL-amyloidosis in 3, and Waldenstrom’s macroglobulinemia in 2, were examined. Results and discussion. The most common maldiagnosed RDs in patients with PCD were seronegative rheumatoid arthritis (RA, systemic lupus erythematosus, Sjogren’s disease, and different forms of vasculitis. The most frequent masks of RD were kidney (78% and osteoarticular system (64% lesions, vascular disorders (36%, peripheral polyneuropathies (36%, and enlarged salivary glands with xerostomia (28.5%. Serum and urine immunochemical study should be performed in all patients who have clinical manifestations of seropositive RA, spondyloarthritis, intensive bone pain syndrome, ulceronecrotic vasculitis, enlarged submandibular salivary glands with macroglossia in the absence of markers of autoimmune disease for the timely diagnosis of PCD and the exclusion of RD. The paper estimates the sensitivity and specificity of main methods used to diagnose different types of PCD.

  2. An automatic optosensing device for the simultaneous determination of resveratrol and piceid in wines

    Energy Technology Data Exchange (ETDEWEB)

    Molina-Garcia, Lucia; Ruiz-Medina, Antonio [Department of Physical and Analytical Chemistry, University of Jaen, Campus Las Lagunillas s/n, 23071 Jaen (Spain); Fernandez-de Cordova, Maria Luisa, E-mail: mferna@ujaen.es [Department of Physical and Analytical Chemistry, University of Jaen, Campus Las Lagunillas s/n, 23071 Jaen (Spain)

    2011-03-18

    For the first time, a spectrofluorimetric method is reported for the simultaneous determination of resveratrol (RVT) and piceid (PCD), two stilbenes showing diverse interesting physiological and biochemical attributes, as well as a wide range of health benefits ranging from cardioprotection to chemoprevention. The method makes use of a multicommutated flow-through optosensor in which the resolution of RVT and PCD is accomplished by means the sequential arrival of their photoproducts, on-line generated by UV-irradiation, to the detection area. This is possible due to the different kinetic behaviour of these latter on a solid support (C{sub 18} silica gel) filling a minicolumn placed before the detector. The measurement in solid-phase of the photochemically induced fluorescence of the photoproducts ({lambda}{sub ex}: 257 nm/{lambda}{sub em}: 382 nm) is used as analytical signal for monitoring both compounds. The method has been applied to the analysis of RVT and PCD in wines and requires a previous solid-phase extraction (SPE) using Bakerbond C{sub 18} cartridges. This pretreatment and the use of a solid-support in both the minicolumn and the flow-cell of the detector allow the determination of RVT and PCD by external calibration. Detection limits (DLs) are 9.3 and 12.6 ng mL{sup -1} for RVT and PCD, respectively. Commercial red and white wine samples have been analysed and the results obtained have been satisfactorily validated by high-performance liquid chromatography (HPLC).

  3. Determination of a Limited Scope Network's Lightning Detection Efficiency

    Science.gov (United States)

    Rompala, John T.; Blakeslee, R.

    2008-01-01

    This paper outlines a modeling technique to map lightning detection efficiency variations over a region surveyed by a sparse array of ground based detectors. A reliable flash peak current distribution (PCD) for the region serves as the technique's base. This distribution is recast as an event probability distribution function. The technique then uses the PCD together with information regarding: site signal detection thresholds, type of solution algorithm used, and range attenuation; to formulate the probability that a flash at a specified location will yield a solution. Applying this technique to the full region produces detection efficiency contour maps specific to the parameters employed. These contours facilitate a comparative analysis of each parameter's effect on the network's detection efficiency. In an alternate application, this modeling technique gives an estimate of the number, strength, and distribution of events going undetected. This approach leads to a variety of event density contour maps. This application is also illustrated. The technique's base PCD can be empirical or analytical. A process for formulating an empirical PCD specific to the region and network being studied is presented. A new method for producing an analytical representation of the empirical PCD is also introduced.

  4. Primary Ciliary Dyskinesia-Causing Mutations in Amish and Mennonite Communities

    Science.gov (United States)

    Ferkol, Thomas W.; Puffenberger, Erik G.; Lie, Hauw; Helms, Cynthia; Strauss, Kevin A.; Bowcock, Anne; Carson, John L.; Hazucha, Milan; Morton, D. Holmes; Patel, Anand C.; Leigh, Margaret W.; Knowles, Michael R.; Zariwala, Maimoona A.

    2013-01-01

    Objective To determine whether individuals with primary ciliary dyskinesia (PCD) from unrelated Amish and Mennonite families harbor a single and unique founder mutation. Study design Subjects from Amish and Mennonite communities in several states were enrolled in the study. All subjects were clinically characterized, and nasal nitric oxide levels were measured. Nasal epithelial scrapings were collected from several subjects for ciliary ultrastructural analyses. DNA was isolated from patients with PCD and their unaffected first- and second-degree relatives. Genome-wide homozygosity mapping, linkage analyses, targeted mutation analyses, and exome sequencing were performed. Results All subjects from Old-Order Amish communities from Pennsylvania were homozygous for a nonsense mutant DNAH5 allele, c.4348C>T (p.Q1450X). Two affected siblings from an unrelated Mennonite family in Arkansas were homozygous for the same nonsense DNAH5 mutation. Children with PCD from an Amish family from Wisconsin had biallelic DNAH5 mutations, c.4348C>T (p.Q1450X) and c.10815delT (p.P3606HfsX23), and mutations in other genes associated with PCD were also identified in this community. Conclusion The Amish and Mennonite subjects from geographically dispersed and socially isolated communities had the same founder DNAH5 mutation, owing to the common heritage of these populations. However, disease-causing mutations in other PCD-associated genes were also found in affected individuals in these communities, illustrating the genetic heterogeneity in this consanguineous population. PMID:23477994

  5. Detection of Defective Sensors in Phased Array Using Compressed Sensing and Hybrid Genetic Algorithm

    Directory of Open Access Journals (Sweden)

    Shafqat Ullah Khan

    2016-01-01

    Full Text Available A compressed sensing based array diagnosis technique has been presented. This technique starts from collecting the measurements of the far-field pattern. The system linking the difference between the field measured using the healthy reference array and the field radiated by the array under test is solved using a genetic algorithm (GA, parallel coordinate descent (PCD algorithm, and then a hybridized GA with PCD algorithm. These algorithms are applied for fully and partially defective antenna arrays. The simulation results indicate that the proposed hybrid algorithm outperforms in terms of localization of element failure with a small number of measurements. In the proposed algorithm, the slow and early convergence of GA has been avoided by combining it with PCD algorithm. It has been shown that the hybrid GA-PCD algorithm provides an accurate diagnosis of fully and partially defective sensors as compared to GA or PCD alone. Different simulations have been provided to validate the performance of the designed algorithms in diversified scenarios.

  6. The breakdown of the cytokine network subsequent to human immunodeficiency virus infection

    Directory of Open Access Journals (Sweden)

    M. Clerici

    1995-01-01

    Full Text Available The acquired immunodeflciency syndrome (AIDS is a clinically multifaceted disease induced by infection with the human immunodeficiency virus (HIV. HIV infection results in a complex pattern of immunologic alterations that leads to the development of AIDS in the majority of HIV seropositive (HIV+ individuals. The reduction in CD4 T lymphocyte counts is the hallmark of HIV infection; nevertheless, long before the reduction in CD4 counts reaches critical levels, a series of profound and complex defects that impair the function of CD4 T lymphocytes can be detected. Thus, HIV infection is characterized by quantitative and qualitative defects affecting CD4 T lymphocytes. It was suggested recently that programmed cell death (PCD is an important mechanism leading to CD4 depletion in HIV infection, and that susceptibility of peripheral lymphocytes to PCD is differentially regulated by diverse cytokines. Thus, type 1 cytokines would protect CD4 lymphocytes against PCD, whereas type 2 cytokines would not protect against, and could augment, PCD. We suggest that the qualitative alterations of the immune response provoke the CD4 depletion characteristic of HIV disease via type 2 cytokinemediated augmentation of PCD, and are therefore ultimately responsible for the progression of HIV infection. Finally, we summarize recent data showing that three correlates of disease progression: emergence of HIV strains with syncitium-inducing ability (SI, type 1-to-type 2 cytokine shift, and CD4 depletion, are significantly associated, suggesting a complex interconnected virologic-immunologic pathogenesis of HIV infection.

  7. Essential role of grim-led programmed cell death for the establishment of corazonin-producing peptidergic nervous system during embryogenesis and metamorphosis in Drosophila melanogaster

    Directory of Open Access Journals (Sweden)

    Gyunghee Lee

    2013-01-01

    In Drosophila melanogaster, combinatorial activities of four death genes, head involution defective (hid, reaper (rpr, grim, and sickle (skl, have been known to play crucial roles in the developmentally regulated programmed cell death (PCD of various tissues. However, different expression patterns of the death genes also suggest distinct functions played by each. During early metamorphosis, a great number of larval neurons unfit for adult life style are removed by PCD. Among them are eight pairs of corazonin-expressing larval peptidergic neurons in the ventral nerve cord (vCrz. To reveal death genes responsible for the PCD of vCrz neurons, we examined extant and recently available mutations as well as RNA interference that disrupt functions of single or multiple death genes. We found grim as a chief proapoptotic gene and skl and rpr as minor ones. The function of grim is also required for PCD of the mitotic sibling cells of the vCrz neuronal precursors (EW3-sib during embryonic neurogenesis. An intergenic region between grim and rpr, which, it has been suggested, may enhance expression of three death genes in embryonic neuroblasts, appears to play a role for the vCrz PCD, but not for the EW3-sib cell death. The death of vCrz neurons and EW3-sib is triggered by ecdysone and the Notch signaling pathway, respectively, suggesting distinct regulatory mechanisms of grim expression in a cell- and developmental stage-specific manner.

  8. Comparison of image uniformity with photon counting and conventional scintillation single-photon emission computed tomography system: A Monte Carlo simulation study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ho Chul; Lee, Young Jin [Dept. of Radiological Science, Eulji University, Seongnam (Korea, Republic of); Kim, Hee Joung; Kim, Kyuseok; Lee, Min Hee [Yonsei University, Wonju (Korea, Republic of)

    2017-06-15

    To avoid imaging artifacts and interpretation mistakes, an improvement of the uniformity in gamma camera systems is a very important point. We can expect excellent uniformity using cadmium zinc telluride (CZT) photon counting detector (PCD) because of the direct conversion of the gamma rays energy into electrons. In addition, the uniformity performance such as integral uniformity (IU), differential uniformity (DU), scatter fraction (SF), and contrast-to-noise ratio (CNR) varies according to the energy window setting. In this study, we compared a PCD and conventional scintillation detector with respect to the energy windows (5%, 10%, 15%, and 20%) using a {sup 99m}Tc gamma source with a Geant4 Application for Tomography Emission simulation tool. The gamma camera systems used in this work are a CZT PCD and NaI(Tl) conventional scintillation detector with a 1-mm thickness. According to the results, although the IU and DU results were improved with the energy window, the SF and CNR results deteriorated with the energy window. In particular, the uniformity for the PCD was higher than that of the conventional scintillation detector in all cases. In conclusion, our results demonstrated that the uniformity of the CZT PCD was higher than that of the conventional scintillation detector.

  9. Comparison of Image Uniformity with Photon Counting and Conventional Scintillation Single-Photon Emission Computed Tomography System: A Monte Carlo Simulation Study

    Directory of Open Access Journals (Sweden)

    Ho Chul Kim

    2017-06-01

    Full Text Available To avoid imaging artifacts and interpretation mistakes, an improvement of the uniformity in gamma camera systems is a very important point. We can expect excellent uniformity using cadmium zinc telluride (CZT photon counting detector (PCD because of the direct conversion of the gamma rays energy into electrons. In addition, the uniformity performance such as integral uniformity (IU, differential uniformity (DU, scatter fraction (SF, and contrast-to-noise ratio (CNR varies according to the energy window setting. In this study, we compared a PCD and conventional scintillation detector with respect to the energy windows (5%, 10%, 15%, and 20% using a 99mTc gamma source with a Geant4 Application for Tomography Emission simulation tool. The gamma camera systems used in this work are a CZT PCD and NaI(Tl conventional scintillation detector with a 1-mm thickness. According to the results, although the IU and DU results were improved with the energy window, the SF and CNR results deteriorated with the energy window. In particular, the uniformity for the PCD was higher than that of the conventional scintillation detector in all cases. In conclusion, our results demonstrated that the uniformity of the CZT PCD was higher than that of the conventional scintillation detector.

  10. Cobalt alleviates GA-induced programmed cell death in wheat aleurone layers via the regulation of H2O2 production and heme oxygenase-1 expression.

    Science.gov (United States)

    Wu, Mingzhu; Li, Jiale; Wang, Fangquan; Li, Feng; Yang, Jun; Shen, Wenbiao

    2014-11-14

    Heme oxygenase-1 (HO-1) and hydrogen peroxide (H2O2) are key signaling molecules that are produced in response to various environmental stimuli. Here, we demonstrate that cobalt is able to delay gibberellic acid (GA)-induced programmed cell death (PCD) in wheat aleurone layers. A similar response was observed when samples were pretreated with carbon monoxide (CO) or bilirubin (BR), two end-products of HO catalysis. We further observed that increased HO-1 expression played a role in the cobalt-induced alleviation of PCD. The application of HO-1-specific inhibitor, zinc protoporphyrin-IX (ZnPPIX), substantially prevented the increases of HO-1 activity and the alleviation of PCD triggered by cobalt. The stimulation of HO-1 expression, and alleviation of PCD might be caused by the initial H2O2 production induced by cobalt. qRT-PCR and enzymatic assays revealed that cobalt-induced gene expression and the corresponding activities of superoxide dismutase (SOD), catalase (CAT) and ascorbate peroxidase (APX), three enzymes that metabolize reactive oxygen species, were consistent with the H2O2 accumulation during GA treatment. These cobalt responses were differentially blocked by co-treatment with ZnPPIX. We therefore suggest that HO-1 functions in the cobalt-triggered alleviation of PCD in wheat aleurone layers, which is also dependent on the enhancement of the activities of antioxidant enzymes.

  11. CCDC39 is required for assembly of inner dynein arms and the dynein regulatory complex and for normal ciliary motility in humans and dogs

    Science.gov (United States)

    Merveille, Anne-Christine; Davis, Erica E; Becker-Heck, Anita; Legendre, Marie; Amirav, Israel; Bataille, Géraldine; Belmont, John; Beydon, Nicole; Billen, Frédéric; Clément, Annick; Clercx, Cécile; Coste, André; Crosbie, Rachelle; de Blic, Jacques; Deleuze, Stephane; Duquesnoy, Philippe; Escalier, Denise; Escudier, Estelle; Fliegauf, Manfred; Horvath, Judith; Hill, Kent; Jorissen, Mark; Just, Jocelyne; Kispert, Andreas; Lathrop, Mark; Loges, Niki Tomas; Marthin, June K; Momozawa, Yukihide; Montantin, Guy; Nielsen, Kim G; Olbrich, Heike; Papon, Jean-François; Rayet, Isabelle; Roger, Gilles; Schmidts, Miriam; Tenreiro, Henrique; Towbin, Jeffrey A; Zelenika, Diana; Zentgraf, Hanswalter; Georges, Michel; Lequarré, Anne-Sophie; Katsanis, Nicholas; Omran, Heymut; Amselem, Serge

    2012-01-01

    Primary ciliary dyskinesia (PCD) is an inherited disorder characterized by recurrent infections of the upper and lower respiratory tract, reduced fertility in males and situs inversus in about 50% of affected individuals (Kartagener syndrome). It is caused by motility defects in the respiratory cilia that are responsible for airway clearance, the flagella that propel sperm cells and the nodal monocilia that determine left-right asymmetry1. Recessive mutations that cause PCD have been identified in genes encoding components of the outer dynein arms, radial spokes and cytoplasmic pre-assembly factors of axonemal dyneins, but these mutations account for only about 50% of cases of PCD. We exploited the unique properties of dog populations to positionally clone a new PCD gene, CCDC39. We found that loss-of-function mutations in the human ortholog underlie a substantial fraction of PCD cases with axonemal disorganization and abnormal ciliary beating. Functional analyses indicated that CCDC39 localizes to ciliary axonemes and is essential for assembly of inner dynein arms and the dynein regulatory complex. PMID:21131972

  12. Functional Analysis of Plant Defense Suppression and Activation by the Xanthomonas Core Type III Effector XopX.

    Science.gov (United States)

    Stork, William; Kim, Jung-Gun; Mudgett, Mary Beth

    2015-02-01

    Many phytopathogenic type III secretion effector proteins (T3Es) have been shown to target and suppress plant immune signaling but perturbation of the plant immune system by T3Es can also elicit a plant response. XopX is a "core" Xanthomonas T3E that contributes to growth and symptom development during Xanthomonas euvesicatoria infection of tomato but its functional role is undefined. We tested the effect of XopX on several aspects of plant immune signaling. XopX promoted ethylene production and plant cell death (PCD) during X. euvesicatoria infection of susceptible tomato and in transient expression assays in Nicotiana benthamiana, which is consistent with its requirement for the development of X. euvesicatoria-induced disease symptoms. Additionally, although XopX suppressed flagellin-induced reactive oxygen species, it promoted the accumulation of pattern-triggered immunity (PTI) gene transcripts. Surprisingly, XopX coexpression with other PCD elicitors resulted in delayed PCD, suggesting antagonism between XopX-dependent PCD and other PCD pathways. However, we found no evidence that XopX contributed to the suppression of effector-triggered immunity during X. euvesicatoria-tomato interactions, suggesting that XopX's primary virulence role is to modulate PTI. These results highlight the dual role of a core Xanthomonas T3E in simultaneously suppressing and activating plant defense responses.

  13. Impact of proximal cytoplasmic droplets on quality traits and in-vitro embryo production efficiency of cryopreserved bull spermatozoa

    Directory of Open Access Journals (Sweden)

    Carreira Janaina T

    2012-01-01

    Full Text Available Abstract Background Proximal cytoplasmic droplets (PCDs, a remnant of germ cell cytoplasm, are common non-specific morphological defects in bovine semen. This study evaluated the effect of higher percentages of PCDs on the quality of frozen-thawed bovine semen, embryo production and early embryo development. Methods Three ejaculates from each of five (group 1: PCD ≤ 1%, control and eight adult Bos indicus bulls (group 2: PCD ≥ 24% were analysed. Semen samples were examined for: post-thaw motility, vigour of movement, concentration, sperm morphology, slow thermoresistance test (STT, membrane integrity, acrosome status, mitochondrial function using fluorescent probes association (FITC-PSA, PI and JC-1 and sperm chromatin integrity using acridine orange assay. Two bulls from group 2, with 28.5% and 48.5% PCD, respectively, and three bulls from the control group, each with 0% PCD, were selected for IVF (in vitro fertilisation. Results Semen analyses revealed a significant correlation (P Conclusion Higher PCD levels influenced spermatozoa quality traits. IVF and embryo development data showed that cleavage, blastocyst formation and blastocyst hatching may have been influenced by the interaction of morphology traits and individual bull effects.

  14. iTRAQ Mitoproteome Analysis Reveals Mechanisms of Programmed Cell Death in Arabidopsis thaliana Induced by Ochratoxin A

    Directory of Open Access Journals (Sweden)

    Yan Wang

    2017-05-01

    Full Text Available Ochratoxin A (OTA is one of the most common and dangerous mycotoxins in the world. Previous work indicated that OTA could elicit spontaneous HR-like lesions formation Arabidopsis thaliana, reactive oxygen species (ROS play an important role in OTA toxicity, and their major endogenous source is mitochondria. However, there has been no evidence as to whether OTA induces directly PCD in plants until now. In this study, the presence of OTA in Arabidopsis thaliana leaves triggered accelerated respiration, increased production of mitochondrial ROS, the opening of ROS-dependent mitochondrial permeability transition pores and a decrease in mitochondrial membrane potential as well as the release of cytochrome c into the cytosol. There were 42 and 43 significantly differentially expressed proteins identified in response to exposure to OTA for 8 and 24 h, respectively, according to iTRAQ analysis. These proteins were mainly involved in perturbation of the mitochondrial electron transport chain, interfering with ATP synthesis and inducing PCD. Digital gene expression data at transcriptional level was consistent with the cell death induced by OTA being PCD. These results indicated that mitochondrial dysfunction was a prerequisite for OTA-induced PCD and the initiation and execution of PCD via a mitochondrial-mediated pathway.

  15. Programmed Cell Death, Proliferating Cell Nuclear Antigen and p53 Expression in Mouse Colon Mucosa during Diet-Induced Tumorigenesis

    Directory of Open Access Journals (Sweden)

    Mauro Risio

    2000-01-01

    Full Text Available Western‐style diets (WDs trigger and sustain the early phases of tumorigenesis in mouse colon, and when continued throughout the life span lead to the development of dysplastic crypts. In order to evaluate the roles both of cell proliferation and programmed cell death (PCD in WD‐induced tumorigenesis, immunohistochemical detection of proliferating nuclear antigen (PCNA, in situ end labeling (TUNEL of DNA breaks, and p53 protein were carried out in mouse colonic mucosa during prolonged feeding of two WDs. PCNA Labeling Index of colonic crypts was significantly higher in WD‐treated animals than in controls only at the beginning of the nutritional study, the gap rapidly bridged by increased cell proliferation spontaneously occurring in the colonic mucosa during aging. A transient early homeostatic activation of PCD at the base of the crypt also was observed in WD groups. No changes in PCD were seen in the upper third of the crypt or in surface epithelium throughout the study, indicating that PCD in that colonic crypt segment produces a constant flux of cell loss, uninfluenced by homeostatic fluctuations. A major finding was an irreversible, progressive, age‐related decline of PCD at the crypt base in both control and treated animals that occurred during the second half of the rodents  life span. p53 protein was not immunohistochemically detected, suggesting that neither overexpression of wild‐type nor mutated forms of the protein are involved in the above mentioned changes.

  16. Primary ciliary dyskinesia-causing mutations in Amish and Mennonite communities.

    Science.gov (United States)

    Ferkol, Thomas W; Puffenberger, Erik G; Lie, Hauw; Helms, Cynthia; Strauss, Kevin A; Bowcock, Anne; Carson, John L; Hazucha, Milan; Morton, D Holmes; Patel, Anand C; Leigh, Margaret W; Knowles, Michael R; Zariwala, Maimoona A

    2013-08-01

    To determine whether individuals with primary ciliary dyskinesia (PCD) from unrelated Amish and Mennonite families harbor a single and unique founder mutation. Subjects from Amish and Mennonite communities in several states were enrolled in the study. All subjects were clinically characterized, and nasal nitric oxide levels were measured. Nasal epithelial scrapings were collected from several subjects for ciliary ultrastructural analyses. DNA was isolated from patients with PCD and their unaffected first- and second-degree relatives. Genome-wide homozygosity mapping, linkage analyses, targeted mutation analyses, and exome sequencing were performed. All subjects from Old-Order Amish communities from Pennsylvania were homozygous for a nonsense mutant DNAH5 allele, c.4348C>T (p.Q1450X). Two affected siblings from an unrelated Mennonite family in Arkansas were homozygous for the same nonsense DNAH5 mutation. Children with PCD from an Amish family from Wisconsin had biallelic DNAH5 mutations, c.4348C>T (p.Q1450X) and c.10815delT (p.P3606HfsX23), and mutations in other genes associated with PCD were also identified in this community. The Amish and Mennonite subjects from geographically dispersed and socially isolated communities had the same founder DNAH5 mutation, owing to the common heritage of these populations. However, disease-causing mutations in other PCD-associated genes were also found in affected individuals in these communities, illustrating the genetic heterogeneity in this consanguineous population. Copyright © 2013 Mosby, Inc. All rights reserved.

  17. Unified control of DC-DC buck converter using dynamic adaptive controller for battery operated devices

    Directory of Open Access Journals (Sweden)

    Kanimozhi Kannabiran

    2016-01-01

    Full Text Available El objetivo de esta investigación es mejorar la respuesta dinámica del sistema de convertidor DC-DC con incertidumbres en los parámetros internos. La metodología de control por modo deslizante en las obras existentes se basa en un sistema de control proporcional-integral-derivativo (PID. El presente trabajo aborda diversas cuestiones en un enfoque unificado para el diseño y la aplicación de la modulación de ancho de pulso (PWM basado en control digital por modos deslizantes adaptativos (CMD, técnica de control para el controlador buck para los teléfonos móviles que funcionan en modo continuo de conducción (MCC y el modo de conducción discontinua (MCD. El controlador está programado para controlar la ganancia de la condición de carga de salida y cambiar adaptativamente los parámetros de control para dar un rendimiento dinámico óptimo correspondiente a las variaciones de carga. Además, la estabilidad se verifica analíticamente utilizando el criterio de estabilidad de Lyapunov y se prueba que el sistema es global y asintóticamente estable. Finalmente, la eficacia del método propuesto se verifica mediante la simulación y experimentación. Se obtiene una respuesta estable en estado estacionario con ondulación reducida.

  18. Simulación de un algoritmo para controlar el nivel en tolva ante alimentación discontinua de caña

    Directory of Open Access Journals (Sweden)

    Fabricio Garelli

    2009-07-01

    Full Text Available Resumen: Los actuales métodos de control del transporte y preparación de la materia prima provocan graves problemas de discontinuidad en la alimentación al tren de molinos de caña en la industria azucarera en Cuba. La introducción masiva de la tecnología de convertidores de frecuencia para el control de velocidad de motores asincrónicos permite proponer la utilización de la velocidad de las esteras como variable manipulada para el control del nivel de la tolva. Este trabajo presenta una variante de control por velocidad considerando la altura del colchón de caña en la estera elevadora como una perturbación multiplicativa a la entrada de la planta. Se propone un algoritmo de adaptación de set-point por modo deslizante para limitar los transitorios en el nivel de caña en tolva provocados por las fluctuaciones en la alimentación de caña. El método propuesto requiere realimentar únicamente variables accesibles y es robusto ante cambios en la densidad de caña y/o ruido de medición. Su implementación es extremadamente sencilla para lazos de control por velocidad tipo PID. Palabras Clave: molienda de caña de azúcar, estera transportadora, molinos de caña, control PID, control de velocidad, modo deslizante, set-point adaptivo

  19. Microfluidic monitoring of programmed cell death in living plant seed tissue

    DEFF Research Database (Denmark)

    Mark, Christina; Heiskanen, Arto; Zor, Kinga

    Programmed cell death (PCD) is a highly regulated process in which cells are dismantled. Reactive oxygen species (ROS) are involved in PCD in plants, but the relationship between and mechanisms behind ROS and PCD are only poorly understood in plant cells compared to in animal cells (Gechev, Tsanko......, et al., (2006), BioEssays, 28, p. 1091). Microfluidic cell culture enables in vitro experiments to approach in vivo conditions. Combining microfluidics with the Lab-On-a-Chip concept allows implementing a wide range of assays for real-time monitoring of effects in a biological system of factors...... such as concentration of selected compounds, external pH, oxygen consumption, redox state and cell viability. The aleurone layer of the barley seed is a 2-3 single cell type thick tissue that can be dissected from the embryo and starchy endosperm. During incubation in vitro this mechanically very robust maintains...

  20. Roles of autophagy in male reproductive development in plants

    Directory of Open Access Journals (Sweden)

    Shigeru eHanamata

    2014-09-01

    Full Text Available Autophagy, a major catabolic pathway in eukaryotic cells, is essential in development, maintenance of cellular homeostasis, immunity and programmed cell death (PCD in multicellular organisms. In plant cells, autophagy plays roles in recycling of proteins and metabolites including lipids, and is involved in many physiological processes such as abiotic and biotic stress responses. However, its roles during reproductive development had remained poorly understood. Quantitative live cell imaging techniques for the autophagic flux and genetic studies in several plant species have recently revealed significant roles of autophagy in developmental processes, regulation of PCD and lipid metabolism. We here review the novel roles of autophagic fluxes in plant cells, and discuss their possible significance in PCD and metabolic regulation, with particular focus on male reproductive development during the pollen maturation.

  1. Expression of the Arabidopsis high-affinity hexose transporter STP13 correlates with programmed cell death

    DEFF Research Database (Denmark)

    Nørholm, Morten Helge Hauberg; Nour-Eldin, Hussam H; Brodersen, Peter

    2006-01-01

    We report the biochemical characterization in Xenopus oocytes of the Arabidopsis thaliana membrane protein, STP13, as a high affinity, hexose-specific H(+)-symporter. Studies with kinase activators suggest that it is negatively regulated by phosphorylation. STP13 promoter GFP reporter lines show ......13 in PCD is supported by microarray data from e.g. plants undergoing senescence and a strong correlation between STP13 transcripts and the PCD phenotype in different accelerated cell death (acd11) mutants....... GFP expression only in the vascular tissue in emerging petals under non-stressed conditions. Quantitative PCR and the pSTP13-GFP plants show induction of STP13 in programmed cell death (PCD) obtained by treatments with the fungal toxin fumonisin B1 and the pathogen Pseudomonas syringae. A role for STP...

  2. Autophagic components contribute to hypersensitive cell death in Arabidopsis

    DEFF Research Database (Denmark)

    Hofius, Daniel; Schultz-Larsen, Torsten; Joensen, Jan

    2009-01-01

    expression. Here, we examined receptor-mediated HR PCD responses in autophagy-deficient Arabidopsis knockout mutants (atg), and show that infection-induced lesions are contained in atg mutants. We also provide evidence that HR cell death initiated via Toll/Interleukin-1 (TIR)-type immune receptors through...... the defense regulator EDS1 is suppressed in atg mutants. Furthermore, we demonstrate that PCD triggered by coiled-coil (CC)-type immune receptors via NDR1 is either autophagy-independent or engages autophagic components with cathepsins and other unidentified cell death mediators. Thus, autophagic cell death......Autophagy has been implicated as a prosurvival mechanism to restrict programmed cell death (PCD) associated with the pathogen-triggered hypersensitive response (HR) during plant innate immunity. This model is based on the observation that HR lesions spread in plants with reduced autophagy gene...

  3. A novel approach for studying programmed cell death in living plant tissues

    DEFF Research Database (Denmark)

    Mark, Christina

    death of the endosperm. The barley aleurone layer is a generally accepted model system for studying phytohormone signalling, enzyme secretion, and PCD during seed germination. However, two main issues affect PCD-related research in the barley aleurone layer: Firstly, the current knowledge about ROS...... that each analysis is performed on a different pool of samples, as each tissue sample or population of cells can only be analysed at a single time point. This is of great importance for studies of time-dependent processes such as PCD, as time course experiments can be affected by biological and experimental...... diversity between independent samples, which could distort the interpretation of the results. Time course experiments on the same tissue or population of cells can be enabled by the use of assays that do not destroy cellular integrity, which could also facilitate the combination of multiple assays. However...

  4. Choice of nasal nitric oxide technique as first-line test for primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Marthin, J K; Nielsen, K G

    2011-01-01

    . 282 subjects, 117 consecutive referrals, 59 PCDs, 49 CF patients and 57 healthy subjects, were included. All methods separated significantly between PCD and non-PCD, including CF with reliability, in ranking order BH-nNO>OE-R-nNO>TB-nNO. Acceptability in children ranked in reverse order. A problematic...... high fraction (39%) of false positive TB-nNO was found in young children. An unexpected large fraction (6.8%) of PCDs had nNO values above cut-off. nNO is a helpful first-line tool in real-life PCD work-up in all age groups if the sampling method is chosen according to age. nNO can be misleading...

  5. Changes of Respiration Activities in Cells of Winter Wheat and Sugar Cane Suspension Cultures During Programmed Cell Death Process

    Directory of Open Access Journals (Sweden)

    I.V. Lyubushkina

    2015-09-01

    Full Text Available Process of cell death in suspension cultures of winter wheat and sugar cane under high (50 °С and negative (-8 °С temperature treatment has been studied. It has been shown, that programmed cell death (PCD process caused by the negative temperature in the culture of winter wheat was noted for slow rate of realization and it was carried out for 10 days. It has been state that rate of cell respiration was significantly higher than in the control culture. At the same time PCD processes induced by the high temperature in the culture of sugar cane and winter wheat and by the negative temperature in the culture of sugar cane realized for 24-48 h and was accompanied by graduate decrease of respiration activities. We can conclude that the main reason of PCD processes realization differences was a different level of respiration metabolism resistance to high and negative temperatures action.

  6. Lower extremity compartment syndrome in the setting of iliofemoral deep vein thrombosis, phlegmasia cerulea dolens and factor VII deficiency.

    Science.gov (United States)

    Abdul, Wahid; Hickey, Ben; Wilson, Chris

    2016-04-25

    Acute compartment syndrome requires urgent fasciotomies to prevent irreversible muscle damage. We present a case of massive iliofemoral deep vein thrombosis (DVT) presenting as acute compartment syndrome. A healthy 21-year-old man presented with a 2-day history of worsening left leg pain with swelling and bluish discolouration. Clinical diagnosis of compartment syndrome secondary to phlegmasia cerulea dolens (PCD) was made and he underwent emergency fasciotomies. Postoperative venous duplex confirmed a massive iliofemoral DVT and intravenous heparin was started. Following skin grafting, the patient made a good recovery. Massive iliofemoral DVT is an uncommon cause of compartment syndrome and has been reported in lower limbs, secondary to PCD. Failure to treat early carries a high degree of morbidity, with amputation rates up to 50% and mortality rates between 25% and 40%. It is important to recognise compartment syndrome as an acute presentation of PCD. Urgent fasciotomies can prevent limb amputation and mortality. 2016 BMJ Publishing Group Ltd.

  7. On the intrinsic disorder status of the major players in programmed cell death pathways [v1; ref status: indexed, http://f1000r.es/1me

    Directory of Open Access Journals (Sweden)

    Alexey V Uversky

    2013-09-01

    Full Text Available Earlier computational and bioinformatics analysis of several large protein datasets across 28 species showed that proteins involved in regulation and execution of programmed cell death (PCD possess substantial amounts of intrinsic disorder. Based on the comprehensive analysis of these datasets by a wide array of modern bioinformatics tools it was concluded that disordered regions of PCD-related proteins are involved in a multitude of biological functions and interactions with various partners, possess numerous posttranslational modification sites, and have specific evolutionary patterns (Peng et al. 2013. This study extends our previous work by providing information on the intrinsic disorder status of some of the major players of the three major PCD pathways: apoptosis, autophagy, and necroptosis. We also present a detailed description of the disorder status and interactomes of selected proteins that are involved in the p53-mediated apoptotic signaling pathways.

  8. Primary ciliary dyskinesia: clinical and genetic aspects

    Directory of Open Access Journals (Sweden)

    E. D’Auria

    2012-06-01

    Full Text Available Primary ciliary dyskinesia (PCD is a rare, genetically heterogeneous disease, characterized by ciliary disfunction and impaired mucociliary clearance, resulting in a range of clinical manifestations such as chronic bronchitis, bronchiectasis, chronic rhino-sinusitis, chronic otitis media, situs viscerum inversus in almost 40-50% of cases and male infertility. The triad situs viscerum inversus, bronchiectasis and sinusitis is known as Kartagener syndrome. Up to now little is known about genetic, diagnostic and therapeutic aspects of primary motile ciliary diseases in children: for this reason, diagnosis is generally delayed and almost all treatments for PCD are not based on randomized studies but extrapolated from cystic fibrosis guidelines. The aim of this review is to propose to pediatricians a summary of current clinical and diagnostic evidence to obtain better knoledwge of this condition. The earlier diagnosis and the right treatment are both crucial to improve the prognosis of PCD.

  9. Monitoring programmed cell death of living plant tissues in microfluidics using electrochemical and optical techniques

    DEFF Research Database (Denmark)

    Mark, Christina; Heiskanen, Arto; Svensson, Birte

    for online, real-time, parallel analysis of important parameters such as redox activity (NADPH:NADP ratio), H2O2 concentration, oxygen consumption, extracellular pH, cell viability and release of target enzymes (α-amylase and limit dextrinase). Probing the intracellular redox activity is of major importance......, since it is known that reactive oxygen species, which are affected by changes in the redox activity of the cells3, are involved in PCD in plants, but the relationship between and mechanisms behind ROS and PCD is only poorly understood in plant cells4. Recently, it has been shown, using optical detection......Programmed cell death (PCD) in plants can influence the outcome of yield and quality of crops through its important role in seed germination and the defence process against pathogens. The main scope of the project is to apply microfluidic cell culture for the measurement of electrochemically...

  10. Can plant oncogenes inhibit programmed cell death? The rolB oncogene reduces apoptosis-like symptoms in transformed plant cells.

    Science.gov (United States)

    Gorpenchenko, Tatiana Y; Aminin, Dmitry L; Vereshchagina, Yuliya V; Shkryl, Yuri N; Veremeichik, Galina N; Tchernoded, Galina K; Bulgakov, Victor P

    2012-09-01

    The rolB oncogene was previously identified as an important player in ROS metabolism in transformed plant cells. Numerous reports indicate a crucial role for animal oncogenes in apoptotic cell death. Whether plant oncogenes such as rolB can induce programmed cell death (PCD) in transformed plant cells is of particular importance. In this investigation, we used a single-cell assay based on confocal microscopy and fluorescent dyes capable of discriminating between apoptotic and necrotic cells. Our results indicate that the expression of rolB in plant cells was sufficient to decrease the proportion of apoptotic cells in steady-state conditions and diminish the rate of apoptotic cells during induced PCD. These data suggest that plant oncogenes, like animal oncogenes, may be involved in the processes mediating PCD.

  11. Sinus bacteriology in patients with cystic fibrosis or primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Møller, Maria E.; Alanin, Mikkel C.; Grønhøj, Christian

    2017-01-01

    , and microbiology analyses from the nose or paranasal sinuses.  Results: We included 46 studies (1823 patients) from 16 countries. Staphylococcus aureus was found in 30% of the noses and sinuses of patients with CF. Other common bacteria found included Pseudomonas aeruginosa, coagulase negative staphylococci......, and Haemophilus influenzae. In PCD, H. influenzae was the most common bacteria (28%), followed by Streptococcus pneumoniae and P. aeruginosa. If studies that included nonsurgical swab and blowing samples were excluded, then P. aeruginosa was the most common bacterium in patients with CF (34%) and in patients...... with PCD (50%), followed by S. aureus and H. influenza.  Conclusion: S. aureus, P. aeruginosa, coagulase negative staphylococci, and H. influenzae dominated in the upper airways of patients with CF. In patients with PCD, H. influenzae, S. pneumoniae, and P. aeruginosa dominated. When studies that included...

  12. Phlegmasia Caerulea Dolens in a Patient With an Inferior Vena Cava Filter: Treatment of Massive Iliocaval Thrombosis Using Local Intravenous Catheter-Directed Thrombolysis

    Energy Technology Data Exchange (ETDEWEB)

    Cookson, Daniel, E-mail: danielthomascookson@yahoo.co.uk [Middlemore Hospital, Department of Radiology (New Zealand); Caldwell, Stuart, E-mail: stuart.caldwell@middlemore.co.nz [Middlemore Hospital, Department of Vascular Surgery (New Zealand)

    2012-10-15

    Phlegmasia caerulea dolens (PCD) is a potentially disastrous complication of inferior vena cava filter insertion, and its optimum management has not been clearly established. We present a case report of a patient with pulmonary embolism and acute adrenal haemorrhage who developed PCD secondary to massive iliocaval thrombosis after insertion of a Cook Celect removable filter. Local intravenous catheter-directed thrombolysis (CDT), followed by systemic anticoagulation, achieved limb salvage and virtual resolution of symptoms at 3 months without complications. CDT can be a successful primary treatment of filter-associated PCD and can be safe in selected patients with acute nontraumatic haemorrhage. Systemic anticoagulation may subsequently restore complete venous patency and may therefore be a useful approach to postthrombolysis management of residual iliocaval thrombus when filter removal is indicated.

  13. Ceramide participates in lysosome-mediated cell death induced by type II anti-CD20 monoclonal antibodies.

    Science.gov (United States)

    Liu, Yuzhi; Shu, Ling; Wu, Jingjing

    2015-06-01

    Considering the variable and often modest therapeutic efficacy of rituximab for a substantial proportion of patients suffering from non-Hodgkin lymphomas (NHLs), various type II anti-CD20 monoclonal antibodies (mAbs) with excellent ability in inducing programmed cell death (PCD) are currently being developed for their enhanced therapeutic index. Although homotypic adhesion (HA) and lysosome leakage are proven to be of vital importance in type II mAb-induced PCD in NHL cells, the detailed relationship between them remains unclear. Herein, for the first time we discovered that improved intracellular ceramide level is an important mediator between HA and lysosome leakage in tositumomab-induced cell death. Further experimental results revealed that the generation of intracellular ceramide acts as the outcome of HA and major cause of lysosome leakage. The clarification of ceramide involvement in type II anti-CD20 mAb-induced PCD may provide new ideas on CD20-based immunotherapy against NHLs.

  14. Monitoring programmed cell death of living plant tissues in microfluidics using electrochemical and optical techniques

    DEFF Research Database (Denmark)

    Mark, Christina; Heiskanen, Arto; Svensson, Birte

    for online, real-time, parallel analysis of important parameters such as redox activity (NADPH:NADP ratio), H2O2 concentration, oxygen consumption, extracellular pH, cell viability and release of target enzymes (α-amylase and limit dextrinase). Probing the intracellular redox activity is of major importance...... or optically detectable events during PCD in barley aleurone layer, a cell model for living plant tissues, for a better understanding of the underlying mechanisms of PCD in plants. Microfluidic cell culture enables in vitro experiments to approach in vivo conditions. The major advantage of electrochemical......, that the H2O2 concentration changes depending on phytohormone activation or inactivation of aleurone layer metabolism and subsequent PCD3. Currently, we are working on the optimization of an intracellular whole-cell redox activity (NADP:NADPH ratio) assay5 to be able to detect possible changes...

  15. Experimental Design for a Sponge-Wipe Study to Relate the Recovery Efficiency and False Negative Rate to the Concentration of a Bacillus anthracis Surrogate for Six Surface Materials

    Energy Technology Data Exchange (ETDEWEB)

    Piepel, Gregory F. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Amidan, Brett G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Krauter, Paula [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Einfeld, Wayne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2010-12-16

    Two concerns were raised by the Government Accountability Office following the 2001 building contaminations via letters containing Bacillus anthracis (BA). These included the: 1) lack of validated sampling methods, and 2) need to use statistical sampling to quantify the confidence of no contamination when all samples have negative results. Critical to addressing these concerns is quantifying the probability of correct detection (PCD) (or equivalently the false negative rate FNR = 1 - PCD). The PCD/FNR may depend on the 1) method of contaminant deposition, 2) surface concentration of the contaminant, 3) surface material being sampled, 4) sample collection method, 5) sample storage/transportation conditions, 6) sample processing method, and 7) sample analytical method. A review of the literature found 17 laboratory studies that focused on swab, wipe, or vacuum samples collected from a variety of surface materials contaminated by BA or a surrogate, and used culture methods to determine the surface contaminant concentration. These studies quantified performance of the sampling and analysis methods in terms of recovery efficiency (RE) and not PCD/FNR (which left a major gap in available information). Quantifying the PCD/FNR under a variety of conditions is a key aspect of validating sample and analysis methods, and also for calculating the confidence in characterization or clearance decisions based on a statistical sampling plan. A laboratory study was planned to partially fill the gap in PCD/FNR results. This report documents the experimental design developed by Pacific Northwest National Laboratory and Sandia National Laboratories (SNL) for a sponge-wipe method. The study will investigate the effects on key response variables from six surface materials contaminated with eight surface concentrations of a BA surrogate (Bacillus atrophaeus). The key response variables include measures of the contamination on test coupons of surface materials tested, contamination

  16. Programmed cell death and cell extrusion in rat duodenum

    DEFF Research Database (Denmark)

    Schauser, Kirsten; Larsson, Lars-Inge

    2005-01-01

    The small intestinal epithelium is continously renewed through a balance between cell division and cell loss. How this balance is achieved is uncertain. Thus, it is unknown to what extent programmed cell death (PCD) contributes to intestinal epithelial cell loss. We have used a battery...... of techniques detecting the events associated with PCD in order to better understand its role in the turnover of the intestinal epithelium, including modified double- and triple-staining techniques for simultaneously detecting multiple markers of PCD in individual cells. Only a partial correlation between TUNEL...... positivity for DNA fragmentation, c-jun phosphorylation on serine-63, positivity for activated caspase-3 and apoptotic morphology was observed. Our results show that DNA fragmentation does not invariable correlate to activation of caspase-3. Moreover, many cells were found to activate caspase-3 early...

