WorldWideScience

Sample records for cengiz acar mustafa

  1. Mustafa Kemal Üniversitesi Tıp Dergisi

    OpenAIRE

    MKU Med J, MKU Med J

    2015-01-01

    Cilt/Vol 6       Sayı/Number 22       Mart/March 2015  p.ISSN: 1308 – 7185e.ISSN: 2149-3103         MUSTAFA KEMAL ÜNİVERSİTESİ TIP DERGİSİMEDICAL JOURNAL OF MUSTAFA KEMAL UNIVERSITY            Mustafa Kemal Üniversitesi Tıp Fakültesi Yayını Medical Journal of the Mustafa Kemal University     Yılda 4 kez yayınlanır.Makale gönderim adresi:  MUSTAFA KEMAL ÜNİVERSİTESİ TIP DERGİSİMedical Journal of Mustafa Kemal University Mustafa Kemal Üniversitesi a...

  2. Çanakkale Muharebeleri ve Mustafa Kemal

    Directory of Open Access Journals (Sweden)

    F. Rezzan Ünalp

    2015-04-01

    Full Text Available Winds of war prevailing over Europe at the beginning of the 20th Century tormented the continent by transforming it into a so called “barrel-of-gunpowder” and mutual declarations of war thence ensued led to unprecedented series of wars which could not have been avoided by any part of Europe, just like the Ottoman Empire… Çanakkale Front was but only one of the innumerable fronts opened in the war. At a meeting held by the War Council, in London, in January 1915, a discussion on waging war against Central Powers was brought up, and consequently a plan of naval attack directed at Çanakkale Strait was accepted. In view of the British authorities by seizing Gelibolu Peninsula the road to İstanbul would be cleared, and thereby casting Turks out of the war a direct link would have been established. To this end, Entente Powers launched their first attack on the Çanakkale Strait in November 1914. The bombardment aimed at destroying the coastal fortifications was repeated over and over again and finally on 18 March 1915 a comprehensive attack was launched. Entente Forces not succeeding in crossing the Strait from the sea launched a land warfare by landing forces to various locations as of 25 April 1915 that was to last for eight-and-a-half-months. Failing to achieve their targets the Ententes, in August 1915, attempted an amphibious campaign on the Anafartalar sector through Suvla Bay for the last time. However, to their dismay, they had to evacuate Gelibolu disillusioned. This article thoroughly embraces Çanakkale Battles’ military aspects by referring to the anecdotes and striking stories of warring soldiers. Moreover, the brilliant role Mustafa Kemal – first as the 19th Division Commander, then as the Commander of the Anafartalar Group – played in winning battles is put forward.

  3. Exon: CBRC-ACAR-01-0787 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available catgatgacgatgacgatgacgatgatgacgacgatgatgacaatgaagatgaacatcatcaccaccatcatgaACATCACGGCAAGCACCACCaccatcatgatgat...gatgacgacgacgatgagaatgatgatgatgatgacgacgacgaggatgacCACCATCACCATAAGCATCATGGCAATCATCACCAACAccatgatcatggtgatccaccacca...CBRC-ACAR-01-0787 ATGACCATGGCAAAGCAGAGCACCAAAGCCATGAGGATGAACACCATCTTCACAAGGAACATGACTACCA...TGGGCATCACAATCAGtacagtaatgatgatgatgatgacgacgacgacgacgacgacgatgacgaTCACCATCATGAAGCCGGGCATCACCAAGAAAGCCAT...CATTCCCACAAAGATCATCATGGTGATGACAGCGATGACACTGGCCACAgtgcacatcatcatcatcatcatgaacatcacagcagccatcaccatcatgatgatggg

  4. Exon: CBRC-ACAR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0145 atgtatatgtatgcatgtatatatgtgcatgcatgtgtatgtgtgtgtatatatatatttgtatgcacacacacacacatatacacaca...tacatacttctGCCTGTttctatgtatatgtatttgtgtacatatatatgtatgtatgcacacacaaacatataaatatatacttacatacacaca...tacatacttatgcctatgtgtttgtatgtatatatatgtatatgtgtgtgcacacaatatatatacatgcatacacatacgtatacacacatacat...acttatgcttatgtttatacatatatgtatatatgtgcacatgtatgtatgcacaaacatacatatacatacatacaaaca...tgcatacTtatgcctatgtgtttatatgtatgtttgtgtgtatatatgtgcatgtatatgtatgtatatatgtatgcatgcacaatatatatacacacacatatacacacatacaca

  5. THE THEME OF HUNT IN CENGIZ AYTMATOV'S PIECES / CENGİZ AYTMATOV’UN ESERLERİNDE AV TEMASI

    Directory of Open Access Journals (Sweden)

    Dr. Özlem NEMUTLU

    2008-12-01

    Full Text Available Cengiz Aytmatov is such a narrator who in hisworks could carry out love, struggle between good andbad, inescapable destiny, war, education, individual andsocial crises caused by the authoritarian regime. Bymaking use of these kind of topics and plots, he was ableto come through giving national and universal messages. “The hunt” and “hunting” is also one of his topicsreflected from different perspectives in his works. In hisworks such as White Ship (Beyaz Gemi, Dreams ofFemale Wolf (Disi Kurdun Rüyaları, Pied-dog Running atthe Shore (Deniz Kıyısında Kosan Ala Köpek, The DayForfeit for the Age (Gün Olur Asra Bedel, FarewellGülsarı (Elveda Gülsarı, Aytmatov plotted that “thehunt” and “hunting” is not harmful if it was the part ofthe nature and natural life, but it is harmful andunacceptable if it was dangerous for the life of humanbeing and the nature. When “the hunt” and “hunting”turns over a dangerous activity, it could cause someinduvidual and social tragedies.In this study, we will tackle with the reflections of“the hunt” and “hunting” in Cengiz Aytmatov’s works andthe effect of his appraches in the society.

  6. Integrated Approach to Repair and Seismic Strengthening of Mustafa Pasha Mosque in Skopje

    International Nuclear Information System (INIS)

    Sendova, Veronika; Gavrilovic, Predrag; Stojanoski, Blagojce

    2008-01-01

    Mustafa Pasha's Mosque is one of the biggest and the best preserved monuments of the Ottoman sacral architecture in Skopje and the Balkan. As a cultural historic monument of an extraordinary importance for the city of Skopje and Republic of Macedonia, it is under protection of the Law on Protection of Cultural Heritage. IZIIS is currently elaborating a project on repair and strengthening of Mustafa Pasha's mosque. Respecting the modern requirements in protection of historical monuments, as is the main principles of seismic strengthening are: application of new technologies and materials, reversibility and invisibility of the applied technique. The concept of structural strengthening and repair aimed at reaching the designed level of earthquake protection has been selected based on: (i) investigations of the soil conditions, (ii) investigations of the characteristics of the built-in materials, (iii) investigation of the main dynamic characteristics, as well as (iv) previous experimental investigation of the mosque model

  7. MUSTAFA a tool for numerical simulations of the beam behavior in a linac

    CERN Document Server

    Guignard, Gilbert

    1998-01-01

    MUSTAFA stands for MUltibunch Simulation and Tracking Algorithm for Future linear Accelerators and provides an environment for tracking a multibunch beam accelerated in the linac of a collider. It is made of three parts: i) an interactive utility MBUNCH which allows to run the simulations, edit the input data, systematically vary some parameters, launch statistics on misalignment realisations and select the outputs, ii) the tracking program itself MBTR that includes magnetic focusing, acceleration, wakefields, misalignments and trajectory correction, and iii) a graphcs facility called MOVIE th at provides an animated representation of the transverse motion within each bunch of a train, either in the geometric space or in the phase space. While MBTR is written in FORTRAN, the other two codes are written in QUICKBASIC (MS V4.5). They run on PC Pentium computers in a stand-alone mode, independent of any network. Hence MUSTAFA is easily transportable and offers a unique graphics facility. It has been extensively ...

  8. HATTAT MUSTAFA HALİM ÖZYAZICI ve TUTTUĞU TALEBE KAYIT DEFTERLERİ

    OpenAIRE

    Berk, süleyman

    2015-01-01

    ÖZETOsmanlı’dan Cumhuriyet dönemine intikal eden önemli hattatlarımızdan biri de Mustafa HalimÖzyazıcı’dır (1315/1898- 1384/1964). Halim Efendi, hat sanatının zirveye çıktığı dönemde ünlü sanatkârlardanders almıştır. Sanat bakımından, “Kalemi kendine esir etmiş ve yazıyı yenmiş” kudretli hattatlarımızdanbirisidir. Her çeşit yazıda mükemmel eserler vermiştir. Kendisinin klasik anlamda icazetiolmamasına rağmen mezun olduğu Medresetü’l-Hattâtîn’den aldığı diplomada ders aldığı hocalarınınimzası ...

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0762 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 2e-98 40% ...

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0695 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-107 43% ...

  11. Can positron 2D-ACAR resolve the electronic structure of high-Tc superconductors

    International Nuclear Information System (INIS)

    Chan, L.P.; Lynn, K.G.; Harshman, D.R.

    1992-01-01

    In this paper, the authors examine the ability of the positron Two-Dimensional Angular Correlation Annihilation Radiation (2D-ACAR) technique to resolve the electronic structures of high-T c cuprate superconductors. Following a short description of the technique, discussions of the theoretical assumptions, data analysis and experimental considerations, in relation to the high-T c superconductors, are given. The authors briefly review recent 2D-ACAR experiments on YBa 2 Cu 3 O 7-x , Bi 2 Sr 2 CaCuO 8+δ and La 2-x Sr x CuO 4 . The 2D-ACAR technique is useful in resolving the band crossings associated with the layers of the superconductors that are preferentially sampled by the positrons. Together with other Fermi surface measurements (namely angle-resolved photoemission), 2D-ACAR can resolve some of the electronic structures of high-T c cuprate superconductors

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-0595 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0595 ref|ZP_01113375.1| GAF sensor hybrid histidine kinase [Reinekea s...p. MED297] gb|EAR10651.1| GAF sensor hybrid histidine kinase [Reinekea sp. MED297] ZP_01113375.1 2.0 31% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0074 ref|YP_317715.1| hypothetical protein Nwi_1101 [Nitrobacter winogradsky...i Nb-255] gb|ABA04363.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] YP_317715.1 6.5 24% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0832 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-142 60% ...

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-0392 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0392 ref|ZP_01465674.1| hypothetical protein STIAU_7012 [Stigmatella a...urantiaca DW4/3-1] gb|EAU63564.1| hypothetical protein STIAU_7012 [Stigmatella aurantiaca DW4/3-1] ZP_01465674.1 1e-04 31% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0222 ref|ZP_01461042.1| hypothetical protein STIAU_7773 [Stigmatella a...urantiaca DW4/3-1] gb|EAU68236.1| hypothetical protein STIAU_7773 [Stigmatella aurantiaca DW4/3-1] ZP_01461042.1 0.004 27% ...

  18. NCBI nr-aa BLAST: CBRC-ACAR-01-1202 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1202 ref|ZP_01461017.1| serine/threonine-protein kinase Pkn6 [Stigmate...lla aurantiaca DW4/3-1] gb|EAU68211.1| serine/threonine-protein kinase Pkn6 [Stigmatella aurantiaca DW4/3-1] ZP_01461017.1 1.9 31% ...

  19. Electronic structure of disordered CuPd alloys by positron-annihilation 2D-ACAR

    International Nuclear Information System (INIS)

    Smedskjaer, L.C.; Benedek, R.; Siegel, R.W.; Legnini, D.G.; Stahulak, M.D.; Bansil, A.

    1988-01-01

    We report 2D-ACAR experiments and KKR CPA calculations on alpha-phase single-crystal Cu/sub 1-x/Pd/sub x/ in the range x ≤ 0.25. The flattening of the Fermi surface near [110] with increasing x predicted by theory is confirmed by our experimental results. 16 refs., 2 figs

  20. NCBI nr-aa BLAST: CBRC-ACAR-01-0231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0231 ref|XP_001209722.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32420.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209722.1 0.48 31% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-0164 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0164 ref|XP_001209232.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU38624.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209232.1 1.5 24% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1054 ref|YP_406984.1| putative transport [Shigella boydii Sb227] sp|Q3...24V2|ENTS_SHIBS Enterobactin exporter entS gb|ABB65156.1| putative transport [Shigella boydii Sb227] YP_406984.1 1.7 27% ...