  17. Apoptosis in Trypanosomatids: Evolutionary and phylogenetic considerations

    Directory of Open Access Journals (Sweden)

    Marcello A. Barcinski

    1998-03-01

    Full Text Available Programmed cell death (PCD or apoptosis, an active process of cell death, plays a central role in normal tissue development and organogenesis, as well as in the pathogenesis of different diseases. Although it occurs in diverse cells and tissues under the influence of a remarkable variety of inducing agents, the resultant ultrastructural and biochemical changes are extremely monotonous, indicating the existence of a common biological mechanism underlying its occurrence. It is generally accepted that a developmental program leading to cell death cannot be advantageous to unicellular organisms and that PCD appeared in evolution to fulfill the organizational needs of multicellular life. However, the recent description of apoptotic death occurring in three different species of pathogenic kinetoplastids suggests that the evolutionary origin of PCD precedes the appearence of multicellular organisms. The present study proposes that a population of pathogenic Trypanosomatids is socially organized and that PCD is a prerequisite for this organization and for the fulfillment of the demands of a heteroxenic lifestyle. This proposal includes possible roles for PCD in the development of the parasite in the insect vector and/or in its mammalian host and suggests experimental strategies to localize the evolutionary origin of PCD within the kinetoplastids.A morte celular programada (PCD ou apoptose, um processo ativo de morte celular, desempenha um papel fundamental no desenvolvimento tecidual normal e na organogênese, assim como na patogênese de diferentes doenças. Embora este processo ocorra em uma gama variada de diferentes células e tecidos, sob a influência dos mais diversos agentes indutores, a resultante morfológica e bioquímica do processo é extremamente monótona, sugerindo que um mecanismo único opere em todas as situações. Era consensualmente aceito que um programa de morte programada não poderia ser vantajoso para organismos unicelulares e

  18. The impact of Primary Ciliary Dyskinesia on the upper respiratory tract.

    Science.gov (United States)

    Morgan, Lucy C; Birman, Catherine S

    2016-03-01

    Primary Ciliary Dyskinesia (PCD) is an autosomal recessive genetic condition affecting the function of motile cilia. The upper respiratory tract is lined with ciliated epithelium and hence a hallmark of PCD is the development, from the neonatal period onwards, of persisting secretion retention and suppurative infection in the middle ear, nose and facial sinuses [1]. This review aims to remind the clinician involved in the care of a patient with PCD of the complexities of making the diagnosis of chronic rhinosinusitis (CRS) and chronic otitis media with effusion (ChOME), the morbidity associated with CRS and ChOME and of current evidence of best practice for the management of these conditions. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

  19. Lanthanide-integrated supramolecular polymeric nanoassembly with multiple regulation characteristics for multidrug-resistant cancer therapy.

    Science.gov (United States)

    Jin, Weihong; Wang, Qiwen; Wu, Min; Li, Yang; Tang, Guping; Ping, Yuan; Chu, Paul K

    2017-06-01

    Cancer treatment can in principle be enhanced by the synergistic effects of chemo- and nucleic acid-based combination therapies but the lack of efficient drug nanocarriers and occurrence of multidrug resistance (MDR) are major obstacles adversely affecting the effectiveness. Herein, a lanthanide-integrated supramolecular polymeric nanoassembly that delivers anticancer drugs and siRNA for more effective cancer therapy is described. This nanotherapeutic system is prepared by loading adamantane-modified doxorubicin (Dox) into polyethylenimine-crosslinked-γ-cyclodextrin (PC) through the supramolecular assembly to form the interior Dox-loaded PC (PCD) followed by electrostatically driven self-assembly of siRNA and PCD to produce the PCD/siRNA nanocomplexes. The PCD/siRNA nanocomplex is further decorated with the exterior neodymium (Nd)-integrated PC (Nd-PC) layer to obtain the PCD/siRNA/Nd-PC nanoassembly in which the interior PC serves as an efficient carrier for simultaneous delivery of Dox and siRNA to the human breast cancer cell line, Dox-resistant MCF-7 (MCF-7/ADR) both in vitro and in vivo. The exterior Nd-PC layer improves the drug sensitivity to the MCF-7/ADR cells as a result of the improved nanoassembly uptake, reduced drug efflux, and enhanced apoptosis, as evidenced by multiple regulation of a series of intracellular proteins related to MDR. Furthermore, in vivo delivery of the PCD/siRNA/Nd-PC nanoassembly is demonstrated to inhibit tumor growth in the mouse model with MCF-7/ADR tumor xenografts as a result of reduced angiogenesis and increased necrosis at the tumor site. This study reveals a simple and universal strategy to transform polymer-based nanoassemblies into advanced organic-inorganic nanotherapeutics suitable for cancer MDR therapy. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. An effective combination of sanger and next generation sequencing in diagnostics of primary ciliary dyskinesia.

    Science.gov (United States)

    Djakow, Jana; Kramná, Lenka; Dušátková, Lenka; Uhlík, Jiří; Pursiheimo, Juha-Pekka; Svobodová, Tamara; Pohunek, Petr; Cinek, Ondřej

    2016-05-01

    Primary ciliary dyskinesia (PCD) is a multigenic autosomal recessive condition affecting respiratory tract and other organs where ciliary motility is required. The extent of its genetic heterogeneity is remarkable. The aim of the study was to develop a cost-effective pipeline for genetic diagnostics using a combination of Sanger and next generation sequencing (NGS). Data and samples of 33 families with 38 affected subjects with PCD diagnosed in childhood were collected over the territory of the Czech Republic. A panel of 18 PCD causative or candidate genes was implemented into an Illumina TruSeq Custom Amplicon NGS assay, and three ancestral mutations in SPAG1 were screened by conventional Sanger sequencing, which was also used for the confirmation of the NGS results and for the analysis of familial segregation. The causative gene was DNAH5 in 11/33 (33%) probands, SPAG1 in 8/33 (24%), and DNAI1, CCDC40, LRRC6 in one family each. If the high proportion of subjects with bi-allelic ancestral mutations in SPAG1 is corroborated in other Caucasian populations, a simple Sanger sequencing test for these three mutations may serve as an effective pre-screening step, being followed by an NGS panel for other, much larger, PCD genes. We present a combination of Sanger sequencing with an NGS panel for known and candidate PCD genes, implemented in a moderate-size national collection of patients. This strategy has proven to be cost-effective, rapid and reliable, and was able to detect the causative gene in two thirds of our PCD patients. © 2015 Wiley Periodicals, Inc.

  1. A role for programmed cell death in the microbial loop.

    Directory of Open Access Journals (Sweden)

    Mónica V Orellana

    Full Text Available The microbial loop is the conventional model by which nutrients and minerals are recycled in aquatic eco-systems. Biochemical pathways in different organisms become metabolically inter-connected such that nutrients are utilized, processed, released and re-utilized by others. The result is that unrelated individuals end up impacting each others' fitness directly through their metabolic activities. This study focused on the impact of programmed cell death (PCD on a population's growth as well as its role in the exchange of carbon between two naturally co-occurring halophilic organisms. Flow cytometric, biochemical, ¹⁴C radioisotope tracing assays, and global transcriptomic analyses show that organic algal photosynthate released by Dunalliela salina cells undergoing PCD complements the nutritional needs of other non-PCD D. salina cells. This occurs in vitro in a carbon limited environment and enhances the growth of the population. In addition, a co-occurring heterotroph Halobacterium salinarum re-mineralizes the carbon providing elemental nutrients for the mixoheterotrophic chlorophyte. The significance of this is uncertain and the archaeon can also subsist entirely on the lysate of apoptotic algae. PCD is now well established in unicellular organisms; however its ecological relevance has been difficult to decipher. In this study we found that PCD in D. salina causes the release of organic nutrients such as glycerol, which can be used by others in the population as well as a co-occurring halophilic archaeon. H. salinarum also re-mineralizes the dissolved material promoting algal growth. PCD in D. salina was the mechanism for the flow of dissolved photosynthate between unrelated organisms. Ironically, programmed death plays a central role in an organism's own population growth and in the exchange of nutrients in the microbial loop.

  2. Liver Abscesses: Factors That Influence Outcome of Percutaneous Drainage.

    Science.gov (United States)

    Haider, Steffen J; Tarulli, Massimo; McNulty, Nancy J; Hoffer, Eric K

    2017-07-01

    The purpose of this study was to identify the details of percutaneous catheter drainage (PCD) of pyogenic liver abscesses, the etiologic factors, and the management techniques that contribute to successful treatment. The records of 75 consecutively registered patients who underwent PCD of 96 abscesses at a single institution between May 2009 and May 2014 were retrospectively reviewed. Thirty-nine patients (52%) were oncology patients, and 36 (48%) had recently undergone abdominal surgery. Primary success was defined as abscess healing with the primary PCD intervention and 30-day postdrainage survival. Salvage success was defined as abscess healing with follow-up secondary PCD placement for symptomatic hepatic satellite collections or for clinical recurrence. Catheter adjustments were performed during follow-up to optimize existing drains. Univariate, multivariate, and general linear mixed model analyses were performed. The median follow-up time after catheter removal was 6 months (range, 2-62 months). Drains were primarily successful in 54 patients (72%), and 17 patients (23%) needed salvage PCD; thus, overall success was achieved in 71 patients (95%). The other four patients (5%) died of sepsis. The primary success rate was reduced in patients with unresectable malignancies (p = 0.01), multiple abscesses (p = 0.01), and output ≥ 15 mL/d at catheter endpoint (n = 7, p = 0.001). Only unresectable malignancies had slightly lower overall success. Large abscesses (> 150 cm(3)) required more catheter adjustments and longer drainage duration to reach abscess cavity closure. Successfully drained abscesses reached cavity closure a mean of 23 days (95% CI, 20-27 days) after treatment. PCD was effective first-line treatment of complicated pyogenic liver abscesses, which often require catheter adjustment and salvage drainage procedures to reliably achieve success.

  3. Análisis de dos variables en la recuperación de información con humanos adultos jóvenes

    Directory of Open Access Journals (Sweden)

    Bruce Overmier

    2007-07-01

    Full Text Available Se examinó el efecto de dos variables en la recuperación de información: el intervalo de retención (IR y el Procedimiento de Consecuencias Diferenciales (PCD en una tarea de discriminación inversa en humanos adultos jóvenes, en tres experimentos. En el primero, se estudió el efecto de un IR de 48h. En el segundo experimento, se examinó el efecto del PCD en las dos fases de una discriminación inversa. En un tercer experimento, se investigó el efecto conjunto de un IR de 48h y del PCD en las fases de adquisición e inversión. En el experimento 1 los resultados muestran la recuperación espontánea después de un IR de 48h. En el experimento 2, se mostró que el PCD no tiene efectos en las dos fases de una tarea de discriminación inversa. En el experimento 3, se observó una interacción entre el IR y el PCD. Se sugiere que el PCD genera expectativas acerca del reforzador que funcionan como señales en interacción con el IR para producir una mayor o menor recuperación de la información. Palabras clave: discriminación inversa, consecuencias diferenciales, recuperación de información, intervalo de retención, igualación a la muestra

  4. Crosstalks between myo-inositol metabolism, programmed cell death and basal immunity in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Ping Hong Meng

    Full Text Available BACKGROUND: Although it is a crucial cellular process required for both normal development and to face stress conditions, the control of programmed cell death in plants is not fully understood. We previously reported the isolation of ATXR5 and ATXR6, two PCNA-binding proteins that could be involved in the regulation of cell cycle or cell death. A yeast two-hybrid screen using ATXR5 as bait captured AtIPS1, an enzyme which catalyses the committed step of myo-inositol (MI biosynthesis. atips1 mutants form spontaneous lesions on leaves, raising the possibility that MI metabolism may play a role in the control of PCD in plants. In this work, we have characterised atips1 mutants to gain insight regarding the role of MI in PCD regulation. METHODOLOGY/PRINCIPAL FINDINGS: - lesion formation in atips1 mutants depends of light intensity, is due to PCD as evidenced by TUNEL labelling of nuclei, and is regulated by phytohormones such as salicylic acid - MI and galactinol are the only metabolites whose accumulation is significantly reduced in the mutant, and supplementation of the mutant with these compounds is sufficient to prevent PCD - the transcriptome profile of the mutant is extremely similar to that of lesion mimic mutants such as cpr5, or wild-type plants infected with pathogens. CONCLUSION/SIGNIFICANCE: Taken together, our results provide strong evidence for the role of MI or MI derivatives in the regulation of PCD. Interestingly, there are three isoforms of IPS in Arabidopsis, but AtIPS1 is the only one harbouring a nuclear localisation sequence, suggesting that nuclear pools of MI may play a specific role in PCD regulation and opening new research prospects regarding the role of MI in the prevention of tumorigenesis. Nevertheless, the significance of the interaction between AtIPS1 and ATXR5 remains to be established.

  5. Standard versus rapid food reintroduction after exclusive enteral nutritional therapy in paediatric Crohn's disease.

    Science.gov (United States)

    Faiman, Abi; Mutalib, Mohamed; Moylan, Alexander; Morgan, Natalie; Crespi, Daniel; Furman, Mark; Kader, Ajmal

    2014-03-01

    In paediatric Crohn's disease (PCD), 6-8 weeks of exclusive enteral nutrition (EEN) is effective in 60-80% cases. EEN is followed by gradual food reintroduction over variable (1-5 weeks) periods. Currently, there is no recommended duration or method for food reintroduction. The rationale for slow reintroduction is unclear and may be because of concerns about food intolerance or to maintain longer remission. The aims of this study were as follows: to compare relapse rates following standard and rapid reintroduction of food after EEN in PCD and to determine the duration of maintained remission in two groups of PCD patients. Two groups with PCD were compared: group A received standard food reintroduction over 5 weeks and group B received rapid reintroduction over 3 days. Data were collected over two consecutive time periods: group A (2005-2009) and group B (2009-2011). Only patients with a new diagnosis of PCD were included. Those with strictures and those on steroids or biologicals during EEN were excluded. The minimum duration of follow-up was 1 year. Group A included 20 patients and group B included 19 patients. In these groups, EEN led to clinical remission in 80% of the patients in group A and in 76% of the patients in group B. At 6 months, one-third of the patients from each group had developed relapse and a year after EEN, 50% of the patients in group A and 47% of the patients in group B developed relapse. Time to first relapse was 188 days (group A) and 136 days (group B). None of these results were statistically significant. In PCD, rapid food reintroduction following 6-week EEN is safe and equally effective as longer food reintroduction. We propose that a rapid food reintroduction schedule be recommended as the most tolerable approach for food reintroduction. Relapse rate and duration of remission are uninfluenced by the type of food reintroduction.

  6. Transcranial Cavitation Detection in Primates during Blood-Brain Barrier Opening – A Performance Assessment Study

    Science.gov (United States)

    Wu, Shih-Ying; Tung, Yao-Sheng; Marquet, Fabrice; Downs, Matthew Eric; Sanchez, Carlos Sierra; Chen, Cherry Chen; Ferrera, Vincent

    2014-01-01

    Focused ultrasound (FUS) has been shown promise in treating the brain locally and noninvasively. Transcranial passive cavitation detection (PCD) provides methodology of monitoring the treatment in real time, while the skull effects remain a major challenge for its translation to the clinic. In this study, we investigated the sensitivity, reliability, and limitations of PCD through primate (macaque and human) skulls in vitro. The results were further correlated with the in vivo macaque studies including the transcranial PCD calibration and real-time monitoring of BBB opening, with magnetic resonance imaging assessing the opening and safety. The stable cavitation doses using harmonics (SCDh) and ultraharmonics (SCDu), the inertial cavitation dose (ICD), and the cavitation signal-to-noise ratio (SNR) were quantified based on the PCD signals. Results showed that through the macaque skull the pressure threshold for detecting the SCDh remained the same as without the skull in place, while it increased for the SCDu and ICD; through the human skull, it increased for all cavitation doses. The transcranial PCD was found reliable both in vitro and in vivo when the transcranial cavitation SNR exceeded the 1-dB detection limit through the in vitro macaque (attenuation: 4.92 dB/mm) and human (attenuation: 7.33 dB/mm) skull. In addition, using long pulses enabled reliable PCD monitoring and facilitate BBB opening at low pressures. The in vivo results showed that the SCDh became detectable at pressures as low as 100 kPa; the ICD, at 250 kPa while it could occur at lower pressures; the SCDu, at 700 kPa and was less reliable at lower pressures. Real-time monitoring of PCD was further implemented during BBB opening, with successful and safe opening achieved at 250–600 kPa in both the thalamus and the putamen. In conclusion, this study shows that transcranial PCD in macaques in vitro and in vivo as well as humans in vitro is reliable by improving the cavitation SNR beyond the 1-d

  7. Modeled microgravity inhibits apoptosis in peripheral blood lymphocytes

    Science.gov (United States)

    Risin, D.; Pellis, N. R.; McIntire, L. V. (Principal Investigator)

    2001-01-01

    Microgravity interferes with numerous lymphocyte functions (expression of cell surface molecules, locomotion, polyclonal and antigen-specific activation, and the protein kinase C activity in signal transduction). The latter suggests that gravity may also affect programmed cell death (PCD) in lymphocyte populations. To test this hypothesis, we investigated spontaneous, activation- and radiation-induced PCD in peripheral blood mononuclear cells exposed to modeled microgravity (MMG) using a rotating cell culture system. The results showed significant inhibition of radiation- and activation-induced apoptosis in MMG and provide insights into the potential mechanisms of this phenomenon.

  8. AcEST: BP915496 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_C11 484 Adiantum capillus-veneris mRNA. clone: YMU001_000072_C11. BP9...llus-veneris mRNA. clone: YMU001_000072_C11. Accession BP915496 Tissue type prothallium Developmental stage ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9...jct: 87 IPNLNPARAAGLPGNCGVSVPYPISTSTDCSK 118 >tr|Q2PCD9|Q2PCD9_WHEAT Non-specific lipid-transfer protein OS=

  9. Biomechanical Effects of Bonding Pericervical Dentin in Maxillary Premolars.

    Science.gov (United States)

    Huynh, Nghia; Li, Fang-Chi; Friedman, Shimon; Kishen, Anil

    2018-02-16

    Pericervical dentin (PCD) loss may increase root fracture propensity in root-filled teeth. This study evaluated the impacts of bonding PCD with composite resin (CR) on radicular microstrain distribution and load at failure of root-filled maxillary premolars. Ten single-canal maxillary premolars decoronated 2 mm coronal to the cementoenamel junction (CEJ) had canals enlarged with ProTaper Universal instruments (Dentsply Tulsa Dental Specialties, Tulsa, OK) to F3. They were root filled with gutta-percha (GP) to the CEJ and restored with Cavit (3M Deutschland GmbH, Neuss, Germany) (GP group, n = 5) or 6 mm apical to the CEJ and restored with bonded CR to simulate bonding of PCD (bonded PCD group, n = 5). Digital moiré interferometry was used to evaluate pre- and postoperative whole-field microstrain distribution in the root dentin under physiologically relevant loads (10-50 N). Another 30 premolars, similarly treated as groups 1 and 2 or left untreated as controls (n = 10/group), were subjected to cyclic loads (1.2 million cycles, 45 N, 4 Hz) followed by uniaxial compressive load to failure. Mechanical data were analyzed with 1-way analysis of variance and the post hoc Tukey test at a 5% level of significance. Microstrain distribution showed bending and compressive patterns at the coronal and apical root dentin, respectively. In the GP group, microstrain distribution was unaltered. In the bonded-PCD group, different microstrain distribution suggested stiffening at the PCD. The load at failure did not differ significantly for the GP, bonded PCD, and control groups (P > .05). CR bonding of PCD might impact the biomechanical responses in maxillary premolar roots at low-level continuous loads. The effect of this impact on root fracture loads when subjected to cyclic load warrants further investigation. Copyright © 2018 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  10. A Dilemma for Research on Yersinia Pestis, a Bioterrorism Agent

    Directory of Open Access Journals (Sweden)

    Ruifu Yang

    2017-10-01

    Full Text Available Yersinia pestis research requires biosafety level thee laboratory practices, which prevents many scientists from conducting research on this pathogen. However, for convenience, many laboratories employ avirulent pCD1-cured strains, such as KIM6+, to perform experiments to study the evolutionary and pathogenic mechanisms of Y. pestis. However, research, including the report by Zhou et al. in this issue, shows that some important Y. pestis phenotypes, including biofilm formation, are influenced by the presence of pCD1. This indicates that we should be prudent when drawing conclusions based on results obtained from plasmid-cured Y. pestis strains.

  11. Comparison of the Truview PCD™ and the GlideScope(®) video laryngoscopes with direct laryngoscopy in pediatric patients: a randomized trial.

    Science.gov (United States)

    Riveros, Ricardo; Sung, Wai; Sessler, Daniel I; Sanchez, Ivan Parra; Mendoza, Maria L; Mascha, Edward J; Niezgoda, Julie

    2013-05-01

    The GlideScope(®) video laryngoscope has a 60° angled blade and the blade of the Truview PCD™ video laryngoscope has an optical lens that provides a 46° refraction of the viewing angle. Despite successful results using the GlideScope in adults, few studies have been published regarding its use in pediatric patients. We therefore tested our joint primary hypothesis that the GlideScope and the Truview PCD video laryngoscopes provide superior visualization to direct laryngoscopy and are non-inferior regarding time to intubation. One hundred thirty-four patients (neonate to ten years of age, American Society of Anesthesiologists physical status I-III) scheduled for general surgical procedures were randomized to tracheal intubation using the Truview PCD or GlideScope video laryngoscope or direct laryngoscopy (Macintosh blade). The laryngoscopic view was scored using the Cormack-Lehane scale. Time to intubation (defined as the time from the moment the device entered the patient's mouth until end-tidal CO2 was detected) and the number of attempts were recorded. The Cormack-Lehane views attained using the GlideScope (P > 0.99) and Truview PCD (P = 0.18) were not superior to the views attained with direct laryngoscopy. Furthermore, the view attained using the GlideScope was significantly worse than that attained using direct laryngoscopy (P Cormack-Lehane grade I views with the GlideScope than with the Truview PCD (14% vs 82%, respectively; 95% confidence interval [CI] -91% to -46%). The observed median [Q1, Q3] times to intubation were: 39 [31, 59] sec, 44 [28, 62] sec, and 23 [21, 28] sec with the GlideScope, Truview PCD, and direct laryngoscopy, respectively, with median differences of 14 sec (95% CI 7 to 26, GlideScope - direct laryngoscopy) and 17 sec (95% CI 6 to 28, Truview PCD - direct laryngoscopy). The Cormack-Lehane views attained using the GlideScope and the Truview PCD video laryngoscopes were not superior to views attained using direct laryngoscopy

  12. Representaciones sociales sobre discapacidad/es y trabajo: articulaciones y transformaciones : Estudio de las inclusiones laborales de personas con discapacidad en Vialidad en el marco de la política pública "SeCLaS" de la provincia de Buenos Aires (2010-2015)

    OpenAIRE

    Scharagrodsky, Carina Judith

    2017-01-01

    El problema de investigación de la presente Tesis doctoral consiste en analizar las representaciones sociales (RS) sobre discapacidad y trabajo de las personas con discapacidad (PCD), sus articulaciones y las transformaciones que las inclusiones en un empleo competitivo formal público promueven en dichas representaciones. Para abordar este problema se analiza el caso de las PCD incluidas en Vialidad en 2010, en el marco de la política pública de promoción de empleo “SeCLaS” (2010-2015) del Mi...

  13. Influencia de la protección social y el sistema de pensiones en la actividad y el acceso al empleo de las personas con discapacidad

    OpenAIRE

    Verdugo Alonso, Miguel Ángel; Jordán de Urríes, Francisco de Borja; Sánchez, María Cruz; Benito, María Carmen

    2010-01-01

    La población de personas con discapacidad (PCD) muestra unas altas tasas de desempleo 26,1% (EDDES, 1999), y lo que es más alarmante una baja tasa de actividad dentro de este colectivo que es de 32,3% (EDDES, 2001). Una de las posibles causas de este bajo nivel de actividad puede establecerse en la percepción de pensiones que actuarían como un inhibidor del empleo. El objetivo de este proyecto fue investigar los efectos de la percepción de una pensión sobre la actividad y el empleo en las PCD...

  14. Efecto de las consecuencias diferenciales e intervalo de retención en la recuperación de información en niños

    Directory of Open Access Journals (Sweden)

    Berenice Chávez

    2007-07-01

    Full Text Available Se examinó el efecto del intervalo de retención y del procedimiento de consecuencias diferenciales (PCD en la recuperación de la información en una tarea de discriminación inversa en niños, en tres experimentos. El primer experimento estudió el efecto de un intervalo de retención de 48 h en una tarea de igualación a la muestra que involucró el aprendizaje de relaciones de formas coloreadas a través de una fase de adquisición, una fase de inversión, y después de diferentes demoras, una fase final de prueba. El segundo experimento estudió el efecto del PCD en las dos fases de una discriminación inversa. En el tercer experimento se exploró el efecto de un intervalo de retención de 48h y el PCD en la recuperación espontánea de la discriminación original. Los resultados del experimento 1 demostraron la recuperación espontánea de la discriminación original cuando se presentó un intervalo de retención de 48 h. El experimento 2 demostró que el PCD no tiene efectos en las dos fases de una tarea de discriminación inversa. En el experimento 3 se observó una interacción entre el intervalo de retención y el PCD, en la que el PCD (grupo CD1-48h puede mejorar la recuperación de la respuesta de la primera fase (i. e. aumento de la recuperación espontánea mientras el PCD en la fase 2 (grupo CD2-48h mejoró la persistencia de la fase de inversión (i. e. disminución de la recuperación espontánea. Se sugiere que la presencia del PCD genera expectativas condicionadas acerca del reforzador que pueden funcionar como señal contextual que interactúan con el intervalo de retención para modular la recuperación de la información demorada.

  15. "Promises and Betrayals": A Radio Novella Focused on Chronic Disease Education

    Centers for Disease Control (CDC) Podcasts

    2012-08-02

    The occurrence of diabetes and other chronic diseases among the Hispanic community living in the United States continues to increase. In this podcast, the authors of an article published in CDC’s Preventing Chronic Disease (PCD) describe how they used a unique entertainment education model to develop a Spanish-language radio novella aimed at reducing the risk factors for chronic diseases among this population.  Created: 8/2/2012 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/2/2012.

  16. Condensation system with seawater in the Royal Solaris Hotel of Cancun; Sistema de condensacion con agua salada en el hotel Royal Solaris de Cancun

    Energy Technology Data Exchange (ETDEWEB)

    Herrero, Juan F.; Hernandez A, David [Celsol, S.A. de C.V., Nuevo Leon (Mexico)

    1999-07-01

    estudio tecnico, durante el mes de septiembre de 1998, en las instalaciones de Villas Solaris, S.A. de C.V., especificamente en el Hotel Royal Solaris, torres Royal y Caribe, se encontraron importantes oportunidades de ahorro, mismas que fueron evaluadas tecnica y economicamente para poder presentar a Villa Solaris, S.A. de C.V., un proyecto de Ahorro de Energia altamente rentable que permita obtener grandes beneficios economicos, un mejor servicio para los huespedes y un importante paso para la reduccion de los gastos operativos (energeticos), que garantizara la futura competitividad del hotel en la zona. La base de las oportunidades de ahorro es la sustitucion de los equipos de aire acondicionado, puesto que los instalados en el Hotel, son equipos muy deficientes (piston en Torre Caribe) o que por normas ecologicas internacionales quedaran obsoletos en poco tiempo (centrifugos R-11 Torre Royal). Ademas se centralizo en un solo sitio el area de maquinas de servicio del Hotel. La medida de sustitucion de los sistemas de aire acondicionado, contemplo el instalar equipos centrifugos de alta eficiencia (0.65kW/Ton a plena carga) enfriados con agua salada, que es un recurso muy abundante en la zona y no representa costo alguno para el Hotel. El resto del calor de las maquinas de refrigeracion se contempla utilizar para precalentar el agua de servicio y el agua de alberca mediante equipos de intercambio de calor. Para llegar a las temperaturas optimas deseadas se aprovecho la instalacion de sistemas termosolares que ya existe en el Hotel. Al implementar este sistema global, se elimino la utilizacion de torres de enfriamiento que era el equipo que enfria el agua de condensacion de los equipos de aire acondicionado. Ademas se elimino la utilizacion de las calderas de vapor que hacian la funcion de calentar el agua de servicios, por lo que se genero un ahorro de combustible importante.

  17. Severe wear behaviour of alumina balls sliding against diamond ...

    Indian Academy of Sciences (India)

    were as-deposited coatings, one was chemo-mechanically polished and the other diamond sample was made free ..... like blood plasma. The radius of the revolutions and the value of the applied loads were varied for different PCD samples at dry and SBF conditions. As the travelling distance and .... takes place (figure 2).

  18. Comparative assessment of coated and uncoated ceramic tools on ...

    Indian Academy of Sciences (India)

    H Aouici

    2017-11-20

    Nov 20, 2017 ... 4105–4114. [25] Arsecularatne J A, Zhang L C and Montross C 2006 Wear and tool life of tungsten carbide, PCBN, PCD cutting tools. Int. J. Mach. Tools Manuf. 46: 482–491. [26] Lahiff C, Gordon S and Phelan P 2007 PCBN tool wear modes and mechanisms in finish hard turning. Robot. Com- put. Integr.

  19. A SNARE-protein has opposing functions in penetration resistance and defence signalling pathways

    DEFF Research Database (Denmark)

    Zhang, Ziguo; Feechan, Angela; Pedersen, Carsten

    2007-01-01

    Penetration resistance is often the first line of defence against fungal pathogens. Subsequently induced defences are mediated by the programmed cell death (PCD) reaction pathway and the salicylic acid (SA), jasmonic acid (JA) and ethylene (ET) signalling pathways. We previously demonstrated...

  20. To die or not to die? Lessons from lesion mimic mutants

    KAUST Repository

    Bruggeman, Quentin

    2015-01-30

    Programmed cell death (PCD) is a ubiquitous genetically regulated process consisting in an activation of finely controlled signaling pathways that lead to cellular suicide. Although some aspects of PCD control appear evolutionary conserved between plants, animals and fungi, the extent of conservation remains controversial. Over the last decades, identification and characterization of several lesion mimic mutants (LMM) has been a powerful tool in the quest to unravel PCD pathways in plants. Thanks to progress in molecular genetics, mutations causing the phenotype of a large number of LMM and their related suppressors were mapped, and the identification of the mutated genes shed light on major pathways in the onset of plant PCD such as (i) the involvements of chloroplasts and light energy, (ii) the roles of sphingolipids and fatty acids, (iii) a signal perception at the plasma membrane that requires efficient membrane trafficking, (iv) secondary messengers such as ion fluxes and ROS and (v) the control of gene expression as the last integrator of the signaling pathways.

  1. Spatio-temporal appearance of α-amylase and limit dextrinase in barley aleurone layer in response to gibberellic acid, abscisic acid and salicylic acid

    DEFF Research Database (Denmark)

    Shahpiri, Azar; Talaei, Nasim; Finnie, Christine

    2015-01-01

    Release of LD was found to differ from that of amylase and was suggested to depend on programmed cell death (PCD). Despite detection of intracellular amylase in untreated aleurone layers or aleurone layers treated with ABA or SA, α-amylase was not released from these samples. Nevertheless, the re...

  2. Programmed Cell Death in Unicellular Phytoplankton.

    Science.gov (United States)

    Bidle, Kay D

    2016-07-11

    Unicellular, planktonic, prokaryotic and eukaryotic photoautotrophs (phytoplankton) have an ancient evolutionary history on Earth during which time they have played key roles in the regulation of marine food webs, biogeochemical cycles, and Earth's climate. Since they represent the basis of aquatic ecosystems, the manner in which phytoplankton die critically determines the flow and fate of photosynthetically fixed organic matter (and associated elements), ultimately constraining nutrient flow. Programmed cell death (PCD) and associated pathway genes, which are triggered by a variety of abiotic (nutrient, light, osmotic) and biotic (virus infection, allelopathy) environmental stresses, have an integral grip on cell fate, and have shaped the ecological success and evolutionary trajectory of diverse phytoplankton lineages. A combination of physiological, biochemical, and genetic techniques in model algal systems has demonstrated a conserved molecular and mechanistic framework of stress surveillance, signaling, and death activation pathways, involving collective and coordinated participation of organelles, redox enzymes, metabolites, and caspase-like proteases. This mechanistic understanding has provided insight into the integration of sensing and transduction of stress signals into cellular responses, and the mechanistic interfaces between PCD, cell stress and virus infection pathways. It has also provided insight into the evolution of PCD in unicellular photoautotrophs, the impact of PCD on the fate of natural phytoplankton assemblages and its role in aquatic biogeochemical cycles. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. The molecular ecophysiology of programmed cell death in marine phytoplankton.

    Science.gov (United States)

    Bidle, Kay D

    2015-01-01

    Planktonic, prokaryotic, and eukaryotic photoautotrophs (phytoplankton) share a diverse and ancient evolutionary history, during which time they have played key roles in regulating marine food webs, biogeochemical cycles, and Earth's climate. Because phytoplankton represent the basis of marine ecosystems, the manner in which they die critically determines the flow and fate of photosynthetically fixed organic matter (and associated elements), ultimately constraining upper-ocean biogeochemistry. Programmed cell death (PCD) and associated pathway genes, which are triggered by a variety of nutrient stressors and are employed by parasitic viruses, play an integral role in determining the cell fate of diverse photoautotrophs in the modern ocean. Indeed, these multifaceted death pathways continue to shape the success and evolutionary trajectory of diverse phytoplankton lineages at sea. Research over the past two decades has employed physiological, biochemical, and genetic techniques to provide a novel, comprehensive, mechanistic understanding of the factors controlling this key process. Here, I discuss the current understanding of the genetics, activation, and regulation of PCD pathways in marine model systems; how PCD evolved in unicellular photoautotrophs; how it mechanistically interfaces with viral infection pathways; how stress signals are sensed and transduced into cellular responses; and how novel molecular and biochemical tools are revealing the impact of PCD genes on the fate of natural phytoplankton assemblages.

  4. CCDC103 mutations cause primary ciliary dyskinesia by disrupting assembly of ciliary dynein arms

    Science.gov (United States)

    Panizzi, Jennifer R.; Becker-Heck, Anita; Castleman, Victoria H.; Al-Mutairi, Dalal; Liu, Yan; Loges, Niki T.; Pathak, Narendra; Austin-Tse, Christina; Sheridan, Eamonn; Schmidts, Miriam; Olbrich, Heike; Werner, Claudius; Häffner, Karsten; Hellman, Nathan; Chodhari, Rahul; Gupta, Amar; Kramer-Zucker, Albrecht; Olale, Felix; Burdine, Rebecca D.; Schier, Alexander F.; O’Callaghan, Christopher; Chung, Eddie MK; Reinhardt, Richard; Mitchison, Hannah M.; King, Stephen M.; Omran, Heymut; Drummond, Iain A.

    2012-01-01

    Cilia are essential for fertilization, respiratory clearance, cerebrospinal fluid circulation, and to establish laterality1. Cilia motility defects cause Primary Ciliary Dyskinesia (PCD, MIM 242650), a disorder affecting 1:15-30,000 births. Cilia motility requires the assembly of multisubunit dynein arms that drive cilia bending2. Despite progress in understanding the genetic basis of PCD, mutations remain to be identified for several PCD linked loci3. Here we show that the zebrafish cilia paralysis mutant schmalhanstn222 (smh) mutant encodes the coiled-coil domain containing 103 protein (Ccdc103), a foxj1a regulated gene. Screening 146 unrelated PCD families identified patients in six families with reduced outer dynein arms, carrying mutations in CCDC103. Dynein arm assembly in smh mutant zebrafish was rescued by wild-type but not mutant human CCDC103. Chlamydomonas Ccdc103 functions as a tightly bound, axoneme-associated protein. The results identify Ccdc103 as a novel dynein arm attachment factor that when mutated causes Primary Ciliary Dyskinesia. PMID:22581229

  5. Treatment with granulocyte colony-stimulating factor decreases the capacity of hematopoietic progenitor cells for generation of lymphocytes in human immunodeficiency virus-infected persons

    DEFF Research Database (Denmark)

    Nielsen, S D; Clark, D R; Hutchings, M

    1999-01-01

    of CD34+ progenitor cells to generate lymphocytes was examined by use of thymic organ cultures. The mean number of lymphocytes generated per CD34+ cell on day 0 was 0.72 and on day 4 was 0.09 (PCD34+ cell was significantly reduced after G-CSF treatment...

  6. Measuring long-term trends in policy coherence for development

    NARCIS (Netherlands)

    Koch, D.J.

    2018-01-01

    Policy coherence for development (PCD) has become an increasingly important topic in development circles over the last couple of decades. It can be seen in the founding documents of the European Union (EU) (the Treaty of Maastricht) and one of the millennium development goals was dedicated to it. It

  7. X-linked primary ciliary dyskinesia due to mutations in the cytoplasmic axonemal dynein assembly factor PIH1D3.

    NARCIS (Netherlands)

    Olcese, C.; Patel, M.P.; Shoemark, A.; Kiviluoto, S.; Legendre, M.; Williams, H.J.; Vaughan, C.K.; Hayward, J.; Goldenberg, A.; Emes, R.D.; Munye, M.M.; Dyer, L.; Cahill, T.; Bevillard, J.; Gehrig, C.; Guipponi, M.; Chantot, S.; Duquesnoy, P.; Thomas, L.; Jeanson, L.; Copin, B.; Tamalet, A.; Thauvin-Robinet, C.; Papon, J.F.; Garin, A.; Pin, I.; Vera, G.; Aurora, P.; Fassad, M.R.; Jenkins, L.; Boustred, C.; Cullup, T.; Dixon, M.; Onoufriadis, A.; Bush, A.; Chung, E.M.; Antonarakis, S.E.; Loebinger, M.R.; Wilson, R.; Armengot, M.; Escudier, E.; Hogg, C.; Amselem, S.; Sun, Z.; Bartoloni, L.; Blouin, J.L.; Mitchison, H.M.; Schmidts, M.; et al.,

    2017-01-01

    By moving essential body fluids and molecules, motile cilia and flagella govern respiratory mucociliary clearance, laterality determination and the transport of gametes and cerebrospinal fluid. Primary ciliary dyskinesia (PCD) is an autosomal recessive disorder frequently caused by non-assembly of

  8. Inhibition of apoptic cell death induced by Pseudomonas syringae pv. Tabaci and mycotoxin fumonisin B1

    NARCIS (Netherlands)

    Iakimova, E.T.; Batchvorova, R.; Kapchina, V.; Popov, T.; Atanassov, A.; Woltering, E.J.

    2004-01-01

    The impact of programmed cell death (PCD) inhibitors on lesion formation and biochemical events in transgenic (ttr line) and non-transgenic (Nevrokop 1164) tobacco infected with Pseudomonas syringae pv. tabaci was tested. Programmed cell death in tomato cell culture was induced by Fumonisin B1 (FUM)

  9. associated athanogene (BAG)

    African Journals Online (AJOL)

    Yomi

    2012-01-03

    Jan 3, 2012 ... OsBAG genes might play important role at the onset of heat stress. A further detailed study may explore the exact function of the members of this gene family and help to make understanding of programmed cell death (PCD) mechanism in plants. Key words: Rice, ubiquitin-like domain, nucleotide-binding ...

  10. Paraphilic Coercive Disorder in the DSM: the right diagnosis for the right reasons.

    Science.gov (United States)

    Stern, Paul

    2010-12-01

    The recommendation to include a Paraphilic Coercive Disorder (PCD) diagnosis in the DSM-5 represents an improvement over current options and would lead to the shrinking of the pool of individuals considered for detention as Sexually Violent Predators. A precise description of the diagnostic criteria for PCD would permit psychologists and psychiatrists to use more specific and narrow criteria for those who seek sexual gratification by coercing others to engage in unwanted sexual behavior. This might permit mental health professionals to abandon the Paraphilia NOS designation in favor of the more defined PCD in appropriate cases. Various critics have attacked the proposal on what appears to be misplaced ideological grounds. Not only should ideological concerns not play a part in a scientific debate, but the critics' predictions of how the PCD diagnosis would play out in the legal arena are likely wrong. Paraphilic Coercive Disorder would give the judicial system the best opportunity to most accurately identify the small group of men who have previously committed, and are likely in the future to commit, this type of predatory sexual violence.

  11. Aerobic fitness in children and young adults with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Madsen, Astrid Hellerup; Green, Kent; Buchvald, Frederik

    2013-01-01

    -score TLC, and indices of N2 MBW were significantly abnormal, but VO2peak only correlated with FEV1 and DLCO/VA. VO2peak correlated with complaints of moderate or significant limitations in vigorous activities (P = 0.0001), exhibited by 39% of PCD...

  12. Machinability of glass fiber reinforced plastic (GFRP) composite ...

    African Journals Online (AJOL)

    This paper deals with the study of machinability of GFRP composite tubes of different fiber orientation angle vary from 300 to 900. Machining studies were carried out on an all geared lathe using three different cutting tools: namely Carbide (K-20), Cubic Boron Nitride (CBN) and Poly-Crystalline Diamond (PCD). Experiments ...

  13. Nuclear fragmentation and DNA degradation during programmed cell death in petals of morning glory (Ipomoea nil)

    NARCIS (Netherlands)

    Yamada, T.; Takatsu, Y.; Kasumi, K.; Ichimura, K.; Doorn, van W.G.

    2006-01-01

    We studied DNA degradation and nuclear fragmentation during programmed cell death (PCD) in petals of Ipomoea nil (L.) Roth flowers. The DNA degradation, as observed on agarose gels, showed a large increase. Using DAPI, which stains DNA, and flow cytometry for DAPI fluorescence, we found that the

  14. Patient-specific three-dimensional explant spheroids derived from human nasal airway epithelium

    DEFF Research Database (Denmark)

    Marthin, June Kehlet; Stevens, Elizabeth Munkebjerg; Larsen, Lars Allan

    2017-01-01

    surface facing the outside and accessible for analysis of ciliary function. METHODS: We performed a two-group comparison study of ciliary beat pattern and ciliary beat frequency in spheroids derived from nasal airway epithelium in patients with primary ciliary dyskinesia (PCD) and in healthy controls...

  15. Intracellular energy depletion triggers programmed cell death during petal senescence in tulip.

    Science.gov (United States)

    Azad, A K; Ishikawa, Takayuki; Ishikawa, Takahiro; Sawa, Y; Shibata, H

    2008-01-01

    Programmed cell death (PCD) in petals provides a model system to study the molecular aspects of organ senescence. In this study, the very early triggering signal for PCD during the senescence process from young green buds to 14-d-old petals of Tulipa gesneriana was determined. The opening and closing movement of petals of intact plants increased for the first 3 d and then gradually decreased. DNA degradation and cytochrome c (Cyt c) release were clearly observed in 6-d-old flowers. Oxidative stress or ethylene production can be excluded as the early signal for petal PCD. In contrast, ATP was dramatically depleted after the first day of flower opening. Sucrose supplementation to cut flowers maintained their ATP levels and the movement ability for a longer time than in those kept in water. The onset of DNA degradation, Cyt c release, and petal senescence was also delayed by sucrose supplementation to cut flowers. These results suggest that intracellular energy depletion, rather than oxidative stress or ethylene production, may be the very early signal to trigger PCD in tulip petals.

  16. Hydrogen Peroxide-induced Cell Death in Arabidopsis : Transcriptional and Mutant Analysis Reveals a Role of an Oxoglutarate-dependent Dioxygenase Gene in the Cell Death Process

    NARCIS (Netherlands)

    Gechev, Tsanko S.; Minkov, Ivan N.; Hille, Jacques

    2005-01-01

    Hydrogen peroxide is a major regulator of plant programmed cell death (PCD) but little is known about the downstream genes from the H2O2-signaling network that mediate the cell death. To address this question, a novel system for studying H2O2-induced programmed cell death in Arabidopsis thaliana was

  17. Chloroplasts activity and PAP-signaling regulate programmed cell death in Arabidopsis

    KAUST Repository

    Bruggeman, Quentin

    2016-01-09

    Programmed cell death (PCD) is a crucial process both for plant development and responses to biotic and abiotic stress. There is accumulating evidence that chloroplasts may play a central role during plant PCD as for mitochondria in animal cells, but it is still unclear whether they participate in PCD onset, execution, or both. To tackle this question, we have analyzed the contribution of chloroplast function to the cell death phenotype of the myoinositol phosphate synthase1 (mips1) mutant that forms spontaneous lesions in a light-dependent manner. We show that photosynthetically active chloroplasts are required for PCD to occur in mips1, but this process is independent of the redox state of the chloroplast. Systematic genetic analyses with retrograde signaling mutants reveal that 3’-phosphoadenosine 5’-phosphate, a chloroplast retrograde signal that modulates nuclear gene expression in response to stress, can inhibit cell death and compromises plant innate immunity via inhibition of the RNA-processing 5’-3’ exoribonucleases. Our results provide evidence for the role of chloroplast-derived signal and RNA metabolism in the control of cell death and biotic stress response. © 2016 American Society of Plant Biologists. All Rights Reserved.

  18. A case of Kartagener syndrome with rhinolalia clausa | Raoufi | Pan ...

    African Journals Online (AJOL)

    Kartagener syndrome is an autosomal recessive genetic ciliary disorder comprising of a classic triad of sinusitis, situs inversus and bronchiectasis. It's the one of primary ciliary dyskinesia disorders with manifestations present from childhood. Most patients of PCD have situs inversus. We present a case of 18 year-old women ...

  19. Series

    Indian Academy of Sciences (India)

    Prakash

    The description of programmed cell death (PCD) (Lockshin and Williams 1964), the characterization of its most popular form, apoptosis (Kerr et al. 1972), and its rapid molecular description thanks to the model organism. Caenorhabditis elegans (Ellis et al. 1991) might appear as a paradigmatic example of the success of ...

  20. CCDC151 mutations cause primary ciliary dyskinesia by disruption of the outer dynein arm docking complex formation

    DEFF Research Database (Denmark)

    Hjeij, Rim; Onoufriadis, Alexandros; Watson, Christopher M

    2014-01-01

    , produced and preassembled in the cytosol, are transported to the ciliary or flagellar compartment and anchored into the axonemal microtubular scaffold via the ODA docking complex (ODA-DC) system. In humans, defects in ODA assembly are the major cause of primary ciliary dyskinesia (PCD), an inherited...

  1. Dioxinen en planaire PCB's in voeding. Gehalten in voedingsprodukten en inname door de Nederlandse bevolking

    NARCIS (Netherlands)

    Liem AKD; Theelen RMC; Slob W; van Wijnen JH

    1991-01-01

    A study has been performed on (the variation of) the exposure to dioxins and related compounds of the Dutch polution. The study included the measurement of PCDD, PCDF and (planar) PCD levels in selected categories of the total diet and the calculation of the average human intake of dioxins by foor

  2. Reference: 788 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available programmed cell death of the endothelium in developing seeds. 8 2205-20 18676877 2008 Aug The Plant cell And...eloping seeds. PDI5 interacts with three different Cys proteases in yeast two-hybri...cations and functions. We demonstrate that PDI5 is expressed in endothelial cells about to undergo programmed cell death (PCD) in dev

  3. Founder mutation in RSPH4A identified in patients of Hispanic descent with Primary Ciliary Dyskinesia

    Science.gov (United States)

    Daniels, M. Leigh Anne; Leigh, Margaret W.; Davis, Stephanie D.; Armstrong, Michael C.; Carson, Johnny L.; Hazucha, Milan; Dell, Sharon D.; Eriksson, Maria; Collins, Francis S.; Knowles, Michael R.; Zariwala, Maimoona A.

    2013-01-01

    Primary ciliary dyskinesia (PCD) is a rare, autosomal recessive, genetically heterogeneous disorder characterized by ciliary dysfunction resulting in chronic oto-sino-pulmonary disease, respiratory distress in term neonates, laterality (situs) defects, and bronchiectasis. Diagnosis has traditionally relied on ciliary ultrastructural abnormalities seen by electron microscopy. Mutations in radial spoke head proteins occur in PCD patients with central apparatus defects. Advances in genetic testing have been crucial in addressing the diagnostic challenge. Here, we describe a novel splice-site mutation (c.921+3_6delAAGT) in RSPH4A, which leads to a premature translation termination signal in nine subjects with PCD (seven families). Loss-of-function was confirmed with quantitative ciliary ultrastructural analysis, measurement of ciliary beat frequency and waveform, and transcript analysis. All nine individuals carrying c.921+3_6delAAGT splice-site mutation in RSPH4A were Hispanic with ancestry tracing to Puerto Rico. This mutation is a founder mutation and a common cause of PCD without situs abnormalities in patients of Puerto Rican descent. PMID:23798057

  4. Involvement of ethylene and nitric oxide in cell death in mastoparan-treated unicellular alga Chlamydomonas reinhardtii

    NARCIS (Netherlands)

    Yordanova, Z.P.; Iakimova, E.T.; Cristescu, S.M.; Harren, F.J.M.; Kapchina-Toteva, V.M.; Woltering, E.J.

    2010-01-01

    This work demonstrates a contribution of ethylene and NO in mastoparan (MP)-induced cell death in the green algae C. reinhardtii. Following MP treatment, C. reinhardtii showed massive cell death, expressing morphological features of programmed cell death (PCD). A pharmacological approach involving

  5. Authoring Systems: Some Instructional Implications.

    Science.gov (United States)

    MacKnight, Carol B.; Balagopalan, Santosh

    1989-01-01

    Compares the strengths and weaknesses of four authoring systems that can be used for courseware development: (1) Quest; (2) PCD3; (3) IconAuthor; and (4) Course of Action. Evaluation procedures used to assess their power, ease of use, and productivity aids are explained; menu and icon structures are described; and interactive design implications…

  6. ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6

    DEFF Research Database (Denmark)

    Zariwala, Maimoona A; Gee, Heon Yung; Kurkowiak, Małgorzata

    2013-01-01

    Defects of motile cilia cause primary ciliary dyskinesia (PCD), characterized by recurrent respiratory infections and male infertility. Using whole-exome resequencing and high-throughput mutation analysis, we identified recessive biallelic mutations in ZMYND10 in 14 families and mutations in the ...

  7. Relevance of Cd-banding and premature centromere division in human metaphase figures

    Energy Technology Data Exchange (ETDEWEB)

    Verschaeve, L.; Defoin, A.; Staessen, K.; Kirsch-Volders, M.

    1986-01-01

    Kinetochore-inactivation as one of the possible mechanisms for aneuploidy was studied in human lymphocytes by two, possibly related, cytogenetic techniques: Cd-banding and premature centromere division (PCD). Cd-banding is a particular staining procedure which is presently admitted to allow discrimination between active and inactive (or absent) kinetochores. PCD is considered to be one of the consequences of kinetochore-inactivation and the origin of at least some aneuploidy. At first a confined study in monozygotic- and dizygotic twins did not reveal that Cd-stainability and PCD are heritable characters. In a second approach they studied the possible role of inactivated kinetochores in aneuploidy produced after exposure of lymphocytes to aneuploidy-inducing substances. It was shown that carbaryl, methylmercury chloride, mercury chloride and arsenic trioxide did not increase the frequency of metaphase figures with Cd-negative and PCD-chromosomes. Therefore, kinetochore-inactivation does not seem to contribute to the known aneuploidy induction of these compounds. As it is known that chromosome segregational errors are very often responsible for early miscarriages, they also investigated some couples with recurrent abortions. Their results indicate that kinetochore-inactivation is apparently not responsible for their abortive conceptions.

  8. Cadmium-induced programmed cell death signaling in tomato suspension cells

    NARCIS (Netherlands)

    Yakimova, E.T.; Woltering, E.J.; Kapchina-Toteva, V.M.

    2009-01-01

    Here we present a summary of our study on cadmium-induced cell death signaling in a model system of suspension-cultured tomato cells. Exposure of the cells to CdSO4 induced typical for PCD (cytoplasm shrinkage and nuclear condensation) morphological changes of the dead cells. Ethylene and hydrogen

  9. Hand-held tidal breathing nasal nitric oxide measurement--a promising targeted case-finding tool for the diagnosis of primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Marthin, June Kehlet; Nielsen, Kim Gjerum

    2013-01-01

    BACKGROUND: Nasal nitric oxide (nNO) measurement is an established first line test in the work-up for primary ciliary dyskinesia (PCD). Tidal breathing nNO (TB-nNO) measurements require minimal cooperation and are potentially useful even in young children. Hand-held NO devices are becoming increa...

  10. Robust cylinder fitting in three-dimensional point cloud data

    NARCIS (Netherlands)

    Nurunnabi, Abdul; Sadahiro, Yukio; Lindenbergh, R.C.

    2017-01-01

    This paper investigates the problems of cylinder fitting in laser scanning three-dimensional Point Cloud Data (PCD). Most existing methods require full cylinder data, do not study the presence of outliers, and are not statistically robust. But especially mobile laser scanning often has incomplete

  11. Long-term clearance from small airways in subjects with ciliary dysfunction

    Directory of Open Access Journals (Sweden)

    Hjelte Lena

    2006-05-01

    Full Text Available Abstract The objective of this study was to investigate if long-term clearance from small airways is dependent on normal ciliary function. Six young adults with primary ciliary dyskinesia (PCD inhaled 111 Indium labelled Teflon particles of 4.2 μm geometric and 6.2 μm aerodynamic diameter with an extremely slow inhalation flow, 0.05 L/s. The inhalation method deposits particles mainly in the small conducting airways. Lung retention was measured immediately after inhalation and at four occasions up to 21 days after inhalation. Results were compared with data from ten healthy controls. For additional comparison three of the PCD subjects also inhaled the test particles with normal inhalation flow, 0.5 L/s, providing a more central deposition. The lung retention at 24 h in % of lung deposition (Ret24 was higher (p 24 with slow inhalation flow was 73.9 ± 1.9 % compared to 68.9 ± 7.5 % with normal inhalation flow in the three PCD subjects exposed twice. During day 7–21 the three PCD subjects exposed twice cleared 9 % with normal flow, probably representing predominantly alveolar clearance, compared to 19 % with slow inhalation flow, probably representing mainly small airway clearance. This study shows that despite ciliary dysfunction, clearance continues in the small airways beyond 24 h. There are apparently additional clearance mechanisms present in the small airways.

  12. A longitudinal study of lung bacterial pathogens in patients with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    C. Alanin, M.; G. Nielsen, K.; von Buchwald, C.

    2015-01-01

    from 107 patients with PCD (median age 17 years, range 0–74 years) (median age at diagnosis 7.8 years, range 0–63 years). Haemophilus influenzae was the most frequent microorganism. Other common pathogens were P. aeruginosa, Streptococcus pneumoniae, Moraxella catarrhalis and Staphylococcus aureus...

  13. Iron (III) complexes of certain tetradentate phenolate ligands as ...

    Indian Academy of Sciences (India)

    Catechol 1,2-dioxygenase (CTD) and protocatechuate 3,4-dioxygenase (PCD) are bacterial non-heme iron enzymes, which catalyse the oxidative cleavage of catechols to cis, cis-muconic acids with the incorporation of molecular oxygen via a mechanism involving a high-spin ferric centre. The iron(III) complexes of tripodal ...

  14. Starch Origin and Thermal Processing Affect Starch Digestion in a Minipig Model of Pancreatic Exocrine Insufficiency

    Directory of Open Access Journals (Sweden)

    Anne Mößeler

    2015-01-01

    Full Text Available Although steatorrhea is the most obvious symptom of pancreatic exocrine insufficiency (PEI, enzymatic digestion of protein and starch is also impaired. Low praecaecal digestibility of starch causes a forced microbial fermentation accounting for energy losses and meteorism. To optimise dietetic measures, knowledge of praecaecal digestibility of starch is needed but such information from PEI patients is rare. Minipigs fitted with an ileocaecal fistula with (n=3 or without (n=3 pancreatic duct ligation (PL were used to estimate the rate of praecaecal disappearance (pcD of starch. Different botanical sources of starch (rice, amaranth, potato, and pea were fed either raw or cooked. In the controls (C, there was an almost complete pcD (>92% except for potato starch (61.5% which was significantly lower. In PL pcD of raw starch was significantly lower for all sources of starch except for amaranth (87.9%. Thermal processing increased pcD in PL, reaching values of C for starch from rice, potato, and pea. This study clearly underlines the need for precise specification of starch used for patients with specific dietetic needs like PEI. Data should be generated in suitable animal models or patients as tests in healthy individuals would not have given similar conclusions.

  15. Starch Origin and Thermal Processing Affect Starch Digestion in a Minipig Model of Pancreatic Exocrine Insufficiency.

    Science.gov (United States)

    Mößeler, Anne; Vagt, Sandra; Beyerbach, Martin; Kamphues, Josef

    2015-01-01

    Although steatorrhea is the most obvious symptom of pancreatic exocrine insufficiency (PEI), enzymatic digestion of protein and starch is also impaired. Low praecaecal digestibility of starch causes a forced microbial fermentation accounting for energy losses and meteorism. To optimise dietetic measures, knowledge of praecaecal digestibility of starch is needed but such information from PEI patients is rare. Minipigs fitted with an ileocaecal fistula with (n = 3) or without (n = 3) pancreatic duct ligation (PL) were used to estimate the rate of praecaecal disappearance (pcD) of starch. Different botanical sources of starch (rice, amaranth, potato, and pea) were fed either raw or cooked. In the controls (C), there was an almost complete pcD (>92%) except for potato starch (61.5%) which was significantly lower. In PL pcD of raw starch was significantly lower for all sources of starch except for amaranth (87.9%). Thermal processing increased pcD in PL, reaching values of C for starch from rice, potato, and pea. This study clearly underlines the need for precise specification of starch used for patients with specific dietetic needs like PEI. Data should be generated in suitable animal models or patients as tests in healthy individuals would not have given similar conclusions.

  16. Involvement of a hypersensitive-like reaction in tolerance to fire ...

    African Journals Online (AJOL)

    SAM

    2014-07-09

    Jul 9, 2014 ... programmed cell death; PEP, plastid encoded RNA polymerase-PEP enzyme; PQ, plastoquinone; PSI, photosystem I; PSII, photosystem II; PTK ... dria and chloroplast are required in programmed cell death (PCD) of guard cells ..... roplasts are believed to have evolved from prokaryotic ancestors, and they ...

  17. Case report

    African Journals Online (AJOL)

    abp

    2014-05-01

    May 1, 2014 ... because antineuronal autoantibodies and T-cell responses against nervous system antigens have been defined ... treated by calcium antagonists, who consulted in our hospital complaining from vertigo, vomiting and ... nuclei and brainstem are also identified in some patients [5]. PCD has been reported in ...

  18. Towards automatic image analysis and assessment of the multicellular apoptosis process.

    Science.gov (United States)

    Ziraldo, Riccardo; Link, Nichole; Abrams, John; Ma, Lan

    2015-05-01

    Apoptotic programmed cell death (PCD) is a fundamental aspect of developmental maturation. However, the authors' understanding of apoptosis, especially in the multi-cell regime, is incomplete because of the difficulty of identifying dying cells by conventional strategies. Real-time in vivo microscopy of Drosophila, an excellent model system for studying the PCD during development, has been used to uncover plausible collective apoptosis at the tissue level, although the dynamic regulation of the process remains to be deciphered. In this work, the authors have developed an image-analysis program that can quantitatively analyse time-lapse microscopy of live tissues undergoing apoptosis with a fluorescent nuclear marker, and subsequently extract the spatiotemporal patterns of multicellular response. The program can process a large number of cells (>103) automatically tracked across sets of image frames. It is applied to characterise the apoptosis of Drosophila wing epithelium at eclosion. Using the natural anatomic structures as reference, the authors identify dynamic patterns in the progression of PCD within the Drosophila tissues. The results not only confirm the previously observed collective multi-cell behaviour from a quantitative perspective, but also reveal a plausible role played by the anatomic structures, such as the wing veins, in the PCD propagation across the Drosophila wing.

  19. Education Predicts Incidence of Preclinical Mobility Disability in Initially High-Functioning Older Women. The Women’s Health and Aging Study II

    Science.gov (United States)

    Gregory, Patricia C.; Xue, Qian-Li; Tian, Jing; Thorpe, Roland J.; Fried, Linda P.

    2011-01-01

    Background. To examine the impact of educational attainment on the incidence of preclinical mobility disability (PCD). Methods. The Women's Health and Aging II Study is a prospective observational cohort study of 436 initially high-functioning community-dwelling women aged 70–79 years at baseline in Baltimore, Maryland. We measured the association of highest attained education level with preclinical mobility disability (PCD) over an 11-year period. PCD is defined as self-reported modification in any of four tasks without reporting difficulty in those tasks. The tasks were walking ½ mile, climbing up steps, doing heavy housework, and getting in/out of bed or chair. Results. Participants with less than 9 years of education were more likely to acquire incident PCD (hazard ratio: 3.1, 95% confidence interval = 1.2–7.7) than their counterparts with more education after adjusting for income, marital status, number of diseases, and high self-efficacy. Conclusions. Lower education level is an independent predictor of incident preclinical mobility disability. This association has important implications for primary and secondary prevention and can be easily assessed in clinical encounters. PMID:21382883

  20. Education predicts incidence of preclinical mobility disability in initially high-functioning older women. The Women's Health and Aging Study II.

    Science.gov (United States)

    Gregory, Patricia C; Szanton, Sarah L; Xue, Qian-Li; Tian, Jing; Thorpe, Roland J; Fried, Linda P

    2011-05-01

    To examine the impact of educational attainment on the incidence of preclinical mobility disability (PCD). The Women's Health and Aging II Study is a prospective observational cohort study of 436 initially high-functioning community-dwelling women aged 70-79 years at baseline in Baltimore, Maryland. We measured the association of highest attained education level with preclinical mobility disability (PCD) over an 11-year period. PCD is defined as self-reported modification in any of four tasks without reporting difficulty in those tasks. The tasks were walking ½ mile, climbing up steps, doing heavy housework, and getting in/out of bed or chair. Participants with less than 9 years of education were more likely to acquire incident PCD (hazard ratio: 3.1, 95% confidence interval = 1.2-7.7) than their counterparts with more education after adjusting for income, marital status, number of diseases, and high self-efficacy. Lower education level is an independent predictor of incident preclinical mobility disability. This association has important implications for primary and secondary prevention and can be easily assessed in clinical encounters.

  1. The Molecular Ecophysiology of Programmed Cell Death in Marine Phytoplankton

    Science.gov (United States)

    Bidle, Kay D.

    2015-01-01

    Planktonic, prokaryotic, and eukaryotic photoautotrophs (phytoplankton) share a diverse and ancient evolutionary history, during which time they have played key roles in regulating marine food webs, biogeochemical cycles, and Earth's climate. Because phytoplankton represent the basis of marine ecosystems, the manner in which they die critically determines the flow and fate of photosynthetically fixed organic matter (and associated elements), ultimately constraining upper-ocean biogeochemistry. Programmed cell death (PCD) and associated pathway genes, which are triggered by a variety of nutrient stressors and are employed by parasitic viruses, play an integral role in determining the cell fate of diverse photoautotrophs in the modern ocean. Indeed, these multifaceted death pathways continue to shape the success and evolutionary trajectory of diverse phytoplankton lineages at sea. Research over the past two decades has employed physiological, biochemical, and genetic techniques to provide a novel, comprehensive, mechanistic understanding of the factors controlling this key process. Here, I discuss the current understanding of the genetics, activation, and regulation of PCD pathways in marine model systems; how PCD evolved in unicellular photoautotrophs; how it mechanistically interfaces with viral infection pathways; how stress signals are sensed and transduced into cellular responses; and how novel molecular and biochemical tools are revealing the impact of PCD genes on the fate of natural phytoplankton assemblages.

  2. Death proteases: alive and kicking

    NARCIS (Netherlands)

    Woltering, E.J.

    2010-01-01

    Two recent discoveries significantly add to our understanding of plant programmed cell death (PCD). Hatsugai et al. showed that cell death is dependent on proper proteasome functioning. Sundström et al. showed that the in vivo substrate of a type II metacaspase is associated with cell viability.

  3. Multiple mediators of plant programmed cell death : interplay of conserved cell death mechanisms and plant-specific regulators

    NARCIS (Netherlands)

    Hoeberichts, F.A.; Woltering, E.J.

    2002-01-01

    Programmed cell death (PCD) is a process aimed at the removal of redundant, misplaced, or damaged cells and it is essential to the development and maintenance of multicellular organisms. In contrast to the relatively well-described cell death pathway in animals, often referred to as apoptosis,

  4. Petal Senescence: New Concepts for Ageing Cells

    NARCIS (Netherlands)

    Woltering, E.J.; Doorn, van W.G.

    2009-01-01

    Senescence in flower petals can be regarded as a form of programmed cell death (PCD), being a process where cells or tissues are broken down in an orderly and predictable manner, whereby nutrients are re-used by other cells, tissues or plant parts. The process of petal senescence shows many

  5. Role of mitochondria in the pheromone- and amiodarone-induced programmed death of yeast.

    Science.gov (United States)

    Pozniakovsky, Andrei I; Knorre, Dmitry A; Markova, Olga V; Hyman, Anthony A; Skulachev, Vladimir P; Severin, Fedor F

    2005-01-17

    Although programmed cell death (PCD) is extensively studied in multicellular organisms, in recent years it has been shown that a unicellular organism, yeast Saccharomyces cerevisiae, also possesses death program(s). In particular, we have found that a high doses of yeast pheromone is a natural stimulus inducing PCD. Here, we show that the death cascades triggered by pheromone and by a drug amiodarone are very similar. We focused on the role of mitochondria during the pheromone/amiodarone-induced PCD. For the first time, a functional chain of the mitochondria-related events required for a particular case of yeast PCD has been revealed: an enhancement of mitochondrial respiration and of its energy coupling, a strong increase of mitochondrial membrane potential, both events triggered by the rise of cytoplasmic [Ca2+], a burst in generation of reactive oxygen species in center o of the respiratory chain complex III, mitochondrial thread-grain transition, and cytochrome c release from mitochondria. A novel mitochondrial protein required for thread-grain transition is identified.

  6. Influence of jasmonic acid as potential activator of induced ...

    Indian Academy of Sciences (India)

    The ultra-structural changes during disease progression showed the signs of programmed cell death (PCD). However, JA strengthened the defense barrier by enhancing the lignifications of cell walls as observed in spikes of both varieties by histochemical analysis. Compared to the plants inoculated with pathogen alone, ...

  7. Industrial diamond

    Science.gov (United States)

    Olson, D.W.

    2013-01-01

    Estimated 2012 world production of natural and synthetic industrial diamond was about 4.45 billion carats. During 2012, natural industrial diamonds were produced in at least 20 countries, and synthetic industrial diamond was produced in at least 12 countries. About 99 percent of the combined natural and synthetic global output was produced in Belarus, China, Ireland, Japan, Russia, South Africa and the United States. During 2012, China was the world’s leading producer of synthetic industrial diamond followed by the United States and Russia. In 2012, the two U.S. synthetic producers, one in Pennsylvania and the other in Ohio, had an estimated output of 103 million carats, valued at about $70.6 million. This was an estimated 43.7 million carats of synthetic diamond bort, grit, and dust and powder with a value of $14.5 million combined with an estimated 59.7 million carats of synthetic diamond stone with a value of $56.1 million. Also in 2012, nine U.S. firms manufactured polycrystalline diamond (PCD) from synthetic diamond grit and powder. The United States government does not collect or maintain data for either domestic PCD producers or domestic chemical vapor deposition (CVD) diamond producers for quantity or value of annual production. Current trade and consumption quantity data are not available for PCD or for CVD diamond. For these reasons, PCD and CVD diamond are not included in the industrial diamond quantitative data reported here.

  8. Tightly Controlled Expression of bHLH142 Is Essential for Timely Tapetal Programmed Cell Death and Pollen Development in Rice

    Directory of Open Access Journals (Sweden)

    Swee-Suak Ko

    2017-07-01

    Full Text Available Male sterility is important for hybrid seed production. Pollen development is regulated by a complex network. We previously showed that knockout of bHLH142 in rice (Oryza sativa causes pollen sterility by interrupting tapetal programmed cell death (PCD and bHLH142 coordinates with TDR to modulate the expression of EAT1. In this study, we demonstrated that overexpression of bHLH142 (OE142 under the control of the ubiquitin promoter also leads to male sterility in rice by triggering the premature onset of PCD. Protein of bHLH142 was found to accumulate specifically in the OE142 anthers. Overexpression of bHLH142 induced early expression of several key regulatory transcription factors in pollen development. In particular, the upregulation of EAT1 at the early stage of pollen development promoted premature PCD in the OE142 anthers, while its downregulation at the late stage impaired pollen development by suppressing genes involved in pollen wall biosynthesis, ROS scavenging and PCD. Collectively, these events led to male sterility in OE142. Analyses of related mutants further revealed the hierarchy of the pollen development regulatory gene network. Thus, the findings of this study advance our understanding of the central role played by bHLH142 in the regulatory network leading to pollen development in rice and how overexpression of its expression affects pollen development. Exploitation of this novel functionality of bHLH142 may confer a big advantage to hybrid seed production.

  9. Monitoring programmed cell death of living plant tissues in microfluidics using electrochemical and optical techniques

    DEFF Research Database (Denmark)

    Mark, Christina; Zor, Kinga; Heiskanen, Arto

    This project focuses on developing and applying a tissue culture system with electrochemical and optical detection techniques for tissue culture of barley aleurone layer to increase understanding of the underlying mechanisms of programmed cell death (PCD) in plants. The major advantage of electro......This project focuses on developing and applying a tissue culture system with electrochemical and optical detection techniques for tissue culture of barley aleurone layer to increase understanding of the underlying mechanisms of programmed cell death (PCD) in plants. The major advantage...... of electrochemical detection systems is that they can be miniaturized, multiplexed and automated without losing their performance[1,2]. Combining tissue culture with electrochemical and optical detection allows implementation of a wide range of assays for online, real-time, parallel analysis of important parameters......-system to electrochemically measure redox activity via changes in the NADP:NADPH ratio. Experiments show that redox activity changes depend on phytohormone activation or inactivation of aleurone layer metabolism and subsequent PCD. We have also successfully detected PCD induced by phytohormones in barley aleurone layer using...

  10. Nucleolar disruption and cajal body disassembly are nuclear hallmarks of DNA damage-induced neurodegeneration in purkinje cells.

    Science.gov (United States)

    Baltanás, Fernando C; Casafont, Iñigo; Weruaga, Eduardo; Alonso, José R; Berciano, María T; Lafarga, Miguel

    2011-07-01

    The Purkinje cell (PC) degeneration (pcd) phenotype results from mutation in nna1 gene and is associated with the degeneration and death of PCs during the postnatal life. Although the pcd mutation is a model of the ataxic mouse, it shares clinical and pathological characteristics of inherited human spinocerebellar ataxias. PC degeneration in pcd mice provides a useful neuronal system to study nuclear mechanisms involved in DNA damage-dependent neurodegeneration, particularly the contribution of nucleoli and Cajal bodies (CBs). Both nuclear structures are engaged in housekeeping functions for neuronal survival, the biogenesis of ribosomes and the maturation of snRNPs and snoRNPs required for pre-mRNA and pre-rRNA processing, respectively. In this study, we use ultrastructural analysis, in situ transcription assay and molecular markers for DNA damage, nucleoli and CB components to demonstrate that PC degeneration involves the progressive accumulation of nuclear DNA damage associated with disruption of nucleoli and CBs, disassembly of polyribosomes into monoribosomes, ribophagy and shut down of nucleolar and extranucleolar transcription. Microarray analysis reveals that four genes encoding repressors of nucleolar rRNA synthesis (p53, Rb, PTEN and SNF2) are upregulated in the cerebellum of pcd mice. Collectively, these data support that nucleolar and CB alterations are hallmarks of DNA damage-induced neurodegeneration. © 2010 The Authors. Brain Pathology © 2010 International Society of Neuropathology.

  11. High vacuum tribology of polycrystalline diamond coatings

    Indian Academy of Sciences (India)

    Coating surfaces with PCD offers exciting possibilities of substantially reducing the wear and possibly the friction of the critical moving mechanical assemblies. There are several mechanisms of friction proposed by different authors for diamond films. Gardos (1994, 1999) through his research over decades has proposed that ...

  12. DOWN-SYNDROME - EFFECTS OF DEMOGRAPHIC-FACTORS AND PRENATAL-DIAGNOSIS ON THE FUTURE LIVEBIRTH PREVALENCE

    NARCIS (Netherlands)

    CORNEL, MC; BREED, ASPM; BEEKHUIS, [No Value; MEERMAN, GJT; TENKATE, LP

    In northwest European countries maternal age is increasing. This will lead to an increase of the prevalence of Down syndrome conceptuses. Meanwhile, the increased use of prenatal cytogenetic diagnosis (PCD) will lead to a decrease in the prevalence of Down syndrome among livebirths. We were

  13. Evaluation of rotavirus dsRNA load in specimens and body fluids from experimentally infected juvenile macaques by real-time PCR.

    Science.gov (United States)

    Zhao, Wei; Xia, Mingjing; Bridges-Malveo, Tamika; Cantú, Mayra; McNeal, Monica M; Choi, Anthony H; Ward, Richard L; Sestak, Karol

    2005-10-25

    We recently established a non-human primate model of rotavirus infection that is characterized by consistent and high levels of virus antigen shedding in stools. Here, we report that starting from post challenge day (PCD) 2, 6 x 10(3) to 1.5 x 10(6) copies of rotavirus double-stranded RNA per nanogram of total RNA were detected by real-time PCR in MA104 cells that were 48 h pre-incubated with filtered stool suspensions of three experimentally infected juvenile macaques. The peak of virus load was detected at PCD 4-5, followed by decreased load at PCD 6-11, and very low levels at PCD 12. Such a pattern corresponded to virus shedding in stools as reported recently based on enzyme-linked immunosorbent assay (ELISA) results. In addition, plasma and cerebrospinal fluids (CSF) from six infected animals were tested for the presence of rotavirus. Rotavirus extraintestinal escape was revealed in three out of six animals by a combination of real-time and nested PCR. However, very low quantities of detected viral RNA (approximately 20 copies/ng of total RNA) were not suggestive of viremia. Thus, the rhesus model of rotavirus infection can be exploited further in studies with vaccine candidates designed to prevent or abrogate rotavirus infection.

  14. An all optical system for studying temperature induced changes in polycrystalline diamond deposited on a tungsten carbide substrate

    CSIR Research Space (South Africa)

    Masina, BN

    2010-09-01

    Full Text Available such that uniform temperature gradients can be created, thus allowing the study of thermal effects in the absence of thermal stresses. They make use of the known grey body emission from polycrystalline diamond (PCD). They show that uniform temperature alone can...

  15. Lessons From Unilateral Loss of Cilia: Early Nasal Nitric Oxide Gas Mixing and the Role of Sinus Patency in Determining Nasal Nitric Oxide.

    Science.gov (United States)

    Rodriguez, Kenneth; Gaston, Benjamin; Wasman, Jay; Marozkina, Nadzeya

    2017-01-01

    Nasal nitric oxide (nNO) measurement is a diagnostic test for primary ciliary dyskinesia (PCD). Here, we have shown the development of unilateral PCD-like symptoms associated with low nNO. A 60-year-old man had been previously healthy but developed unilateral, severe pansinusitis. He required surgical drainage of all left sinuses, and biopsies showed loss of the ciliated epithelium. At 4 weeks, he had unilateral (left-sided), profuse, clear rhinorrhea characteristic of PCD, and his surgical ostia were all patent endoscopically. His left-sided nNO was less than the right side by 37 ± 1.2 nL/min; this difference decreased to 18 ± 0.87 nL/min at 5 weeks and was gone by 6 weeks when his symptoms resolved. Measurements of 2- and 10-second measurements, in addition to standard nNO measurements, identified this discordance. We conclude that nNO reflects, in part, the production of NO by the ciliated epithelium, not just in the absence or occlusion of sinuses. Early (nasal/sinus volume) measures may be better for diagnosing PCD in than standard, steady-state assays in certain populations.

  16. Programmed cell death in plants and caspase-like activities

    NARCIS (Netherlands)

    Gaussand, Gwénael Martial Daniel Jean-Marie

    2007-01-01

    The development of multicellular organisms involves an important balance between cell growth, cell division and cell death. In animals, programmed cell death (PCD) plays a key role by forming and deleting structures, controlling cell numbers and eliminating abnormal damaged cells. Caspases were

  17. Programmed cell death – strategy for maintenance cellular organisms homeostasis

    Directory of Open Access Journals (Sweden)

    Mirosław Godlewski

    2016-12-01

    Full Text Available Programmed cell death (PCD is a cellular suicide process, commonly found in organisms, that is important for elimination unnecessary and damaged cells during development and adaptation to abiotic and biotic environmental stresses. PCD is a complex and precise, genetically controlled cellular process, in opposite to non-programmed death, necrosis, in which cells are “killed” by strong abiotic factors. This article shows: the occurrence of PCD during animals and plants ontogenesis, classification of cell death types in these organisms with description of autophagy, apoptosis and necrotic cell death and with discussion on plant cell death by apoptosis. The role of Bcl-2 protein and other proteins involved in the regulation of apoptosis induction and detection in the plant’s (whose genomes do not encode these proteins proteins of analogous function is also discussed. The paper also presents the effects of the expression of animals pro- and anti-apoptotic genes transformed into yeast and plants, and the use of transformed yeast as model to identify in cDNA libraries animal and plant genes involved in regulation of the induction and course of the PCD.

  18. Clinical care of children with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Lucas, Jane S; Alanin, Mikkel Christian; Collins, Samuel

    2017-01-01

    is inappropriate since differences in pathophysiology, morbidity and prognosis risk treatment failure and lack of adherence. Areas covered: Review authors searched PubMed and Cochrane databases for publications relating to management of children with PCD. Because of the paucity of data, we emphasise the need...

  19. Correlation between optical emission spectra and the process ...

    Indian Academy of Sciences (India)

    In this paper, the hydrogen and hydrogen-methane mixed plasma have been generated inside a 33 cm diameter quartz bell jar with a low power (9 KW) and lower frequency 915 MHz microwave plasma chemical vapor deposition system. The reactor is being used for growing polycrystalline diamond (PCD) over large area ...

  20. Peace and democracy go hand in hand — or do they? | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-09-08

    Sep 8, 2011 ... However, despite increased public voice at the local government level, this government often still remains hierarchical, corrupt, and marked by favoritism. The result is a low quality of democracy at local levels and potential for social conflict. Also concentrating on local democracy, PCD's fourth award went to ...

  1. A comparative machining study of diamond-coated tools made by ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Laboratory and field metal-cutting tests have shown that the performance of diamond- coated WC–Co inserts can be at least equal to that of conventional polycrystalline diamond (PCD). Some specific applications and working conditions are listed as follows: • machining of fibre reinforced plastics: profiling, turning, facing, ...

  2. Germs: Learn How Germs Work and What You Can Do to Protect Yourself

    Science.gov (United States)

    ... Accessed Dec. 2, 2016. In search of a germ theory equivalent of chronic disease. Centers for Disease Control and Prevention. http://www.cdc.gov/pcd/issues/2012/11_0301.htm. Accessed Dec. 5, 2016. ... . Mayo Clinic Footer Legal Conditions and ...

  3. Induction of a ricinosomal-protease and programmed cell death in tomato endosperm by gibberellic acid.

    Science.gov (United States)

    Trobacher, Christopher P; Senatore, Adriano; Holley, Christine; Greenwood, John S

    2013-03-01

    Several examples of programmed cell death (PCD) in plants utilize ricinosomes, organelles that appear prior to cell death and store inactive KDEL-tailed cysteine proteinases. Upon cell death, the contents of ricinosomes are released into the cell corpse where the proteinases are activated and proceed to degrade any remaining protein for use in adjacent cells or, in the case of nutritive seed tissues, by the growing seedling. Ricinosomes containing pro-SlCysEP have been observed in anther tissues prior to PCD and ricinosome-like structures have been observed in imbibed seeds within endosperm cells of tomato. The present study confirms that the structures in tomato endosperm cells contain pro-SlCysEP making them bona fide ricinosomes. The relative abundance of pro- versus mature SlCysEP is suggested to be a useful indicator of the degree of PCD that has occurred in tomato endosperm, and is supported by biochemical and structural data. This diagnostic tool is used to demonstrate that a sub-region of the micropylar endosperm surrounding the emerged radical is relatively long-lived and may serve to prevent loss of mobilized reserves from the lateral endosperm. We also demonstrate that GA-induced reserve mobilization, SlCysEP accumulation and processing, and PCD in tomato endosperm are antagonized by ABA.

  4. Il significato di centralità. Tecniche di densificazione dello spazio costruito / The meaning of centrality. Technique of densifying built space

    Directory of Open Access Journals (Sweden)

    Paolo Strina

    2014-11-01

    Full Text Available Il presente articolo indaga il termine centralità urbana, una delle parole chiave della ricerca Spinner 2013 Progettare il costruito: nuovi modelli a qualità integrata per la città compatta, in corso dal 2012. L’architettura si è spesso confrontata col significato di centralità urbana interpretandolo a seconda delle dinamiche evolutive che, via via, hanno guidato le scelte progettuali di sviluppo urbano. Il termine centralità è da intendersi nell'accezione di tipologia architettonica ma in primis nell'accezione simbolica di effetto comunitario, aggregativo e, in conclusione, di luogo. Essa si concretizza in un sistema insediativo complesso che conforma uno spazio di tipo centrifugo e allo stesso tempo centripeto, introverso e estroverso, capace di custodire in se la memoria del contesto di appartenenza da cui ha attinto i propri caratteri formali e, al contempo, costruire una memoria identitaria della comunità che lo abita e che lo abiterà. / This article investigates the term urban centrality, one of the key words of the 2013 Spinner Research Project: Designing the built: new models of integrated quality for the compact city, ongoing since 2012. Architecture has often had to deal with the meaning of urban centrality, interpreting it according to the evolutive dynamics that have gradually come to guide planning choices in urban development. The term centrality is to be understood in the sense of architectural typology, but in primis in the symbolic sense of its effect on the community, aggregation, and ultimately, the place itself. It becomes concrete within a complex settlement system that shapes a space of a centrifugal and centripetal type, both introvert and extrovert, that can hoard the memory of the context of belonging from whose formal characteristics it has drawn and, at the same time, build an identity memory of the community that inhabits and will continue to inhabit it.

  5. Optimum geometry for boiler soot blowers nozzles; Geometria optima de toberas para deshollinadores de caldera

    Energy Technology Data Exchange (ETDEWEB)

    Espinoza Garza, Jesus; Garcia Tinoco, Guillermo J.; Martinez Flores, Jose Oscar [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1989-12-31

    For boiler soot blowing converging-diverging nozzles are employed, whose function is to convert thermal energy of a gas into kinetic energy to remove the deposits that adhere to the heat exchanger surfaces. In this paper are described the experimental equipment and the methods for flow, dynamic pressure, discharge velocity and air expansion factor calculation in each nozzle, as a function of its design geometry, utilizing air from a five stage centrifugal compressor. The graphic analysis of the results, concludes that the most efficient nozzles are not the ones than develop the greatest velocity, but the ones of highest dynamic pressure at the outlet. The nozzle geometry that allows obtaining the maximum dynamic air pressure at the discharge is A{sub 2}/A{sub g}=1.3676 [Espanol] Para el deshollinado de calderas se utilizan las toberas convergentes-divergentes, cuya funcion es convertir la energia termica de un gas en energia cinetica para remover los depositos que se adhieren a las superficies de intercambio de calor. En este trabajo se describen el equipo experimental y los metodos de calculo para flujo, presion dinamica, velocidad a la descarga y factor de expansion del aire en cada tobera, como funcion de su geometria de diseno. Durante la experimentacion se evaluaron siete disenos diferentes de toberas, empleando aire de un compresor centrifugo de cinco etapas. Del analisis grafico de los resultados, se concluye que las toberas mas eficientes no son las que desarrollan mayor velocidad sino las de mayor presion dinamica de la salida. La geometria de tobera que permite obtener la maxima presion dinamica del aire a la descarga es A{sub 2}/A{sub g} = 1.3676.

  6. The polyadenylation factor subunit CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR30: A key factor of programmed cell death and a regulator of immunity in arabidopsis

    KAUST Repository

    Bruggeman, Quentin

    2014-04-04

    Programmed cell death (PCD) is essential for several aspects of plant life, including development and stress responses. Indeed, incompatible plant-pathogen interactions are well known to induce the hypersensitive response, a localized cell death. Mutational analyses have identified several key PCD components, and we recently identified the mips1 mutant of Arabidopsis (Arabidopsis thaliana), which is deficient for the key enzyme catalyzing the limiting step of myoinositol synthesis. One of the most striking features of mips1 is the light-dependent formation of lesions on leaves due to salicylic acid (SA)-dependent PCD, revealing roles for myoinositol or inositol derivatives in the regulation of PCD. Here, we identified a regulator of plant PCD by screening for mutants that display transcriptomic profiles opposing that of the mips1 mutant. Our screen identified the oxt6 mutant, which has been described previously as being tolerant to oxidative stress. In the oxt6 mutant, a transfer DNA is inserted in the CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR30 (CPSF30) gene, which encodes a polyadenylation factor subunit homolog. We show that CPSF30 is required for lesion formation in mips1 via SA-dependent signaling, that the prodeath function of CPSF30 is not mediated by changes in the glutathione status, and that CPSF30 activity is required for Pseudomonas syringae resistance. We also show that the oxt6 mutation suppresses cell death in other lesion-mimic mutants, including lesion-simulating disease1, mitogen-activated protein kinase4, constitutive expressor of pathogenesis-related genes5, and catalase2, suggesting that CPSF30 and, thus, the control of messenger RNA 3′ end processing, through the regulation of SA production, is a key component of plant immune responses. © 2014 American Society of Plant Biologists. All rights reserved.

  7. Cellular and Molecular Changes Associated with Onion Skin Formation Suggest Involvement of Programmed Cell Death

    Science.gov (United States)

    Galsurker, Ortal; Doron-Faigenboim, Adi; Teper-Bamnolker, Paula; Daus, Avinoam; Fridman, Yael; Lers, Amnon; Eshel, Dani

    2017-01-01

    Skin formation of onion (Allium cepa L.) bulb involves scale desiccation accompanied by scale senescence, resulting in cell death and tissue browning. Understanding the mechanism of skin formation is essential to improving onion skin and bulb qualities. Although onion skin plays a crucial role in postharvest onion storage and shelf life, its formation is poorly understood. We investigated the mode of cell death in the outermost scales that are destined to form the onion skin. Surprisingly, fluorescein diacetate staining and scanning electron microscopy indicated that the outer scale desiccates from the inside out. This striking observation suggests that cell death in the outer scales, during skin formation, is an internal and organized process that does not derive only from air desiccation. DNA fragmentation, a known hallmark of programmed cell death (PCD), was revealed in the outer scales and gradually decreased toward the inner scales of the bulb. Transmission electron microscopy further revealed PCD-related structural alterations in the outer scales which were absent from the inner scales. De novo transcriptome assembly for three different scales: 1st (outer), 5th (intermediate) and 8th (inner) fleshy scales identified 2,542 differentially expressed genes among them. GO enrichment for cluster analysis revealed increasing metabolic processes in the outer senescent scale related to defense response, PCD processes, carbohydrate metabolism and flavonoid biosynthesis, whereas increased metabolism and developmental growth processes were identified in the inner scales. High expression levels of PCD-related genes were identified in the outer scale compared to the inner ones, highlighting the involvement of PCD in outer-skin development. These findings suggest that a program to form the dry protective skin exists and functions only in the outer scales of onion. PMID:28119713

  8. Effects of Per-diem payment on the duration of hospitalization and medical expenses according to the palliative care demonstration project in Korea.

    Science.gov (United States)

    Shin, J Y; Yoon, S J; Ahn, H S; Yun, Y H

    2017-04-01

    The aim of this study was to examine the impacts of a government-directed palliative care demonstration (PCD) project, Per-diem Payment System (PDPS), on length of stay (LOS), hospital costs, resource usage and healthcare quality during the searched period from January in 2009 to December in 2010. A retrospective claim data review. Individuals who had been eligible for the palliative care payment policy, PDPS, during 2 years (from 2009 to 2010) were assigned to the case group including seven hospitals (n = 3117). Those (seven hospitals) who were not come eligible for the palliative care payment policy were assigned to the control group (n = 2347) with fee for service. The data used in this study were electronically submitted requests of payment to the Health Insurance Review Agency during the period January 2009 to December 2010. After the PCD project, the length of stay for palliative patients with cancer diseases decreased by 2.56% (β = -0.026; p-value = 0.0001) among patients hospitalized in a PCD project compared with patients hospitalized in seven hospitals that was not designed as a PCD project. Compared with costs before the PCD project, costs decreased by 0.76% (β = 0.013; p-value = 0.0001). We provided evidence regarding the change in the societal burden due to palliative care. Although there was a reduction of direct medical costs reported in limited number of hospitals, in the long term, we can anticipate an expanding impact on medical costs in all palliative hospitals. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  9. The choice of regimens based on bortezomib for patients with newly diagnosed multiple myeloma.