  3. NCBI nr-aa BLAST: CBRC-ACAR-01-1202 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1202 ref|YP_001449434.1| putative acyltransferase [Streptococcus gordon...ii str. Challis substr. CH1] gb|ABV10561.1| putative acyltransferase [Streptococcus gordonii str. Challis substr. CH1] YP_001449434.1 1.9 25% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0466 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0466 ref|YP_001450257.1| streptococcal hemagglutinin [Streptococcus gordon...ii str. Challis substr. CH1] gb|ABV10391.1| streptococcal hemagglutinin [Streptococcus gordonii str. Challis substr. CH1] YP_001450257.1 2e-16 51% ...

  5. NCBI nr-aa BLAST: CBRC-ACAR-01-0325 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0325 ref|NP_543045.1| NADH dehydrogenase subunit 1 [Venerupis (Ruditap...es) philippinarum] dbj|BAB83796.1| NADH dehydrogenase subunit 1 [Venerupis (Ruditapes) philippinarum] NP_543045.1 6.5 26% ...

  6. NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0089 ref|YP_459771.1| hypothetical protein ELI_14410 [Erythrobacter litoral...is HTCC2594] gb|ABC64974.1| hypothetical protein ELI_14410 [Erythrobacter litoralis HTCC2594] YP_459771.1 4.4 24% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0152 ref|YP_482503.1| hypothetical protein Francci3_3420 [Frankia sp. ...CcI3] gb|ABD12774.1| hypothetical protein Francci3_3420 [Frankia sp. CcI3] YP_482503.1 0.022 26% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-0711 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0711 ref|ZP_01509857.1| glycosyl transferase, family 2 [Burkholderia phytofirm...ans PsJN] gb|EAV05410.1| glycosyl transferase, family 2 [Burkholderia phytofirmans PsJN] ZP_01509857.1 4.7 30% ...

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0939 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0939 ref|ZP_01513727.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirm...ans PsJN] gb|EAV01607.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirmans PsJN] ZP_01513727.1 5.4 32% ...

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0829 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0829 ref|ZP_02028047.1| hypothetical protein BIFADO_00459 [Bifidobacterium adolescent...is L2-32] gb|EDN83548.1| hypothetical protein BIFADO_00459 [Bifidobacterium adolescentis L2-32] ZP_02028047.1 6.2 30% ...

  11. NCBI nr-aa BLAST: CBRC-ACAR-01-0904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0904 ref|YP_001403054.1| multidrug translocase MdfA [Yersinia pseudotuberculosis... IP 31758] gb|ABS48940.1| multidrug translocase MdfA [Yersinia pseudotuberculosis IP 31758] YP_001403054.1 2.1 28% ...

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-1044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1044 ref|NP_001025549.1| potassium voltage-gated channel, shaker-relat...ed subfamily, member 3 [Gallus gallus] gb|AAP94028.1| shaker subfamily potassium channel Kv1.3 [Gallus gallus] NP_001025549.1 0.0 90% ...

  13. LCAO fitting of positron 2D-ACAR momentum densities of non-metallic solids

    International Nuclear Information System (INIS)

    Chiba, T.

    2001-01-01

    We present a least-squares fitting method to fit and analyze momentum densities obtained by 2D-ACAR. The method uses an LCAO-MO as a fitting basis and thus is applicable to non-metals. Here we illustrate the method by taking MgO as an example. (orig.)

  14. LCAO fitting of positron 2D-ACAR momentum densities of non-metallic solids

    Energy Technology Data Exchange (ETDEWEB)

    Chiba, T. [National Inst. for Research in Inorganic Materials, Tsukuba, Ibaraki (Japan)

    2001-07-01

    We present a least-squares fitting method to fit and analyze momentum densities obtained by 2D-ACAR. The method uses an LCAO-MO as a fitting basis and thus is applicable to non-metals. Here we illustrate the method by taking MgO as an example. (orig.)

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-1152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1152 ref|YP_026083.1| NADH dehydrogenase subunit 2 [Steinernema carpoc...apsae] gb|AAT00526.1| NADH dehydrogenase subunit 2 [Steinernema carpocapsae] YP_026083.1 0.14 32% ...

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-0720 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0720 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 1e-108 43% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0695 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 1e-107 43% ...

  18. NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0762 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 2e-98 41% ...

  19. Positron annihilation 2D-ACAR study of irradiation-induced defects in Si

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Masayuki; Tang, Z.; Kawasuso, Atsuo; Suezawa, Masashi; Yamaguchi, Sadaei; Sumino, Koji [Tohoku Univ., Sendai (Japan). Inst. for Materials Research; Chiba, T.

    1996-04-01

    A positron annihilation method constitutes the most characteristic feature to demonstrate directly the lattice vacancy (hereinafter referred to vacancy) independent of the added elements, the electrical conductance and the charge state of them. The method can detect hole, divacancy and vacancy cluster. The divacancy is introduced into the single crystal sample by using the electron radiation with 15 MeV at room temperature. For 2D-ACAR spectrum of the perfect crystal,the maximum peak to valley showed 12.3% of the peak height of 2D-ACAR spectrum. It was clear from the measurement results of sample with the neutral divacancy (V2deg) that 2D-ACAR spectra of divacancy are isotropic and stable at the different charged states. 2D-ACAR spectra are calculated by using the first principle to the neutral divacancy. The results of the theoretical calculation are very agreed with those of observation and they are very isotropic. (S.Y.)

  20. NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0569 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 2e-89 53% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-0779 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0779 ref|YP_866941.1| major facilitator superfamily MFS_1 [Magnetococc...us sp. MC-1] gb|ABK45535.1| major facilitator superfamily MFS_1 [Magnetococcus sp. MC-1] YP_866941.1 5.6 26% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0089 ref|YP_865716.1| TPR repeat-containing protein [Magnetococcus sp.... MC-1] gb|ABK44310.1| TPR repeat-containing protein [Magnetococcus sp. MC-1] YP_865716.1 3.4 28% ...