    Directory of Open Access Journals (Sweden)

    Jingsong He

    Full Text Available INTRODUCTION: Bortezomib has significantly improved multiple myeloma (MM response rates, but strategies for choosing bortezomib-based regimens for initial MM therapy are not standardized. Here, we describe four bortezomib-based therapies in Chinese MM patients to determine the optimal chemotherapeutic approach. METHODS: Newly diagnosed symptomatic MM patients at three hematological centers between February 1, 2006 and May 31, 2013 were treated with therapies including bortezomib plus dexamethasone (PD or combinations of PD with either adriamycin (PAD, cyclophosphamide (PCD or thalidomide (PTD for every 28 days. RESULTS: The overall response rate of all the 215 eligible patients was 90.2%. The ORR for PCD, PAD, PTD and PD were 97.4%, 93.2%, 85.3% and 77.8% while the effects with VGPR or better were 63.7%, 62.7%, 44.2% and 37.8%, respectively. The effect of ORR, VGPR and CR/nCR for the PCD regimen was better than the PD protocol. Median PFS for all patients was 29.0 months with significant differences observed among treatment groups. Median OS of all the patients was not reached, but three-drug combinations were superior to PD alone. Frequently observed toxicities were neutropenia, thrombocytopenia, fatigue, infection, herpes zoster, and peripheral neuropathy. The incidence of peripheral neuropathy (PN in PTD group was significantly higher than other three groups, especially grade 2-3 PN. Treatment with anti-viral agent acyclovir significantly reduced the incidence of herpes zoster. CONCLUSIONS: Our experience indicated that bortezomib-based regimens were effective and well-tolerated in the Chinese population studied; three-drug combinations PCD, PAD were superior to PD, especially with respect to PCD.

  10. Anhydrobiosis and programmed cell death in plants: Commonalities and Differences

    Directory of Open Access Journals (Sweden)

    Samer Singh

    2015-05-01

    Full Text Available Anhydrobiosis is an adaptive strategy of certain organisms or specialised propagules to survive in the absence of water while programmed cell death (PCD is a finely tuned cellular process of the selective elimination of targeted cell during developmental programme and perturbed biotic and abiotic conditions. Particularly during water stress both the strategies serve single purpose i.e., survival indicating PCD may also function as an adaptive process under certain conditions. During stress conditions PCD cause targeted cells death in order to keep the homeostatic balance required for the organism survival, whereas anhydrobiosis suspends cellular metabolic functions mimicking a state similar to death until reestablishment of the favourable conditions. Anhydrobiosis is commonly observed among organisms that have ability to revive their metabolism on rehydration after removal of all or almost all cellular water without damage. This feature is widely represented in terrestrial cyanobacteria and bryophytes where it is very common in both vegetative and reproductive stages of life-cycle. In the course of evolution, with the development of advanced vascular system in higher plants, anhydrobiosis was gradually lost from the vegetative phase of life-cycle. Though it is retained in resurrection plants that primarily belong to thallophytes and a small group of vascular angiosperm, it can be mostly found restricted in orthodox seeds of higher plants. On the contrary, PCD is a common process in all eukaryotes from unicellular to multicellular organisms including higher plants and mammals. In this review we discuss physiological and biochemical commonalities and differences between anhydrobiosis and PCD.

  11. Ricinosomes: an organelle for developmentally regulated programmed cell death in senescing plant tissues

    Science.gov (United States)

    Gietl, C.; Schmid, M.

    2001-02-01

    This review describes aspects of programmed cell death (PCD). Present research maps the enzymes involved and explores the signal transduction pathways involved in their synthesis. A special organelle (the ricinosome) has been discovered in the senescing endosperm of germinating castor beans (Ricinus communis) that develops at the beginning of PCD and delivers large amounts of a papain-type cysteine endopeptidase (CysEP) in the final stages of cellular disintegration. Castor beans store oil and proteins in a living endosperm surrounding the cotyledons. These stores are mobilized during germination and transferred into the cotyledons. PCD is initiated after this transfer is complete. The CysEP is synthesized in the lumen of the endoplasmic reticulum (ER) where it is retained by its C-terminal KDEL peptide as a rather inactive pro-enzyme. Large number of ricinosomes bud from the ER at the same time as the nuclear DNA is characteristically fragmented during PCD. The mitochondria, glyoxysomes and ribosomes are degraded in autophagic vacuoles, while the endopeptidase is activated by removal of the propeptide and the KDEL tail and enters the cytosol. The endosperm dries and detaches from the cotyledons. A homologous KDEL-tailed cysteine endopeptidase has been found in several senescing tissues; it has been localized in ricinosomes of withering day-lily petals and dying seed coats. Three genes for a KDEL-tailed cysteine endopeptidase have been identified in Arabidopsis. One is expressed in senescing ovules, the second in the vascular vessels and the third in maturing siliques. These genes open the way to exploring PCD in plants.

  12. Development of active immunity in newborn pigs with colostral antibodies by vaccination with gIII-deleted PRV.

    Science.gov (United States)

    Kit, S; Kit, M; McConnell, S; Lawhorn, B

    1994-01-01

    Maternal antibodies interfere with active immunization of swine by gI-deleted pseudorabies virus [(PRV); Aujeszky's disease virus] vaccines. To test the hypothesis that modified-live (MLV) vaccines retaining the PRV gI and with deletions in the PRV glycoprotein gIII and thymidine kinase (TK) genes might be efficacious in circumventing colostral antibody interference, the OMNI-MARK-PRV (gI+ gIII- TK-) vaccine was administered intramuscularly to 13 newborn pigs with colostral antibodies, while 10 pigs from the same litters served as nonvaccinated controls. At 49 days of age, when PRV virus neutralization (VN) antibodies were negative and all nonvaccinated pigs as well as 10 vaccinates were latex agglutination test (LAT)-negative, the pigs were challenged intranasally with the virulent PRV(SHOPE) strain. In support of the hypothesis, it was found that several central nervous system and respiratory disease signs developed in 6 of 10 nonvaccinates, with one fatality, while 2 of 13 vaccinates showed only very mild and transient disease signs. Nonvaccinates lost weight until post challenge day (PCD) 6, did not regain prechallenge weight until PCD 8, and at PCD 11 had gained only 4.9 pounds/pig. Vaccinates gained weight after challenge and at PCD 11 showed a 9.4 pounds/pig weight gain. On PCD 11, the geometric mean titer (GMT) for VN antibodies of the nonvaccinates was 9.3, while the GMT of the vaccinates for VN antibodies was 49.0, showing that vaccinated pigs had been immunologically primed.

  13. Ensaio de aplicabilidade in vitro do sistema dinâmico do quadril AF(DHS- AF In vitro applicability test of the AF dynamic hip system (DHS-AF

    Directory of Open Access Journals (Sweden)

    Anderson Freitas

    2011-04-01

    Full Text Available OBJETIVO: Apresentar os resultados obtidos em ensaios de aplicabilidade de uma placa do tipo sistema dinâmico do quadril modificado, que permite a manipulação ou troca do parafuso deslizante, sem que haja necessidade da retirada de todo o sistema. MÉTODO: Foram utilizadas cinco placas do tipo sistema dinâmico do quadril modificado (DHS- AFpat.req., fabricadas por uma empresa nacional, produzidas em aço inoxidável austenítico ASTM F 138, com quatro furos e ângulo de 135o, as quais foram aplicadas a cinco segmentos de osso sintético de fêmur proximal da marca Synbone. Todos os implantes foram fixados ao osso sintético, seguindo as técnicas cirúrgicas descritas pela fundação AO (Arbeitsgemeinschaft für Osteosynthesefragen. RESULTADOS: Todas as placas do sistema dinâmico do quadril modificado (DHS-AF permitiram facilidade na manipulação e a troca do pino deslizante sem a necessidade de retirada da placa. CONCLUSÃO: Os testes in vitro de aplicabilidade do DHS-AF nos forneceram resultados promissores e nos levaram a acreditar que, após avaliações biomecânicas, para confirmar a sua segurança, podem ser reproduzidos in vivo.OBJECTIVE: This report considers the results of the applicability test of a modified dynamic hip system developed by the authors, which allows either the manipulation or the exchange of the sliding screw, without the need to remove the plate and take all the system apart in order to change its size or position. METHODS: Five modified plates - DHS-AF - manufactured with austenitic stainless steel ASTM F 138, with 4 holes and a 135o angle were inserted in five segments of synthetic bone of proximal femur (Synbone. All implants were fixed to the femur following the surgical techniques described by AO foundation (Arbeitsgemeinschaft für Osteosynthesefragen. RESULTS: The modified dynamic hip system (DHS-AF allowed ease in handling and exchange of sliding screw without the need for plate removal. CONCLUSION: In

  14. Cascaded systems analysis of photon counting detectors.

    Science.gov (United States)

    Xu, J; Zbijewski, W; Gang, G; Stayman, J W; Taguchi, K; Lundqvist, M; Fredenberg, E; Carrino, J A; Siewerdsen, J H

    2014-10-01

    Photon counting detectors (PCDs) are an emerging technology with applications in spectral and low-dose radiographic and tomographic imaging. This paper develops an analytical model of PCD imaging performance, including the system gain, modulation transfer function (MTF), noise-power spectrum (NPS), and detective quantum efficiency (DQE). A cascaded systems analysis model describing the propagation of quanta through the imaging chain was developed. The model was validated in comparison to the physical performance of a silicon-strip PCD implemented on an experimental imaging bench. The signal response, MTF, and NPS were measured and compared to theory as a function of exposure conditions (70 kVp, 1-7 mA), detector threshold, and readout mode (i.e., the option for coincidence detection). The model sheds new light on the dependence of spatial resolution, charge sharing, and additive noise effects on threshold selection and was used to investigate the factors governing PCD performance, including the fundamental advantages and limitations of PCDs in comparison to energy-integrating detectors (EIDs) in the linear regime for which pulse pileup can be ignored. The detector exhibited highly linear mean signal response across the system operating range and agreed well with theoretical prediction, as did the system MTF and NPS. The DQE analyzed as a function of kilovolt (peak), exposure, detector threshold, and readout mode revealed important considerations for system optimization. The model also demonstrated the important implications of false counts from both additive electronic noise and charge sharing and highlighted the system design and operational parameters that most affect detector performance in the presence of such factors: for example, increasing the detector threshold from 0 to 100 (arbitrary units of pulse height threshold roughly equivalent to 0.5 and 6 keV energy threshold, respectively), increased the f50 (spatial-frequency at which the MTF falls to a value of

  15. A supramolecular ''Double-cable'' structure with a 129{sub 44} helix in a columnar porphyrin-C{sub 60} dyad and its application in polymer solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chien-Lung [College of Polymer Science and Polymer Engineering, The University of Akron, Akron, OH (United States); Department of Applied Chemistry, National Chiao Tung University, Hsinchu, Taiwan (China); Zhang, Wen-Bin; Sun, Hao-Jan; Van Horn, Ryan M.; Kulkarni, Rahul R.; Tsai, Chi-Chun; Gong, Xiong; Cheng, Stephen Z.D. [College of Polymer Science and Polymer Engineering, The University of Akron, Akron, OH (United States); Hsu, Chain-Shu [Department of Applied Chemistry, National Chiao Tung University, Hsinchu, Taiwan (China); Lotz, Bernard [Institut Charles Sadron, Strasbourg (France)

    2012-11-15

    A novel porphyrin-C{sub 60} dyad (PCD1) is designed and synthesized to investigate and manipulate the supramolecular structure where geometrically isotropic [such as [60]fullerene (C{sub 60})] and anisotropic [such as porphyrin (Por)] units coexist. It is observed that PCD1 possesses an enantiomeric phase behavior. The melting temperature of the stable PCD1 thermotropic phase is 160 C with a latent heat ({Delta}H) of 18.5 kJ mol{sup -1}. The phase formation is majorly driven by the cooperative intermolecular Por-Por and C{sub 60}-C{sub 60} interactions. Structural analysis reveals that this stable phase possesses a supramolecular ''double-cable'' structure with one p-type Por core columnar channel and three helical n-type C{sub 60} peripheral channels. These ''double-cable'' columns further pack into a hexagonal lattice with a = b = 4.65 nm, c = 41.3 nm, {alpha} = {beta} = 90 , and {gamma} = 120 . The column repeat unit is determined to possess a 129{sub 44} helix. With both donor (D; Pro) and acceptor (A; C{sub 60}) units having their own connecting channels as well as the large D/A interface within the supramolecular ''double-cable'' structure, PCD1 has photogenerated carriers with longer lifetimes compared to the conventional electron acceptor [6,6]-phenyl-C{sub 61}-butyric acid methyl ester. A phase-separated columnar morphology is observed in a bulk-heterojunction (BHJ) material made by the physical blend of a low band-gap conjugated polymer, poly[2,6-(4,4-bis-(2-ethylhexyl)-4H-cyclopenta [2,1-b;3,4-b']-dithiophene)-alt-4,7-(2,1,3-benzothia-diazole)] (PCPDTBT), and PCD1. With a specific phase structure in the solid state and in the blend, PCD1 is shown to be a promising candidate as a new electron acceptor in high performance BHJ polymer solar cells. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Ligation of CD40 in Human Müller Cells Induces P2X7 Receptor–Dependent Death of Retinal Endothelial Cells

    Science.gov (United States)

    Portillo, Jose-Andres C.; Lopez Corcino, Yalitza; Dubyak, George R.; Kern, Timothy S.; Matsuyama, Shigemi; Subauste, Carlos S.

    2016-01-01

    Purpose Cluster of differentiation 40 (CD40) is required for retinal capillary degeneration in diabetic mice, a process mediated by the retinal endothelial cells (REC) death. However, CD40 activates prosurvival signals in endothelial cells. The purpose of this study was to identify a mechanism by which CD40 triggers programmed cell death (PCD) of RECs and address this paradox. Methods Human RECs and Müller cells were incubated with CD154 and L-N6-(1-Iminoethyl)lysine (L-Nil, nitric oxide synthase 2 inhibitor), α-lipoic acid (inhibitor of oxidative stress), anti-Fas ligand antibody, or A-438079 (P2X7 adenosine triphosphate [ATP] receptor inhibitor). Programmed cell death was analyzed by fluorescence-activated cell sorting (FACS) or Hoechst/propidium iodide staining. Release of ATP was measured using a luciferase-based assay. Mice were made diabetic with streptozotocin. Expression of P2X7 was assessed by FACS, quantitative PCR, or immunohistochemistry. Results Ligation of CD40 in primary RECs did not induce PCD. In contrast, in the presence of primary CD40+ Müller cells, CD40 stimulation caused PCD of RECs that was not impaired by L-Nil, α-lipoic acid, or anti-Fas ligand antibody. We found CD40 did not trigger TNF-α or IL-1β secretion. Primary Müller cells released extracellular ATP in response to CD40 ligation. Inhibition of P2X7 (A-438079) impaired PCD of RECs; CD40 upregulated P2X7 in RECs, making them susceptible to ATP/P2X7–mediated PCD. Diabetic mice upregulated P2X7 in the retina and RECs in a CD40-dependent manner. Conclusions Cluster of differentiation 40 induces PCD of RECs through a dual mechanism: ATP release by Müller cells and P2X7 upregulation in RECs. These findings are likely of in vivo relevance since CD40 upregulates P2X7 in RECs in diabetic mice and CD40 is known to be required for retinal capillary degeneration. PMID:27893093

  17. [Ceramide participates in cell programmed death induced by Type II anti-CD20 mAb].

    Science.gov (United States)

    Huang, Yan; Wu, Sun; Zhang, Yuan; Zi, Youmei; Yang, Man; Guo, Yan; Zhang, Lingxiu; Wang, Lihua

    2015-12-01

    To explore the exact mechanisms of programmed cell death (PCD) induced by Type II anti-CD20 mAb in CD20+ non-Hodgkin lymphoma (NHL) cells, and to provide theoretical basis for anti-tumor ability of new CD20 mAb.
 After incubation with Rituximab (a Type I anti-CD20 mAb) and Tositumomab (a Type II anti-CD20 mAb), Raji cells were stained by annexin V & propidium iodide (PI). The ratio of programmed death cells were measured by two channel flow cytometry (FCM). Before the treatment of anti-CD20 mAbs, Raji cells was incubated with a caspase inhibitor carbobenzoxy-valyl-alanyl-aspartyl-[O-methyl]- fluoromethylketone (Z-VAD-FMK) and a dihydroceramide synthase inhibitor fumonisin B1 (FB1) for 30 minutes to assess their inhibitory effect on PCD. High performance liquid chromatography (HPLC) was utilized to compare the ratio of programmed death cells between the pretreatment group (treated by Rituximab and Tositumomab) and the non-pretreatment group. The anti-CD20 mAbs-treated Raji cells were collected, and the ceramide levels in the Raji cells in the different pretreatment groups were also examined by HPLC, and the inhibitory effect of FB1 on the changes of ceramide levels in the Raji cells was measured. The Raji cells were incubated with different concentration C2-ceramide, C2-Ceramide-induced PCD was also evaluated by annexin V & PI staining after 16 hours. 
 Tositumomab (10 µg/mL) but not Rituximab (10 µg/mL) can induce significant PCD (28.6±4.2)% in Raji cells, with significant difference (t=26.48, P0.05). The cellular ceramide levels in Raji cells were significantly elevated after the treatment of Tositumomab (t=28.48, P0.05). The dihydroceramide synthase inhibitor FB1 can significantly inhibit the elevated cellular ceramide levels (F=20.18, P<0.01) and cell programmed death induced by Tositumomab (F=17.02, P<0.01).
 Type II but not Type I anti-CD20 mAbs can induce caspase independent PCD in CD20+ NHL cells through the elevation of cellular ceramide levels

  18. Genome-wide identification of genes involved in the positive and negative regulation of acetic acid-induced programmed cell death in Saccharomyces cerevisiae.

    Science.gov (United States)

    Sousa, Marlene; Duarte, Ana Marta; Fernandes, Tânia R; Chaves, Susana R; Pacheco, Andreia; Leão, Cecília; Côrte-Real, Manuela; Sousa, Maria João

    2013-11-28

    Acetic acid is mostly known as a toxic by-product of alcoholic fermentation carried out by Saccharomyces cerevisiae, which it frequently impairs. The more recent finding that acetic acid triggers apoptotic programmed cell death (PCD) in yeast sparked an interest to develop strategies to modulate this process, to improve several biotechnological applications, but also for biomedical research. Indeed, acetate can trigger apoptosis in cancer cells, suggesting its exploitation as an anticancer compound. Therefore, we aimed to identify genes involved in the positive and negative regulation of acetic acid-induced PCD by optimizing a functional analysis of a yeast Euroscarf knock-out mutant collection. The screen consisted of exposing the mutant strains to acetic acid in YPD medium, pH 3.0, in 96-well plates, and subsequently evaluating the presence of culturable cells at different time points. Several functional categories emerged as greatly relevant for modulation of acetic acid-induced PCD (e.g.: mitochondrial function, transcription of glucose-repressed genes, protein synthesis and modifications, and vesicular traffic for protection, or amino acid transport and biosynthesis, oxidative stress response, cell growth and differentiation, protein phosphorylation and histone deacetylation for its execution). Known pro-apoptotic and anti-apoptotic genes were found, validating the approach developed. Metabolism stood out as a main regulator of this process, since impairment of major carbohydrate metabolic pathways conferred resistance to acetic acid-induced PCD. Among these, lipid catabolism arose as one of the most significant new functions identified. The results also showed that many of the cellular and metabolic features that constitute hallmarks of tumour cells (such as higher glycolytic energetic dependence, lower mitochondrial functionality, increased cell division and metabolite synthesis) confer sensitivity to acetic acid-induced PCD, potentially explaining why

  19. Transmit Energy Efficiency of Two Cognitive Radar Platforms for Target Identification

    Directory of Open Access Journals (Sweden)

    Ric Romero

    2015-06-01

    Full Text Available Cognitive radar (CRr is a recent radar paradigm that can potentially help drive aerospace innovation forward. Two specific platforms of cognitive radar used for target identification are discussed. One uses sequential hypothesis testing (SHT in the receiver processing and is referred to as SHT-CRr and the other one uses maximum a posteriori (MAP and is referred to as MAP-CRr. Our main goal in this article is to make a practical comparison between SHT-CRr and MAP-CRr platforms in terms of transmission energy efficiency. Since the performance metric for the SHT-CRr is the average number of illuminations (ANI and the performance metric for MAP-CRr is the percentage of correct decisions (\\(P_{cd}\\, a direct comparison between the platforms is difficult to perform. In this work, we introduce a useful procedure that involves a metric called total transmit energy (TTE given a fixed \\(P_{cd}\\ as a metric to measure the transmit energy efficiency of both platforms. Lower TTE means that the platform is more efficient in achieving a desired \\(P_{cd}\\. To facilitate a robust comparison, a transmit-adaptive waveform that consistently outperforms the pulsed waveform in terms of both \\(P_{cd}\\ and ANI is needed. We show that a certain adaptive waveform called the probability weighted energy signal-to-noise ratio-based (PWE-SNR waveform outperforms the pulsed wideband waveform (i.e., flat frequency response in terms of ANI and \\(P_{cd}\\ for all ranges of transmit waveform energy. We also note that the \\(P_{cd}\\ performance of SHT-CRr can be drastically different from the probability threshold (i.e., the probability value that is used to stop radar illumination for the purposes of classification, which is critically important for CRr system designers to realize. Indeed, this fact turns out to be key in accomplishing our goal to compare SHT-CRr and MAP-CRr in terms of transmit energy efficiency.

  20. Maximum power point tracking in PV systems based on adaptive control and sliding mode control

    Directory of Open Access Journals (Sweden)

    Paula Andrea Ortiz-Valencia

    2015-01-01

    Full Text Available Los sistemas fotovoltaicos (PV son comúnmente controlados utilizando estructuras PI o PID, las cuales no pueden asegurar estabilidad global y un tiempo de establecimiento constante. Por esto, los algoritmos de optimización, e.g. Perturbar y Observar (P&O, son diseñados utilizando el tiempo de establecimiento más alto en el rango de operación, lo cual produce una búsqueda lenta del punto de máxima potencia (MPP para gran parte del rango de operación, introduciendo pérdidas dinámicas de potencia al sistema. Este artículo propone combinar un controlador adaptativo y un controlador de corriente por modos deslizantes (SMCC para garantizar estabilidad global y un tiempo de establecimiento constante para cualquier condición de operación, lo que permite incrementar la potencia generada en comparación con controladores PI y PID. El SMCC permite mitigar las perturbaciones del sistema y garantizar estabilidad global, mientras que el controlador adaptativo define la referencia del SMCC para asegurar un tiempo de estabilización constante. El diseño de la nueva estructura de control se soporta con análisis matemáticos y simulaciones realizadas en Matlab® para validar la robustez del sistema.

  1. Autopista Tarragona – Valencia - España

    Directory of Open Access Journals (Sweden)

    Fernández Sánchez, R.

    1974-07-01

    Full Text Available The present article describes the construction of the stretch Puzol-Castellón of the Mediterranean Highway in which for the second time the Californian techniques of rigid pavements have been used in a Spanish highway: bases of gravel-cement and slabs of mass concrete, with oblique, sawn, unsealed joints. This system is especially appropriate for the use of sliding shutterings which means greater savings and faster execution of the roadbed.En el presente artículo se describe la construcción del tramo Puzol-Castellón de la Autopista del Mediterráneo, en el que por segunda vez se han utilizado en una autopista española las técnicas californianas de pavimentos rígidos: bases de grava-cemento y losas de hormigón en masa, con juntas oblicuas serradas y sin sellar. Este sistema está especialmente adecuado para la utilización de equipos de encofrados deslizantes, lo que se traduce en una mayor economía y rapidez en la ejecución del firme.

  2. Delimitación de zonas susceptibles a filtraciones en el túnel Serones-Salida Guaro del Trasvase Este-Oeste

    Directory of Open Access Journals (Sweden)

    José A. Otaño-Noguel

    2009-03-01

    Full Text Available La existencia de flujos de agua subterránea en un macizo rocoso muy agrietado, unido a un relieve favorable al escurrimiento superficial, facilita la infiltración del agua hacia el interior de los túneles, laboreados al nivel del manto freático o por debajo de éste, en el Trasvase Este-Oeste que se construye en la provincia de Holguín, Cuba. Como consecuencia, se producen inundaciones arciales y derrumbes por la pérdida de resistencia de las rocas o por el lavado del relleno de las grietas. Para adoptar medidas correctoras que aumenten la seguridad de las excavaciones y garanticen una mayor estabilidad de las obras es necesaria la delimitación de las áreas susceptibles a inundaciones y derrumbes por infiltración del agua. Mediante la combinación de métodos geomecánicos de análisis de macizos, estudios hidrogeológicos y cartografía digital se delimitaron, para el túnel Serones-Salida Guaro, cuatro zonas muy susceptibles por infiltración atendiendo a su alta permeabilidad (más de 10 m/día y a su ubicación en la intersección de dos sistemas de fallas donde han ocurrido movimientos rumbo-deslizantes.

  3. ORF Alignment: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available thetic construct] gb|AAF20323.1| GAL4 DNA ... binding domain [Yeast 2-hybrid vector pCD.2] ... ... gb|AAF20318.1| GAL4 DNA binding domain [Yeast 2-hybrid ... vector pCD.1] gb|AAB49955.1| GAL4p [Cloning vector... ... pGBDU-C3] gb|AAB49952.1| GAL4p [Cloning vector pGBDU-C2] ... ... ... gb|AAB49949.1| GAL4p [Cloning vector pGBDU-C1] ... gb|AAB49946.1| GAL4p [Cloning vector pGBD-...C3] ... gb|AAB49943.1| GAL4p [Cloning vector pGBD-C2] ... gb|AAB49940.1| GAL4p [Cloning vector

  4. Evolution and adaptation of Pseudomonas aeruginosa in cystic fibrosis airways

    DEFF Research Database (Denmark)

    Madsen Sommer, Lea Mette

    adaptational patterns.However, the genetic overlap between CF and PCD isolates did not extend to a phenotypic overlap, which indicates that the mucus, which is different in CF patients compared to PCD patients, is a significant selective factor for the evolution and adaptation of P. aeruginosa...... of evolution to these observations, this thesis shows that collections of longitudinal P. aeruginosa isolates from CF patients provide a valuable basis for the study of adaptation and evolution in natural environments....... laboratory experiments, with a high degree of control and rigour. But to truly understand evolution and the complex mechanisms it deploys, it is necessary to combine the laboratory learnings with investigations of natural systems. –Though, this can be tricky. Because of the heterogeneity and constant change...

  5. Vision 20/20: Single photon counting x-ray detectors in medical imaging.

    Science.gov (United States)

    Taguchi, Katsuyuki; Iwanczyk, Jan S

    2013-10-01

    Photon counting detectors (PCDs) with energy discrimination capabilities have been developed for medical x-ray computed tomography (CT) and x-ray (XR) imaging. Using detection mechanisms that are completely different from the current energy integrating detectors and measuring the material information of the object to be imaged, these PCDs have the potential not only to improve the current CT and XR images, such as dose reduction, but also to open revolutionary novel applications such as molecular CT and XR imaging. The performance of PCDs is not flawless, however, and it seems extremely challenging to develop PCDs with close to ideal characteristics. In this paper, the authors offer our vision for the future of PCD-CT and PCD-XR with the review of the current status and the prediction of (1) detector technologies, (2) imaging technologies, (3) system technologies, and (4) potential clinical benefits with PCDs.

  6. The nexin-dynein regulatory complex subunit DRC1 is essential for motile cilia function in algae and humans.

    Science.gov (United States)

    Wirschell, Maureen; Olbrich, Heike; Werner, Claudius; Tritschler, Douglas; Bower, Raqual; Sale, Winfield S; Loges, Niki T; Pennekamp, Petra; Lindberg, Sven; Stenram, Unne; Carlén, Birgitta; Horak, Elisabeth; Köhler, Gabriele; Nürnberg, Peter; Nürnberg, Gudrun; Porter, Mary E; Omran, Heymut

    2013-03-01

    Primary ciliary dyskinesia (PCD) is characterized by dysfunction of respiratory cilia and sperm flagella and random determination of visceral asymmetry. Here, we identify the DRC1 subunit of the nexin-dynein regulatory complex (N-DRC), an axonemal structure critical for the regulation of dynein motors, and show that mutations in the gene encoding DRC1, CCDC164, are involved in PCD pathogenesis. Loss-of-function mutations disrupting DRC1 result in severe defects in assembly of the N-DRC structure and defective ciliary movement in Chlamydomonas reinhardtii and humans. Our results highlight a role for N-DRC integrity in regulating ciliary beating and provide the first direct evidence that mutations in DRC genes cause human disease.

  7. Using microfluidics to study programmed cell death: A new approach

    DEFF Research Database (Denmark)

    Mark, Christina; Zor, Kinga; Heiskanen, Arto

    This project focuses on applying microfluidic tissue culture for electrochemical or optical measurements during programmed cell death (PCD) in barley aleurone layer to increase understanding of the underlying mechanisms of PCD in plants. Microfluidic tissue culture enables in vitro experiments...... to approach in vivo conditions. Microfluidics also allow implementation of a wide range of electrochemical or optical assays for online, real-time, parallel analysis of important parameters such as redox activity, O2 and H2O2 concentration, extracellular pH, cell viability and enzyme activity1,2. Currently...... a double-fluorescent probe-system also used by Fath et al5. Future challenges include integrating both these systems into a microfluidic device for plant tissue culture....

  8. Catalase and alternative oxidase cooperatively regulate programmed cell death induced by beta-glucan elicitor in potato suspension cultures.

    Science.gov (United States)

    Mizuno, Masashi; Tada, Yasuomi; Uchii, Kimitaka; Kawakami, Sachiko; Mayama, Shigeyuki

    2005-04-01

    In potato (Solanum tuberosum L.) suspension cells, the expression of the gene encoding alternative oxidase (AOX) and H2O2 accumulation were induced by treatment with beta-glucan elicitor. The inhibition of catalase activity enhanced both AOX mRNA expression and the production of H2O2, whereas the ascorbate peroxidase inhibitor did not have any effect on these responses. Simultaneous inhibition of catalase and AOX activities in elicited cells dramatically increased H2O2 accumulation, leading to the disruption of mitochondrial membrane potential (deltapsi(m)) and programmed cell death (PCD). The results demonstrate, for the first time, that not only AOX but also catalase plays a central role in the suppression of mitochondrial deltapsi(m) breakdown and PCD induced by beta-glucan elicitor.

  9. Processing of microstrip detectors on Czochralski grown high resistivity silicon substrates

    CERN Document Server

    Härkönen, J; Tuovinen, E; Mehtälä, P; Lassila-Perini, K M; Ovchinnikov, V; Heikkilä, P; Ylikoski, M; Palmu, L; Kallijärvi, S; Nikkila, H; Anttila, O; Niinikoski, T O; Eremin, V; Ivanov, A; Verbitskaya, E

    2003-01-01

    We have processed large-area strip sensors on silicon wafers grown by the magnetic Czochralski (MCZ) method. The n-type MCZ silicon wafers manufactured by Okmetic Oyj have nominal resistivity of 900 Omega cm and oxygen concentration of less than 10 ppma. The Photoconductive Decay (PCD) measurements, current-voltage measurements and capacitance-voltage measurements were made to characterise the samples. The leakage current of 3 muA at 900 V bias voltage was measured on the 32.5 cm**2 detector. Detector depletion took place at about 420 V. According to PCD measurements, process induced contamination was effectively bound and neutralised by the oxygen present in Czochralski silicon. During the sample processing, the silicon resistivity increased in spite of the lack of specific donor- killing heat treatment.

  10. Can a single "powerless" mitochondrion in the malaria parasite contribute to parasite programmed cell death in the asexual stages?

    Science.gov (United States)

    Ch'ng, Jun-Hong; Yeo, Su-Ping; Shyong-Wei Tan, Kevin

    2013-05-01

    The protozoan pathogens responsible for malaria are from the Plasmodium genus, with Plasmodium falciparum and Plasmodium vivax accounting for almost all clinical infections. With recent estimates of mortality exceeding 800,000 annually, malaria continues to take a terrible toll on lives and the early promises of medicine to eradicate the disease have yet to approach realization, in part due to the spread of drug resistant parasites. Recent reports of artemisinin-resistance have prompted renewed efforts to identify novel therapeutic options, and one such pathway being considered for antimalarial exploit is the parasite's programmed cell death (PCD) pathway. In this mini-review, we will discuss the roles of the plasmodium mitochondria in cell death and as a target of antimalarial compounds, taking into account recent data suggesting that PCD pathways involving the mitochondria may be attractive antimalarial targets. Copyright © 2012 Elsevier B.V. and Mitochondria Research Society. All rights reserved.

  11. Abbreviation modalities of nitrogen multiple-breath washout tests in school children with obstructed lung disease

    DEFF Research Database (Denmark)

    Green, Kent; Ejlertsen, Jacob S; Madsen, Astrid

    2016-01-01

    RATIONALE: Nitrogen multiple-breath washout (N2 MBW) is a promising tool for assessing early lung damage in children with chronic obstructive pulmonary disease, but it can be a time-consuming procedure. We compared alternative test-shortening endpoints with the most commonly reported N2 MBW outcome...... tested alternative endpoints exhibited increasing disagreement with increasing LCI2.5 . With an average reduction in test duration of 40%, LCI2.5 derived from two runs exhibited good agreement in all children. CONCLUSIONS: Cn@TO6 may be suggested as a potential test-shortening endpoint in school children...... with PCD. In CF, early test termination may reduce measurement power with advancing pulmonary disease, suggesting differences in underlying pathophysiology. Two technically acceptable N2 MBW runs may be sufficient in school children irrespective of diagnosis with CF or PCD. Pediatr Pulmonol. 2016...

  12. Simultaneous sinus and lung infections in patients with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Alanin, Mikkel Christian; Johansen, Helle Krogh; Aanaes, Kasper

    2015-01-01

    effect of combined endoscopic sinus surgery (ESS) and concomitant medical treatment. Objectives: The purpose of this research, which is the first study addressing bacteriology in the sinuses of patients with PCD, was to examine the association between sinus and lung infections. Methods: We reviewed...... patients (88%) exhibited intermittent or chronic pulmonary infection with P. aeruginosa. Sinus cultures were obtained during ESS in seven patients. The sinuses were colonized with P. aeruginosa in four of seven patients (57%). Bacterial sinusitis was found in five of seven patients (71%) and the same...... findings of bacterial pathogens from the sinuses obtained during ESS and the lung infection status in eight PCD patients over a 6 year period. Precipitins against P. aeruginosa were used as a marker of severity of chronic infection and effect of treatment. Results: Preoperatively, seven of the eight...

  13. Evaluación de la calidad docente y promoción del profesorado (VII. Legislación universitaria española (e: modificación de la Ley Orgánica de Universidades. Profesorado contratado permanente (2004-2008 Evaluation of teaching and faculty promotion (VII. University Spanish legislation (e: modification of the Organic Law of Universities. Recruited staff with indefinite contract (2004-2005

    Directory of Open Access Journals (Sweden)

    J. Carreras

    2010-12-01

    Full Text Available La Ley Orgánica de Modificación de la Ley Orgánica de Universidades (LOMLOU, promulgada el año 2007, incluyó disposiciones referentes al profesorado contratado doctor (PCD que supusieron la consolidación de la vía laboral como alternativa a la vía funcionarial en la carrera universitaria. La Ley estableció que la contratación de los PCD sería de carácter indefinido y con dedicación a tiempo completo, determinó que dichos profesores tenían plena capacidad docente e investigadora, reconoció su condición de elegibles para los órganos unipersonales de gobierno (salvo para el cargo de rector, les atribuyó voto ponderado en la constitución del claustro universitario y en la elección de rector y, mediante modificación de la Ley General de Sanidad, determinó que podría establecerse vinculación de plazas asistenciales con plazas de PCD. Por lo que respecta a los requisitos para acceder a una plaza de PCD, la LOMLOU suprimió la necesidad de acreditar tres años de actividad docente e investigadora, establecida por la LOU, pero mantuvo como requisito una evaluación positiva por parte de un órgano externo (acreditación. En este artículo se analizan comparativamente los procesos de acreditación desarrollados por la Agencia Nacional de Evaluación de la Calidad y Acreditación (ANECA y por los órganos de evaluación establecidos por las diversas comunidades autónomas, así como los concursos de acceso a las plazas convocadas por las universidades. Además, se describen las características de las diversas figuras de PCD establecidas por las comunidades autónomas.The Organic Law of Modification of the Organic Law of Universities (LOMLOU, promulgated the year 2007, included referring dispositions to the recruited professors with doctorate qualification (PCDs that supposed the consolidation of the direct contracting way as alternative to the way functionarial in the academic career. The Law established that the contract of the

  14. Clinical value of measurement of pulmonary radioaerosol mucociliary clearance in the work up of primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Munkholm, Mathias; Nielsen, Kim Gjerum; Mortensen, Jann

    2015-01-01

    primarily to results from nasal ciliary function testing, to electron microscopic (EM) examination of the ultrastructure of the cilia, and to the final clinical diagnosis. RESULTS: Of the 239 patients, 27 ended up with a final clinical diagnosis of definitive PCD. No patients with a PRMC test...... a high rate of conclusive results (90 %). Children test providing evaluation of the mucociliary clearance...... of the entire lung. Its greatest strength is its ability to reject a suspected PCD diagnosis with great certainty. In our material, this accounted for 2/3 of referred patients. In addition, the test has a high rate of conclusive results. According to our analyses, reference equations on children would benefit...

  15. Exhaled breath analysis using electronic nose in cystic fibrosis and primary ciliary dyskinesia patients with chronic pulmonary infections

    DEFF Research Database (Denmark)

    Joensen, Odin; Paff, Tamara; Haarman, Eric G

    2014-01-01

    The current diagnostic work-up and monitoring of pulmonary infections may be perceived as invasive, is time consuming and expensive. In this explorative study, we investigated whether or not a non-invasive exhaled breath analysis using an electronic nose would discriminate between cystic fibrosis...... (CF) and primary ciliary dyskinesia (PCD) with or without various well characterized chronic pulmonary infections. We recruited 64 patients with CF and 21 with PCD based on known chronic infection status. 21 healthy volunteers served as controls. An electronic nose was employed to analyze exhaled......, this method significantly discriminates CF patients suffering from a chronic pulmonary P. aeruginosa (PA) infection from CF patients without a chronic pulmonary infection. Further studies are needed for verification and to investigate the role of electronic nose technology in the very early diagnostic workup...

  16. Anti-Yo Mediated Paraneoplastic Cerebellar Degeneration Associated with Pseudobulbar Affect in a Patient with Breast Cancer

    Directory of Open Access Journals (Sweden)

    Allison N. Martin

    2017-01-01

    Full Text Available Paraneoplastic cerebellar degeneration (PCD is a rare anti-Yo mediated paraneoplastic syndromes rarely that is infrequently associated with breast cancer. We present a case of a 52-year-old female presenting with diplopia, gait instability, dysarthria, dysphagia, nystagmus, and, most notably, new onset paroxysmal episodes of uncontrollable crying concerning for pseudobulbar affect (PBA. Serologic testing showed anti-Yo antibodies. The patient was found to have stage IIIA breast cancer as the inciting cause of the paraneoplastic syndrome. The patient was treated with neoadjuvant chemotherapy, modified radical mastectomy, adjuvant Herceptin, and pertuzumab. She was given IVIG for paraneoplastic syndrome, antidepressants, and dextromethorphan-quinidine (Nuedexta, the first FDA-approved therapy for PBA. With multimodality therapy, she demonstrated significant improvement in neurologic and mood symptoms associated with PCD and PBA.

  17. Autophagy, programmed cell death and reactive oxygen species in sexual reproduction in plants.

    Science.gov (United States)

    Kurusu, Takamitsu; Kuchitsu, Kazuyuki

    2017-05-01

    Autophagy is one of the major cellular processes of recycling of proteins, metabolites and intracellular organelles, and plays crucial roles in the regulation of innate immunity, stress responses and programmed cell death (PCD) in many eukaryotes. It is also essential in development and sexual reproduction in many animals. In plants, although autophagy-deficient mutants of Arabidopsis thaliana show phenotypes in abiotic and biotic stress responses, their life cycle seems normal and thus little had been known until recently about the roles of autophagy in development and reproduction. Rice mutants defective in autophagy show sporophytic male sterility and immature pollens, indicating crucial roles of autophagy during pollen maturation. Enzymatic production of reactive oxygen species (ROS) by respiratory burst oxidase homologues (Rbohs) play multiple roles in regulating anther development, pollen tube elongation and fertilization. Significance of autophagy and ROS in the regulation of PCD of transient cells during plant sexual reproduction is discussed in comparison with animals.

  18. Promesas y traiciones: una radionovela enfocada en la educación sobre enfermedades crónicas (Promises and Betrayals: A Radio Novella Focused on Chronic Disease Education)

    Centers for Disease Control (CDC) Podcasts

    2012-08-02

    Los casos de diabetes y de otras enfermedades crónicas en la comunidad hispana de los Estados Unidos siguen en aumento. En este Podcast, los autores de un artículo publicado en la revista Preventing Chronic Disease (PCD) de los CDC hablan en acerca de cómo usaron un innovador modelo educativo de entretenimiento para crear una radionovela en español con el objetivo de reducir los factores de riesgo de enfermedades crónicas en este sector de la población.  Created: 8/2/2012 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/2/2012.

  19. Alkaloids Induce Programmed Cell Death in Bloodstream Forms of Trypanosomes (Trypanosoma b. brucei

    Directory of Open Access Journals (Sweden)

    Michael Wink

    2008-10-01

    Full Text Available The potential induction of a programmed cell death (PCD in Trypanosoma b. brucei by 55 alkaloids of the quinoline, quinolizidine, isoquinoline, indole, terpene, tropane, steroid, and piperidine type was studied by measuring DNA fragmentation and changes in mitochondrial membrane potential. For comparison, the induction of apoptosis by the same alkaloids in human leukemia cells (Jurkat APO-S was tested. Several alkaloids of the isoquinoline, quinoline, indole and steroidal type (berberine, chelerythrine, emetine, sanguinarine, quinine, ajmalicine, ergotamine, harmine, vinblastine, vincristine, colchicine, chaconine, demissidine and veratridine induced programmed cell death, whereas quinolizidine, tropane, terpene and piperidine alkaloids were mostly inactive. Effective PCD induction (EC50 below 10 µM was caused in T. brucei by chelerythrine, emetine, sanguinarine, and chaconine. The active alkaloids can be characterized by their general property to inhibit protein biosynthesis, to intercalate DNA, to disturb membrane fluidity or to inhibit microtubule formation.

  20. Sinus surgery can improve quality of life, lung infections, and lung function in patients with primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Alanin, Mikkel Christian; Aanaes, Kasper; Hoiby, Niels

    2017-01-01

    patients (62%). Four patients with preoperative P. aeruginosa lung colonization (25%) had no regrowth during follow-up; 2 of these had P. aeruginosa sinusitis. Sinonasal symptoms were improved 12 months after ESS and we observed a trend toward better lung function after ESS. Conclusion We demonstrated...... an improvement in CRS-related symptoms after ESS and adjuvant therapy. In selected PCD patients, the suggested regimen may postpone chronic lung infection with P. aeruginosa and stabilize lung function....

  1. Communities Putting Prevention to Work: The Healthy Corner Store Initiative

    Centers for Disease Control (CDC) Podcasts

    2013-07-18

    This podcast is an interview with Dr. Stephanie Jilcott Pitts, Associate Professor in the Department of Public Health at East Carolina University. Dr. Pitts answers questions about her study involving a healthy corner store initiative in North Carolina.  Created: 7/18/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 7/18/2013.

  2. High School Students’ Use of Sunscreen and Tanning Beds

    Centers for Disease Control (CDC) Podcasts

    2014-08-20

    This podcast is an interview with Corey Basch, EdD, MPH, assistant professor in the Department of Public Health at William Paterson University. Dr. Basch discusses her study on high school students’ use of sunscreen and tanning beds between 2001 and 2011.  Created: 8/20/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/20/2014.

  3. Local Health Departments’ Use of Twitter

    Centers for Disease Control (CDC) Podcasts

    2013-05-02

    This podcast is an interview with Jenine K. Harris, PhD, from the Brown School at Washington University in St. Louis, MO, about local health departments’ use of Twitter to disseminate diabetes information.  Created: 5/2/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 5/2/2013.

  4. Bringing Bike Share to a Low-Income Community

    Centers for Disease Control (CDC) Podcasts

    2013-08-14

    This podcast is an interview with Sarah Kretman Stewart, MPH, MEd, Healthy Living Minneapolis Project Specialist at the Minneapolis Health Department. In this program, Sarah talks about the impact a bike share program had on the low-income town of Near North, Minnesota.  Created: 8/14/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/14/2013.

  5. CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration.

    Directory of Open Access Journals (Sweden)

    Tilo W Eichler

    Full Text Available Yo antibodies are associated with paraneoplastic cerebellar degeneration (PCD. We have characterized Yo sera by measuring CDR2 and CDR2L antibodies and the localization of their antigens.Forty-two Yo sera from patients with paraneoplastic neurological syndromes (PNS, 179 sera from ovarian and 114 sera from breast cancer patients without PNS and 100 blood donors were screened for CDR2 and CDR2L antibodies by radioactive immune assay (RIA. Fluorescence microscopy was also used to determine the presence of CDR2 or CDR2L antibodies by staining of HeLa cells transfected with CDR2 or CDR2L fused to green fluorescent protein (GFP. Confocal microscopy was further used to localize the CDR2 and CDR2L proteins.RIA showed that 36 of the 42 Yo positive sera contained CDR2 and CDR2L antibodies whereas 6 sera contained only CDR2 antibodies. Five of the ovarian cancer patients had CDR2L antibodies and 4 of the breast cancer patients had either CDR2 or CDR2L antibodies. Only patients with both antibodies had PCD. RIA and staining of transfected cells showed similar results. Yo antibodies were not present in the 100 blood donors. Confocal microscopy showed that CDR2 and CDR2L were localized to the cytoplasm, whereas CDR2L was also present on the cell membrane.Yo sera usually contain CDR2 and CDR2L antibodies and both antibodies are associated with PCD. Since only CDR2L is localized to the cell membrane it is likely that CDR2L antibodies may be of primary pathogenic importance for the development of PCD.

  6. Molecular cloning of the apoptosis-related calcium-binding protein AsALG-2 in Avena sativa.

    Science.gov (United States)

    Hoat, Trinh Xuan; Nakayashiki, Hitoshi; Yang, Qian; Tosa, Yukio; Mayama, Shigeyuki

    2013-04-01

    Victorin, the host-selective toxin produced by the fungus Cochliobolus victoriae, induces programmed cell death (PCD) in victorin-sensitive oat lines with characteristic features of animal apoptosis, such as mitochondrial permeability transition, chromatin condensation, nuclear DNA laddering and rRNA/mRNA degradation. In this study, we characterized a calcium-binding protein, namely AsALG-2, which might have a role in the victorin-induced PCD. AsALG-2 is homologous to the Apoptosis-Linked Gene ALG-2 identified in mammalian cells. Northern blot analysis revealed that the accumulation of AsALG-2 transcripts increased during victorin-induced PCD, but not during necrotic cell death. Salicylic acid, chitosan and chitin strongly activated the expression of general defence response genes, such as PR-10; however, neither induced cell death nor the accumulation of AsALG-2 mRNA. Pharmacological studies indicated that victorin-induced DNA laddering and AsALG-2 expression were regulated through similar pathways. The calcium channel blocker, nifedipine, moderately inhibited the accumulation of AsALG-2 mRNA during cell death. Trifluoperazine (calmodulin antagonist) and K252a (serine-threonine kinase inhibitor) reduced the victorin-induced phytoalexin accumulation, but did not prevent the victorin-induced DNA laddering or accumulation of AsALG-2 mRNA. Taken together, our investigations suggest that there is a calcium-mediated signalling pathway in animal and plant PCD in common. © 2012 THE AUTHORS. MOLECULAR PLANT PATHOLOGY © 2012 BSPP AND BLACKWELL PUBLISHING LTD.

  7. The Hydrogen Sulfide Donor NaHS Delays Programmed Cell Death in Barley Aleurone Layers by Acting as an Antioxidant

    Directory of Open Access Journals (Sweden)

    Ying-Xin Zhang

    2015-01-01

    Full Text Available H2S is a signaling molecule in plants and animals. Here we investigated the effects of H2S on programmed cell death (PCD in barley (Hordeum vulgare L. aleurone layers. The H2S donor NaHS significantly delayed PCD in aleurone layers isolated from imbibed embryoless barley grain. NaHS at 0.25 mM effectively reduced the accumulation of superoxide anion (·O2-, hydrogen peroxide (H2O2, and malondialdehyde (MDA, promoted the activity of superoxide dismutase (SOD, guaiacol peroxidase (POD, catalase (CAT, and ascorbate peroxidase (APX, and decreased those of lipoxygenase (LOX in isolated aleurone layers. Quantitative-PCR showed that NaHS treatment of aleurone tissue led to enhanced transcript levels of the antioxidant genes HvSOD1, HvAPX, HvCAT1, and HvCAT2 and repressed transcript levels of HvLOX (lipoxygenase gene and of two cysteine protease genes HvEPA and HvCP3-31. NaHS treatment in gibberellic acid- (GA- treated aleurone layers also delayed the PCD process, reduced the content of ·O2-, and increased POD activity while decreasing LOX activity. Furthermore, α-amylase secretion in barley aleurone layers was enhanced by NaHS treatment regardless of the presence or absence of GA. These data imply that H2S acted as an antioxidant in delaying PCD and enhances α-amylase secretion regardless of the presence of GA in barley aleurone layers.

  8. Stomatal and pavement cell density linked to leaf internal CO2 concentration.

    Science.gov (United States)

    Santrůček, Jiří; Vráblová, Martina; Simková, Marie; Hronková, Marie; Drtinová, Martina; Květoň, Jiří; Vrábl, Daniel; Kubásek, Jiří; Macková, Jana; Wiesnerová, Dana; Neuwithová, Jitka; Schreiber, Lukas

    2014-08-01

    Stomatal density (SD) generally decreases with rising atmospheric CO2 concentration, Ca. However, SD is also affected by light, air humidity and drought, all under systemic signalling from older leaves. This makes our understanding of how Ca controls SD incomplete. This study tested the hypotheses that SD is affected by the internal CO2 concentration of the leaf, Ci, rather than Ca, and that cotyledons, as the first plant assimilation organs, lack the systemic signal. Sunflower (Helianthus annuus), beech (Fagus sylvatica), arabidopsis (Arabidopsis thaliana) and garden cress (Lepidium sativum) were grown under contrasting environmental conditions that affected Ci while Ca was kept constant. The SD, pavement cell density (PCD) and stomatal index (SI) responses to Ci in cotyledons and the first leaves of garden cress were compared. (13)C abundance (δ(13)C) in leaf dry matter was used to estimate the effective Ci during leaf development. The SD was estimated from leaf imprints. SD correlated negatively with Ci in leaves of all four species and under three different treatments (irradiance, abscisic acid and osmotic stress). PCD in arabidopsis and garden cress responded similarly, so that SI was largely unaffected. However, SD and PCD of cotyledons were insensitive to Ci, indicating an essential role for systemic signalling. It is proposed that Ci or a Ci-linked factor plays an important role in modulating SD and PCD during epidermis development and leaf expansion. The absence of a Ci-SD relationship in the cotyledons of garden cress indicates the key role of lower-insertion CO2 assimilation organs in signal perception and its long-distance transport. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Mesure de durée de vie de porteurs minoritaires dans les structures semiconductrices de basse dimensionnalité

    OpenAIRE

    Daanoune, Mehdi

    2015-01-01

    The minority carrier lifetime is one of the main parameters used to analyse the semiconductors quality and photoconductivity decay (PCD) is one of the most widely used lifetime characterization method. Thanks to the variety of automated equipment that has developed, lifetime measurement has become a routine technique to assess the quality of semiconductors. However, the micro and nano materials used in the photovoltaic and microelectronics industry require an adaptation of the existing method...

  10. Making Texas Restaurants Healthier for Children

    Centers for Disease Control (CDC) Podcasts

    2014-12-30

    Sylvia Crixell, PhD, RD, Professor of Nutrition at Texas State University, discusses her study which details the success of a community-based program in Texas aimed at combatting childhood obesity by improving children’s menus in restaurants.  Created: 12/30/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 12/30/2014.

  11. Salmonella Typhimurium infection in the porcine intestine

    DEFF Research Database (Denmark)

    Schauser, Kirsten; Olsen, John Elmerdahl; Larsson, Lars-Inge

    2005-01-01

    The normal intestinal epithelium is renewed with a turnover rate of 3-5 days. During Salmonella infection increased cell loss is observed, possibly as a result of programmed cell death (PCD). We have, therefore, studied the effects of Salmonella Typhimurium infection on three elements involved...... in scattered epithelial cells and the number of positive cells increased with increasing times of exposure to Salmonella (P

  12. A Multicenter Access and Distribution Protocol for Unlicensed Cryopreserved Cord Blood Units (CBUs)

    Science.gov (United States)

    2017-11-17

    Hematologic Malignancies; Inherited Disorders of Metabolism; Inherited Abnormalities of Platelets; Histiocytic Disorders; Acute Myelogenous Leukemia (AML or ANLL); Acute Lymphoblastic Leukemia (ALL); Other Acute Leukemia; Chronic Myelogenous Leukemia (CML); Myelodysplastic (MDS) / Myeloproliferative (MPN) Diseases; Other Leukemia; Hodgkin Lymphoma; Non-hodgkin Lymphoma; Multiple Myeloma/ Plasma Cell Disorder (PCD); Inherited Abnormalities of Erythrocyte Differentiation or Function; Disorders of the Immune System; Automimmune Diseases; Severe Aplastic Anemia

  13. A passive cold storage device economic model to evaluate selected immunization location scenarios.

    Science.gov (United States)

    Norman, Bryan A; Nourollahi, Sevnaz; Chen, Sheng-I; Brown, Shawn T; Claypool, Erin G; Connor, Diana L; Schmitz, Michelle M; Rajgopal, Jayant; Wateska, Angela R; Lee, Bruce Y

    2013-10-25

    The challenge of keeping vaccines cold at health posts given the unreliability of power sources in many low- and middle-income countries and the expense and maintenance requirements of solar refrigerators has motivated the development of passive cold storage devices (PCDs), containers that keep vaccines cold without using an active energy source. With different PCDs under development, manufacturers, policymakers and funders need guidance on how varying different PCD characteristics may affect the devices' cost and utility. We developed an economic spreadsheet model representing the lowest two levels of a typical Expanded Program on Immunization (EPI) vaccine supply chain: a district store, the immunization locations that the district store serves, and the transport vehicles that operate between the district store and the immunization locations. The model compares the use of three vaccine storage device options [(1) portable PCDs, (2) stationary PCDs, or (3) solar refrigerators] and allows the user to vary different device (e.g., size and cost) and scenario characteristics (e.g., catchment area population size and vaccine schedule). For a sample set of select scenarios and equipment specification, we found the portable PCD to generally be better suited to populations of 5,000 or less. The stationary PCD replenished once per month can be a robust design especially with a 35L capacity and a cost of $2,500 or less. The solar device was generally a reasonable alternative for most of the scenarios explored if the cost was $2,100 or less (including installation). No one device type dominated over all explored circumstances. Therefore, the best device may vary from country-to-country and location-to-location within a country. This study introduces a quantitative model to help guide PCD development. Although our selected set of explored scenarios and device designs was not exhaustive, future explorations can further alter model input values to represent additional scenarios

  14. Increasing Access to Farmers Markets for Beneficiaries of Nutrition Assistance

    Centers for Disease Control (CDC) Podcasts

    2013-10-22

    In this audio podcast, listen to author Kate Cole, MPH talk about her article on farmers markets and how acceptance of nutrition assistance could increase access to fruits and vegetables to those in low-income communities.  Created: 10/22/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/22/2013.

  15. Caspase-2 mediates a Brucella abortus RB51-induced hybrid cell death having features of apoptosis and pyroptosis

    Directory of Open Access Journals (Sweden)

    Denise Nicole Bronner

    2013-11-01

    Full Text Available Programmed cell death (PCD can play a crucial role in tuning the immune response to microbial infection. Although PCD can occur in different forms, all are mediated by a family of proteases called caspases. Caspase-2 is the most conserved caspase; however its function in cell death is ill-defined. Previously we demonstrated that live attenuated cattle vaccine strain Brucella abortus RB51 induces caspase-2-mediated PCD of infected macrophages. However, the mechanism of caspase-2-mediated cell death pathway remained unclear. In this study, we found that caspase-2 mediated proinflammatory cell death of RB51-infected macrophages and regulated many genes in different PCD pathways. We show that the activation of proapoptotic caspases-3 and -8 was dependent upon caspase-2. Caspase-2 regulated mitochondrial cytochrome c release and TNFα production, both of which are known to activate caspase-3 and caspase-8, respectively. In addition to TNFα, RB51-induced caspase-1 and IL-1β production was also driven by caspase-2-mediated mitochondrial dysfunction. Interestingly, pore formation, a phenomenon commonly associated with caspase-1-mediated pyroptosis, occurred; however it did not contribute to RB51-induced proinflammatory cell death. Our data suggest that caspase-2 acts as an initiator caspase that mediates a novel RB51-induced hybrid cell death that simulates but differs from typical apoptosis and pyroptosis. The initiator role of the caspase-2-mediated cell death was also conserved in cellular stress-induced cell death of macrophages treated with etoposide, naphthalene, or anti-Fas. Caspase-2 also regulated caspase-3 and -8 activation, as well as cell death in macrophages treated with each of the three reagents. Taken together, our data has demonstrated that caspase-2 can play an important role in mediating a proinflammatory response and a hybrid cell death that demonstrates features of both apoptosis and pyroptosis.

  16. Novel Acoustic Scattering Processes for Target Discrimination

    Science.gov (United States)

    2014-12-31

    polystyrene foam (“StyrofoamTM”). This method of simulating scattering by objects near an air-water surface was subsequently deployed at the NSWC-PCD pond...domain tone burst response (analogous to the cylinder case in Fig. 1). Franz wave contributions are clearly evident in his results in the time domain...sand partially exposed to sound in water at various grazing angles. (To reduce the contamination associated with the possibility of bubbles trapped

  17. Design and development of the Australian and New Zealand (ANZ) myeloma and related diseases registry

    OpenAIRE

    Krystal Bergin; Elizabeth Moore; Zoe McQuilten; Erica Wood; Bradley Augustson; Hilary Blacklock; Joy Ho; Noemi Horvath; Tracy King; John McNeil; Peter Mollee; Hang Quach; Christopher M. Reid; Brian Rosengarten; Patricia Walker

    2016-01-01

    Abstract Background Plasma cell dyscrasias (PCD) are a spectrum of disorders resulting from the clonal expansion of plasma cells, ranging from the pre-malignant condition monoclonal gammopathy of undetermined significance (MGUS) to multiple myeloma (MM). MM generates a significant burden of disease on the community and it is predicted that it will increase in both incidence and prevalence owing to an ageing population and longer survival secondary to new therapeutic options. Robust and compre...

  18. Nutrition Recommendations for Foods Marketed to Children

    Centers for Disease Control (CDC) Podcasts

    2013-09-25

    In this audio podcast, listen to Michigan State University authors Lorraine J. Weatherspoon, PhD, RD, and Elizabeth Taylor Quilliam, PhD, talk about the impact food advertising may have on children’s eating behaviors.  Created: 9/25/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/25/2013.

  19. Accumulation of N-acyl-ethanolamine phospholipids in rat brains during post-decapitative ischemia

    DEFF Research Database (Denmark)

    Moesgaard, B.; Hansen, Harald S.; Jaroszewski, J.W.

    1999-01-01

    in the NMR spectra at 0.18 and 0.22 ppm (relative to the chemical shift of 1,2-diacyl-sn-glycero-3-phosphocholine (PCD(DIACYL)) at -0.84 ppm). These signals were identified as originating from 1,2-diacyl- sn-glycero-3-phospho-(N-acyl)-ethanolamine (NAPED(DIACYL)) and 1-(1'- alkenyl)-2-acyl-sn-glycero-3...

  20. A Dilemma for Research on Yersinia Pestis, a Bioterrorism Agent

    OpenAIRE

    Ruifu Yang

    2017-01-01

    Yersinia pestis research requires biosafety level thee laboratory practices, which prevents many scientists from conducting research on this pathogen. However, for convenience, many laboratories employ avirulent pCD1-cured strains, such as KIM6+, to perform experiments to study the evolutionary and pathogenic mechanisms of Y. pestis. However, research, including the report by Zhou et al. in this issue, shows that some important Y. pestis phenotypes, including biofilm formation, are influenced...

  1. Diagnostic Support for Selected Paediatric Pulmonary Diseases Using Answer-Pattern Recognition in Questionnaires Based on Combined Data Mining Applications--A Monocentric Observational Pilot Study.

    Directory of Open Access Journals (Sweden)

    Ann-Katrin Rother

    Full Text Available Clinical symptoms in children with pulmonary diseases are frequently non-specific. Rare diseases such as primary ciliary dyskinesia (PCD, cystic fibrosis (CF or protracted bacterial bronchitis (PBB can be easily missed at the general practitioner (GP.To develop and test a questionnaire-based and data mining-supported tool providing diagnostic support for selected pulmonary diseases.First, interviews with parents of affected children were conducted and analysed. These parental observations during the pre-diagnostic time formed the basis for a new questionnaire addressing the parents' view on the disease. Secondly, parents with a sick child (e.g. PCD, PBB answered the questionnaire and a data base was set up. Finally, a computer program consisting of eight different classifiers (support vector machine (SVM, artificial neural network (ANN, fuzzy rule-based, random forest, logistic regression, linear discriminant analysis, naive Bayes and nearest neighbour and an ensemble classifier was developed and trained to categorise any given new questionnaire and suggest a diagnosis. For estimating the diagnostic accuracy, we applied ten-fold stratified cross validation.All questionnaires of patients suffering from CF, asthma (AS, PCD, acute bronchitis (AB and the healthy control group were correctly diagnosed by the fusion algorithm. For the pneumonia (PM group 19/21 (90.5% and for the PBB group 17/18 (94.4% correct diagnoses could be reached. The program detected the correct diagnoses with an overall sensitivity of 98.8%. Receiver operating characteristics (ROC analyses confirmed the accuracy of this diagnostic tool. Case studies highlighted the applicability of the tool in the daily work of a GP.For children with symptoms of pulmonary diseases a questionnaire-based diagnostic support tool using data mining techniques exhibited good results in arriving at diagnostic suggestions. In the hands of a doctor, this tool could be of value in arousing awareness for

  2. Neonatal outcome of very preterm twins: policy of planned vaginal or cesarean delivery.

    Science.gov (United States)

    Sentilhes, Loïc; Oppenheimer, Anne; Bouhours, Anne-Charlotte; Normand, Estelle; Haddad, Bassam; Descamps, Philippe; Marpeau, Loïc; Goffinet, François; Kayem, Gilles

    2015-07-01

    The objective of the study was to compare neonatal mortality and morbidity in very preterm twins with the first twin in cephalic presentation in hospitals with a policy of planned vaginal delivery (PVD) and those with a policy of planned cesarean delivery (PCD). Women with preterm cephalic first twins delivered after preterm labor and/or premature preterm rupture of membranes from 26(0/7) to 31(6/7) weeks of gestation were identified from the databases of 6 perinatal centers and classified as PVD or PCD according to the center's management policy from 1999 to 2010. Severe neonatal morbidity was defined as any of the following: intraventricular hemorrhage grades 3-4, periventricular leukomalacia, necrotizing enterocolitis, bronchopulmonary dysplasia, and hospital death. The independent effect of the planned mode of delivery, defined by the center's management policy, was tested and quantified with a 2-level multivariable logistic regression. The PVD group included 248 women, and the PCD group 63. Maternal characteristics did not differ between the 2 groups. The rate of vaginal delivery was 85.9% (213 of 248) vs 20.6% (13 of 63) (P twin was 1.6% (4 of 248) vs 4.8% (3 of 63) (P = .13) for PVD and PCD. PVD had no independent effect on either newborn hospital mortality or severe neonatal composite morbidity. A policy of planned vaginal delivery of very preterm twins with the first twin in cephalic presentation does not increase either severe neonatal morbidity or mortality. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Promoting Physical Activity Among Overweight Young African American Women

    Centers for Disease Control (CDC) Podcasts

    2014-01-15

    This podcast is an interview with Nefertiti Durant, MD, MPH, from the University of Alabama at Birmingham about promoting physical activity among overweight and obese young African American Women using Internet-based tools.  Created: 1/15/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 1/15/2014.

  4. Microstructure and tribological performance of self-lubricating diamond/tetrahedral amorphous carbon composite film

    Science.gov (United States)

    Chen, Xinchun; Peng, Zhijian; Yu, Xiang; Fu, Zhiqiang; Yue, Wen; Wang, Chengbiao

    2011-02-01

    In order to smooth the rough surface and further improve the wear-resistance of coarse chemical vapor deposition diamond films, diamond/tetrahedral amorphous carbon composite films were synthesized by a two-step preparation technique including hot-filament chemical vapor deposition for polycrystalline diamond (PCD) and subsequent filtered cathodic vacuum arc growth for tetrahedral amorphous carbon (ta-C). The microstructure and tribological performance of the composite films were investigated by means of various characterization techniques. The results indicated that the composite films consisted of a thick well-grained diamond base layer with a thickness up to 150 μm and a thin covering ta-C layer with a thickness of about 0.3 μm, and sp3-C fraction up to 73.93%. Deposition of a smooth ta-C film on coarse polycrystalline diamond films was proved to be an effective tool to lower the surface roughness of the polycrystalline diamond film. The wear-resistance of the diamond film was also enhanced by the self-lubricating effect of the covering ta-C film due to graphitic phase transformation. Under dry pin-on-disk wear test against Si3N4 ball, the friction coefficients of the composite films were much lower than that of the single PCD film. An extremely low friction coefficient (∼0.05) was achieved for the PCD/ta-C composite film. Moreover, the addition of Ti interlayer between the ta-C and the PCD layers can further reduce the surface roughness of the composite film. The main wear mechanism of the composite films was abrasive wear.

  5. Dicty_cDB: VSK288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rrkk*nfqrlcllii*ncslnfrflir*tii icfhvfiv*ln*v*afkmihqqqlknqqtqqpvmifhh*kktmnhlkwkkstrfny*PFC YQFFGILLYYYNKINFKKNLQ---...ppkkvklsktlftyymklls*lqvsh* mnhhhllhvfiv*ln*v*afkmihqqqlknqqtqqpvmifhh*kktmnhlkwkkstrfny *pfcyqffgillyyynkinlk...ppkkvklsktlftyymklls*lqvsh* mnhhhllhvfiv*ln*v*afkmihqqqlknqqtqqpvmifhh*kktmnhlkwkkstrfny *pfcyqffgillyyynkinlk...rrkk*nfqrlcllii*ncslnfrflir*tii icfhvfiv*ln*v*afkmihqqqlknqqtqqpvmifhh*kktmnhlkwkkstrfny*PFC YQFFGILLYYYNKINFKKNLQ---...DQ884433_1( DQ884433 |pid:none) Karlodinium micrum clone Kmi-5p-cD... 151 5e-39 DQ062086_1( DQ062086 |pid:none)

  6. The dual role of cyclin C connects stress regulated gene expression to mitochondrial dynamics

    Directory of Open Access Journals (Sweden)

    Randy Strich

    2014-09-01

    Full Text Available Following exposure to cytotoxic agents, cellular damage is first recognized by a variety of sensor mechanisms. Thenceforth, the damage signal is transduced to the nucleus to install the correct gene expression program including the induction of genes whose products either detoxify destructive compounds or repair the damage they cause. Next, the stress signal is disseminated throughout the cell to effect the appropriate changes at organelles including the mitochondria. The mitochondria represent an important signaling platform for the stress response. An initial stress response of the mitochondria is extensive fragmentation. If the damage is prodigious, the mitochondria fragment (fission and lose their outer membrane integrity leading to the release of pro-apoptotic factors necessary for programmed cell death (PCD execution. As this complex biological process contains many moving parts, it must be exquisitely coordinated as the ultimate decision is life or death. The conserved C-type cyclin plays an important role in executing this molecular Rubicon by coupling changes in gene expression to mitochondrial fission and PCD. Cyclin C, along with its cyclin dependent kinase partner Cdk8, associates with the RNA polymerase holoenzyme to regulate transcription. In particular, cyclin C-Cdk8 repress many stress responsive genes. To relieve this repression, cyclin C is destroyed in cells exposed to pro-oxidants and other stressors. However, prior to its destruction, cyclin C, but not Cdk8, is released from its nuclear anchor (Med13, translocates from the nucleus to the cytoplasm where it interacts with the fission machinery and is both necessary and sufficient to induce extensive mitochondria fragmentation. Furthermore, cytoplasmic cyclin C promotes PCD indicating that it mediates both mitochondrial fission and cell death pathways. This review will summarize the role cyclin C plays in regulating stress-responsive transcription. In addition, we will detail

  7. Lung disease assessment in primary ciliary dyskinesia: a comparison between chest high-field magnetic resonance imaging and high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Iacotucci Paola

    2009-08-01

    Full Text Available Abstract Background Primary ciliary dyskinesia (PCD is associated with pulmonary involvement that requires periodical assessment. Chest high-resolution computed tomography (HRCT has become the method of choice to evaluate chronic lung disease, but entails exposure to ionizing radiation. Magnetic resonance imaging (MRI has been proposed as a potential radiation-free technique in several chest disorders. Aim of our study is to evaluate whether high-field MRI is as effective as HRCT in identifying PCD pulmonary abnormalities. We also analyzed the relationships between the severity and extension of lung disease, and functional data. Methods Thirteen PCD patients (8 children/5 adults; median age, 15.2 yrs underwent chest HRCT and high-field 3T MRI, spirometry, and deep throat or sputum culture. Images were scored using a modified version of the Helbich system. Results HRCT and MRI total scores were 12 (range, 6–20 and 12 (range, 5–17, respectively. Agreement between HRCT and MRI scores was good or excellent (r > 0.8. HRCT and MRI total scores were significantly related to forced vital capacity (r = -0.5, p = 0.05; and r = -0.7, p = 0.009, respectively and forced expiratory volume at 1 second (r = -0.6, p = 0.03; and r = -0.7, p = 0.009, respectively. Conclusion Chest high-field 3T MRI appears to be as effective as HRCT in assessing the extent and severity of lung abnormalities in PCD. MRI scores might be used for longitudinal assessment and be an outcome surrogate in future studies.

  8. Anti-CHMP5 single chain variable fragment antibody retrovirus infection induces programmed cell death of AML leukemic cells in vitro.

    Science.gov (United States)

    Wang, Hai-rong; Xiao, Zhen-yu; Chen, Miao; Wang, Fei-long; Liu, Jia; Zhong, Hua; Zhong, Ji-hua; Ou-Yang, Ren-rong; Shen, Yan-lin; Pan, Shu-ming

    2012-06-01

    Over-expressed CHMP5 was found to act as oncogene that probably participated in leukemogenesis. In this study, we constructed the CHMP5 single chain variable fragment antibody (CHMP5-scFv) retrovirus and studied the changes of programmed cell death (PCD) of AML leukemic cells after infection by the retrovirus. The anti-CHMP5 KC14 hybridoma cell line was constructed to generate monoclonal antibody of CHMP5. The protein expression of CHMP5 was studied using immunofluorescence analysis. pMIG-CHMP5 scFv antibody expressible retroviral vector was constructed to prepare CHMP5-scFv retrovirus. AML leukemic U937 cells were infected with the retrovirus, and programmed cell death was studied using confocal microscope, FCM and Western blot. We obtained a monoclonal antibody of CHMP5, and found the expression of CHMP5 was up-regulated in the leukemic cells. After U937 cells were infected with CHMP5-scFv retrovirus, CHMP5 protein was neutralized. Moreover, the infection resulted in a significant increase in apoptosis and necrosis of U937 cells. In U937 cells infected with CHMP5-scFv retrovirus, apoptosis-inducing factor (AIF)-mediated caspase-independent necrotic PCD was activated, but autophagic programmed cell death was not observed. Neither the intrinsic nor extrinsic apoptotic PCD pathway was activated. The granzyme B/perforin-mediated caspase-dependent apoptotic PCD pathway was not activated. CHMP5-scFv retrovirus can neutralize the abnormally high levels of the CHMP5 protein in the cytosol of AML leukemic U937 cells, thereby inducing the programmed cell death of the leukemic cells via AIF-mediated caspase-independent necrosis and apoptosis.

  9. Sunlight inhibits growth and induces markers of programmed cell death in Plasmodium falciparum in vitro.

    Science.gov (United States)

    Engelbrecht, Dewaldt; Coetzer, Thérèsa Louise

    2015-09-29

    Plasmodium falciparum is responsible for the majority of global malaria deaths. During the pathogenic blood stages of infection, a rapid increase in parasitaemia threatens the survival of the host before transmission of slow-maturing sexual parasites to the mosquito vector to continue the life cycle. Programmed cell death (PCD) may provide the parasite with the means to control its burden on the host and thereby ensure its own survival. Various environmental stress factors encountered during malaria may induce PCD in P. falciparum. This study is the first to characterize parasite cell death in response to natural sunlight. The 3D7 strain of P. falciparum was cultured in vitro in donor erythrocytes. Synchronized and mixed-stage parasitized cultures were exposed to sunlight for 1 h and compared to cultures maintained in the dark, 24 h later. Mixed-stage parasites were also subjected to a second one-hour exposure at 24 h and assessed at 48 h. Parasitaemia was measured daily by flow cytometry. Biochemical markers of cell death were assessed, including DNA fragmentation, mitochondrial membrane polarization and phosphatidylserine externalization. Sunlight inhibited P. falciparum growth in vitro. Late-stage parasites were more severely affected than early stages. However, some late-stage parasites survived exposure to sunlight to form new rings 24 h later, as would be expected during PCD whereby only a portion of the population dies. DNA fragmentation was observed at 24 and 48 h and preceded mitochondrial hyperpolarization in mixed-stage parasites at 48 h. Mitochondrial hyperpolarization likely resulted from increased oxidative stress. Although data suggested increased phosphatidylserine externalization in mixed-stage parasites, results were not statistically significant. The combination of biochemical markers and the survival of some parasites, despite exposure to a lethal stimulus, support the occurrence of PCD in P. falciparum.

  10. A BAX inhibitor-1 gene in Capsicum annuum is induced under various abiotic stresses and endows multi-tolerance in transgenic tobacco.

    Science.gov (United States)

    Isbat, Mohammad; Zeba, Naheed; Kim, Seong Ryong; Hong, Choo Bong

    2009-10-15

    Programmed cell death (PCD) is a highly conserved cellular suicide process important in developmental processes and elimination of damaged cells upon environmental stresses. Among the important regulators of PCD, much interest has been centered on BCL2-associated x protein (BAX) as the pro-PCD factor. On the other hand, BAX inhibitor-1 (BI-1) has been implicated as an anti-PCD factor that balances out the activity of BAX in the developmental processes and responses to environment. A cDNA clone coding a BI-1 gene was isolated from a cDNA library of heat-stressed hot pepper (Capsicum annuum) and named as CaBI-1. This gene contains an open reading frame (ORF) of 248 amino acids encoding a BI-1 protein. Genomic DNA-blot analysis for CaBI-1 suggested one or two loci in the C. annuum genome. Transcription of CaBI-1 was induced in response to high or low temperatures, drought, high salinity, flooding and heavy metal stresses, and ABA. We introduced the ORF of CaBI-1 under the control of the CaMV 35S promoter (P(35S)) into tobacco (Nicotiana tabacum cv. Wisconsin 38) genome by Agrobacterium-mediated transformation. The P(35S):CaBI-1 transgenic plants displayed markedly improved tolerance to high temperature, water deficit, and high salinity in comparison to the control plants. The results indicate that CaBI-1 is a BI-1 gene of which expression induced under various abiotic stresses and endows tolerance to several types of environmental stresses.

  11. Improving Healthy Eating Through Social Marketing

    Centers for Disease Control (CDC) Podcasts

    2017-10-09

    This podcast features Emily Liu, a freshman at the University of Pennsylvania and one of the winners of PCD’s 2017 Student Research Paper Contest. Emily answers questions about her winning research and what impact her study has on obesity prevention and public health.  Created: 10/9/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/9/2017.

  12. A Inclusão de Pessoas com Deficiência no Contexto do Trabalho em Florianópolis: Relato de Experiência no Sistema Nacional de Emprego

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Hammes

    Full Text Available Após a implantação da Lei de Cotas, que obriga as empresas com mais de cem funcionários a contratarem pessoas com deficiência (PcD, percebeu-se uma mudança de paradigma que coaduna com o princípio de inclusão. Além disso, estudos de Responsabilidade Social Empresarial têm levantado a importância da diversidade dentro das organizações, apontando a inclusão das PcD como forte aliada para uma gestão socialmente responsável, com significativos ganhos para a empresa. Assim, este artigo pretende mostrar a experiência vivida pelo Sistema Nacional de Emprego (SINE, na Grande Florianópolis, por meio do desenvolvimento de ações específicas para inclusão das PcD no mundo do trabalho. Realizando atividades focadas no público interno, nos empregadores e trabalhadores com deficiência, o SINE teve um aumento de 52% no fluxo de atendimentos às PcD, intermediando a inserção desse público no mercado de trabalho. Constatou-se que as principais dificuldades encontradas no desenvolvimento dessas ações são as barreiras atitudinais, ou seja, o preconceito e o desconhecimento das pessoas acerca da deficiência, além da falta de rotina de fiscalização do cumprimento das cotas nas empresas e da presença de barreiras programáticas relativas ao BPC (Benefício da Prestação Continuada.

  13. Assessing Tobacco Treatment Practices and Beliefs Among Clinicians

    Centers for Disease Control (CDC) Podcasts

    2014-05-22

    Michael Celestin, Jr, MA, from the Louisiana Tobacco Control Initiative and Louisiana State University Health Sciences Center, discusses his study conducted among health care staff to determine what they believe are the best ways to help patients quit smoking.  Created: 5/22/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 5/22/2014.

  14. ROS-induced oxidative stress and apoptosis-like event directly affect the cell viability of cryopreserved embryogenic callus in Agapanthus praecox.

    Science.gov (United States)

    Zhang, Di; Ren, Li; Chen, Guan-Qun; Zhang, Jie; Reed, Barbara M; Shen, Xiao-Hui

    2015-09-01

    Oxidative stress and apoptosis-like programmed cell death, induced in part by H 2 O 2 , are two key factors that damage cells during plant cryopreservation. Their inhibition can improve cell viability. We hypothesized that oxidative stress and apoptosis-like event induced by ROS seriously impact plant cell viability during cryopreservation. This study documented changes in cell morphology and ultrastructure, and detected dynamic changes in ROS components (O 2 (·-) , H2O2 and OH·), antioxidant systems, and programmed cell death (PCD) events during embryonic callus cryopreservation of Agapanthus praecox. Plasmolysis, organelle ultrastructure changes, and increases in malondialdehyde (a membrane lipid peroxidation product) suggested that oxidative damage and PCD events occurred at several early cryopreservation steps. PCD events including autophagy, apoptosis-like, and necrosis also occurred at later stages of cryopreservation, and most were apoptosis. H2O2 is the most important ROS molecule mediating oxidative damage and affecting cell viability, and catalase and AsA-GSH cycle are involved in scavenging the intracellular H2O2 and protecting the cells against stress damage in the whole process. Gene expression studies verified changes of antioxidant system and PCD-related genes at the main steps of the cryopreservation process that correlated with improved cell viability. Reducing oxidative stress or inhibition of apoptosis-like event by deactivating proteases improved cryopreserved cell viability from 49.14 to 86.85 % and 89.91 %, respectively. These results verify our model of ROS-induced oxidative stress and apoptosis-like event in plant cryopreservation. This study provided a novel insight into cell stress response mechanisms in cryopreservation.

  15. Accuracy analysis of point cloud modeling for evaluating concrete specimens

    Science.gov (United States)

    D'Amico, Nicolas; Yu, Tzuyang

    2017-04-01

    Photogrammetric methods such as structure from motion (SFM) have the capability to acquire accurate information about geometric features, surface cracks, and mechanical properties of specimens and structures in civil engineering. Conventional approaches to verify the accuracy in photogrammetric models usually require the use of other optical techniques such as LiDAR. In this paper, geometric accuracy of photogrammetric modeling is investigated by studying the effects of number of photos, radius of curvature, and point cloud density (PCD) on estimated lengths, areas, volumes, and different stress states of concrete cylinders and panels. Four plain concrete cylinders and two plain mortar panels were used for the study. A commercially available mobile phone camera was used in collecting all photographs. Agisoft PhotoScan software was applied in photogrammetric modeling of all concrete specimens. From our results, it was found that the increase of number of photos does not necessarily improve the geometric accuracy of point cloud models (PCM). It was also found that the effect of radius of curvature is not significant when compared with the ones of number of photos and PCD. A PCD threshold of 15.7194 pts/cm3 is proposed to construct reliable and accurate PCM for condition assessment. At this PCD threshold, all errors for estimating lengths, areas, and volumes were less than 5%. Finally, from the study of mechanical property of a plain concrete cylinder, we have found that the increase of stress level inside the concrete cylinder can be captured by the increase of radial strain in its PCM.

  16. Phosphoproteome analysis of streptomyces development reveals extensive protein phosphorylation accompanying bacterial differentiation

    DEFF Research Database (Denmark)

    Manteca, Angel; Ye, Juanying; Sánchez, Jesús

    2011-01-01

    Streptomycetes are bacterial species that undergo a complex developmental cycle that includes programmed cell death (PCD) events and sporulation. They are widely used in biotechnology because they produce most clinically relevant secondary metabolites. Although Streptomyces coelicolor is one...... events were detected during the presporulation and sporulation stages (80%). Most of these phosphorylations were not reported before in Streptomyces, and included sporulation factors, transcriptional regulators, protein kinases and other regulatory proteins. Several of the identified phosphorylated...

  17. Emergency Medical Services Capacity for Prehospital Stroke Care

    Centers for Disease Control (CDC) Podcasts

    2013-09-05

    In this audio podcast, lead author and Preventing Chronic Disease’s 2013 Student Research Contest Winner, Mehul D. Patel, talks about his article on stroke care and emergency medical services.  Created: 9/5/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/5/2013.

  18. Geographical Overlapping of Obesity, Heart Disease, and Type 2 Diabetes

    Centers for Disease Control (CDC) Podcasts

    2017-10-09

    This podcast features Kayla Smurthwaite, an undergraduate student at Australian National University in Canberra, Australia, and one of the winners of PCD’s 2017 Student Research Paper Contest. Kayla answers questions about her winning research and what impact her study has on chronic disease prevention and public health.  Created: 10/9/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/9/2017.

  19. Defining and Measuring Chronic Conditions

    Centers for Disease Control (CDC) Podcasts

    2013-05-20

    This podcast is an interview with Dr. Anand Parekh, U.S. Department of Health and Human Services Deputy Assistant Secretary for Health, and Dr. Samuel Posner, Preventing Chronic Disease Editor in Chief, about the definition and burden of multiple chronic conditions in the United States.  Created: 5/20/2013 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 5/20/2013.

  20. La capacidad del Congreso de los Diputados español para impulsar la incorporación del enfoque de Coherencia de Políticas para el Desarrollo (CPD)

    OpenAIRE

    Pérez-González, J.; Segovia-Moreno, M.

    2017-01-01

    The international community has approved the 2030 Agenda for Sustainable Development as a common roadmap to face the global challenges of poverty, inequity and the sustainable management of the planet’s natural resources. For this Agenda to succeed, all countries must adopt the Policy Coherence for Development (PCD) approach as the guiding and crosscutting principle of all domestic and foreign policies during the next 15 years. National parliaments are going to be key players to urge Governme...

  1. Programmed cell death during quinoa perisperm development

    OpenAIRE

    L?pez-Fern?ndez, Mar?a Paula; Maldonado,Sara

    2013-01-01

    At seed maturity, quinoa (Chenopodium quinoa Willd.) perisperm consists of uniform, non-living, thin-walled cells full of starch grains. The objective of the present study was to study quinoa perisperm development and describe the programme of cell death that affects the entire tissue. A number of parameters typically measured during programmed cell death (PCD), such as cellular morphological changes in nuclei and cytoplasm, endoreduplication, DNA fragmentation, and the participation of nucle...

  2. BID regulates AIF-mediated caspase-independent necroptosis by promoting BAX activation.

    Science.gov (United States)

    Cabon, L; Galán-Malo, P; Bouharrour, A; Delavallée, L; Brunelle-Navas, M-N; Lorenzo, H K; Gross, A; Susin, S A

    2012-02-01

    Alkylating DNA-damage agents such as N-methyl-N'-nitro-N'-nitrosoguanidine (MNNG) trigger necroptosis, a newly defined form of programmed cell death (PCD) managed by receptor interacting protein kinases. This caspase-independent mode of cell death involves the sequential activation of poly(ADP-ribose) polymerase-1 (PARP-1), calpains, BAX and AIF, which redistributes from mitochondria to the nucleus to promote chromatinolysis. We have previously demonstrated that the BAX-mediated mitochondrial release of AIF is a critical step in MNNG-mediated necroptosis. However, the mechanism regulating BAX activation in this PCD is poorly understood. Employing mouse embryonic knockout cells, we reveal that BID controls BAX activation in AIF-mediated necroptosis. Indeed, BID is a link between calpains and BAX in this mode of cell death. Therefore, even if PARP-1 and calpains are activated after MNNG treatment, BID genetic ablation abolishes both BAX activation and necroptosis. These PCD defects are reversed by reintroducing the BID-wt cDNA into the BID(-/-) cells. We also demonstrate that, after MNNG treatment, BID is directly processed into tBID by calpains. In this way, calpain non-cleavable BID proteins (BID-G70A or BID-Δ68-71) are unable to promote BAX activation and necroptosis. Once processed, tBID localizes in the mitochondria of MNNG-treated cells, where it can facilitate BAX activation and PCD. Altogether, our data reveal that, as in caspase-dependent apoptosis, BH3-only proteins are key regulators of caspase-independent necroptosis.

  3. A Biopsy-based 17-gene Genomic Prostate Score as a Predictor of Metastases and Prostate Cancer Death in Surgically Treated Men with Clinically Localized Disease.

    Science.gov (United States)

    Van Den Eeden, Stephen K; Lu, Ruixiao; Zhang, Nan; Quesenberry, Charles P; Shan, Jun; Han, Jeong S; Tsiatis, Athanasios C; Leimpeter, Amethyst D; Lawrence, H Jeffrey; Febbo, Phillip G; Presti, Joseph C

    2017-10-05

    A 17-gene biopsy-based reverse transcription polymerase chain reaction assay, which provides a Genomic Prostate Score (GPS-scale 0-100), has been validated as an independent predictor of adverse pathology and biochemical recurrence after radical prostatectomy (RP) in men with low- and intermediate-risk prostate cancer (PCa). To evaluate GPS as a predictor of PCa metastasis and PCa-specific death (PCD) in a large cohort of men with localized PCa and long-term follow-up. A retrospective study using a stratified cohort sampling design was performed in a cohort of men treated with RP within Kaiser Permanente Northern California. RNA from archival diagnostic biopsies was assayed to generate GPS results. We assessed the association between GPS and time to metastasis and PCD in prespecified uni- and multivariable statistical analyses, based on Cox proportional hazard models accounting for sampling weights. The final study population consisted of 279 men with low-, intermediate-, and high-risk PCa between 1995 and 2010 (median follow-up 9.8 yr), and included 64 PCD and 79 metastases. Valid GPS results were obtained for 259 (93%). In univariable analysis, GPS was strongly associated with time to PCD, hazard ratio (HR)/20 GPS units=3.23 (95% confidence interval [CI] 1.84-5.65; passociation between GPS and both end points remained significant after adjusting for National Comprehensive Cancer Network, American Urological Association, and Cancer of the Prostate Risk Assessment (CAPRA) risks (pcourse of management of their disease. Copyright © 2017 European Association of Urology. Published by Elsevier B.V. All rights reserved.

  4. Error-related functional connectivity of the thalamus in cocaine dependence

    Directory of Open Access Journals (Sweden)

    Sheng Zhang

    2014-01-01

    Full Text Available Error processing is a critical component of cognitive control, an executive function that has been widely implicated in substance misuse. In previous studies we showed that error related activations of the thalamus predicted relapse to drug use in cocaine addicted individuals (Luo et al., 2013. Here, we investigated whether the error-related functional connectivity of the thalamus is altered in cocaine dependent patients (PCD, n = 54 as compared to demographically matched healthy individuals (HC, n = 54. The results of a generalized psychophysiological interaction analysis showed negative thalamic connectivity with the ventral medial prefrontal cortex (vmPFC, in the area of perigenual and subgenual anterior cingulate cortex, in HC but not PCD (p < 0.05, corrected, two-sample t test. This difference in functional connectivity was not observed for task-residual signals, suggesting that it is specific to task-related processes during cognitive control. Further, the thalamic-vmPFC connectivity is positively correlated with the amount of cocaine use in the prior month for female but not for male PCD. These findings add to recent literature and provide additional evidence for circuit-level biomarkers of cocaine dependence.