  3. NCBI nr-aa BLAST: CBRC-ACAR-01-1107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1107 ref|NP_519445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solana...cearum GMI1000] emb|CAD15026.1| probable lipid a biosynthesis transmembrane protein [Ralstonia solanacearum] NP_519445.1 6.1 29% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0779 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0779 ref|YP_001127455.1| Putative sigma-B regulator [Geobacillus thermoden...itrificans NG80-2] gb|ABO68710.1| Putative sigma-B regulator [Geobacillus thermodenitrificans NG80-2] YP_001127455.1 5.6 32% ...

  5. NCBI nr-aa BLAST: CBRC-ACAR-01-0358 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0358 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-05 31% ...

  6. NCBI nr-aa BLAST: CBRC-ACAR-01-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0101 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 6e-11 29% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0015 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-13 75% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-0245 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0245 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-08 34% ...

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0712 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0712 ref|YP_604712.1| cytochrome c assembly protein [Deinococcus geothermal...is DSM 11300] gb|ABF45543.1| cytochrome c assembly protein [Deinococcus geothermalis DSM 11300] YP_604712.1 7.8 32% ...

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0906 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0906 ref|YP_845838.1| DNA internalization-related competence protein C...omEC/Rec2 [Syntrophobacter fumaroxidans MPOB] gb|ABK17403.1| DNA internalization-related competence protein ComEC/Rec2 [Syntrophobacter fumaroxidans MPOB] YP_845838.1 4.8 26% ...

  11. NCBI nr-aa BLAST: CBRC-ACAR-01-0160 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0160 ref|YP_001100094.1| NADH dehydrogenase I chain M, membrane subunit [Herminiimonas arsenico...xydans] emb|CAL61969.1| NADH dehydrogenase I chain M, membrane subunit [Herminiimonas arsenicoxydans] YP_001100094.1 0.14 22% ...

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-0595 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0595 ref|YP_246431.1| Zinc/manganese ABC transporter permease protein ...[Rickettsia felis URRWXCal2] gb|AAY61266.1| Zinc/manganese ABC transporter permease protein [Rickettsia felis URRWXCal2] YP_246431.1 2.0 21% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-0449 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0449 ref|ZP_01443175.1| regulatory protein, putative [Roseovarius sp. ...HTCC2601] gb|EAU46540.1| regulatory protein, putative [Roseovarius sp. HTCC2601] ZP_01443175.1 6.3 28% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0087 ref|YP_677558.1| CHU large protein; uncharacterized [Cytophaga hutchinson...ii ATCC 33406] gb|ABG58218.1| CHU large protein; uncharacterized [Cytophaga hutchinsonii ATCC 33406] YP_677558.1 3.8 22% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0968 ref|NP_001103230.1| Fanconi anemia core complex 100 kDa subunit i...soform b [Homo sapiens] sp|Q0VG06|FP100_HUMAN Fanconi anemia-associated protein of 100 kDa NP_001103230.1 2e-50 46% ...

  16. Ab initio calculation of positron distribution, ACAR and lifetime in TTF-TCNQ

    International Nuclear Information System (INIS)

    Ishibashi, Shoji; Kohyama, Masanori

    2000-01-01

    We have performed ab initio calculations of positron distribution, ACAR and lifetime in the quasi-one-dimensional organic conductor TTF-TCNQ. The electronic structure is obtained within the LDA, while the positron state is calculated either with the LDA or with the GGA. Except the positron lifetime, differences between the LDA and GGA results are rather small. The obtained results are compared with our previous experiments and calculations.

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0365 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...

  18. NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...

  19. NCBI nr-aa BLAST: CBRC-ACAR-01-1115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1115 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-144 72% ...

  20. Mustafa Bin Bâlî ve İlm-i Firâset’i Mustafa Bin Bâlî And İlm-i Firâset

    Directory of Open Access Journals (Sweden)

    Ramazan SARIÇİÇEK

    2012-12-01

    Full Text Available There wasn’t any study over this work which was Mustafa bin Bâlî’s, who lived 16th century, plain-text. But there is some information about works which were made over firâset, physiognomy and like sciences.2 The study which we make over this work comes last stage and it is firstly presented to science-world here. Although it is said that it was compiled from Fahreddin Razi veMuhyiddin-i Arabî at primary of the work, it is quality of an academicstudy which was prepared with study of many more works over scienceof firâset. Not only Fahreddin Razi and Muhyiddin-i Arabî but also theauthor benefited from works of many more scientists from HamdullahHamdi to İbni Sina. we can say that it is unique in its field with thiscourse. In that works, which were written in this field, are generallyover application of firaset science. That is, they pay attention overresults instead of the basic criterion of this science. Nevertheless,thiswork is a well-coorinated study which was made over firaset aswhole.That work compile and gather informations about firaset withcare of an academician while they are in bits and disorganized atanother works.In addition, the work is included various verses like Arabic,Persian and Turkish in spite it is plain-text. As for aspect of language,also it is included materials of language which belonging to Turkish ofAncient Anatolian. 16. yüzyılda yaşayan Mustafa bin Bâlî’nin mensur olan bu eseri üzerinde daha önce bir çalışma yapılmamıştır. Ancak firâset, kıyâfet ve benzeri ilimler üzerinde yapılan çalışmalarda hakkında bazı bilgiler verilmiştir.1 Bizim ise bu eser üzerinde yaptığımız çalışma son aşamasına gelmiş olmakla beraber ilk defa burada bilim âleminin dikkatine sunulmaktadır.Her ne kadar eserin başında Fahreddin Razi ve Muhyiddin-i Arabî’den derlendiği söyleniyor ise de eser firâset ilmi üzerine daha birçok eser de taranarak hazırlanmış akademik bir

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0845 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 86% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-0408 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0408 ref|NP_000671.2| alpha-1A-adrenergic receptor isoform 1 [Homo sap...iens] sp|P35348|ADA1A_HUMAN Alpha-1A adrenergic receptor (Alpha 1A-adrenoceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic... receptor) (Alpha adrenergic receptor 1c) gb|AAB60353.1| adrenergic alpha-1c receptor pro...tein dbj|BAC05926.1| seven transmembrane helix receptor [Homo sapiens] gb|AAQ91331.1| adrenergic

  3. 2D-ACAR spectra of insulating and superconducting Y-123

    International Nuclear Information System (INIS)

    Smedskjaer, L.C.; Bansil, A.