  5. Study of Subtropical Forestry Index Retrieval Using Terrestrial Laser Scanning and Hemispherical Photography

    Directory of Open Access Journals (Sweden)

    Ting Yun

    2015-01-01

    Full Text Available In order to retrieve gap fraction, leaf inclination angle, and leaf area index (LAI of subtropical forestry canopy, here we acquired forestry detailed information by means of hemispherical photography, terrestrial laser scanning, and LAI-2200 plant canopy analyzer. Meanwhile, we presented a series of image processing and computer graphics algorithms that include image and point cloud data (PCD segmentation methods for branch and leaf classification and PCD features, such as normal vector, tangent plane extraction, and hemispherical projection method for PCD coordinate transformation. In addition, various forestry mathematical models were proposed to deduce forestry canopy indexes based on the radiation transfer model of Beer-Lambert law. Through the comparison of the experimental results on many plot samples, the terrestrial laser scanner- (TLS- based index estimation method obtains results similar to digital hemispherical photograph (HP and LAI-2200 plant canopy analyzer taken of the same stands and used for validation. It indicates that the TLS-based algorithm is able to capture the variability in LAI of forest stands with a range of densities, and there is a high chance to enhance TLS as a calibration tool for other devices.

  6. GASIFICATION TEST RUN TC06

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services, Inc.

    2003-08-01

    This report discusses test campaign TC06 of the Kellogg Brown & Root, Inc. (KBR) Transport Reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using a particulate control device (PCD). The Transport Reactor was operated as a pressurized gasifier during TC06. Test run TC06 was started on July 4, 2001, and completed on September 24, 2001, with an interruption in service between July 25, 2001, and August 19, 2001, due to a filter element failure in the PCD caused by abnormal operating conditions while tuning the main air compressor. The reactor temperature was varied between 1,725 and 1,825 F at pressures from 190 to 230 psig. In TC06, 1,214 hours of solid circulation and 1,025 hours of coal feed were attained with 797 hours of coal feed after the filter element failure. Both reactor and PCD operations were stable during the test run with a stable baseline pressure drop. Due to its length and stability, the TC06 test run provided valuable data necessary to analyze long-term reactor operations and to identify necessary modifications to improve equipment and process performance as well as progressing the goal of many thousands of hours of filter element exposure.

  7. Restriction endonuclease triggered bacterial apoptosis as a mechanism for long time survival.

    Science.gov (United States)

    Nagamalleswari, Easa; Rao, Sandhya; Vasu, Kommireddy; Nagaraja, Valakunja

    2017-08-21

    Programmed cell death (PCD) under certain conditions is one of the features of bacterial altruism. Given the bacterial diversity and varied life style, different PCD mechanisms must be operational that remain largely unexplored. We describe restriction endonuclease (REase) mediated cell death by an apoptotic pathway, beneficial for isogenic bacterial communities. Cell death is pronounced in stationary phase and when the enzyme exhibits promiscuous DNA cleavage activity. We have elucidated the molecular mechanism of REase mediated cell killing and demonstrate that released nutrients from dying cells support the growth of the remaining cells in the population. These findings illustrate a new intracellular moonlighting role for REases which are otherwise established host defence arsenals. REase induced PCD appears to be a cellular design to replenish nutrients for cells undergoing starvation stress and the phenomenon could be wide spread in bacteria, given the abundance of restriction-modification (R-M) systems in the microbial population. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  8. Involvement of Arabidopsis Hexokinase1 in Cell Death Mediated by Myo -Inositol Accumulation

    KAUST Repository

    Bruggeman, Quentin

    2015-06-05

    Programmed cell death (PCD) is essential for several aspects of plant life, including development and stress responses. We recently identified the mips1 mutant of Arabidopsis thaliana, which is deficient for the enzyme catalyzing the limiting step of myo-inositol (MI) synthesis. One of the most striking features of mips1 is the light-dependent formation of lesions on leaves due to salicylic acid (SA)-dependent PCD. Here, we identified a suppressor of PCD by screening for mutations that abolish the mips1 cell death phenotype. Our screen identified the hxk1 mutant, mutated in the gene encoding the hexokinase1 (HXK1) enzyme that catalyzes sugar phosphorylation and acts as a genuine glucose sensor. We show that HXK1 is required for lesion formation in mips1 due to alterations in MI content, via SA-dependant signaling. Using two catalytically inactive HXK1 mutants, we also show that hexokinase catalytic activity is necessary for the establishment of lesions in mips1. Gas chromatography-mass spectrometry analyses revealed a restoration of the MI content in mips1 hxk1 that it is due to the activity of the MIPS2 isoform, while MIPS3 is not involved. Our work defines a pathway of HXK1-mediated cell death in plants and demonstrates that two MIPS enzymes act cooperatively under a particular metabolic status, highlighting a novel checkpoint of MI homeostasis in plants. © 2015 American Society of Plant Biologists. All rights reserved.

  9. A comparison between nuclear dismantling during plant and animal programmed cell death.

    Science.gov (United States)

    Domínguez, Fernando; Cejudo, Francisco Javier

    2012-12-01

    Programmed cell death (PCD) is a process of organized destruction of cells, essential for the development and maintenance of cellular homeostasis of multicellular organisms. Cells undergoing PCD begin a degenerative process in response to internal or external signals, whereby the nucleus becomes one of the targets. The process of nuclear dismantling includes events affecting the nuclear envelope, such as formation of lobes at the nuclear surface, selective proteolysis of nucleoporins and nuclear pore complex clustering. In addition, chromatin condensation increases in coordination with DNA fragmentation. These processes have been largely studied in animals, but remain poorly understood in plants. The overall process of cell death has different morphological and biochemical features in plants and animals. However, recent advances suggest that nuclear dismantling in plant cells progresses with morphological and biochemical characteristics similar to those in apoptotic animal cells. In this review, we summarize nuclear dismantling in plant PCD, focusing on the similarities and differences with their animal counterparts. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  10. The effect of acrylamide and nitric oxide donors on human mesenchymal progenitor cells.

    Science.gov (United States)

    Szewczyk, Lukasz; Ulańska, Justyna; Dubiel, Marta; Osyczka, Anna Maria; Tylko, Grzegorz

    2012-09-01

    We have examined the effects of nitric oxide donors and acrylamide on mesenchymal progenitor cell (hMPC) viability, programmed cell death (PCD) and differentiation. Acrylamide was examined at 0.5mM and 1.5mM concentrations, NOC-18 at 10μM and SNP at 100μM. Cell viability was assayed with MTS, PCD was determined by phosphatidylserine, caspase-9 and -3/7 and mitochondrial membrane potential assays, and osteogenic cell differentiation was evaluated by alkaline phosphatase activity (ALP) and mRNA levels for collagen type I, bone sialoprotein, ostepontin and osteocalcin. Serum-free hMPC cultures treated with 1.5mM acrylamide and SNP for 72h demonstrated reduced viability. PCD analyses revealed that SNP stimulated cells to necrosis in reactive species-dependent manner. Acrylamide (1.5mM) led to apoptosis independent of reactive species. Acrylamide and SNP reduced ALP activity and collagen type I mRNA levels but mRNA levels for bone sialoprotein and osteopontin increased in SNP treated cells and remained unchanged in acrylamide. Acrylamide had no effect on guanylate cyclase and cGMP osteogenic signaling pathway. The study suggests that acrylamide might impair bone development and remodeling upon acute or prolonged intoxication with this compound of mesenchymal cells. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Quantum Theory for a Total System with One Internal Measuring Apparatus

    Science.gov (United States)

    Wang, Wen-Ge

    2011-03-01

    We propose a quantum theory for a total system including one internal measuring apparatus. The theory is based on three basic assumptions and a principle termed the principle of compatible description (PCD). The assumptions are: (i) Physical states of the total system can be associated with vectors in the Hilbert space. (ii) Dynamical evolution of a state vector obeys Schrö dinger equation. (iii) For a physical state of the total system described by a pure vector, in which a subsystem may play the role of an internal measuring apparatus, when certain stable condition is satisfied, the pure-vector description may be given a Born-type ensemble interpretation. The PCD states that different descriptions for the same state of the total system must give consistent predictions for results of measurements performed by the internal measuring apparatus. The proposed theory lies at a meeting point of Copenhagen, Everett's relative-state, and consistent-histories interpretations of quantum mechanics. While, it provides something new: For example, the PCD imposes a restriction to vectors that can be associated with physical states, which may effectively break the time-reversal symmetry of Schrödinger equation. As an application of the theory, we derive a condition under which a two-level quantum system may have definite properties, such that it may play the essential role of a measuring apparatus.

  12. Effects of pruning in Monterey pine plantations affected by Fusarium circinatum

    Energy Technology Data Exchange (ETDEWEB)

    Bezos, D.; Lomba, J. M.; Martinez-Alvarez, P.; Fernandez, M.; Diez, J. J.

    2012-07-01

    Fusarium circinatum Nirenberg and O'Donnell (1998) is the causal agent of Pitch Canker Disease (PCD) in Pinus species, producing damage to the main trunk and lateral branches as well as causing branch dieback. The disease has been detected recently in northern Spain in Pinus spp. seedlings at nurseries and in Pinus radiata D. Don adult trees in plantations. Fusarium circinatum seems to require a wound to enter the tree, not only that as caused by insects but also that resulting from damage by humans, i.e. mechanical wounds. However, the effects of pruning on the infection process have yet to be studied. The aim of the present study was to know how the presence of mechanical damage caused by pruning affects PCD occurrence and severity in P. radiata plantations. Fifty P. radiata plots (pruned and unpruned) distributed throughout 16 sites affected by F. circinatum in the Cantabria region (northern Spain) were studied. Symptoms of PCD presence, such as dieback, oozing cankers and trunk deformation were evaluated in 25 trees per plot and related to pruning effect. A significant relationship between pruning and the number of cankers per tree was observed, concluding that wounds caused by pruning increase the chance of pathogen infection. Other trunk symptoms, such as the presence of resin outside the cankers, were also higher in pruned plots. These results should be taken into account for future management of Monterey Pine plantations. (Author) 36 refs.

  13. Relações entre significado do trabalho e percepção de suporte para pessoas com deficiência em organizações brasileiras

    Directory of Open Access Journals (Sweden)

    Raissa Pedrosa Gomes Tette

    2014-09-01

    Full Text Available Mediante a obrigatoriedade de contratação de pessoas com deficiência advinda com a Lei de Cotas, o processo de inclusão de pessoas com deficiência (PcD nas organizações brasileiras tem sido permeado por desafios, tanto para as empresas quanto para as próprias PcD. Este trabalho foi desenvolvido com o propósito de verificar a influência da percepção de suporte social e de suporte organizacional no significado do trabalho para PcD. As investigações foram realizadas com uma amostra de 169 pessoas com deficiência que trabalham em organizações de diversos segmentos nas diferentes regiões do Brasil. Concluiu-se que as categorias que melhor descrevem o significado do trabalho concreto das pessoas com deficiência estão associadas à garantia de condições econômicas de sobrevivência e de sustento pessoal e familiar, da estabilidade no emprego, do salário e do progresso social. As percepções de 'Suporte Social no Trabalho' e de 'Suporte Organizacional' são variáveis preditivas do Significado do Trabalho.

  14. Abnormal development of tapetum and microspores induced by chemical hybridization agent SQ-1 in wheat.

    Directory of Open Access Journals (Sweden)

    Shuping Wang

    Full Text Available Chemical hybridization agent (CHA-induced male sterility is an important tool in crop heterosis. To demonstrate that CHA-SQ-1-induced male sterility is associated with abnormal tapetal and microspore development, the cytology of CHA-SQ-1-treated plant anthers at various developmental stages was studied by light microscopy, scanning and transmission electron microscopy, in situ terminal deoxynucleotidyl transferasemediated dUTP nick end-labelling (TUNEL assay and DAPI staining. The results indicated that the SQ-1-treated plants underwent premature tapetal programmed cell death (PCD, which was initiated at the early-uninucleate stage of microspore development and continued until the tapetal cells were completely degraded; the process of microspore development was then blocked. Microspores with low-viability (fluorescein diacetate staining were aborted. The study suggests that premature tapetal PCD is the main cause of pollen abortion. Furthermore, it determines the starting period and a key factor in CHA-SQ-1-induced male sterility at the cell level, and provides cytological evidence to further study the mechanism between PCD and male sterility.

  15. NH4+-NH3 removal from simulated wastewater using UV-TiO2 photocatalysis: effect of co-pollutants and pH.

    Science.gov (United States)

    Vohra, M S; Selimuzzaman, S M; Al-Suwaiyan, M S

    2010-05-01

    The main objective of the present study was to investigate the efficiency of titanium dioxide (TiO2) assisted photocatalytic degradation (PCD) process for the removal of ammonium-ammonia (NH4(+)-NH3) from the aqueous phase and in the presence of co-pollutants thiosulfate (S2O3(2-)) and p-cresol (C6H4CH3OH) under varying mixed conditions. For the NH4(+)-NH3 only PCD experiments, results showed higher NH4 -NH3 removal at pH 12 compared to pH 7 and 10. For the binary NH4(+)-NH3/S2O3(2-) studies the respective results indicated a significant lowering in NH4(+)-NH3 PCD in the presence of S2O32- at pH 7/12 whereas at pH 10 a marked increase in NH4(+)-NH3 removal transpired. A similar trend was noted for the p-cresol/NH4(+)-NH3 binary system. Comparing findings from the binary (NH4(+)-NH3/S2O3(2-) and p-cresol/NH4(+)-NH3) and tertiary (NH4(+)-NH3/S2O3(2-)/p-cresol) systems, at pH 10, showed fastest NH4(+)-NH3 removal transpiring for the tertiary system as compared to the binary systems, whereas both the binary systems indicated comparable NH4(+)-NH3 removal trends. The respective details have been discussed.

  16. Applications of pixellated GaAs X-ray detectors in a synchrotron radiation beam

    CERN Document Server

    Watt, J; Campbell, M; Mathieson, K; Mikulec, B; O'Shea, V; Passmore, M S; Schwarz, C; Smith, K M; Whitehill, C

    2001-01-01

    Hybrid semiconductor pixel detectors are being investigated as imaging devices for radiography and synchrotron radiation beam applications. Based on previous work in the CERN RD19 and the UK IMPACT collaborations, a photon counting GaAs pixel detector (PCD) has been used in an X-ray powder diffraction experiment. The device consists of a 200 mu m thick SI-LEC GaAs detector patterned in a 64*64 array of 170 mu m pitch square pixels, bump-bonded to readout electronics operating in single photon counting mode. Intensity peaks in the powder diffraction pattern of KNbO/sub 3/ have been resolved and compared with results using the standard scintillator, and a PCD predecessor (the Omega 3). The PCD shows improved speed, dynamic range, 2-D information and comparable spatial resolution to the standard scintillator based systems. It also overcomes the severe dead time limitations of the Omega 3 by using a shutter based acquisition mode. A brief demonstration of the possibilities of the system for dental radiography and...

  17. HEATR2 plays a conserved role in assembly of the ciliary motile apparatus.

    Directory of Open Access Journals (Sweden)

    Christine P Diggle

    2014-09-01

    Full Text Available Cilia are highly conserved microtubule-based structures that perform a variety of sensory and motility functions during development and adult homeostasis. In humans, defects specifically affecting motile cilia lead to chronic airway infections, infertility and laterality defects in the genetically heterogeneous disorder Primary Ciliary Dyskinesia (PCD. Using the comparatively simple Drosophila system, in which mechanosensory neurons possess modified motile cilia, we employed a recently elucidated cilia transcriptional RFX-FOX code to identify novel PCD candidate genes. Here, we report characterization of CG31320/HEATR2, which plays a conserved critical role in forming the axonemal dynein arms required for ciliary motility in both flies and humans. Inner and outer arm dyneins are absent from axonemes of CG31320 mutant flies and from PCD individuals with a novel splice-acceptor HEATR2 mutation. Functional conservation of closely arranged RFX-FOX binding sites upstream of HEATR2 orthologues may drive higher cytoplasmic expression of HEATR2 during early motile ciliogenesis. Immunoprecipitation reveals HEATR2 interacts with DNAI2, but not HSP70 or HSP90, distinguishing it from the client/chaperone functions described for other cytoplasmic proteins required for dynein arm assembly such as DNAAF1-4. These data implicate CG31320/HEATR2 in a growing intracellular pre-assembly and transport network that is necessary to deliver functional dynein machinery to the ciliary compartment for integration into the motile axoneme.

  18. Leaf-shape remodeling: programmed cell death in fistular leaves of Allium fistulosum.

    Science.gov (United States)

    Ni, Xi-Lu; Su, Hui; Zhou, Ya-fu; Wang, Feng-Hua; Liu, Wen-Zhe

    2015-03-01

    Some species of Allium in Liliaceae have fistular leaves. The fistular lamina of Allium fistulosum undergoes a process from solid to hollow during development. The aims were to reveal the process of fistular leaf formation involved in programmed cell death (PCD) and to compare the cytological events in the execution of cell death to those in the unusual leaf perforations or plant aerenchyma formation. In this study, light and transmission electron microscopy were used to characterize the development of fistular leaves and cytological events. Terminal deoxynucleotidyl transferase-mediated dUTP nick end labeling (TUNEL) assays and gel electrophoresis were used to determine nuclear DNA cleavage during the PCD. The cavity arises in the leaf blade by degradation of specialized cells, the designated pre-cavity cells, in the center of the leaves. Nuclei of cells within the pre-cavity site become TUNEL-positive, indicating that DNA cleavage is an early event. Gel electrophoresis revealed that DNA internucleosomal cleavage occurred resulting in a characteristic DNA ladder. Ultrastructural analysis of cells at the different stages showed disrupted vacuoles, misshapen nuclei with condensed chromatin, degraded cytoplasm and organelles and emergence of secondary vacuoles. The cell walls degraded last, and residue of degraded cell walls aggregated together. These results revealed that PCD plays a critical role in the development of A. fistulosum fistular leaves. The continuous cavity in A. fistulosum leaves resemble the aerenchyma in the pith of some gramineous plants to improve gas exchange. © 2014 Scandinavian Plant Physiology Society.

  19. Effectiveness of Fluoroscopic and US - Guided Percutaneous Catheter Drainage for Iliopsoas Abscess through the Anterolateral Transabdominal Approach

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Ho Cheol; Shin, Tae Beom; Park, Mee Jung; Kim, Ji Eun; Choi, Hye Young; Bae, Kyung Soo; Choi, Dae Seob; Na, Jae Boem; Jeong, Seong Hoon [Gyeongsang National University Hospital, College of Medicine, Jinju (Korea, Republic of)

    2011-02-15

    We evaluated the effectiveness of performing fluoroscopic and ultrasonography guided percutaneous catheter drainage (PCD) through the anterolateral transabdominal approach for treating iliopsoas abscess. From January 2008 to December 2009, fluoroscopic and US-guided PCD through the anterolateral transabdominal approach was performed on sixteen iliopsoas abscesses of fourteen patients (7 males and 7 females; mean age: 63 years; age range: 30-87 years). Six abscesses were on the right side and ten abscesses were on the left side. The location of the abscesses were the psoas muscle (n=7), the iliacus muscle (n=7) and the iliopsoas muscle (n=2). All the procedures were performed under fluoroscopy and US guidance in the angiography room. The clinical findings before and after the procedure, the duration of catheter insertion and the procedure-related complications were evaluated. 15 out of the 16 iliopsoas abscesses were effectively treated. The duration of catheter insertion was 5- 27 days (mean: 14.6) days. No patient had significant complications during or after drainage. One patient died of uncontrolled diabetes complications and shock on the 9th day after percutaneous catheter drainage. One recurrence was noted 5 months after removal of the catheter. This patient underwent aspiration and antibiotic treatment for this lesion and the patient improved. Fluoroscopic and US-guided PCD for iliopsoas abscess through the anterolateral transabdominal approach is an effective and safe procedure

  20. Pharmacologic IKK/NF-κB inhibition causes antigen presenting cells to undergo TNFα dependent ROS-mediated programmed cell death

    Science.gov (United States)

    Tilstra, Jeremy S.; Gaddy, Daniel F.; Zhao, Jing; Davé, Shaival H.; Niedernhofer, Laura J.; Plevy, Scott E.; Robbins, Paul D.

    2014-01-01

    Monocyte-derived antigen presenting cells (APC) are central mediators of the innate and adaptive immune response in inflammatory diseases. As such, APC are appropriate targets for therapeutic intervention to ameliorate certain diseases. APC differentiation, activation and functions are regulated by the NF-κB family of transcription factors. Herein, we examined the effect of NF-κB inhibition, via suppression of the IκB Kinase (IKK) complex, on APC function. Murine bone marrow-derived macrophages and dendritic cells (DC), as well as macrophage and DC lines, underwent rapid programmed cell death (PCD) after treatment with several IKK/NF-κB inhibitors through a TNFα-dependent mechanism. PCD was induced proximally by reactive oxygen species (ROS) formation, which causes a loss of mitochondrial membrane potential and activation of a caspase signaling cascade. NF-κB-inhibition-induced PCD of APC may be a key mechanism through which therapeutic targeting of NF-κB reduces inflammatory pathologies.

  1. Programmed cell death in salivary glands of Drosophila arizonae and Drosophila mulleri.

    Science.gov (United States)

    Ianella, P; Azeredo-Oliveira, M T V; Itoyama, M M

    2008-01-01

    Programmed cell death (PCD) in insect metamorphosis assumes a great diversity of morphology and controlling processes that are still not well understood. With the objective of obtaining information about the PCD process, salivary glands of Drosophila arizonae and D. mulleri were studied during larval-pupal development. From the results, it can be concluded that the type of the PCD that occurs in these organs is morphologically typical of apoptosis (formation of apoptotic nuclei, followed by fragmentation into apoptotic bodies). Histolysis happens in both species, between 22 and 23 h after pupation. There were no significant differences between the species studied. Apoptosis does not occur simultaneously in all cells. Cytoplasmic acid phosphatase activity gradually increases during development, suggesting the existence of acid phosphatases that are only expressed during the apoptotic stage. Twenty hours after pupation, salivary glands already show biochemical alterations relative to nuclear permeability such as acidification, possibly due to the fusion of lysosomes with the nucleus a few hours before apoptosis. Autophagy seems to act together with apoptosis and has a secondary role in cell death.

  2. Cerebellar degeneration-related proteins 2 and 2-like are present in ovarian cancer in patients with and without Yo antibodies.

    Science.gov (United States)

    Raspotnig, Margrethe; Haugen, Mette; Thorsteinsdottir, Maria; Stefansson, Ingunn; Salvesen, Helga B; Storstein, Anette; Vedeler, Christian A

    2017-11-01

    Cerebellar degeneration-related protein 2 (CDR2) has been presumed to be the main antigen for the onconeural antibody Yo, which is strongly associated with ovarian cancer and paraneoplastic cerebellar degeneration (PCD). Recent data show that Yo antibodies also target the CDR2-like protein (CDR2L). We, therefore, examined the expression of CDR2 and CDR2L in ovarian cancer tissue from patients with and without Yo antibodies and from various other cancerous and normal human tissues. Ovarian cancer tissue and serum samples from 16 patients were included in the study (four with anti-Yo and PCD, two with anti-Yo without PCD, five with only CDR2L antibodies, and five without onconeural antibodies). Clinical data were available for all patients. The human tissues were examined by western blot and immunohistochemistry using rabbit CDR2 and CDR2L antibodies. Ovarian cancers from all 16 patients expressed CDR2 and CDR2L proteins. Both proteins were also present in normal and cancer tissue from mammary tissue, kidney, ovary, prostate, and testis. CDR2L is present in ovarian cancers from patients with and without Yo antibodies as was shown previously for CDR2. In addition, both CDR2 and CDR2L proteins are more widely expressed than previously thought, both in normal and cancerous tissues.

  3. A comparison of acoustic cavitation detection thresholds measured with piezo-electric and fiber-optic hydrophone sensors.

    Science.gov (United States)

    Bull, Victoria; Civale, John; Rivens, Ian; Ter Haar, Gail

    2013-12-01

    A Fabry-Perot interferometer fiber-optic hydrophone (FOH) was investigated for use as an acoustic cavitation detector and compared with a piezo-ceramic passive cavitation detector (PCD). Both detectors were used to measure negative pressure thresholds for broadband emissions in 3% agar and ex vivo bovine liver simultaneously. FOH-detected half- and fourth-harmonic emissions were also studied. Three thresholds were defined and investigated: (i) onset of cavitation; (ii) 100% probability of cavitation; and (iii) a time-integrated threshold where broadband signals integrated over a 3-s exposure duration, averaged over 5-10 repeat exposures, become statistically significantly greater than noise. The statistical sensitiviy of FOH broadband detection was low compared with that of the PCD (0.43/0.31 in agar/liver). FOH-detected fourth-harmonic data agreed best with PCD broadband (sensitivity: 0.95/0.94, specificity: 0.89/0.76 in agar/liver). The FOH has potential as a cavitation detector, particularly in applications where space is limited or during magnetic resonance-guided studies. Copyright © 2013 World Federation for Ultrasound in Medicine & Biology. Published by Elsevier Inc. All rights reserved.

  4. Automated identification of abnormal respiratory ciliary motion in nasal biopsies.

    Science.gov (United States)

    Quinn, Shannon P; Zahid, Maliha J; Durkin, John R; Francis, Richard J; Lo, Cecilia W; Chennubhotla, S Chakra

    2015-08-05

    Motile cilia lining the nasal and bronchial passages beat synchronously to clear mucus and foreign matter from the respiratory tract. This mucociliary defense mechanism is essential for pulmonary health, because respiratory ciliary motion defects, such as those in patients with primary ciliary dyskinesia (PCD) or congenital heart disease, can cause severe sinopulmonary disease necessitating organ transplant. The visual examination of nasal or bronchial biopsies is critical for the diagnosis of ciliary motion defects, but these analyses are highly subjective and error-prone. Although ciliary beat frequency can be computed, this metric cannot sensitively characterize ciliary motion defects. Furthermore, PCD can present without any ultrastructural defects, limiting the use of other detection methods, such as electron microscopy. Therefore, an unbiased, computational method for analyzing ciliary motion is clinically compelling. We present a computational pipeline using algorithms from computer vision and machine learning to decompose ciliary motion into quantitative elemental components. Using this framework, we constructed digital signatures for ciliary motion recognition and quantified specific properties of the ciliary motion that allowed high-throughput classification of ciliary motion as normal or abnormal. We achieved >90% classification accuracy in two independent data cohorts composed of patients with congenital heart disease, PCD, or heterotaxy, as well as healthy controls. Clinicians without specialized knowledge in machine learning or computer vision can operate this pipeline as a "black box" toolkit to evaluate ciliary motion. Copyright © 2015, American Association for the Advancement of Science.

  5. Contrast-enhanced spectral mammography based on a photon-counting detector: quantitative accuracy and radiation dose

    Science.gov (United States)

    Lee, Seungwan; Kang, Sooncheol; Eom, Jisoo

    2017-03-01

    Contrast-enhanced mammography has been used to demonstrate functional information about a breast tumor by injecting contrast agents. However, a conventional technique with a single exposure degrades the efficiency of tumor detection due to structure overlapping. Dual-energy techniques with energy-integrating detectors (EIDs) also cause an increase of radiation dose and an inaccuracy of material decomposition due to the limitations of EIDs. On the other hands, spectral mammography with photon-counting detectors (PCDs) is able to resolve the issues induced by the conventional technique and EIDs using their energy-discrimination capabilities. In this study, the contrast-enhanced spectral mammography based on a PCD was implemented by using a polychromatic dual-energy model, and the proposed technique was compared with the dual-energy technique with an EID in terms of quantitative accuracy and radiation dose. The results showed that the proposed technique improved the quantitative accuracy as well as reduced radiation dose comparing to the dual-energy technique with an EID. The quantitative accuracy of the contrast-enhanced spectral mammography based on a PCD was slightly improved as a function of radiation dose. Therefore, the contrast-enhanced spectral mammography based on a PCD is able to provide useful information for detecting breast tumors and improving diagnostic accuracy.

  6. Ricinosomes predict programmed cell death leading to anther dehiscence in tomato.

    Science.gov (United States)

    Senatore, Adriano; Trobacher, Christopher P; Greenwood, John S

    2009-02-01

    Successful development and dehiscence of the anther and release of pollen are dependent upon the programmed cell death (PCD) of the tapetum and other sporophytic tissues. Ultrastructural examination of the developing and dehiscing anther of tomato (Solanum lycopersicum) revealed that cells of the interlocular septum, the connective tissue, the middle layer/endothecium, and the epidermal cells surrounding the stomium all exhibit features consistent with progression through PCD. Ricinosomes, a subset of precursor protease vesicles that are unique to some incidents of plant PCD, were also present in all of these cell types. These novel organelles are known to harbor KDEL-tailed cysteine proteinases that act in the final stages of corpse processing following cell death. Indeed, a tomato KDEL-tailed cysteine proteinase, SlCysEP, was identified and its gene was cloned, sequenced, and characterized. SlCysEP transcript and protein were restricted to the anthers of the senescing tomato flower. Present in the interlocular septum and in the epidermal cells surrounding the stomium relatively early in development, SlCysEP accumulates later in the sporophytic tissues surrounding the locules as dehiscence ensues. At the ultrastuctural level, immunogold labeling localized SlCysEP to the ricinosomes within the cells of these tissues, but not in the tapetum. It is suggested that the accumulation of SlCysEP and the appearance of ricinosomes act as very early predictors of cell death in the tomato anther.

  7. Stress responses of the oil-producing green microalga Botryococcus braunii Race B

    Science.gov (United States)

    Cornejo-Corona, Ivette; Thapa, Hem R.; Browne, Daniel R.; Devarenne, Timothy P.

    2016-01-01

    Plants react to biotic and abiotic stresses with a variety of responses including the production of reactive oxygen species (ROS), which may result in programmed cell death (PCD). The mechanisms underlying ROS production and PCD have not been well studied in microalgae. Here, we analyzed ROS accumulation, biomass accumulation, and hydrocarbon production in the colony-forming green microalga Botryococcus braunii in response to several stress inducers such as NaCl, NaHCO3, salicylic acid (SA), methyl jasmonate, and acetic acid. We also identified and cloned a single cDNA for the B. braunii ortholog of the Arabidopsis gene defender against cell death 1 (DAD1), a gene that is directly involved in PCD regulation. The function of B. braunii DAD1 was assessed by a complementation assay of the yeast knockout line of the DAD1 ortholog, oligosaccharyl transferase 2. Additionally, we found that DAD1 transcription was induced in response to SA at short times. These results suggest that B. braunii responds to stresses by mechanisms similar to those in land plants and other  organisms. PMID:27957393

  8. Construction and characterization of an anti-CD20 mAb nanocomb with exceptionally excellent lymphoma-suppressing activity.

    Science.gov (United States)

    Li, Hua-Fei; Wu, Cong; Chen, Ting; Zhang, Ge; Zhao, He; Ke, Chang-Hong; Xu, Zheng

    2015-01-01

    The CD20-directed monoclonal antibody rituximab (RTX) established a new era in the treatment of non-Hodgkin lymphoma (NHL); however, suboptimal response and/or resistance to RTX still limit its clinical merits. Although four effector mechanisms are validated to participate in CD20-based immunotherapy, including complement-dependent cytotoxicity, antibody-dependent cell-mediated cytotoxicity, caspase-dependent apoptosis, and lysosome-mediated programmed cell death (PCD), they could hardly be synchronously activated by any anti-CD20 mAb or mAb derivative until now. Herein, a novel mAb nanocomb (polyethylenimine polymer-RTX-tositumomab [PPRT nanocomb]) was firstly constructed through mass arming two different anti-CD20 mAbs (RTX and tositumomab) to one polymer by nanotechnology. Comparing with free mAbs, PPRT nanocomb possesses a comparable binding ability and reduced "off-rate" to surface CD20 of NHL cells. When treated by PPRT nanocomb, the caspase-dependent apoptosis was remarkably enhanced except for concurrently eliciting complement-dependent cytotoxicity, antibody-dependent cell-mediated cytotoxicity, and lysosome-mediated PCD. Besides, "cross-cell link"-assisted homotypic adhesion by PPRT nanocomb further enhanced the susceptibility to PCD of lymphoma cells. Pharmacokinetic assays revealed that PPRT nanocomb experienced a relatively reduced clearance from peripheral blood compared with free antibodies. With the cooperation of all the abovementioned superiorities, PPRT nanocomb exhibits exceptionally excellent in vivo antitumor activities in both disseminated and localized human NHL xenotransplant models.

  9. Stratification of Antigen-presenting Cells within the Normal Cornea

    Directory of Open Access Journals (Sweden)

    Jared E. Knickelbein

    2009-11-01

    Full Text Available The composition and location of professional antigen presenting cells (APC varies in different mucosal surfaces. The cornea, long considered an immune-privileged tissue devoid of APCs, is now known to host a heterogeneous network of bone marrow-derived cells. Here, we utilized transgenic mice that express enhanced green fluorescent protein (EGFP from the CD11c promoter (pCD11c in conjunction with immunohistochemical staining to demonstrate an interesting stratification of APCs within non-inflamed murine corneas. pCD11c+ dendritic cells (DCs reside in the basal epithelium, seemingly embedded in the basement membrane. Most DCs express MHC class II on at least some dendrites, which extend up to 50 µm in length and traverse up 20 µm tangentially towards the apical surface of the epithelium. The DC density diminishes from peripheral to central cornea. Beneath the DCs and adjacent to the stromal side of the basement membrane reside pCD11c-CD11b+ putative macrophages that express low levels of MHC class II. Finally, MHC class IIpCD11c-CD11b+ cells form a network throughout the remainder of the stroma. This highly reproducible stratification of bone marrow-derived cells is suggestive of a progression from an APC function at the exposed corneal surface to an innate immune barrier function deeper in the stroma.

  10. Energy-sensitive photon counting detector-based X-ray computed tomography.

    Science.gov (United States)

    Taguchi, Katsuyuki

    2017-03-01

    Energy-sensitive photon counting detectors (PCDs) have recently been developed for medical X-ray computed tomography (CT) imaging and a handful of prototype PCD-CT systems have been built and evaluated. PCDs detect X-rays by using mechanisms that are completely different from the current CT detectors (i.e., energy integrating detectors or EIDs); PCDs count photons and obtain the information of the object tissues (i.e., the effective atomic numbers and mass densities) to be imaged. Therefore, these PCDs have the potential not only for evolution-to improve the current CT images such as providing dose reduction-but also for a revolution-to enable novel applications with a new concept such as molecular CT imaging. The performance of PCDs, however, is not flawless, and thus, it requires integrated efforts to develop PCD-CT for clinical use. In this article, we review the current status and the prediction for the future of PCDs, PCD-CT systems, and potential clinical applications.

  11. Ysp2 mediates death of yeast induced by amiodarone or intracellular acidification.

    Science.gov (United States)

    Sokolov, Sviatoslav; Knorre, Dmitry; Smirnova, Ekaterina; Markova, Olga; Pozniakovsky, Andrey; Skulachev, Vladimir; Severin, Fedor

    2006-01-01

    Recently we have found that the drug amiodarone induces apoptosis in yeast, which is mediated by reactive oxygen species (ROS). Here we have used this finding as a tool to screen for genes involved in the death program. We have described a novel mitochondrial protein, Ysp2, acting in the amiodarone-induced death cascade. After amiodarone addition both the control and amiodarone-resistant ysp2-deleted cells formed ROS, but the mutant (unlike the control) did not undergo the mitochondrial thread-to-grain transition. To test whether the action of Ysp2 is amiodarone-specific we tried to induce PCD by other agents. We have found that acetic acid-induced PCD also depends on Ysp2. We also demonstrate that, like acetic acid, propionic acid or nigericin triggered intracellular acidification causing ROS-dependent death. We suggest that intracellular acidification results in the protonation of superoxide anion (O2-*) to form HO2, one of the most aggressive ROS, which in turn induces Ysp2-mediated PCD.

  12. Measuring the carrier lifetime by using a quasi-optical millimeter- and THz-wave system

    Science.gov (United States)

    Choe, Mun Seok; Sawant, Ashwini; Lee, Kyu-Sup; Yu, Nan Ei; Choi, EunMi

    2017-02-01

    The existing method for contactless measurement of the photoconductivity decay time is limited in terms of sample selection according to the injection level or doping density. To solve this problem and improve the measurement sensitivity, we developed a quasi-optical photoconductivity decay (QO-PCD) technique based on millimeter- and terahertz-wave technology. A semi-insulating silicon (Si) wafer was used in a proof-of-concept experiment with the proposed QO-PCD system to find the initial excess carrier density and carrier lifetime based on the Drude-Zener model with a single decay function. The initial excess carrier density and carrier lifetime were measured to be 1.5 × 1015 cm-3 and 30.6 μs, respectively, in semi-insulating Si wafer (460 μm thickness). A 2D areal measurement of the decay time of the Si wafer was experimentally obtained. The proposed QO-PCD technique can provide more reliable and sensitive carrier lifetime measurement data for semiconductor wafers, which may impact the fields of photovoltaic solar cells and power electronics.

  13. Viral-induced systemic necrosis in plants involves both programmed cell death and the inhibition of viral multiplication, which are regulated by independent pathways.

    Science.gov (United States)

    Komatsu, Ken; Hashimoto, Masayoshi; Ozeki, Johji; Yamaji, Yasuyuki; Maejima, Kensaku; Senshu, Hiroko; Himeno, Misako; Okano, Yukari; Kagiwada, Satoshi; Namba, Shigetou

    2010-03-01

    Resistant plants respond rapidly to invading avirulent plant viruses by triggering a hypersensitive response (HR). An HR is accompanied by a restraint of virus multiplication and programmed cell death (PCD), both of which have been observed in systemic necrosis triggered by a successful viral infection. Here, we analyzed signaling pathways underlying the HR in resistance genotype plants and those leading to systemic necrosis. We show that systemic necrosis in Nicotiana benthamiana, induced by Plantago asiatica mosaic virus (PlAMV) infection, was associated with PCD, biochemical features, and gene expression patterns that are characteristic of HR. The induction of necrosis caused by PlAMV infection was dependent on SGT1, RAR1, and the downstream mitogen-activated protein kinase (MAPK) cascade involving MAPKKKalpha and MEK2. However, although SGT1 and RAR1 silencing led to an increased accumulation of PlAMV, silencing of the MAPKKKalpha-MEK2 cascade did not. This observation indicates that viral multiplication is partly restrained even in systemic necrosis induced by viral infection, and that this restraint requires SGT1 and RAR1 but not the MAPKKKalpha-MEK2 cascade. Similarly, although both SGT1 and MAPKKKalpha were essential for the Rx-mediated HR to Potato virus X (PVX), SGT1 but not MAPKKKalpha was involved in the restraint of PVX multiplication. These results suggest that systemic necrosis and HR consist of PCD and a restraint of virus multiplication, and that the latter is induced through unknown pathways independent from the former.

  14. Expressions of CD44,CD47,and c-met in Ovarian Clear Cell Carcinoma and Their Clinical Significance.

    Science.gov (United States)

    Wang, Hui-Min; Tan, Ming-Zi; Zhang, Song; Li, Xiao; Gao, Jian; Zhang, Dan-Ye; Hao, Ying-Ying; Gao, Song; Liu, Juan-Juan; Lin, Bei

    2016-12-20

    Objective To investigate the expressions of CD44,CD47,and c-met in ovarian clear cell carcinoma (OCCC) tissue and their correlations with clinical variables and prognosis. Methods Immunohistochemical method was used to investigate the expressions of CD44,CD47,and c-met in tissues from 86 OCCC patients and the relationships of their expressions with the clinicopathological factors of OCCC were analyzed. Results The expressions of CD44,CD47,and c-met were significantly high in OCCC tissues (90.7%,91.9%,and 94.2%,respectively). The strong positive expressions of CD44 and CD47 were significantly correlated with advanced International Federation of Gynecology and Obstetrics stages,chemotherapeutic resistance,and poor prognosis (all PCD47,and c-met and the lymphatic node metastasis. COX survival analysis revealed that advanced International Federation of Gynecology and Obstetrics stages and high expressions of CD44,CD47 and c-met were independent risk factors for poor prognosis (PCD47) and c-met and between CD44 and CD47 (the Spearman correlation coefficient rs was 0.783,0.776,and 0.835,respectively,all PCD47,and c-met increase in OCCC tissues and are correlated with each other. High expressions of CD44,CD47,and c-met are independent factors for poor prognosis.

  15. Expression and significance of CD44, CD47 and c-met in ovarian clear cell carcinoma.

    Science.gov (United States)

    Wang, Huimin; Tan, Mingzi; Zhang, Song; Li, Xiao; Gao, Jian; Zhang, Danye; Hao, Yingying; Gao, Song; Liu, Juanjuan; Lin, Bei

    2015-02-04

    The aim of the present study is to investigate the differential expression of CD44, CD47 and c-met in ovarian clear cell carcinoma (OCCC), the correlation in their expression and their relationship with the biological behavior of OCCC. We used immunohistochemistry to examine the expression of CD44, CD47 and c-met in OCCC (86 cases) and investigated the effects of the expression and interaction of these molecules on the development of OCCC. CD44, CD47 and c-met expression was significantly high in OCCC. Expression of CD44 and CD47 correlated with patient surgical stage, chemotherapy resistance and prognosis (all p0.05). The surgical stage, CD44, CD47 and c-met expression were independent risk factors for OCCC prognosis (all pCD47 and c-met showed better survival than those with high levels (all pCD47) and c-met, as well as between CD44 and CD47 (the Spearman correlation coefficient rs was 0.783, 0.776 and 0.835, respectively, all pCD47, CD44/c-met and CD47/c-met were correlated with patient surgical stage, chemotherapy resistance and prognosis (all p0.05). Expression of CD44, CD47 and c-met was upregulated in OCCC and pairwise correlation. CD44, CD47 and c-met may have synergistic effects on the development of OCCC and are prognostic factors for ovarian cancer.

  16. Boolean model of yeast apoptosis as a tool to study yeast and human apoptotic regulations.

    Science.gov (United States)

    Kazemzadeh, Laleh; Cvijovic, Marija; Petranovic, Dina

    2012-01-01

    Programmed cell death (PCD) is an essential cellular mechanism that is evolutionary conserved, mediated through various pathways and acts by integrating different stimuli. Many diseases such as neurodegenerative diseases and cancers are found to be caused by, or associated with, regulations in the cell death pathways. Yeast Saccharomyces cerevisiae, is a unicellular eukaryotic organism that shares with human cells components and pathways of the PCD and is therefore used as a model organism. Boolean modeling is becoming promising approach to capture qualitative behavior and describe essential properties of such complex networks. Here we present large literature-based and to our knowledge first Boolean model that combines pathways leading to apoptosis (a type of PCD) in yeast. Analysis of the yeast model confirmed experimental findings of anti-apoptotic role of Bir1p and pro-apoptotic role of Stm1p and revealed activation of the stress protein kinase Hog proposing the maximal level of activation upon heat stress. In addition we extended the yeast model and created an in silico humanized yeast in which human pro- and anti-apoptotic regulators Bcl-2 family and Valosin-contain protein (VCP) are included in the model. We showed that accumulation of Bax in silico humanized yeast shows apoptotic markers and that VCP is essential target of Akt Signaling. The presented Boolean model provides comprehensive description of yeast apoptosis network behavior. Extended model of humanized yeast gives new insights of how complex human disease like neurodegeneration can initially be tested.

  17. Expression of an oxalate decarboxylase impairs the necrotic effect induced by Nep1-like protein (NLP) of Moniliophthora perniciosa in transgenic tobacco.

    Science.gov (United States)

    da Silva, Leonardo F; Dias, Cristiano V; Cidade, Luciana C; Mendes, Juliano S; Pirovani, Carlos P; Alvim, Fátima C; Pereira, Gonçalo A G; Aragão, Francisco J L; Cascardo, Júlio C M; Costa, Marcio G C

    2011-07-01

    Oxalic acid (OA) and Nep1-like proteins (NLP) are recognized as elicitors of programmed cell death (PCD) in plants, which is crucial for the pathogenic success of necrotrophic plant pathogens and involves reactive oxygen species (ROS). To determine the importance of oxalate as a source of ROS for OA- and NLP-induced cell death, a full-length cDNA coding for an oxalate decarboxylase (FvOXDC) from the basidiomycete Flammulina velutipes, which converts OA into CO(2) and formate, was overexpressed in tobacco plants. The transgenic plants contained less OA and more formic acid compared with the control plants and showed enhanced resistance to cell death induced by exogenous OA and MpNEP2, an NLP of the hemibiotrophic fungus Moniliophthora perniciosa. This resistance was correlated with the inhibition of ROS formation in the transgenic plants inoculated with OA, MpNEP2, or a combination of both PCD elicitors. Taken together, these results have established a pivotal function for oxalate as a source of ROS required for the PCD-inducing activity of OA and NLP. The results also indicate that FvOXDC represents a potentially novel source of resistance against OA- and NLP-producing pathogens such as M. perniciosa, the causal agent of witches' broom disease of cacao (Theobroma cacao L.).