    1992-09-01

    An overview of the two-dimensional angular correlation (2D-ACAR) positron annihilation results for the three fundamental phases of YBa 2 Cu 3 O x , namely, the normal metal, the superconductor, and the insulator, is presented. In addition to the c-axis projected momentum density, the recent results for the a-axis projection as well as the insulating Y123 are discussed. The experimental results are compared and contrasted with the corresponding band theory predictions as far as possible in order to gain insight into the electronic structure and Fermiology of this archetypal high-T c superconductor

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-1154 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1154 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-124 69% ...

  5. NCBI nr-aa BLAST: CBRC-ACAR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0009 ref|NP_001851.1| solute carrier family 31 (copper transporters), ...ns] gb|AAH26252.1| Solute carrier family 31 (copper transporters), member 2 [Homo... sapiens] emb|CAG28543.1| SLC31A2 [Homo sapiens] gb|EAW87355.1| solute carrier family 31 (copper transporters...), member 2 [Homo sapiens] gb|ABM82295.1| solute carrier family 31 (copper transporters), member 2 [synthet...ic construct] gb|ABM85475.1| solute carrier family 31 (copper transporters), memb

  6. Positron-annihilation 2D-ACAR studies of disordered and defected alloys

    International Nuclear Information System (INIS)

    Bansil, A.; Prasad, R.; Smedskjaer, L.C.; Benedek, R.; Mijnarends, P.E.

    1987-09-01

    Theoretical and experimental progess in connection with 2D-ACAR positron annihilation studies of ordered, disordered, and defected alloys is discussed. We present, in particular, some of the recent developments concerning the electronic structure of disordered alloys, and the work in the area of annihilation from positrons trapped at vacancy-type defects in metals and alloys. The electronic structure and properties of a number of compounds are also discussed briefly; we comment specifically on high T/sub c/ ceramic superconductors, Heusler alloys, and transition-metal aluminides. 58 refs., 116 figs

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0066 gb|AAT90207.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90208.1| mela...nocortin 1 receptor [Holbrookia maculata] gb|AAT90209.1| melanocortin 1 receptor [Holbrookia ...maculata] gb|AAT90210.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90211.1| melanocortin 1 recepto...r [Holbrookia maculata] gb|AAT90213.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90214.1| mela...nocortin 1 receptor [Holbrookia maculata] gb|AAT90215.1| melanocortin 1 receptor [Hol

  8. Disruption of the nitrogen regulatory gene AcareA in Acremonium chrysogenum leads to reduction of cephalosporin production and repression of nitrogen metabolism.

    Science.gov (United States)

    Li, Jinyang; Pan, Yuanyuan; Liu, Gang

    2013-12-01

    AcareA, encoding a homologue of the fungal nitrogen regulatory GATA zinc-finger proteins, was cloned from Acremonium chrysogenum. Gene disruption and genetic complementation revealed that AcareA was required for nitrogen metabolism and cephalosporin production. Disruption of AcareA resulted in growth defect in the medium using nitrate, uric acid and low concentration of ammonium, glutamine or urea as sole nitrogen source. Transcriptional analysis showed that the transcription of niaD/niiA was increased drastically when induced with nitrate in the wild-type and AcareA complemented strains but not in AcareA disruption mutant. Consistent with the reduction of cephalosporin production, the transcription of pcbAB, cefD2, cefEF and cefG encoding the enzymes for cephalosporin production was reduced in AcareA disruption mutant. Band shift assays showed that AcAREA bound to the promoter regions of niaD, niiA and the bidirectional promoter region of pcbAB-pcbC. Sequence analysis showed that all the AcAREA binding sites contain the consensus GATA elements. These results indicated that AcAREA plays an important role both in the regulation of nitrogen metabolism and cephalosporin production in A. chrysogenum. Copyright © 2013 Elsevier Inc. All rights reserved.

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0569 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  11. NCBI nr-aa BLAST: CBRC-ACAR-01-0377 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0377 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-0724 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0724 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  13. Positron annihilation 2D-ACAR study of semi-coherent Li nanoclusters in MgO(1 0 0) and MgO(1 1 0)

    International Nuclear Information System (INIS)

    Falub, C.V.; Mijnarends, P.E.; Eijt, S.W.H.; Huis, M.A. van; Veen, A. van; Schut, H.

    2002-01-01

    Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10 16 cm -2 6 Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations

  14. Positron annihilation 2D-ACAR study of semi-coherent Li nanoclusters in MgO(1 0 0) and MgO(1 1 0)

    Energy Technology Data Exchange (ETDEWEB)

    Falub, C.V. E-mail: c.falub@iri.tudelft.nl; Mijnarends, P.E.; Eijt, S.W.H.; Huis, M.A. van; Veen, A. van; Schut, H

    2002-05-01

    Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10{sup 16} cm{sup -2} {sup 6}Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations.

  15. Positron annihilation 2D-ACAR study of semi-coherent Li nanoclusters in MgO( 1 0 0 ) and MgO( 1 1 0 )

    Science.gov (United States)

    Falub, C. V.; Mijnarends, P. E.; Eijt, S. W. H.; van Huis, M. A.; van Veen, A.; Schut, H.

    2002-05-01

    Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10 16 cm -26Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations.

  16. Depth-selective 2D-ACAR and coincidence Doppler investigation of embedded Au nanocrystals in MgO

    International Nuclear Information System (INIS)

    Eijt, S.W.H.; Veen, A. van; Falub, C.V.; Schut, H.; Huis, M.A. van; Mijnarends, P.E.

    2004-01-01

    We present a depth-selective 2D-ACAR and two-detector Doppler broadening study on Au nanocrystals in monocrystalline MgO(100), produced in sub-surface layers by ion implantation and subsequent thermal annealing to temperatures beyond the stability range of vacancy clusters in MgO. In contrast to the case of Li nanocrystals, it was found that positrons do not trap inside the Au nanocrystals, but only in defects at the nanocrystal-to-host interface (attached vacancy clusters). This is interpreted in terms of the positron affinity of Au, MgO and the defects. (orig.)

  17. Depth-selective 2D-ACAR and coincidence Doppler investigation of embedded Au nanocrystals in MgO

    Energy Technology Data Exchange (ETDEWEB)

    Eijt, S.W.H.; Veen, A. van; Falub, C.V.; Schut, H.; Huis, M.A. van [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Mijnarends, P.E. [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Dept. of Physics, Northeastern Univ., Boston, MA (United States)

    2004-07-01

    We present a depth-selective 2D-ACAR and two-detector Doppler broadening study on Au nanocrystals in monocrystalline MgO(100), produced in sub-surface layers by ion implantation and subsequent thermal annealing to temperatures beyond the stability range of vacancy clusters in MgO. In contrast to the case of Li nanocrystals, it was found that positrons do not trap inside the Au nanocrystals, but only in defects at the nanocrystal-to-host interface (attached vacancy clusters). This is interpreted in terms of the positron affinity of Au, MgO and the defects. (orig.)

  18. Fermi surface in La/sub 2/CuO/sub 4-δ/ determine by positron 2D-ACAR

    International Nuclear Information System (INIS)

    Tanigawa, S.; Mizuhara, Y.; Hidaka, Y.; Oda, M.; Suzuki, M.; Murakami, T.

    1988-01-01

    The topology of the Fermi surface in La/sub 2/CuO/sub 4-δ/ is determined by two dimensional angular correlation measurements of annihilation radiations (2D-ACAR) at room temperature. The determined Fermi surface is two dimensional and has a slender electron pillar along ΓZ and two kinds of hole pillars along PX and along NN direction parallel to ΓZ, respectively. It is concluded that the Fermi surface is not a simple half filled one and this compound should be metallic at least at room temperature in the band picture

  19. West Europe Report. No. 2183.

    Science.gov (United States)

    1983-08-03

    requested under article 141/1 of the TPC [Turkish Penal Code] are: Alp Selek, Dincer Dogu, Nurdan Orpeu, Musfik Eren, Bekir Yenigun , Mustafa Aktulgali...Bilginer Mustafa Ozkan Ismail Ozkan Ismail Yildiz Vedat Demirkol Ugur Özdemir Selahattin Ozpalabiyiklar Serafettin Akkaya Selim Cuhaci Husnu...Murat Gezgin Ibrahim Yazganoglu Fatma Ertanyilmaz Mustafa User Hasan Ozdil Mualla Guner Ismail Semercioglu Zeynel Simsek Musa Dogru Cengiz

  20. Yerelden Evrensele İki Yol Arkadaşı: Cengiz Aytmatov ve Kaysın Kuliyev Two Fellow Travellers From Local To Universal: Chingiz Aitmatov And Kaisyn Kuliyev

    Directory of Open Access Journals (Sweden)

    Mehmed Said ARBATLI

    2013-07-01

    Full Text Available While Chingiz Aitmatov almost always reflected Kyrgyz people, their traditions and their lifestyles in his works, he is undisputably a world writer who managed to reach the universal with local materials through his ability to catch the common values, feelings and thoughts of humanity. There seems to be a great similarity between Aitmatov and the Balkar poet Kaisyn Kuliyev, who had a significant role in his making his first public appearance in literature and was accepted as a teacher and was respected as well. Being from a small nation and reflecting its values, Kaisyn Kuliyev attained universal values and achieved great success. His poems were translated into 120 languages. Millions of copies of his books were printed, especially in Soviet Union period. However, although today Aitmatov is well-known by many people, Kuliyev is not recognized enough. The literature on Aitmatov being grand in scope, has barely mentioned the relationship between him and Kaisyn Kuliyev. In fact, Kuliyev was one of the most significant and well-known poets of his period, and it was him who influenced Aitmatov to begin a writing career. In this study of ours, we are going to examine their fellowship extending from the local to the universal and their common points, in addition to the mostly unknown close relationship of these two great artists of Turkic World. Cengiz Aytmatov eserlerinde hemen daima Kırgız halkını, onun geleneklerini, yaşantısını yansıttığı halde insanlığın ortak değerlerini, duygu ve düşüncelerini yakalayabilmesi sayesinde yerel malzemeyle evrensele ulaşmayı başarmış tartışmasız bir dünya yazarıdır. Aytmatov ile onun kendisini bir hoca kabul edip hürmet gösterdiği Balkar şairi Kaysın Kuliyev arasında büyük bir benzerlik görülmektedir. Kaysın da küçük bir halkın içinden çıkıp onların değerlerini yansıtırken evrensel değerleri yakalayarak büyük bir başarı elde etmiş, şiirleri 120 dile

  1. City Satires in the Classical Turkish Poetry and Arpaemîni-zâde Mustafa Samî’s Qasida of Edirne Klasik Türk Şiirinde Şehir Hicivleri ve Arpaemîni-zâde Mustafa Samî’nin Edirne Kasidesi

    Directory of Open Access Journals (Sweden)

    Fatma Sabiha KUTLAR

    2011-06-01

    Full Text Available ABSTRACT In the classical Turkish poetry, there are satirical examples among the poems which is subject about settlement places like cities, towns and villages. Poets, in these texts, had satirized various settlement place at imperial geography, generally because of its place name and folk features under cover of rhetoric and argo, reasons such as “disapprobation, aversion of the folk, disappointment, getting irritate from nature or geographical location, to be dispatched involuntarily”. In this study, the city satires that put down on paper by the Divan poets shortly familiarized which we have made firm, and it is focused on the Edirne satire of the XVIII. century poets Arpaemîni-zâde Mustafa Samî which put down on paper his negative feelings about the Edirne city, combining by negative features of the winter season. By the expressions in this qasida, the poet revealed intimately that he doesn’t like the Edirne and its folk. Likewise, he had indicated the contention among the two capital city of Ottoman Empire which its root reached to conquest years, continued implicitly beginnig of the XVIII. Century. Klasik Türk şiirinde şehir, kasaba, köy gibi yerleşim yerlerinin konu edildiği manzumeler arasında hiciv niteliği taşıyan örnekler de bulunmaktadır. Şairler, bu metinlerde “beğenmeme, halkından hoşlanmama, umduğunu bulamama, doğasından ya da coğrafî konumundan rahatsızlık duyma, isteği dışında gönderilme” gibi çok farklı gerekçelerle İmparatorluk coğrafyasına ait birçok yerleşim yerini, genellikle isminden ya da halkının özelliklerinden hareketle söz sanatlarından ve argo ifadelerden de yararlanarak hicvetmişlerdir. Bu çalışmada divan şairlerinin kaleme aldığı şehir hicivlerinin tespit ettiğimiz örnekleri kısaca tanıtılmış ve XVIII. yüzyıl şairlerinden Arpaemîni-zâde Mustafa Samî’nin, Edirne’ye ilişkin olumsuz duygularıyla kış mevsiminin olumsuz