  18. Stress responses of the oil-producing green microalga Botryococcus braunii Race B

    Directory of Open Access Journals (Sweden)

    Ivette Cornejo-Corona

    2016-12-01

    Full Text Available Plants react to biotic and abiotic stresses with a variety of responses including the production of reactive oxygen species (ROS, which may result in programmed cell death (PCD. The mechanisms underlying ROS production and PCD have not been well studied in microalgae. Here, we analyzed ROS accumulation, biomass accumulation, and hydrocarbon production in the colony-forming green microalga Botryococcus braunii in response to several stress inducers such as NaCl, NaHCO3, salicylic acid (SA, methyl jasmonate, and acetic acid. We also identified and cloned a single cDNA for the B. braunii ortholog of the Arabidopsis gene defender against cell death 1 (DAD1, a gene that is directly involved in PCD regulation. The function of B. braunii DAD1 was assessed by a complementation assay of the yeast knockout line of the DAD1 ortholog, oligosaccharyl transferase 2. Additionally, we found that DAD1 transcription was induced in response to SA at short times. These results suggest that B. braunii responds to stresses by mechanisms similar to those in land plants and other  organisms.

  19. Matrine induces caspase-independent program cell death in hepatocellular carcinoma through bid-mediated nuclear translocation of apoptosis inducing factor.

    Science.gov (United States)

    Zhou, Huan; Xu, Minying; Gao, Ya; Deng, Zhigang; Cao, Hanwei; Zhang, Wenqing; Wang, Qiao; Zhang, Bing; Song, Gang; Zhan, Yanyan; Hu, Tianhui

    2014-03-16

    Matrine, a clinical drug in China, has been used to treat viral hepatitis, cardiac arrhythmia and skin inflammations. Matrine also exhibits chemotherapeutic potential through its ability to trigger cancer cell death. However, the mechanisms involved are still largely unknown. The objective of this study was to investigate the major determinant for the cell death induced by matrine in human hepatocellular carcinoma. We use human hepatocellular carcinoma cell line HepG2 and human hepatocellular carcinoma xenograft in nude mice as models to study the action of matrine in hepatocellular cancers. We found that caspase-dependent and -independent Program Cell Death (PCD) occurred in matrine-treated HepG2 cells, accompanied by the decreasing of mitochondrial transmembrane potential and the increasing ROS production. Further studies showed that AIF released from the mitochondria to the nucleus, and silencing of AIF reduced the caspase-independent PCD induced by matrine. What's more, AIF nuclear translocation, and the subsequent cell death as well, was prevented by Bid inhibitor BI-6C9, Bid-targeted siRNA and ROS scavenger Tiron. In the in vivo study, matrine significantly attenuated tumor growth with AIF release from mitochondria into nucleus in nude mice. These data imply that matrine potently induce caspase-independent PCD in HepG2 cells through Bid-mediated AIF translocation.

  20. Primary ciliary dyskinesia in the paediatric population: range and severity of radiological findings in a cohort of patients receiving tertiary care

    Energy Technology Data Exchange (ETDEWEB)

    Jain, K. [Department of Radiology, Royal Brompton and Harefield NHS Trust, London (United Kingdom); Padley, S.P.G. [Department of Radiology, Royal Brompton and Harefield NHS Trust, London (United Kingdom)], E-mail: s.padley@ic.ac.uk; Goldstraw, E.J.; Kidd, S.J. [Department of Radiology, Royal Brompton and Harefield NHS Trust, London (United Kingdom); Hogg, C.; Biggart, E.; Bush, A. [Department of Paediatric Respiratory Medicine, Royal Brompton and Harefield NHS Trust, London (United Kingdom)

    2007-10-15

    Aim: To investigate the clinical range and severity of radiological findings in a cohort of patients with primary ciliary dyskinesia (PCD) receiving tertiary care. Materials and methods: The case notes and clinical test results of 89 children attending the paediatric respiratory disease clinic at our institution were retrospectively analysed. Demographic details including age at diagnosis and common presenting signs and symptoms were studied. Results of chest radiographs, microscopy, and high-resolution computed tomography (HRCT) for quantification of lung damage were analysed. Results: In a cohort of 89 children with PCD, a presentation chest radiograph was available in 62% of patients (n = 55), with all but one demonstrating changes of bronchial wall thickening. HRCT of the lungs, available in 26 patients, were scored using the system described by Brody et al. analysing five specific features of lung disease, including bronchiectasis, mucus plugging, peribronchial thickening, parenchymal changes of consolidation, and ground-glass density, and focal air-trapping in each lobe. Peribronchial thickening was observed using HRCT in 25 patients, while 20 patients had bronchiectasis. Severity scores were highest for the middle and the lingular lobes. Conclusion: The radiographic findings of the largest reported cohort of patients with PCD are presented, with associated clinical findings. Dextrocardia remains the commonest finding on chest radiography. HRCT demonstrates peribronchial thickening and bronchiectasis, which is most marked in the lower zones. Radiological scoring techniques developed for assessment of cystic fibrosis can also be applied for the assessment of disease severity in this patient population.

  1. Purification and characterization of serine proteases that exhibit caspase-like activity and are associated with programmed cell death in Avena sativa.

    Science.gov (United States)

    Coffeen, Warren C; Wolpert, Thomas J

    2004-04-01

    Victoria blight of Avena sativa (oat) is caused by the fungus Cochliobolus victoriae, which is pathogenic because of the production of the toxin victorin. The victorin-induced response in sensitive A. sativa has been characterized as a form of programmed cell death (PCD) and displays morphological and biochemical features similar to apoptosis, including chromatin condensation, DNA laddering, cell shrinkage, altered mitochondrial function, and ordered, substrate-specific proteolytic events. Victorin-induced proteolysis of ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) is shown to be prevented by caspase-specific and general protease inhibitors. Evidence is presented for a signaling cascade leading to Rubisco proteolysis that involves multiple proteases. Furthermore, two proteases that are apparently involved in the Rubisco proteolytic cascade were purified and characterized. These proteases exhibit caspase specificity and display amino acid sequences homologous to plant subtilisin-like Ser proteases. The proteases are constitutively present in an active form and are relocalized to the extracellular fluid after induction of PCD by either victorin or heat shock. The role of the enzymes as processive proteases involved in a signal cascade during the PCD response is discussed.

  2. Two-Phase Flow Evaluation in Geothermal Pipelines; Evaluacion de flujos bifasicos en tuberias geotermicas

    Energy Technology Data Exchange (ETDEWEB)

    Del Rio Garcia, Luis [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)

    1996-01-01

    Pipe transportation of two phase-flow is a common practice in Mexican geothermal fields under commercial exploitation. Steam is separated from water using a centrifugal separator installed nearby a power plant. Afterwards, steam is conduced to the turbine and the water is reinjected into the reservoir. Sometimes the separation equipment are shared by two or more two-phase producing wells, so that the individual mass flow rate of each well is unknown. This paper is concerned with the evaluation of two-phase mass flow rates through sharp edged orifice plates, and attempts to establish the limits of steam quality in order that Murdock`s correlation gives acceptable results. This correlation was experimentally applied to well Az-25 of Los Azufres Geothermal field. In this case the single phase flows were determined after its separation by standard orifice plates (steam) and the weir box method. The results show that the Murdock`s correlation can be used for steam qualities of 50% and higher. [Espanol] El transporte de flujos bifasicos a traves de tuberias es una practica comun en los campos geotermicos mexicanos en la etapa de explotacion comercial. El vapor se separa del agua usando separadores centrifugos instalados en la vecindad de las unidades turbogeneradoras. Despues de esto, el vapor se conduce a las turbinas y el agua es reinyectada al yacimiento. En ocasiones, los equipos de separacion son compartidos por dos o mas pozos que producen flujos en dos fases, por lo que normalmente se desconocen tanto el gasto masico como la evolucion de la produccion de cada pozo. En este trabajo se propone una tecnica util en la evaluacion de flujos bifasicos, empleando placas orificio a partir de la correlacion de Murdock y se establece el intervalo de humedad para el cual el metodo proporciona resultados confiables. El metodo de Murdock fue aplicado experimentalmente al pozo Az-25 del campo geotermico de Los Azufres, para calidades de vapor entre 25 y 50%. En este caso los

  3. Research on remote sensing assessment technology for porphyry copper in south of Arequipa province of Peru

    Science.gov (United States)

    Yang, Rihong; Li, Zhizhong; Cheng, Xiufa; Zhao, Yuling

    2014-05-01

    The study area is located in the middle section of Andean metallogenic zone. Excellent mineralization geological conditions make it the most principal Porphyry Copper Deposits (PCDs) distribution area in southern Peru and there are several super-large PCDs for hundreds of kilometers in every direction. The regional metallogenic regularity of this area is controlled by the NNW fault parallel to the trench on the west of the South American continent. Small porphyry rocks are very common in this area (circular structure pattern in remote sensing image) with typical zoned alteration of PCD - potassic alteration, argillic alteration, phyllic alteration and propylitization (most exposed) from inside to the outside on the surface. These geologic features can be recognized and extracted by using remote sensing image data. Accordingly, the reflectivity curve of main altered minerals of the typical alteration zones of PCD was rebuilt which was corresponded to B1-B9 of ASTER satellite data, based on the altered mineral assemblages and their spectral characteristics of the typical alteration zones of PCD, and ASTER data's ability of identifying minerals with argillic alteration and carbonatite alteration. Based on the standard spectral data of USGS, We found that the information of argillic-and phyllic- altered minerals assemblages in the typical alteration zones can be extracted in the principal components analysis pattern based on ASTER B1467 while the information of propylitization altered minerals in the principal components analysis pattern based on ASTER B1348 with larger reflectivity of B9 than B8, after comparing and analyzing comprehensively the spectral curve characteristics of main altered minerals. In this method, altered minerals assemblages of argillic-and phyllic- altered zone and propylitization altered zone in this study area was extracted, and the results agree well with the distribution of known PCD. Meanwhile, remote sensing geological interpretation has

  4. Steroid-triggered, cell-autonomous death of a Drosophila motoneuron during metamorphosis.

    Science.gov (United States)

    Winbush, Ari; Weeks, Janis C

    2011-04-27

    The metamorphosis of Drosophila melanogaster is accompanied by elimination of obsolete neurons via programmed cell death (PCD). Metamorphosis is regulated by ecdysteroids, including 20-hydroxyecdysone (20E), but the roles and modes of action of hormones in regulating neuronal PCD are incompletely understood. We used targeted expression of GFP to track the fate of a larval motoneuron, RP2, in ventral ganglia. RP2s in abdominal neuromeres two through seven (A2 to A7) exhibited fragmented DNA by 15 hours after puparium formation (h-APF) and were missing by 20 h-APF. RP2 death began shortly after the 'prepupal pulse' of ecdysteroids, during which time RP2s expressed ecdysteroid receptors (EcRs). Genetic manipulations showed that RP2 death required the function of EcR-B isoforms, the death-activating gene, reaper (but not hid), and the apoptosome component, Dark. PCD was blocked by expression of the caspase inhibitor p35 but unaffected by manipulating Diap1. In contrast, aCC motoneurons in neuromeres A2 to A7, and RP2s in neuromere A1, expressed EcRs during the prepupal pulse but survived into the pupal stage under all conditions tested. To test the hypothesis that ecdysteroids trigger RP2's death directly, we placed abdominal GFP-expressing neurons in cell culture immediately prior to the prepupal pulse, with or without 20E. 20E induced significant PCD in putative RP2s, but not in control neurons, as assessed by morphological criteria and propidium iodide staining. These findings suggest that the rise of ecdysteroids during the prepupal pulse acts directly, via EcR-B isoforms, to activate PCD in RP2 motoneurons in abdominal neuromeres A2 to A7, while sparing RP2s in A1. Genetic manipulations suggest that RP2's death requires Reaper function, apoptosome assembly and Diap1-independent caspase activation. RP2s offer a valuable 'single cell' approach to the molecular understanding of neuronal death during insect metamorphosis and, potentially, of neurodegeneration in other

  5. Steroid-triggered, cell-autonomous death of a Drosophila motoneuron during metamorphosis

    Directory of Open Access Journals (Sweden)

    Winbush Ari

    2011-04-01

    Full Text Available Abstract Background The metamorphosis of Drosophila melanogaster is accompanied by elimination of obsolete neurons via programmed cell death (PCD. Metamorphosis is regulated by ecdysteroids, including 20-hydroxyecdysone (20E, but the roles and modes of action of hormones in regulating neuronal PCD are incompletely understood. Results We used targeted expression of GFP to track the fate of a larval motoneuron, RP2, in ventral ganglia. RP2s in abdominal neuromeres two through seven (A2 to A7 exhibited fragmented DNA by 15 hours after puparium formation (h-APF and were missing by 20 h-APF. RP2 death began shortly after the 'prepupal pulse' of ecdysteroids, during which time RP2s expressed ecdysteroid receptors (EcRs. Genetic manipulations showed that RP2 death required the function of EcR-B isoforms, the death-activating gene, reaper (but not hid, and the apoptosome component, Dark. PCD was blocked by expression of the caspase inhibitor p35 but unaffected by manipulating Diap1. In contrast, aCC motoneurons in neuromeres A2 to A7, and RP2s in neuromere A1, expressed EcRs during the prepupal pulse but survived into the pupal stage under all conditions tested. To test the hypothesis that ecdysteroids trigger RP2's death directly, we placed abdominal GFP-expressing neurons in cell culture immediately prior to the prepupal pulse, with or without 20E. 20E induced significant PCD in putative RP2s, but not in control neurons, as assessed by morphological criteria and propidium iodide staining. Conclusions These findings suggest that the rise of ecdysteroids during the prepupal pulse acts directly, via EcR-B isoforms, to activate PCD in RP2 motoneurons in abdominal neuromeres A2 to A7, while sparing RP2s in A1. Genetic manipulations suggest that RP2's death requires Reaper function, apoptosome assembly and Diap1-independent caspase activation. RP2s offer a valuable 'single cell' approach to the molecular understanding of neuronal death during insect

  6. Semiactive balancing control scheme in a rotor - bearing system supported on Mr. Dampers: design and experiments

    Energy Technology Data Exchange (ETDEWEB)

    Silva Navarro, Gerardo; Cabrera Amado, Alvaro [Cinvestav, IPN, Mexico, D.F. (Mexico)

    2007-11-15

    This paper deals with the problem of semiactive balancing control of a rotor-bearing system, where one journal bearings is supported on two radial Magneto-Rheological (MR) dampers. The mathematical model of the rotor-bearing system results from an orthotropic Jeffcott-like model and the dynamics associated to the MR dampers, whose rheological properties depend on the current inputs. For control purposes we use the Choi-Lee-Park polynomial for the MR dampers, which is quite consistent with the tpical nonlinear and complex hysteresis behavior and also simplifies the physical implementation on an experimental setup. The semiactive control scheme for the unbalance reponse of the rotor-bearing system is synthesized using sliding-mode control techniques. Some numerical and experimental results are included to illustrate the dynamic performance and robustness of the overall system. [Spanish] En este trabajo se abora el problema de control semiactivo del desbalance en un sistema rotor-chumacera, donde una de las chumaceras convencionales se monta sobre una suspension con dos amortiguadores Magneto-Reologicos (MR) radiales. El modelo matematico del sistema rotorchumacera se obtiene de un modelo tipo Jefcott ortotropico y la dinamica de los amortiguadores MR, cuyas propiedades reologicas dependen de las corrientes electricas de alimentacion. Para propositos de control se emplea el modelo polinomial de Choi-Lee-Park para los dos amortiguadores MR, el cual es consistente con el tipico comportamiento no-lineal y de histeresis, permitiendo simplificar su implementacion fisica en una plataforma experimental. El esquema de control semiactivo de la respuesta al desbalance, en el sistema rotor-chumacera, se basa en las tecnicas de control por modos deslizantes. Se presentan algunos resultados de simulacion numerica y experimentos que utilizan el funcionamiento y robustez del sistema completo.

  7. Tribological behaviour of line hardening of steel U13A with Nd: YAG laser

    Directory of Open Access Journals (Sweden)

    Sagaro, R.

    1999-06-01

    Full Text Available To diminish wear in tribological systems is frequently to harden locally the load carrying areas, which are subjected to wear. A Nd:YAG laser was used for the improvement of hardness and wear resistance of steel U13A. The friction and wear characteristics of steel U13A in sliding contact against steel 65MN4 under unlubricated conditions were evaluated for conventional treatments and after laser irradiation. In addition the transformations occurring during laser treatments and the influence of laser parameters for quenching on tribological characteristics are presented. The experimental work indicates that wear resistance of steel U13A (AISI Wl 12 is several times higher then that for conventional heat treatments.

    Para disminuir el desgaste en los sistemas tribológicos frecuentemente se llevan a cabo endurecimientos localizados en aquellas áreas sometidas a esfuerzos y que están sujetas a desgaste. En el trabajo se presenta el endurecimiento y el incremento de la resistencia al desgaste del acero U13A, empleando un láser de Nd: YAG. Se evalúan las características de fricción y desgaste del acero U13A en contacto deslizante con el acero 65MN4 bajo condiciones de fricción seca para muestras con tratamientos térmicos convencionales y luego del tratamiento con láser. Se presentan además las transformaciones estructurales que tienen lugar durante el tratamiento con láser, así como la influencia de los parámetros operacionales del láser en las características tribológicas. Todo el trabajo experimental muestra un incremento de la resistencia al desgaste del acero U13A (AISI W112 con tratamiento térmico superficial con láser comparativamente con los tratamientos térmicos convencionales.

  8. Puente de Humber Gran Bretaña

    Directory of Open Access Journals (Sweden)

    Población Knappe, Eleuterio

    1981-03-01

    Full Text Available This article describes the building of the world's longest single- span hanging bridge (2,250 metres in the Humber estuary. The floor of this bridge, the main light of which Is 1,410 m, is formed by trapezoidal chestbeams made with 18 m long rigid sheets. This makes possible both economy of steel and a reduction In the dimensions of the cables, pylons and anchorage masses. The pylons, built of sliding formwork, consist of two 155 m high reinforced concrete hollow pillars.These pillars are joined by four horizontal struts. The construction of the Humber bridge allows the distances between both shores of the estuary to be cut and completes the motorway network in the area.

    Se describe en este artículo la construcción del puente colgado de tramo sencillo más largo del mundo (2.250 m en el estuario de Humber. El tablero de este puente, cuya luz principal es de 1.410 m, está formado por vigas-cajón trapezoidales realizadas mediante chapas rigidizadas de 18 m de longitud. De esta manera se obtiene una economía de acero así como una reducción en las dimensiones de los cables, pilonos y macizos de anclaje. Los pilonos, construidos con encofrado deslizante, se componen de dos pilares huecos de hormigón armado de 155 m de altura. Estos pilares están unidos por cuatro riostras horizontales. La construcción del puente de Humber permite acortar las distancias entre ambas orillas del estuario y completa la red de autopistas de la zona.

  9. d_21 system: un juego para ser habitado

    Directory of Open Access Journals (Sweden)

    Reyes, J. M.

    2008-12-01

    Full Text Available d21_system is a prototype for a convertible room built with compatible construction component systems. It consists in: 1- a catalogue of massproduced, fully equipped booths. 2- a bolted steel structure with identical and standardized staircase sections. 3- a wood structure comprising four different frames compatible with the steel structure. 4- three service systems with a fi xed layout where the booths, as well as lighting and all the electrical outlets needed, can be plugged in. 5- wheeled cabinets and sliding panels to divide different areas and uses. These "open meccanos" take their inspiration from the application of "open industrialization" processes. d21_system was set up, in just two weeks’ time, in the central courtyard at the Madrid fairgrounds for the CONSTRUTEC’04 event.d21_system es un prototipo de habitación transformable construido a base de S.3c (sistemas de construcción por componentes compatibles que consiste en: 1- un catalogo de cabinas producidas en serie. Totalmente equipadas2- una estructura de acero atornillada con sus tramos de escalera idénticos y normalizados3- una estructura de madera compuesta de 4 marcas distintas compatible con la estructura de acero4- tres redes de instalaciones capaces de enchufar- desenchufar en su trazado fi jo tanto las cabinas equipadas, como los focos y enchufes de corriente eléctrica que se necesiten5- armarios- rodantes y paneles deslizantes para dividir y separar las diferentes zonas de usos. La aplicación de los procesos pertenecientes a "la industrialización abierta" es lo que permite pensar en esta clase de "mecanos abiertos". d21_system fue montado en el patio central de IFEMA para el certamen CONSTRUTEC`o4 y se montó en tan sólo 15 días.

  10. Nuevas tendencias metodológicas en la enseñanza del esquí: orientaciones didácticas para su iniciación en los centros educativos

    Directory of Open Access Journals (Sweden)

    Antonio Méndez-Giménez

    2011-09-01

    Full Text Available El presente trabajo recoge una propuesta de iniciación al esquí alpino desde los centros educativos de primaria y secundaria a partir de unidades didácticas que fomenten la transferencia vertical. Precisamente, se sugiere una secuenciación de las tareas en la que los aprendizajes realizados en primer lugar puedan facilitar el aprendizaje posterior de tareas similares, pero más complejas. La primera fase pone el énfasis en la realización de actividades lúdicas con esquís autoconstruidos; después, se pasa a una fase de actividades de deslizamiento sobre patines en línea y monopatín, y finalmente, el proceso culmina con la experiencia práctica del esquí en la nieve. Las claves metodológicas son las siguientes: diseño de una unidad didáctica más larga que la tradicional, empleo del juego como recurso de búsqueda y de diversión, autoconstrucción del material, uso de estilos de enseñanza combinados (mediante la búsqueda cuando las condiciones sean favorables, y mediante instrucción directa, en situaciones de mayor riesgo, práctica de patinaje en línea y monopatín (como modalidades populares de transición que permiten experimentar el desplazamiento sobre objetos deslizantes, así como una organización flexible de los grupos.

  11. PADRONIZAÇÃO DE EXCIPIENTES PARA MANIPULAÇÃO DE CÁPSULAS GELATINOSAS DURAS CONTENDO EXTRATO SECO DE VALERIANA (Valeriana officinalis, PRODUZIDAS NO PROJETO FARMÁCIA VIVA EM SOBRAL-CE

    Directory of Open Access Journals (Sweden)

    Antônio Neudimar Bastos Costa

    2016-07-01

    Full Text Available O Projeto Farmácia Viva é o primeiro projeto de assistência social farmacêutica desenvolvido no Brasil baseado no emprego científico de plantas medicinais. Dentre as formulações padronizadas a partir de cápsulas gelatinosas duras, destacam-se as cápsulas contendo Extrato Seco de Valeriana. Para manipulação dessas cápsulas, é necessária uma quantidade adicional de excipientes, que possuem papel importante na qualidade, segurança e no desempenho do medicamento. O objetivo deste estudo é padronizar excipientes para formulação fitoterápica em cápsulas manipuladas no Projeto Farmácia Viva. A metodologia seguida foi por meio de análise bibliográfica sobre os variados excipientes e fitoterápicos e análise de bulas de medicamentos para posterior sugestão de padronização. Foram manipuladas 30 cápsulas e submetidas ao controle da qualidade, onde foram avaliados o peso médio, limite de variação, coeficiente de variação, desvio padrão e variação do conteúdo teórico das cápsulas. A formulação de Valeriana proposta teve como excipientes escolhidos o estearato de magnésio (0,5 % como lubrificante, o dióxido de silício coloidal (1,0 % como deslizante, o talco farmacêutico (1,0 % como adsorvente, o amido farmacêutico (73,0 % como um diluente hidrofóbico, lactose monohidratada (24,5 % como um diluente hidrofílico. Todos os resultados do controle da qualidade obtidos atenderam as especificações farmacopeicas.

  12. Centro administrativo y de investigación de una compañía de seguros Viena – Austria

    Directory of Open Access Journals (Sweden)

    Hlaweniczka, Kurt

    1978-09-01

    Full Text Available This building is shaped in the form of a cross, with ten towers, six of which are 70 m high and the other four 45 m high. The most outstanding feature is their slender Steel, water-filled columns supporting the floor construction. The columns, in their turn rest on cross beams placed on box trusses (caisson connecting the towers. The towers were built using sliding forms, while the box trusses were built using scaffold forms. Infra-red rays were used in different construction stages to achieve the fast curing of the concrete. The building contains, among other areas, an electronic data processing facility, a teaching hall, mess hall, lounge, etc.

    Este edificio tiene forma de una cruz, con diez torres, cuatro de ellas con una altura de 70 m y las otras seis con una altura de 45 m. Su rasgo más característico son unas columnas delgadas de acero llenas de agua, sobre las que se apoyan los forjados de las plantas. Estas columnas, a su vez, se apoyan sobre vigas transversales colocadas sobre las vigas-cajón que unen las torres. Las torres fueron realizadas mediante encofrados deslizantes, mientras las vigas-cajón lo fueron con cimbras. En diversas fases de la construcción se utilizaron rayos ¡infrarrojos para conseguir un endurecimiento rápido del hormigón. El edificio consta de una instalación de elaboración electrónica de datos, una sala de enseñanza, comedor, sala de estar, etc.

  13. Puente Öland

    Directory of Open Access Journals (Sweden)

    Skanska Cementgjüteriet, Empresa

    1974-06-01

    Full Text Available The Öland bridge spans across the Kalmar strait, reaching from Möllstorpslage, on the island of Öland, to the island of N. Skallö; from here to the island of Svinö and then to Jutnabben, on the Swedish peninsula. It has 155 spans out of which 147 are small spans, two medium and six central, each one of them 130 m, with a total length of 6.070 m. The high arches have been constructed by the system of successive corbels and the low ones with a launching of big beams of reinforced concrete. Foundations on columns or poured on site in pneumatic emptied boxes, depending on the cases and piers of reinforced concrete, constructed by means of sliding formwork. The Construction Firm has been Skanska Cementgjuteriet, on account of the Government Administration.El puente de Öland salva el estrecho de Kalmar, partiendo de Möllstorpslage, en la isla de Öland, hasta la isla de N. Skallö; de aquí a la de Svinö y desde ésta hasta Jutnabben, en la península sueca. Tiene 155 vanos: 147 de luces pequeñas, 2 de luces medianas y 6 centrales, de 130 m cada una, con una longitud total de 6.070 m. Los arcos denominados altos se han realizado por el sistema de voladizos sucesivos, y los bajos, mediante lanzamiento de grandes vigas de hormigón armado. Cimientos sobre pilotes o vertidos in situ, en cajones vaciados neumáticamente, según los casos, y pilas de hormigón armado, construidas con auxilio de encofrados deslizantes. La Empresa constructora ha sido Skanska Cementgjuteriet, por cuenta de la Administración del Estado.

  14. Estudo comparativo dos procedimentos percutâneos orientados por métodos de imagem no tratamento das coleções intraperitoneais A comparison study between image-guided percutaneous procedures in the treatment of intra-abdominal liquid collections

    Directory of Open Access Journals (Sweden)

    Giselle Guedes Netto de Mello

    2004-04-01

    Full Text Available OBJETIVO: Verificar e comparar a eficácia da aspiração percutânea (AP e da drenagem percutânea (DP, orientadas por métodos de imagem, no tratamento das coleções intraperitoneais. MATERIAIS E MÉTODOS: Foram encaminhados ao nosso setor 52 pacientes para tratamento percutâneo de coleções abdominais. Destes, 16 apresentavam coleções intraperitoneais, sendo dez complexas (multiloculadas ou múltiplas e seis, simples. O volume das coleções variou de 40 a 1.200 ml, com mediana de 200 ml. Foram submetidas a AP seis coleções (37,5% e a DP, dez (62,5%. Considerou-se como sucesso do método a resolução completa da coleção, com melhora clínico-laboratorial do paciente. RESULTADOS: O sucesso do procedimento ocorreu em 75% dos casos. Nas coleções submetidas a AP houve sucesso em 100%, e nas submetidas a DP o sucesso foi de 60%. O índice de sucesso no grupo submetido a DP foi de 50% nas coleções menores ou iguais a 200 ml e de 75% nas de maior volume. Obteve-se sucesso com a DP em 33,3% das coleções complexas, em 42,9% das infectadas e em 100% das não infectadas e simples. Foram observadas apenas duas complicações menores (bacteremia transitória e infecção cutânea após os procedimentos. CONCLUSÃO: A AP e a DP são métodos eficazes e seguros para tratamento das coleções intraperitoneais. No nosso estudo, a AP foi mais eficaz que a DP, principalmente nas coleções de menor volume.OBJECTIVE: To determine and compare the efficacy of image-guided percutaneous needle aspiration (PNA versus percutaneous catheter drainage (PCD in the treatment of intra-abdominal liquid collections. MATERIALS AND METHODS: A prospective study involving 52 patients referred to our service for percutaneous treatment of abdominal liquid collections was carried out. Sixteen of these patients had intra-abdominal liquid collections (six patients with simple localized collections and ten patients with complex, multiseptated or multiple, collections

  15. Discinesia ciliar primária: considerações sobre seis casos da síndrome de Kartagener Primary ciliary dyskinesia: considerations regarding six cases of Kartagener syndrome

    Directory of Open Access Journals (Sweden)

    Hugo Alejandro Vega Ortega

    2007-10-01

    Full Text Available A discinesia ciliar primária (DCP, anteriormente conhecida como síndrome dos cílios imóveis, é uma doença hereditária autossômica recessiva que inclui vários padrões de defeitos em sua ultra-estrutura ciliar. Sua forma clínica mais grave é a síndrome de Kartagener (SK, a qual é encontrada em 50% dos casos de DCP. A DCP causa deficiência ou mesmo estase no transporte de secreções em todo o trato respiratório, favorecendo a proliferação de vírus e bactérias. Sua incidência varia de 1:20.000 a 1:60.000. Como conseqüência, os pacientes apresentam infecções crônicas e repetidas desde a infância e geralmente são portadores de bronquite, pneumonia, hemoptise, sinusite e infertilidade. As bronquiectasias e outras infecções crônicas podem ser o resultado final das alterações irreversíveis dos brônquios, podendo progredir para cor pulmonale crônico e suas conseqüências. Somente a metade dos pacientes afetados pela DCP apresenta todos os sintomas, condição denominada SK completa; no restante, não ocorre situs inversus, condição denominada SK incompleta. O diagnóstico é feito com base no quadro clínico e confirmado por meio da microscopia eletrônica de transmissão. Como não há tratamento especifico para a DCP, recomenda-se que, tão logo seja feito o diagnóstico, as infecções secundárias sejam tratadas com antibióticos potentes e medidas profiláticas sejam adotadas. Neste trabalho, relatamos seis casos de DCP (cinco casos de SK completa e um caso de SK incompleta e revisamos a literatura sobre o assunto, tendo como foco os aspectos diagnósticos, terapêuticos e clínicos desta doença.Primary ciliary dyskinesia (PCD, previously known as immotile cilia syndrome, is an autosomal recessive hereditary disease that includes various patterns of ciliary ultrastructural defects. The most serious form is Kartagener syndrome (KS, which accounts for 50% of all cases of PCD. The incidence of PCD ranges from 1

  16. Mutation of Growth Arrest Specific 8 Reveals a Role in Motile Cilia Function and Human Disease.

    Directory of Open Access Journals (Sweden)

    Wesley R Lewis

    2016-07-01

    Full Text Available Ciliopathies are genetic disorders arising from dysfunction of microtubule-based cellular appendages called cilia. Different cilia types possess distinct stereotypic microtubule doublet arrangements with non-motile or 'primary' cilia having a 9+0 and motile cilia have a 9+2 array of microtubule doublets. Primary cilia are critical sensory and signaling centers needed for normal mammalian development. Defects in their structure/function result in a spectrum of clinical and developmental pathologies including abnormal neural tube and limb patterning. Altered patterning phenotypes in the limb and neural tube are due to perturbations in the hedgehog (Hh signaling pathway. Motile cilia are important in fluid movement and defects in motility result in chronic respiratory infections, altered left-right asymmetry, and infertility. These features are the hallmarks of Primary Ciliary Dyskinesia (PCD, OMIM 244400. While mutations in several genes are associated with PCD in patients and animal models, the genetic lesion in many cases is unknown. We assessed the in vivo functions of Growth Arrest Specific 8 (GAS8. GAS8 shares strong sequence similarity with the Chlamydomonas Nexin-Dynein Regulatory Complex (NDRC protein 4 (DRC4 where it is needed for proper flagella motility. In mammalian cells, the GAS8 protein localizes not only to the microtubule axoneme of motile cilia, but also to the base of non-motile cilia. Gas8 was recently implicated in the Hh signaling pathway as a regulator of Smoothened trafficking into the cilium. Here, we generate the first mouse with a Gas8 mutation and show that it causes severe PCD phenotypes; however, there were no overt Hh pathway phenotypes. In addition, we identified two human patients with missense variants in Gas8. Rescue experiments in Chlamydomonas revealed a subtle defect in swim velocity compared to controls. Further experiments using CRISPR/Cas9 homology driven repair (HDR to generate one of these human missense

  17. The introduction of basic critical care echocardiography reduces the use of diagnostic echocardiography in the intensive care unit.

    Science.gov (United States)

    Alherbish, Aws; Priestap, Fran; Arntfield, Robert

    2015-12-01

    Basic critical care echocardiography (CCE) is routinely used by intensive care unit (ICU) providers to rapidly address key hemodynamic questions for the critically ill. By comparison, diagnostic echocardiography (DE) uses a comprehensive examination with more traditional workflow and sophisticated techniques. Despite these differences, both are frequently used to answer similar questions in ICU. This overlap raises questions of duplicate testing and redundancy of hospital resources. We therefore evaluated the effect of the introduction of basic CCE over the use of DE in Victoria Hospital, a tertiary care ICU in London Ontario, Canada. The monthly mean ratios of basic CCE and DE studies to patient care days (PCD) were plotted and general linear models were used to test for trends over time. Student t test was used to compare the mean DE/PCD before and after the introduction of basic CCE. The ratio of management actions for basic CCE studies was described. Outcome measures were compared using Pearson χ(2) test of association or the Wilcoxon rank sum test. Over the 2-year study period, 1264 basic CCE studies were performed. Over this time, the ratio of CCE/PCD increased significantly (Pbasic CCE. Mortality rates (pre- and post-CCE) were 23.69% and 24.61% (P=.48); median length of stay was 4.18 and 3.53 days (P.9). There was a significant increase in vasoactive/inotropic drugs from a 20.47% vasoactive/inotropic drug/patient day rate to 21.99% (Pbasic CCE studies, 61% led to a specific management action, including ordering a DE in 10.7% of cases. In a hospital with a significant increase in basic CCE use, an associated significant decrease in DE use was observed with no increase in adverse outcomes. The significant increase in basic CCE use resulted in a change of management in most cases including the request for DE in a minority of cases. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Power Systems Development Facility Gasification Test Run TC08

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services

    2002-06-30

    This report discusses Test Campaign TC08 of the Kellogg Brown & Root, Inc. (KBR) Transport Gasifier train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Gasifier is an advanced circulating fluidized-bed gasifier designed to operate as either a combustor or a gasifier in air- or oxygen-blown mode using a particulate control device (PCD). The Transport Gasifier was operated as a pressurized gasifier in air- and oxygen-blown modes during TC08. Test Run TC08 was started on June 9, 2002 and completed on June 29. Both gasifier and PCD operations were stable during the test run with a stable baseline pressure drop. The oxygen feed supply system worked well and the transition from air to oxygen blown was smooth. The gasifier temperature was varied between 1,710 and 1,770 F at pressures from 125 to 240 psig. The gasifier operates at lower pressure during oxygen-blown mode due to the supply pressure of the oxygen system. In TC08, 476 hours of solid circulation and 364 hours of coal feed were attained with 153 hours of pure oxygen feed. The gasifier and PCD operations were stable in both enriched air and 100 percent oxygen blown modes. The oxygen concentration was slowly increased during the first transition to full oxygen-blown operations. Subsequent transitions from air to oxygen blown could be completed in less than 15 minutes. Oxygen-blown operations produced the highest synthesis gas heating value to date, with a projected synthesis gas heating value averaging 175 Btu/scf. Carbon conversions averaged 93 percent, slightly lower than carbon conversions achieved during air-blown gasification.

  19. La capacidad del Congreso de los Diputados español para impulsar la incorporación del enfoque de Coherencia de Políticas para el Desarrollo (CPD

    Directory of Open Access Journals (Sweden)

    Pérez-González, J.

    2017-05-01

    Full Text Available The international community has approved the 2030 Agenda for Sustainable Development as a common roadmap to face the global challenges of poverty, inequity and the sustainable management of the planet’s natural resources. For this Agenda to succeed, all countries must adopt the Policy Coherence for Development (PCD approach as the guiding and crosscutting principle of all domestic and foreign policies during the next 15 years. National parliaments are going to be key players to urge Governments to make the ambitious and long-term commitments that the 2030 Agenda requires. Proyecto Avizor —a Spanish Parliament Monitoring Organization (PMO— has monitored the activity of the Spanish Parliament during the 2011-2016 period, analyzing the contribution that the parliamentarian activity has had to promote the Government’s commitment in the fight against global poverty, inequality and in favor of sustainable development and human rights. With the information provided by Proyecto Avizor, this article has aimed to find if, in the current Spanish political context, the political initiatives that will be needed to fulfill the 2030 Agenda’s goals, face extra obstacles and burdens during their approval procedures compared withthe rest of initiatives. The results of the analysis show that the inclusion of the PCD approach in a political initiative decreases its chances of being successfully processed at the Parliament. On the other hand, the analysis has found no evidences that a stronger presence of the PCD approach in the political mandates approved by theParliament hampers its chances of being accomplished by the Government.Being solidarity one of the values on which the European Union is founded, the European regional framework becomes the most suitable level to increase the effectiveness of European aid, assuming responsibility for coordination and management of policy coherence.

  20. Release of apical dominance in potato tuber is accompanied by programmed cell death in the apical bud meristem.

    Science.gov (United States)

    Teper-Bamnolker, Paula; Buskila, Yossi; Lopesco, Yael; Ben-Dor, Shifra; Saad, Inbal; Holdengreber, Vered; Belausov, Eduard; Zemach, Hanita; Ori, Naomi; Lers, Amnon; Eshel, Dani

    2012-04-01

    Potato (Solanum tuberosum) tuber, a swollen underground stem, is used as a model system for the study of dormancy release and sprouting. Natural dormancy release, at room temperature, is initiated by tuber apical bud meristem (TAB-meristem) sprouting characterized by apical dominance (AD). Dormancy is shortened by treatments such as bromoethane (BE), which mimics the phenotype of dormancy release in cold storage by inducing early sprouting of several buds simultaneously. We studied the mechanisms governing TAB-meristem dominance release. TAB-meristem decapitation resulted in the development of increasing numbers of axillary buds with time in storage, suggesting the need for autonomous dormancy release of each bud prior to control by the apical bud. Hallmarks of programmed cell death (PCD) were identified in the TAB-meristems during normal growth, and these were more extensive when AD was lost following either extended cold storage or BE treatment. Hallmarks included DNA fragmentation, induced gene expression of vacuolar processing enzyme1 (VPE1), and elevated VPE activity. VPE1 protein was semipurified from BE-treated apical buds, and its endogenous activity was fully inhibited by a cysteinyl aspartate-specific protease-1-specific inhibitor N-Acetyl-Tyr-Val-Ala-Asp-CHO (Ac-YVAD-CHO). Transmission electron microscopy further revealed PCD-related structural alterations in the TAB-meristem of BE-treated tubers: a knob-like body in the vacuole, development of cytoplasmic vesicles, and budding-like nuclear segmentations. Treatment of tubers with BE and then VPE inhibitor induced faster growth and recovered AD in detached and nondetached apical buds, respectively. We hypothesize that PCD occurrence is associated with the weakening of tuber AD, allowing early sprouting of mature lateral buds.

  1. Release of Apical Dominance in Potato Tuber Is Accompanied by Programmed Cell Death in the Apical Bud Meristem[C][W

    Science.gov (United States)

    Teper-Bamnolker, Paula; Buskila, Yossi; Lopesco, Yael; Ben-Dor, Shifra; Saad, Inbal; Holdengreber, Vered; Belausov, Eduard; Zemach, Hanita; Ori, Naomi; Lers, Amnon; Eshel, Dani

    2012-01-01

    Potato (Solanum tuberosum) tuber, a swollen underground stem, is used as a model system for the study of dormancy release and sprouting. Natural dormancy release, at room temperature, is initiated by tuber apical bud meristem (TAB-meristem) sprouting characterized by apical dominance (AD). Dormancy is shortened by treatments such as bromoethane (BE), which mimics the phenotype of dormancy release in cold storage by inducing early sprouting of several buds simultaneously. We studied the mechanisms governing TAB-meristem dominance release. TAB-meristem decapitation resulted in the development of increasing numbers of axillary buds with time in storage, suggesting the need for autonomous dormancy release of each bud prior to control by the apical bud. Hallmarks of programmed cell death (PCD) were identified in the TAB-meristems during normal growth, and these were more extensive when AD was lost following either extended cold storage or BE treatment. Hallmarks included DNA fragmentation, induced gene expression of vacuolar processing enzyme1 (VPE1), and elevated VPE activity. VPE1 protein was semipurified from BE-treated apical buds, and its endogenous activity was fully inhibited by a cysteinyl aspartate-specific protease-1-specific inhibitor N-Acetyl-Tyr-Val-Ala-Asp-CHO (Ac-YVAD-CHO). Transmission electron microscopy further revealed PCD-related structural alterations in the TAB-meristem of BE-treated tubers: a knob-like body in the vacuole, development of cytoplasmic vesicles, and budding-like nuclear segmentations. Treatment of tubers with BE and then VPE inhibitor induced faster growth and recovered AD in detached and nondetached apical buds, respectively. We hypothesize that PCD occurrence is associated with the weakening of tuber AD, allowing early sprouting of mature lateral buds. PMID:22362870

  2. Physiological phenotyping of pediatric chronic obstructive airway diseases.

    Science.gov (United States)

    Nyilas, Sylvia; Singer, Florian; Kumar, Nitin; Yammine, Sophie; Meier-Girard, Delphine; Koerner-Rettberg, Cordula; Casaulta, Carmen; Frey, Urs; Latzin, Philipp

    2016-07-01

    Inert tracer gas washout (IGW) measurements detect increased ventilation inhomogeneity (VI) in chronic lung diseases. Their suitability for different diseases, such as cystic fibrosis (CF) and primary ciliary dyskinesia (PCD), has already been shown. However, it is still unclear if physiological phenotypes based on different IGW variables can be defined independently of underlying disease. Eighty school-age children, 20 with CF, 20 with PCD, 20 former preterm children, and 20 healthy children, performed nitrogen multiple-breath washout, double-tracer gas (DTG) single-breath washout, and spirometry. Our primary outcome was the definition of physiological phenotypes based on IGW variables. We applied principal component analysis, hierarchical Ward's clustering, and enrichment analysis to compare clinical characteristics between the clusters. IGW variables used for clustering were lung clearance index (LCI) and convection-dependent [conductive ventilation heterogeneity index (Scond)] and diffusion-convection-dependent variables [acinar ventilation heterogeneity index (Sacin) and carbon dioxide and DTG phase III slopes]. Three main phenotypes were identified. Phenotype I (n = 38) showed normal values in all IGW outcome variables. Phenotype II (n = 21) was characterized by pronounced global and convection-dependent VI while diffusion-dependent VI was normal. Phenotype III (n = 21) was characterized by increased global and diffusion- and convection-dependent VI. Enrichment analysis revealed an overrepresentation of healthy children and former preterm children in phenotype I and of CF and PCD in phenotypes II and III. Patients in phenotype III showed the highest proportion and frequency of exacerbations and hospitalization in the year prior to the measurement. IGW techniques allow identification of clinically meaningful, disease-independent physiological clusters. Their predictive value of future disease outcomes remains to be determined. Copyright © 2016 the American

  3. Mutation of Growth Arrest Specific 8 Reveals a Role in Motile Cilia Function and Human Disease.

    Science.gov (United States)

    Lewis, Wesley R; Malarkey, Erik B; Tritschler, Douglas; Bower, Raqual; Pasek, Raymond C; Porath, Jonathan D; Birket, Susan E; Saunier, Sophie; Antignac, Corinne; Knowles, Michael R; Leigh, Margaret W; Zariwala, Maimoona A; Challa, Anil K; Kesterson, Robert A; Rowe, Steven M; Drummond, Iain A; Parant, John M; Hildebrandt, Friedhelm; Porter, Mary E; Yoder, Bradley K; Berbari, Nicolas F

    2016-07-01

    Ciliopathies are genetic disorders arising from dysfunction of microtubule-based cellular appendages called cilia. Different cilia types possess distinct stereotypic microtubule doublet arrangements with non-motile or 'primary' cilia having a 9+0 and motile cilia have a 9+2 array of microtubule doublets. Primary cilia are critical sensory and signaling centers needed for normal mammalian development. Defects in their structure/function result in a spectrum of clinical and developmental pathologies including abnormal neural tube and limb patterning. Altered patterning phenotypes in the limb and neural tube are due to perturbations in the hedgehog (Hh) signaling pathway. Motile cilia are important in fluid movement and defects in motility result in chronic respiratory infections, altered left-right asymmetry, and infertility. These features are the hallmarks of Primary Ciliary Dyskinesia (PCD, OMIM 244400). While mutations in several genes are associated with PCD in patients and animal models, the genetic lesion in many cases is unknown. We assessed the in vivo functions of Growth Arrest Specific 8 (GAS8). GAS8 shares strong sequence similarity with the Chlamydomonas Nexin-Dynein Regulatory Complex (NDRC) protein 4 (DRC4) where it is needed for proper flagella motility. In mammalian cells, the GAS8 protein localizes not only to the microtubule axoneme of motile cilia, but also to the base of non-motile cilia. Gas8 was recently implicated in the Hh signaling pathway as a regulator of Smoothened trafficking into the cilium. Here, we generate the first mouse with a Gas8 mutation and show that it causes severe PCD phenotypes; however, there were no overt Hh pathway phenotypes. In addition, we identified two human patients with missense variants in Gas8. Rescue experiments in Chlamydomonas revealed a subtle defect in swim velocity compared to controls. Further experiments using CRISPR/Cas9 homology driven repair (HDR) to generate one of these human missense variants in

  4. Loss of zinc finger MYND-type containing 10 (zmynd10) affects cilia integrity and axonemal localization of dynein arms, resulting in ciliary dysmotility, polycystic kidney and scoliosis in medaka (Oryzias latipes).