  2. Positron-annihilation 2D-ACAR measurements in the incommensurately modulated high-Tc superconductor Bi2Sr2CaCu2O8+x

    International Nuclear Information System (INIS)

    Mijnarends, P.E.; Melis, A.F.J.; Weeber, A.W.; Menovsky, A.A.; Kadowaki, K.; National Research Inst. for Metals, Tsukuba, Ibaraki

    1990-12-01

    Measurements are presented of the two-dimensional angular correlation of annihilation radiation (2D-ACAR) in a single crystal of approximate composition Bi 2 Sr 2 CaCu 2 O 8+x (T c =85 K) at 6 K and 92 K. Data taken with projection along the c axis show a strong C 2v symmetry due to the presence of an incommensurate modulation with wave vector q in the crystal structure, together with considerable fine-structure. It is shown theoretically that the modulation should cause images of the Fermi surface displaced over an integer times q relative to the usual high-momentum components. An analysis of the behaviour of the fine-structure in the 2D-ACAR distribution shows that many peaks change in intensity and width but little in position T is raised from 6 to 92 K. (author). 32 refs.; 6 figs

  3. a Positron 2D-ACAR Study of the Silicon-Dioxide Interface and the Point Defects in the Semi-Insulating Gallium Arsenide

    Science.gov (United States)

    Peng, Jianping

    The SiO_2-Si system has been the subject of extensive study for several decades. Particular interest has been paid to the interface between Si single crystal and the amorphous SiO_2 which determines the properties and performances of devices. This is significant because of the importance of Si technology in the semiconductor industry. The development of the high-intensity slow positron beam at Brookhaven National Laboratory make it possible to study this system for the first time using the positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) technique. 2D-ACAR is a well established and is a non-destructive microscopic probe for studying the electronic structure of materials, and for doing the depth-resolved measurements. Some unique information was obtained from the measurements performed on the SiO_2-Si system: Positronium (Ps) atoms formation and trapping in microvoids in both oxide and interface regions; and positron annihilation at vacancy-like defects in the interface region which can be attributed to the famous Pb centers. The discovery of the microvoids in the interface region may have some impact on the fabrication of the next generation electronic devices. Using the conventional 2D-ACAR setup with a ^{22}Na as positron source, we also studied the native arsenic (As) vacancy in the semi -insulating gallium-arsenide (SI-GaAs), coupled with in situ infrared light illumination. The defect spectrum was obtained by comparing the spectrum taken without photo -illumination to the spectrum taken with photo-illumination. The photo-illumination excited electrons from valence band to the defect level so that positrons can become localized in the defects. The two experiments may represent a new direction of the application of positron 2D-ACAR technique on the solid state physics and materials sciences.

  4. Surfaces of nanomaterials for sustainable energy applications: thin-film 2D-ACAR and PALS studies

    Science.gov (United States)

    Barbiellini, B.; Chai, L.; Al-Sawai, W.; Eijt, S. W. H.; Mijnarends, P. E.; Schut, H.; Gao, Y.; Houtepen, A. J.; Ravelli, L.; Egger, W.; van Huis, M. A.; Bansil, A.

    2013-03-01

    Positron (e+) annihilation spectroscopy is one of only a few techniques to probe the surfaces of nanoparticles. We investigated thin films of PbSe colloidal semiconductor nanocrystals (NCs) in the range 2-10 nm as prospective highly efficient absorbers for solar cells. We compare and contrast our findings with previous studies on CdSe NCs. Evidence obtained from our e+ lifetime spectroscopy study using the PLEPS spectrometer shows that 90-95% of the implanted positrons are effectively trapped and confined at the surfaces of these NCs. The remaining 5-10% of the e+ annihilate in the relatively large oleic acid ligands, in fair agreement with the estimated positron stopping power of the PbSe nanoparticle ``core'' relative to the ligand ``shell.'' 2D-ACAR measurements on the same set of films using the low-energy e+ beam POSH showed that the e+ wavefunction at the surfaces of the PbSe NCs is more localized than for the case of CdSe NCs. Comparison with calculated e+ - e- momentum densities indicates a Pb deficiency at the surfaces of the PbSe NCs, which correlates with e+ lifetime and the NCs morphology. Work supported in part by the US Department of Energy.

  5. Flora y vegetación en tres localidades de una cuenca costeña: río Acarí, provincia de Caravelí (Arequipa, Perú)

    NARCIS (Netherlands)

    Montesinos, D.B.; Mondragon, L.P.