    Science.gov (United States)

    Kobayashi, Daisuke; Asano-Hoshino, Anshin; Nakakura, Takashi; Nishimaki, Toshiyuki; Ansai, Satoshi; Kinoshita, Masato; Ogawa, Motoyuki; Hagiwara, Haruo; Yokoyama, Takahiko

    2017-10-01

    Cilia and flagella are hair-like organelles that project from the cell surface and play important roles in motility and sensory perception. Motility defects in cilia and flagella lead to primary ciliary dyskinesia (PCD), a rare human disease. Recently zinc finger MYND-type containing 10 (ZMYND10) was identified in humans as a PCD-associated gene. In this study, we use medaka fish as a model to characterize the precise functions of zmynd10. In medaka, zmynd10 is exclusively expressed in cells with motile cilia. Embryos with zmynd10 Morpholino knockdown exhibited a left-right (LR) defect associated with loss of motility in Kupffer's vesicle (KV) cilia. This immotility was caused by loss of the outer dynein arms, which is a characteristic ultrastructural phenotype in PCD. In addition, KV cilia in zmynd10 knockdown embryos had a swollen and wavy morphology. Together, these results suggest that zmynd10 is a multi-functional protein that has independent roles in axonemal localization of dynein arms and in formation and/or maintenance of cilia. The C-terminal region of zmynd10 has a MYND-type zinc finger domain (zf-MYND) that is important for its function. Our rescue experiment showed that the zmynd10-ΔC truncated protein, which lacks zf-MYND, was still partially functional, suggesting that zmynd10 has another functional domain besides zf-MYND. To analyze the later stages of development, we generated a zmynd10 knockout mutant using transcription activator-like effector nuclease (TALEN) technology. Adult mutants exhibited sperm dysmotility, scoliosis and progressive polycystic kidney. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Partial lamellar keratoplasty for peripheral corneal disease using a graft from the glycerin-preserved corneoscleral rim.

    Science.gov (United States)

    Gao, Hua; Wang, Xiuxian; Echegaray, Jose J; Li, Suxia; Wang, Ting; Shi, Weiyun

    2014-06-01

    To evaluate the feasibility of partial lamellar keratoplasty (LK) for treatment of peripheral corneal disease (PCD) using a graft from the corneoscleral rim preserved in glycerin. Patients who underwent LK for PCD at Shandong Eye Hospital from January 2006 to December 2012 were included. Corneoscleral rims of donor grafts, out of which the corneal buttons had been punched and used for penetrating keratoplasty, were preserved in glycerin and used for LK procedures. A trephine of 7.5-8.0 mm was used to mark the central cornea. An excision was made according to the size of the lesions, after which a partial ring-shaped corneoscleral graft was transplanted to repair the peripheral cornea. Visual acuity, refractive astigmatism, and complications were monitored. There were 26 patients (28 eyes), including 15 patients with Terrien's marginal degeneration, eight with Mooren's ulcer, two with Wegener's granulomatosis, and one with peripheral corneal ulcer. The mean follow-up was 15 months (range, 6-36 months). Uncorrected visual acuity was improved by a mean of 3.17 Snellen chart lines (P = 0.010), and best spectacle-corrected visual acuity was improved by a mean of 0.85 Snellen chart lines (P = 0.045) at 6 months after surgery. The refractive astigmatism decreased by 5.1 ± 8.6 diopters (P = 0.003). Two patients suffering graft ulcers (recurrence) were successfully treated by a second partial LK. No graft rejection occurred. Partial LK using a graft from the corneoscleral rim appears to be effective in the treatment of patients with PCD. This approach saves the donor graft, which is important in the countries or regions with scarcity of donor tissue.

  6. Epigenetic Changes are Associated with Programmed Cell Death Induced by Heat Stress in Seedling Leaves of Zea mays.

    Science.gov (United States)

    Wang, Pu; Zhao, Lin; Hou, Haoli; Zhang, Hao; Huang, Yan; Wang, Yapei; Li, Hui; Gao, Fei; Yan, Shihan; Li, Lijia

    2015-05-01

    Histone modification plays a crucial role in regulation of chromatin architecture and function, responding to adverse external stimuli. However, little is known about a possible relationship between epigenetic modification and programmed cell death (PCD) in response to environmental stress. Here, we found that heat stress induced PCD in maize seedling leaves which was characterized by chromatin DNA laddering and DNA strand breaks detected by a terminal deoxynucleotidyl transferase-mediated dUTP nick end labeling (TUNEL) test. The activities of the reactive oxygen species (ROS)-related enzymes superoxide dismutase (SOD), peroxidase (POD) and catalase (CAT) were progressively increased over time in the heat-treated seedlings. However, the concentration of H2O2 remained at relatively lower levels, while the concentration of superoxide anion ([Formula: see text]) was increased, accompanied by the occurrence of higher ion leakage rates after heat treatment. The total acetylation levels of histones H3K9, H4K5 and H3 were significantly increased, whereas the di-methylation level of histone H3K4 was unchanged and the di-methylation level of histone H3K9 was decreased in the seedling leaves exposed to heat stress compared with the control seedlings, accompanied by increased nucleolus size indicative of chromatin decondensation. Furthermore, treatment of seedlings with trichostatin A (TSA), which always results in genomic histone hyperacetylation, caused an increase in the [Formula: see text] level within the cells. The results suggested that heat stress persistently induced [Formula: see text], leading to PCD in association with histone modification changes in the maize leaves. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  7. The RhoGAP SPIN6 associates with SPL11 and OsRac1 and negatively regulates programmed cell death and innate immunity in rice.

    Directory of Open Access Journals (Sweden)

    Jinling Liu

    2015-02-01

    Full Text Available The ubiquitin proteasome system in plants plays important roles in plant-microbe interactions and in immune responses to pathogens. We previously demonstrated that the rice U-box E3 ligase SPL11 and its Arabidopsis ortholog PUB13 negatively regulate programmed cell death (PCD and defense response. However, the components involved in the SPL11/PUB13-mediated PCD and immune signaling pathway remain unknown. In this study, we report that SPL11-interacting Protein 6 (SPIN6 is a Rho GTPase-activating protein (RhoGAP that interacts with SPL11 in vitro and in vivo. SPL11 ubiquitinates SPIN6 in vitro and degrades SPIN6 in vivo via the 26S proteasome-dependent pathway. Both RNAi silencing in transgenic rice and knockout of Spin6 in a T-DNA insertion mutant lead to PCD and increased resistance to the rice blast pathogen Magnaporthe oryzae and the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. The levels of reactive oxygen species and defense-related gene expression are significantly elevated in both the Spin6 RNAi and mutant plants. Strikingly, SPIN6 interacts with the small GTPase OsRac1, catalyze the GTP-bound OsRac1 into the GDP-bound state in vitro and has GAP activity towards OsRac1 in rice cells. Together, our results demonstrate that the RhoGAP SPIN6 acts as a linkage between a U-box E3 ligase-mediated ubiquitination pathway and a small GTPase-associated defensome system for plant immunity.

  8. Characteristics of donkey spermatozoa along the length of the epididymis.

    Science.gov (United States)

    Contri, A; Gloria, A; Robbe, D; De Amicis, I; Carluccio, A

    2012-01-01

    In mammals, the epididymis has numerous interrelated functions including absorptive and secretory activity that affect luminal environment and cell membrane, and the maturation and storage of sperm. Spermatozoa acquire their motility and fertilizing ability during their passage through the epididymis and the motility of epididymal spermatozoa should be a balance between the maturation of flagellum and the inhibition of the flagellar machinery. In this study maturational change in sperm characteristics were evaluated in the epididymis of donkey. Spermatozoa collected from four portions of the epididymis (head, cranial corpus, caudal corpus, tail) were compared before and after ejaculation for viability, mitochondrial activity, kinetic parameters, and morphology. A significant increase in the mitochondrial activity along the epididymis was reported, suggesting a possible involvement in the motion mechanism. This should be corroborated by the significant correlation between mitochondrial activity and the total and progressive motility and the increase in velocities of spermatozoa recorded by computer-assisted sperm analysis. The percentage of most of the abnormal spermatozoa were similar in all tracts, with a great variability between jackasses. Only the bent midpiece percentage decreased significantly along epididymis. A significant increase in the percentage of distal cytoplasmic droplets (DCD), and a simultaneous decrease in the proximal cytoplasmic droplets (PCD), was found. The DCD fell down after ejaculation suggesting the late loss of the cytoplasmic residual (DCD) in the donkey, as hypothesized in the stallion. Because the prevalence of PCD were similar in both tail epididymal and ejaculated spermatozoa, a defect of the maturative process in the PCD sperm should be speculated. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Ethylene antagonizes salt-induced growth retardation and cell death process via transcriptional controlling of ethylene-, BAG- and senescence-associated genes in Arabidopsis

    Directory of Open Access Journals (Sweden)

    YaJie ePan

    2016-05-01

    Full Text Available The existing question whether ethylene is involved in the modulation of salt-induced cell death to mediate plant salt tolerance is important for understanding the salt tolerance mechanisms. Here, we employed Arabidopsis plants to study the possible role of ethylene in salt-induced growth inhibition and programmed cell death (PCD profiles. The root length, DNA ladder and cell death indicated by Evan’s blue detection were measured by compared to the control or salt-stressed seedlings. Secondly, the protoplasts isolated from plant leaves and dyed with Annexin V-FITC were subjected to flow cytometric (FCM assay. Our results showed that ethylene works effectively in seedling protoplasts, antagonizing salt-included root retardation and restraining cell death both in seedlings or protoplasts. Due to salinity, the entire or partial insensitivity of ethylene signaling resulted in an elevated levels of cell death in ein2-5 and ein3-1 plants and the event were amended in ctr1-1 plants after salt treatment. The subsequent experiment with exogenous ACC further corroborated that ethylene could modulate salt-induced PCD process actively. Plant Bcl-2-associated athanogene (BAG family genes are recently identified to play an extensive role in plant PCD processes ranging from growth, development to stress responses and even cell death. Our result showed that salinity alone significantly suppressed the transcripts of BAG6, BAG7 and addition of ACC in the saline solution could obviously re-activate BAG6 and BAG7 expressions, which might play a key role to inhibit the salt-induced cell death. In summary, our research implies that ethylene and salinity antagonistically control BAG family-, ethylene-, and senescence-related genes to alleviate the salt-induced cell death.

  10. Expression of the Theobroma cacao Bax-inhibitor-1 gene in tomato reduces infection by the hemibiotrophic pathogen Moniliophthora perniciosa.

    Science.gov (United States)

    Scotton, Danielle Camargo; Azevedo, Mariana Da Silva; Sestari, Ivan; Da Silva, Jamille Santos; Souza, Lucas Anjos; Peres, Lázaro Eustáquio Pereira; Leal, Gildemberg Amorim; Figueira, Antonio

    2017-10-01

    Programmed cell death (PCD) plays a key role in plant responses to pathogens, determining the success of infection depending on the pathogen lifestyle and on which participant of the interaction triggers cell death. The hemibiotrophic basidiomycete Moniliophthora perniciosa is the causal agent of witches' broom disease of Theobroma cacao L. (cacao), a serious constraint for production in South America and the Caribbean. It has been hypothesized that M. perniciosa pathogenesis involves PCD, initially as a plant defence mechanism, which is diverted by the fungus to induce necrosis during the dikaryotic phase of the mycelia. Here, we evaluated whether the expression of a cacao anti-apoptotic gene would affect the incidence and severity of M. perniciosa infection using the 'Micro-Tom' (MT) tomato as a model. The cacao Bax-inhibitor-1 (TcBI-1) gene, encoding a putative basal attenuator of PCD, was constitutively expressed in MT to evaluate function. Transformants expressing TcBI-1, when treated with tunicamycin, an inducer of endoplasmic reticulum stress, showed a decrease in cell peroxidation. When the same transformants were inoculated with the necrotrophic fungal pathogens Sclerotinia sclerotiorum, Sclerotium rolfsii and Botrytis cinerea, a significant reduction in infection severity was observed, confirming TcBI-1 function. After inoculation with M. perniciosa, TcBI-1 transformant lines showed a significant reduction in disease incidence compared with MT. The overexpression of TcBI-1 appears to affect the ability of germinating spores to penetrate susceptible tissues, restoring part of the non-host resistance in MT against the S-biotype of M. perniciosa. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  11. ROBUST CYLINDER FITTING IN THREE-DIMENSIONAL POINT CLOUD DATA

    Directory of Open Access Journals (Sweden)

    A. Nurunnabi

    2017-05-01

    Full Text Available This paper investigates the problems of cylinder fitting in laser scanning three-dimensional Point Cloud Data (PCD. Most existing methods require full cylinder data, do not study the presence of outliers, and are not statistically robust. But especially mobile laser scanning often has incomplete data, as street poles for example are only scanned from the road. Moreover, existence of outliers is common. Outliers may occur as random or systematic errors, and may be scattered and/or clustered. In this paper, we present a statistically robust cylinder fitting algorithm for PCD that combines Robust Principal Component Analysis (RPCA with robust regression. Robust principal components as obtained by RPCA allow estimating cylinder directions more accurately, and an existing efficient circle fitting algorithm following robust regression principles, properly fit cylinder. We demonstrate the performance of the proposed method on artificial and real PCD. Results show that the proposed method provides more accurate and robust results: (i in the presence of noise and high percentage of outliers, (ii for incomplete as well as complete data, (iii for small and large number of points, and (iv for different sizes of radius. On 1000 simulated quarter cylinders of 1m radius with 10% outliers a PCA based method fit cylinders with a radius of on average 3.63 meter (m; the proposed method on the other hand fit cylinders of on average 1.02 m radius. The algorithm has potential in applications such as fitting cylindrical (e.g., light and traffic poles, diameter at breast height estimation for trees, and building and bridge information modelling.

  12. Robust Cylinder Fitting in Three-Dimensional Point Cloud Data

    Science.gov (United States)

    Nurunnabi, A.; Sadahiro, Y.; Lindenbergh, R.

    2017-05-01

    This paper investigates the problems of cylinder fitting in laser scanning three-dimensional Point Cloud Data (PCD). Most existing methods require full cylinder data, do not study the presence of outliers, and are not statistically robust. But especially mobile laser scanning often has incomplete data, as street poles for example are only scanned from the road. Moreover, existence of outliers is common. Outliers may occur as random or systematic errors, and may be scattered and/or clustered. In this paper, we present a statistically robust cylinder fitting algorithm for PCD that combines Robust Principal Component Analysis (RPCA) with robust regression. Robust principal components as obtained by RPCA allow estimating cylinder directions more accurately, and an existing efficient circle fitting algorithm following robust regression principles, properly fit cylinder. We demonstrate the performance of the proposed method on artificial and real PCD. Results show that the proposed method provides more accurate and robust results: (i) in the presence of noise and high percentage of outliers, (ii) for incomplete as well as complete data, (iii) for small and large number of points, and (iv) for different sizes of radius. On 1000 simulated quarter cylinders of 1m radius with 10% outliers a PCA based method fit cylinders with a radius of on average 3.63 meter (m); the proposed method on the other hand fit cylinders of on average 1.02 m radius. The algorithm has potential in applications such as fitting cylindrical (e.g., light and traffic) poles, diameter at breast height estimation for trees, and building and bridge information modelling.

  13. Detecting Diabetic Blindness in Low-Income Mexican Adults

    Centers for Disease Control (CDC) Podcasts

    2017-10-09

    This podcast features Kenny Mendoza-Herrera, a former graduate student at the National Institute of Public Health of Mexico and one of the winners of PCD’s 2017 Student Research Paper Contest. Kenny answers questions about his winning research and what impact his study has on the prevention of diabetic blindness and public health, particularly for Mexican adults.  Created: 10/9/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/9/2017.

  14. The Use of Compañeros in Childhood Obesity Prevention

    Centers for Disease Control (CDC) Podcasts

    2017-10-09

    This podcast features Katie Arlinghaus, a doctoral student at the University of Houston and one of the winners of PCD’s 2017 Student Research Paper Contest. Katie answers questions about her winning research and what impact her study has on childhood obesity prevention and public health, particularly for the Hispanic community.  Created: 10/9/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/9/2017.

  15. Women and Cancer: Examining Breast Cancer-Screening Behaviors and Survival

    Centers for Disease Control (CDC) Podcasts

    2015-07-24

    This podcast features Siran Koroukian, PhD, associate professor in the School of Medicine at Case Western Reserve University and lead author of one of PCD’s most recent articles. Dr. Koroukian answers questions about the National Breast and Cervical Cancer Early Detection Program (BCCP) in Ohio and discusses the effectiveness of the program among low-income women enrolled Medicare.  Created: 7/24/2015 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 7/24/2015.

  16. Installation Restoration Program. Phase II. Confirmation McClellan AFB, California. Volume 2.

    Science.gov (United States)

    1983-06-01

    nap-hthaloe 59A 2,4-!Listtrooheo~l -7ld- 568 nltrobenzent ld 60A 4A&-!L4tro-oCM0S1 -r. 618B N-ntrosodimthylauln ?110- 64A onelgh1 Ihl - noir 628 N-ni...3) p,hc,d,o 2C 1 £.ot. -. - Cobalt s0o1 IDICopper pcd~o 20 1 Gold 100 1 Trou d 100 1 " Lead p,h,cd,o 100 10 . - - Lithium 50- Magnesiuzm

  17. Lysosomal-associated protein multispanning transmembrane 5 gene (LAPTM5 is associated with spontaneous regression of neuroblastomas.

    Directory of Open Access Journals (Sweden)

    Jun Inoue

    Full Text Available BACKGROUND: Neuroblastoma (NB is the most frequently occurring solid tumor in children, and shows heterogeneous clinical behavior. Favorable tumors, which are usually detected by mass screening based on increased levels of catecholamines in urine, regress spontaneously via programmed cell death (PCD or mature through differentiation into benign ganglioneuroma (GN. In contrast, advanced-type NB tumors often grow aggressively, despite intensive chemotherapy. Understanding the molecular mechanisms of PCD during spontaneous regression in favorable NB tumors, as well as identifying genes with a pro-death role, is a matter of urgency for developing novel approaches to the treatment of advanced-type NB tumors. PRINCIPAL FINDINGS: We found that the expression of lysosomal associated protein multispanning transmembrane 5 (LAPTM5 was usually down-regulated due to DNA methylation in an NB cell-specific manner, but up-regulated in degenerating NB cells within locally regressing areas of favorable tumors detected by mass-screening. Experiments in vitro showed that not only a restoration of its expression but also the accumulation of LAPTM5 protein, was required to induce non-apoptotic cell death with autophagic vacuoles and lysosomal destabilization with lysosomal-membrane permeabilization (LMP in a caspase-independent manner. While autophagy is a membrane-trafficking pathway to degrade the proteins in lysosomes, the LAPTM5-mediated lysosomal destabilization with LMP leads to an interruption of autophagic flux, resulting in the accumulation of immature autophagic vacuoles, p62/SQSTM1, and ubiqitinated proteins as substrates of autophagic degradation. In addition, ubiquitin-positive inclusion bodies appeared in degenerating NB cells. CONCLUSIONS: We propose a novel molecular mechanism for PCD with the accumulation of autophagic vacuoles due to LAPTM5-mediated lysosomal destabilization. LAPTM5-induced cell death is lysosomal cell death with impaired autophagy

  18. Biogas from landfills embankments: the Brazilian contribution for the management of urban solid residues and the greenhouse effect mitigation through the mechanisms for clean development; Biogas de aterros: a contribuicao do Brasil na gestao de residuos solidos urbanos e na mitigacao do efeito estufa atraves dos mecanismos de desenvolvimento limpo

    Energy Technology Data Exchange (ETDEWEB)

    Lacerda, Gleide B.M.; Guimaraes, Hoji Y' a Henda da R.; Andrade, Euridice S. Mamede de; Teixeira, Gisele Pereira; Freitas, Marcos A.V. [Universidade Federal do Rio de Janeiro (COPPE/UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-Graduacao de Engenharia. Programa de Planejamento Energetico

    2008-07-01

    This paper studies the clean development mechanism (CDM) for sanitary sewage in Brazil, as instruments for flexibilization and mitigation of the effects of climate changes coming from the global heating. This research presents the assessments of the CDM projects for sanitary sewage in Brazil, considering the Project Conception Documents (PCD) approved until November 2007. The paper presents some methodologies for studying of energy generation potential from the biogas originated in sanitary sewage. The paper also contributes to projects of carbon credit commercialization, and relevance of the CDM instrument for the adequate management expansion of the residence solid residues as well, and advances in the implantation of sanitary embankments in Brazil.

  19. Photochemical inactivation of pathogenic bacteria in human platelet concentrates.

    Science.gov (United States)

    Lin, L; Londe, H; Janda, J M; Hanson, C V; Corash, L

    1994-05-01

    Platelet concentrates (PC) may be infrequently contaminated with low levels of bacteria that can cause septicemia and death in patients receiving transfusion therapy. We evaluated the efficacy of a photochemical decontamination (PCD) technique using 8-methoxypsoralen (8-MOP) and long wavelength UV light (UVA) to inactivate bacteria in standard therapeutic PC. Twelve phylogenetically distinct pathogenic bacteria, 5 gram-positive and 7 gram-negative organisms, were seeded into PC to a final challenge dose ranging from 10(5) to 10(7) colony-forming units (CFU)/mL. Contaminated PC were treated with 8-MOP (5 micrograms/mL) and 5 J/cm2 of UVA, a PCD treatment regimen found to adequately preserve in vitro platelet function. Greater than 10(5) CFU/mL of all 5 gram-positive (Staphylococcus aureus, Streptococcus epidermidis, Streptococcus pyogenes, Listeria monocytogenes, and Corynebacterium minutissimum) and 2 of the gram-negative (Escherichia coli and Yersinia enterocolitica) organisms were inactivated. The remaining 5 gram-negative organisms were more resistant, with less than 10(1) to 10(3.7) CFU/mL inactivated under these conditions. The inactivation efficiency for this resistant group of gram-negative organisms was improved when PC were resuspended in a synthetic storage medium with reduced plasma protein concentration (15%) and an increased 8-MOP concentration (23.4 micrograms/mL). Illumination with 3 J/cm2 of UVA in this system inactivated greater than 10(5) CFU/mL of 4 resistant gram-negative organisms (Salmonella choleraesuis, Enterobacter cloacae, Serratia marcescens, and Klebsiella pneumoniae) and 10(4.1) CFU/mL of the most resistant gram-negative organism (Pseudomonas aeruginosa). This level of PCD treatment did not adversely affect in vitro platelet function. These results demonstrate that PCD using 8-MOP (5 to 23.4 micrograms/mL) effectively inactivated high levels of pathogenic bacteria in PC with adequate preservation of in vitro platelet properties.

  20. Food Environment, Diet, and Obesity Among LA County Adults

    Centers for Disease Control (CDC) Podcasts

    2015-08-31

    This podcast features Nelly Mejia, winner of the journal’s 2015 Student Research Paper Contest and PhD Candidate at the Pardee RAND Graduate School in Santa Monica, California. Nelly discusses her winning paper, which examined the relationship between neighborhood food outlet locations and the diet and body mass index of adults living in Los Angeles County, California.  Created: 8/31/2015 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/31/2015.

  1. What Drives Health Professionals to Tweet About the HPV Vaccine?

    Centers for Disease Control (CDC) Podcasts

    2018-02-20

    This podcast features Philip Massey, PhD, MPH, an assistant professor at Drexel University and one of the authors of a recent study that looks at what motivates health professionals to tweet about the HPV vaccine. Philip answers questions about his research and what impact social media can have on public health and health care communication.  Created: 2/20/2018 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 2/20/2018.

  2. Using GIS Maps to Improve Diabetes Prevention in New York

    Centers for Disease Control (CDC) Podcasts

    2014-02-26

    This podcast features Rachael Ruberto, MPH, New York State Department of Health research scientist and lead author of PCD’s most recent Geographic Information Systems (GIS) Snapshots article. Rachael provides an overview of her article and how GIS was used for the analysis of diabetes prevention in New York.  Created: 2/26/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 2/26/2014.

  3. Finding Nutritious Foods in Small Food Stores

    Centers for Disease Control (CDC) Podcasts

    2012-07-12

    Nutrition has consistently been a popular topic of discussion among researchers and public health officials. This podcast consists of an interview with a nutrition-minded author and University of California, Berkeley PhD candidate whose 2012 original research article was the winner of PCD’s 2012 Student Paper Contest.  Created: 7/12/2012 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 7/12/2012.

  4. Caspase-2 mediates a Brucella abortus RB51-induced hybrid cell death having features of apoptosis and pyroptosis.

    Science.gov (United States)

    Bronner, Denise N; O'Riordan, Mary X D; He, Yongqun

    2013-01-01

    Programmed cell death (PCD) can play a crucial role in tuning the immune response to microbial infection. Although PCD can occur in different forms, all are mediated by a family of proteases called caspases. Caspase-2 is the most conserved caspase, however, its function in cell death is ill-defined. Previously we demonstrated that live attenuated cattle vaccine strain Brucella abortus RB51 induces caspase-2-mediated and caspase-1-independent PCD of infected macrophages. We also discovered that rough attenuated B. suis strain VTRS1 induces a caspase-2-mediated and caspase-1-independent proinflammatory cell death in infected macrophages, which was tentatively coined "caspase-2-mediated pyroptosis". However, the mechanism of caspase-2-mediated cell death pathway remained unclear. In this study, we found that caspase-2 mediated proinflammatory cell death of RB51-infected macrophages and regulated many genes in different PCD pathways. We show that the activation of proapoptotic caspases-3 and -8 was dependent upon caspase-2. Caspase-2 regulated mitochondrial cytochrome c release and TNFα production, both of which are known to activate caspase-3 and caspase-8, respectively. In addition to TNFα, RB51-induced caspase-1 and IL-1β production was also driven by caspase-2-mediated mitochondrial dysfunction. Interestingly, pore formation, a phenomenon commonly associated with caspase-1-mediated pyroptosis, occurred; however, unlike its role in S. typhimurium-induced pyroptosis, pore formation did not contribute to RB51-induced proinflammatory cell death. Our data suggest that caspase-2 acts as an initiator caspase that mediates a novel RB51-induced hybrid cell death that simulates but differs from typical non-proinflammatory apoptosis and caspase-1-mediated proinflammatory pyroptosis. The initiator role of the caspase-2-mediated cell death was also conserved in cellular stress-induced cell death of macrophages treated with etoposide, naphthalene, or anti-Fas. Caspase-2 also

  5. Reconhecimento e construção da competência da pessoa com deficiência na organização em debate

    Directory of Open Access Journals (Sweden)

    Danielle Cristine Beltrão

    2012-03-01

    Full Text Available Neste artigo, pretende-se analisar experiências de desenvolvimento de competências e reconhecimento profissional da pessoa com deficiência já inserida no contexto organizacional, considerando os principais atores envolvidos nesse processo. Trata-se de um estudo de caso qualitativo, realizado em uma multinacional farmacêutica, sediada no estado de São Paulo, em que se teve por objetivo descrever e discutir as práticas formais de desenvolvimento profissional da pessoa com deficiência (PcD adotadas por essa organização, bem como as experiências informais pelas quais passaram esses indivíduos na empresa em questão. Além disso, buscou-se analisar a articulação entre atores externos que estavam imbricados no processo de inclusão, a saber: o sindicato das indústrias farmacêuticas e uma organização não governamental (ONG especializada em PcDs. Os resultados problematizam a iniciativa de promover um processo de construção e desenvolvimento de competências por meio de experiências formais e informais, e mesmo de autodesenvolvimento, específicas para a PcD. Nesse sentido, a experiência em estudo revelou que nessa iniciativa prevaleceram as premissas acerca das limitações decorrentes das características biológicas dos indivíduos, já que as práticas de desenvolvimento nem sempre trabalharam sobre o potencial desses profissionais, que pouco avançaram, considerando-se as possibilidades que a organização oferece. Outro resultado relevante é que, embora a articulação entre empresa e agentes externos ocorra, não há um diálogo nem uma parceria efetiva que permita fazer avançar o processo de inclusão e de desenvolvimento desse grupo de profissionais. Ao final, procurou-se apresentar ainda elementos que permitam a reflexão sobre a condução de programas organizacionais voltados à PcD e suas implicações, que podem estar a serviço tanto da promoção como da manutenção do status quo da PcD na corporação.

  6. Hypervelocity Impact: Proceedings of the 1992 Symposium Held in Austin, Texas on 17-19 November 1992

    Science.gov (United States)

    1993-10-01

    8217 thle exper~imenIts 11e alsO described inl latter sections. tlie prin lciple that Nt rct ired t i nue-deperildent (shoe kless). miega bar driv ing...begins when the obturator clears the muzzle and releases the high pressure propellant gases. The relative strength of the two is dependent upon the...separator is higher than the p)ressure in the two e•ent tubes. While the sabot and obturator De ckIpnicint 01 I1 Sca1Ui•iia cc erakr hxt pcd !ii i’r c

  7. Experimental study of surface quality and damage when drilling unidirectional CFRP composites

    Directory of Open Access Journals (Sweden)

    Eshetu D. Eneyew

    2014-10-01

    Full Text Available In this study, an experimental investigation on the drilling of unidirectional carbon fiber reinforced plastic (UD-CFRP composite was conducted using polycrystalline diamond (PCD tipped eight facet drill. The quality of the drilled hole surface was examined through surface roughness measurements and surface damage by scanning electron microscopy (SEM. It was found that fiber pullout occurred in two specific sectors relative to the angle between the cutting direction and the fiber orientation. The thrust force was highly influenced by the feed rate than the cutting speed and it shows a significant variation throughout the rotation of the drill.

  8. Laser beam machining of polycrystalline diamond for cutting tool manufacturing

    Science.gov (United States)

    Wyszyński, Dominik; Ostrowski, Robert; Zwolak, Marek; Bryk, Witold

    2017-10-01

    The paper concerns application of DPSS Nd: YAG 532nm pulse laser source for machining of polycrystalline WC based diamond inserts (PCD). The goal of the research was to determine optimal laser cutting parameters for cutting tool shaping. Basic criteria to reach the goal was cutting edge quality (minimalization of finishing operations), material removal rate (time and cost efficiency), choice of laser beam characteristics (polarization, power, focused beam diameter). The research was planned and realised and analysed according to design of experiment rules (DOE). The analysis of the cutting edge was prepared with use of Alicona Infinite Focus measurement system.

  9. The LSD1-Type Zinc Finger Motifs of Pisum sativa LSD1 Are a Novel Nuclear Localization Signal and Interact with Importin Alpha

    OpenAIRE

    Shanping He; Kuowei Huang; Xu Zhang; Xiangchun Yu; Ping Huang; Chengcai An

    2011-01-01

    BACKGROUND: Genetic studies of the Arabidopsis mutant lsd1 highlight the important role of LSD1 in the negative regulation of plant programmed cell death (PCD). Arabidopsis thaliana LSD1 (AtLSD1) contains three LSD1-type zinc finger motifs, which are involved in the protein-protein interaction. METHODOLOGY/PRINCIPAL FINDINGS: To further understand the function of LSD1, we have analyzed cellular localization and functional localization domains of Pisum sativa LSD1 (PsLSD1), which is a homolog ...

  10. Photoacoustic cavitation for theranostics: mechanism, current progress and applications

    Science.gov (United States)

    Feng, Y.; Qin, D.; Wan, M.

    2015-12-01

    As an emerging cavitation technology, photoacoustic cavitation (PAC) means the formation of bubbles in liquids using focused laser and pre-established ultrasound synchronously. Its significant advantages include the decreased threshold of each modality and the precise location of cavitation determined by the focused laser. In this paper, a brief review of PAC is presented, including the physical mechanism description, the classic experimental technology, the representative results in variety of media, and its applications in biomedical imaging and therapy. Moreover, some preliminary results of PAC in perfluoropentane (PFP) liquid and PFP droplets investigated by passive cavitation detection (PCD) in our group are also presented.

  11. Hydraulic Presses,

    Science.gov (United States)

    1984-03-09

    8217(’--2pA.(I-.); (179) h 4 .- , C(,2PCD W) 4 c D LAE ; hPC =1;D’)_= I. i-= I -- cD (wc) + 2 PCo (I-WIC) (180) According to the flow-continuity condition Wewe... soft packing and sometimes ferrules. Cylinder block is manufactured with forged from steel of brands 25-30. All channels and seats for the valves make...cavity of apparatus is a float 1 with core 2 of soft iron. Core *passes through induction coils 3. aWith a change in the level of mercury in the

  12. Mutations in ZMYND10, a gene essential for proper axonemal assembly of inner and outer dynein arms in humans and flies, cause primary ciliary dyskinesia

    DEFF Research Database (Denmark)

    Moore, Daniel J; Onoufriadis, Alexandros; Shoemark, Amelia

    2013-01-01

    Primary ciliary dyskinesia (PCD) is a ciliopathy characterized by airway disease, infertility, and laterality defects, often caused by dual loss of the inner dynein arms (IDAs) and outer dynein arms (ODAs), which power cilia and flagella beating. Using whole-exome and candidate-gene Sanger...... neurons and sperm. In these cells, P-element-mediated gene silencing caused IDA and ODA defects, proprioception deficits, and sterility due to immotile sperm. Drosophila Zmynd10 with an equivalent c.47T>G (p.Val16Gly) missense change rescued mutant male sterility less than the wild-type did. Tagged...

  13. Characteristics of pulse width for an enhanced second harmonic generation

    Science.gov (United States)

    Zhang, Yun; Hyodo, Masaharu; Okada-Shudo, Yoshiko; Zhu, Yun; Wang, Xiaoyang; Zhu, Yong; Wang, Guiling; Chen, Chuangtian; Watanabe, Shuntaro; Watanabe, Masayoshi

    2017-03-01

    Temporal characteristics of a cavity enhancement second harmonic (SH) generation for picosecond laser pulse are investigated. We experimentally measured pulse width changes that were indued by group velocity mismatching (GVM), SH process, and enhancement cavity. It indicates that the generated pulse width is a combined effect of the GVM and SH process. Meanwhile, the effect of the enhancement cavity can be avoided by controlling its free spectrum range. A interferometric autocorrelator with a KBBF-PCD as nonlinear crystal is also composed and this extends the measurement light wavelength below 410 nm.

  14. Screening for primary creatine deficiencies in French patients with unexplained neurological symptoms

    Science.gov (United States)

    2012-01-01

    A population of patients with unexplained neurological symptoms from six major French university hospitals was screened over a 28-month period for primary creatine disorder (PCD). Urine guanidinoacetate (GAA) and creatine:creatinine ratios were measured in a cohort of 6,353 subjects to identify PCD patients and compile their clinical, 1H-MRS, biochemical and molecular data. Six GAMT [N-guanidinoacetatemethyltransferase (EC 2.1.1.2)] and 10 X-linked creatine transporter (SLC6A8) but no AGAT (GATM) [L-arginine/glycine amidinotransferase (EC 2.1.4.1)] deficient patients were identified in this manner. Three additional affected sibs were further identified after familial inquiry (1 brother with GAMT deficiency and 2 brothers with SLC6A8 deficiency in two different families). The prevalence of PCD in this population was 0.25% (0.09% and 0.16% for GAMT and SLC6A8 deficiencies, respectively). Seven new PCD-causing mutations were discovered (2 nonsense [c.577C > T and c.289C > T] and 1 splicing [c.391 + 15G > T] mutations for the GAMT gene and, 2 missense [c.1208C > A and c.926C > A], 1 frameshift [c.930delG] and 1 splicing [c.1393-1G > A] mutations for the SLC6A8 gene). No hot spot mutations were observed in these genes, as all the mutations were distributed throughout the entire gene sequences and were essentially patient/family specific. Approximately one fifth of the mutations of SLC6A8, but not GAMT, were attributed to neo-mutation, germinal or somatic mosaicism events. The only SLC6A8-deficient female patient in our series presented with the severe phenotype usually characterizing affected male patients, an observation in agreement with recent evidence that is in support of the fact that this X-linked disorder might be more frequent than expected in the female population with intellectual disability. PMID:23234264

  15. Primary Carnitine deficiency in the Faroe Islands

    DEFF Research Database (Denmark)

    Rasmussen, Jan; Køber, Lars; Lund, Allan M

    2014-01-01

    BACKGROUND: Carnitine deficiency can cause cardiomyopathy and cardiac arrhythmia. The prevalence in the Faroe Islands is the highest reported in the world (1:300). A nationwide screening program identified 76 Faroese adult patients (15-80 years) with Primary Carnitine Deficiency (PCD). We describe...... prior and current health status and symptoms in these patients, especially focusing on cardiac characteristics. METHODS: Upon identification, patients were immediately admitted for physical examination, ECG, blood tests and initiation of L-carnitine supplementation. Medical records were reviewed...... apart from left ventricular hypertrophy with normal systolic function in one young male. Symptoms, e.g. fatigue, were reported in 43 % with a reduction to 12 % (p 

  16. Yersinia pestis subverts the dermal neutrophil response in a mouse model of bubonic plague.

    Science.gov (United States)

    Shannon, Jeffrey G; Hasenkrug, Aaron M; Dorward, David W; Nair, Vinod; Carmody, Aaron B; Hinnebusch, B Joseph

    2013-08-27

    The majority of human Yersinia pestis infections result from introduction of bacteria into the skin by the bite of an infected flea. Once in the dermis, Y. pestis can evade the host's innate immune response and subsequently disseminate to the draining lymph node (dLN). There, the pathogen replicates to large numbers, causing the pathognomonic bubo of bubonic plague. In this study, several cytometric and microscopic techniques were used to characterize the early host response to intradermal (i.d.) Y. pestis infection. Mice were infected i.d. with fully virulent or attenuated strains of dsRed-expressing Y. pestis, and tissues were analyzed by flow cytometry. By 4 h postinfection, there were large numbers of neutrophils in the infected dermis and the majority of cell-associated bacteria were associated with neutrophils. We observed a significant effect of the virulence plasmid (pCD1) on bacterial survival and neutrophil activation in the dermis. Intravital microscopy of i.d. Y. pestis infection revealed dynamic interactions between recruited neutrophils and bacteria. In contrast, very few bacteria interacted with dendritic cells (DCs), indicating that this cell type may not play a major role early in Y. pestis infection. Experiments using neutrophil depletion and a CCR7 knockout mouse suggest that dissemination of Y. pestis from the dermis to the dLN is not dependent on neutrophils or DCs. Taken together, the results of this study show a very rapid, robust neutrophil response to Y. pestis in the dermis and that the virulence plasmid pCD1 is important for the evasion of this response. Yersinia pestis remains a public health concern today because of sporadic plague outbreaks that occur throughout the world and the potential for its illegitimate use as a bioterrorism weapon. Since bubonic plague pathogenesis is initiated by the introduction of Y. pestis into the skin, we sought to characterize the response of the host's innate immune cells to bacteria early after

  17. Mobile Fruit and Vegetable Vendors’ Impact on Food Deserts

    Centers for Disease Control (CDC) Podcasts

    2014-09-10

    Kathleen Y. L, BS, winner of PCD’s 2014 Student Research Paper Contest and medical student at the University of California, San Francisco, discusses her winning paper on the evaluation and placement of mobile fruit and vegetables vendors and their ability to alleviate food deserts in New York City.  Created: 9/10/2014 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 9/10/2014.

  18. Early Onset Childhood Obesity and Risk of Metabolic Syndrome

    Centers for Disease Control (CDC) Podcasts

    2017-10-09

    This podcast features Lorena Pacheco, a doctoral student at the University of California San Diego and one of the winners of PCD’s 2017 Student Research Paper Contest. Lorena answers questions about her winning research, which focuses on the relationship between early onset obesity as a risk factor for increased metabolic syndrome in Chilean children.  Created: 10/9/2017 by Preventing Chronic Disease (PCD), National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 10/9/2017.

  19. Lazarus1, a DUF300 Protein, Contributes to Programmed Cell Death Associated with Arabidopsis acd11 and the Hypersensitive Response

    DEFF Research Database (Denmark)

    Malinovsky, F.G.; Brodersen, P.; Fiil, B.K.

    2010-01-01

    , the subcellular localization pattern of LAZ1 suggests that it may have transport functions for yet unknown, death-related signaling molecules at the plasma membrane and/or endosomal compartments. In summary, our results validate the utility of the large-scale suppressor screen to identify novel components...... associated with the HR, in addition to its role in acd11-related death. Furthermore, the similar topology of a plant and human DUF300 proteins suggests similar functions in PCD across the eukaryotic kingdoms, although a direct role for TMEM34 in cell death control remains to be established. Finally...

  20. [Primary ciliary dyskinesia with HYDIN gene mutations in a child and literature review].

    Science.gov (United States)

    Chen, L L; Yang, Y G; Wu, J Z; Chen, X R

    2017-04-02

    Objective: To review children's primary ciliary dyskinesia (PCD) in the pathogenesis, clinical manifestation, diagnosis and treatment. Method: To summarize and analyze the clinical data of a patient who was admitted to the first affiliated hospital of Xiamen University with primary ciliary dyskinesia in April 2014 while referring to related literature. Result: An 11 years old boy, weighting about 22 kg, had a course of more than 10 years with repeated cough, stuffy and runny nose shortly after the birth. Examinations after admission to hospital showed that he presented with visible clubbing, bilateral paranasal sinus area tenderness, pharynx posterior wall with visible yellow pussy stuff drip and bilateral lung had scattered wet rales. Auxiliary examination revealed bilateral maxillary sinus, ethmoid sinus inflammation and bronchitis with left lower lung bronchiectasis. Fiberoptic bronchoscopy discovered congestion and a lot of sputum; ciliary biopsy pathology displayed that cilia were sparse and partial cilia 9+ 2 microtubules structural abnormalities. Full sequence of exon gene sequencing revealed two mutations located at chromosome 16 chr16: 71061369 (non-coding regions) and chr16: 70993591 (coding). Two novel mutations m. 3362A>G(E20) and c. 6101G>A(E39) in exon 16 of the HYDIN gene were identified. With the" ciliary motility disorder, gene" as keywords , the CNKI, Wanfang digital knowledge service platform and PubMed were searched for relevant articles from the establishment to July 2016. The studies retrieved included 9 cases and these cases were summarized. Comprehensive analysis showed that HYDIN gene mutations related PCD patients had the typical PCD performance such as repeatedly wet cough, sinusitis, bronchiectasis, and otitis media. The majority of patients have a history of acute respiratory distress syndrome in infancy and no visceral dislocation was not found. Most of the patients had no obvious structural abnormalities in cilia electron microscopic