    2014-01-01

    We studied the floristic composition and vegetation of the Acarí River basin and boundaries, located in Caravelí province at the west of the department of Arequipa, and performed between 2006 and 2013. A total of 86 vascular species were identified from 38 families. As for the life forms, they were

  6. A pesca e o conhecimento ecológico local dos pescadores de acará-disco (Symphysodon aequifasciatus, Pellegrin 1904: Cichlidae na Reserva de Desenvolvimento Sustentável Piagaçu-Purus, baixo rio Purus, Brasil

    Directory of Open Access Journals (Sweden)

    Felipe Rossoni

    Full Text Available O acará-disco (Symphysodon aequifasciatus, Pellegrin 1904, peixe endêmico da bacia amazônica, é uma das espécies ornamentais mais conhecidas do mundo. Apesar disso, informações sobre a explotação desse animal em vida livre são quase inexistentes na literatura científica. Nesse artigo, a pesca de pequena escala do acará-disco na Reserva de Desenvolvimento Sustentável Piagaçu-Purus (RDS-PP, baixo rio Purus, Amazonas, é caracterizada com base em entrevistas estruturadas e abertas com pescadores e habitantes, bem como em observações de campo. A pesca do acará-disco é sazonal, ocorrendo durante o período de seca. É realizada por pescadores locais, utilizando atratores de pesca e uma técnica de detecção e estimativa de abundância por mergulho em apneia. O armazenamento local é feito em tanques de madeira e os peixes são transportados em recipientes plásticos para distribuição nos mercados regionais por meio de barcos dos próprios pescadores, barcos de linha ou jangadas. Os peixes são vendidos para empresas exportadoras especializadas de Manaus. Neste estudo, descrevemos o conhecimento ecológico local dos pescadores de acará-disco na RDS-PP e discutimos sua importância para a gestão da pesca nessa unidade de conservação.

  7. Halveti-Şâbânî Şeyhi Mustafa Kemâleddîn Bekrî ve Hediyyetü’l-Ahbâb Adlı Eseri

    Directory of Open Access Journals (Sweden)

    Halim Gül

    2013-03-01

    Full Text Available AbstractThis article studies the life and woks of Kemaleddin Bekrî, who affiliated himself to Khalvati-Shabani Sheikh Abdullatîf b. Hüsameddîn el-Halebî, and who was growed up under Abd al-Ghani al-Nabulsi’s control. His work “Hadiyyat al-Ahbab fi ma li’l-Khalveti min al-Şuruti va’l-Adab”, which explains the conditions and rules of “khalvet” was also studied. The work consists of preface, eight parts and an epilogue and all parts examined in detail.ÖzetBu makalede, Abdülganî Nablusî’nin (ö.1143/1730 gözetiminde yetişen, halvetî-Şabânî şeyhi Abdullatîf b. Hüsameddîn el-Halebî’ye intisap eden Mustafa Kemaleddin Bekrî’nin hayatı ve eserleri incelenmiştir. Bu çerçevede onun tasavvufi bir kavram olan halvetin âdab ve şartlarını izah eden “Hediyyetü’l ahbâb fî mâ li’l-halveti mine’ş-şurûti ve’l-âdâb” adlı risalesinin incelenmesi ve değerlendirmesi üzerinde durulmuştur. Söz konusu eser, mukaddime sekiz bölüm ve bir hatimeden oluşmaktadır.Le Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî et son Traité qui s’intitule Hadiyya al-ahbâbRésuméDans cet article, on va étudier d’abord la vie et les œuvres du Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî qui a été éduqué par le célèbre soufi ‘Abd al-Ghanî Nablûsî (m. 1143/1730 et a été initié par ‘Abd al-Latîf b. Husâm al-Dîn al-Halabî. Puis, plus particulièrement, on va analyser son traité qui s’intitule ‘Hadiyya al-ahbâb fî mâ li’l-khalwatî min al-shurût wa’l-âdâb’. Ce traité – qui a été composé de dix-huit chapitres et d’une conclusion – étudie les convenances et les conditions de la retraite spirituelle, khalwa, une des notions soufies importantes

  8. Comportamento reprodutivo do acará bandeira, Pterophyllum scalare Cuvier & Valenciennes (Osteichthyes, Cichlidae Reproductive behaviour of Pterophyllum scalare Cuvier & Valenciennes (Osteichthyes, Cichlidae

    Directory of Open Access Journals (Sweden)

    Maria do Socorro R.F Cacho

    1999-01-01

    Full Text Available Acará bandeira, Pterophyllum scalare Cuvier & Valenciennes, 1831 is a Neotropical cichlid fish, which has not been studied under a scientific approach. The objective of this work was to identify and describe the reproductive behaviour involved in the various phases of its reproductive cycle, such as territorial disputes and its establishment, substrate selection for spawning, courtship and mating, selection of mate and parental care. Twenty males and ten females of the study species were observed in the laboratory, over a period of six consecutive months. Behaviour descriptions resulting from these observations were analysed and the results show that the reproductive males are very agressive in the initial phase of reproduction. Agressiveness is a constant variable in encounters between territorial fishes, and possession of territory is of fundamental importance for reproduction of this species. Males with established territories were those which very successful in atracting the females during courtship. The selection of the females were influenced by the possession of territory, the type of substrate available for spawning and the body size. The fish preferred aquatic plants with broad leaves as an adequate substrate for spawning. It was observed that there was a short-term biparental care, before the eggs hatched, during which period the males played an important role in protecting them. After the eggs hatched, the male continued to protect the hatchling in his mouth, but played a lesser role, possibly to seek other females for mating so as to increase his reproductive output. Selection of a good mate by the female and the high degree of parental care were the factors which influence the reproductive success of the study species.

  9. El quintal y las frutas: recursos económicos y alimentares en la comunidad negra de Itacoã, Acará, Pará, Brasil The home garden and fruits: economic and food resources in the black community of Itacoã, Acará, Pará, Brazil

    Directory of Open Access Journals (Sweden)

    Ricardo Scoles

    2009-03-01

    Full Text Available En este estudio, se inventariaron 46 especies de especies fructíferas en la comunidad negra de Itacoã, Acará, Pará, situada a pocos kilómetros de la ciudad de Belem en el Estuario Amazónico. De igual manera se investigó las diversas actividades productivas desarrolladas por las familias y su relación con la generación de renta. Los principales métodos usados en el trabajo fueron las entrevistas y la visita a los quintales y otras áreas de producción de frutas (várzeas y purmas para identificación y localización de las especies fructíferas. Existe alta diversidad de frutas en todo el territorio, especialmente en los quintales, con abundancia de especies de interés nutricional y/o comercial e importancia de la comercialización de esta producción como fuente de recursos económicos para las familias residentes. De hecho, para el 28% de las unidades familiares, la principal fuente de ingresos anuales es la venta de frutas regionales, a pesar de su marcada estacionalidad, con picos de fructificación durante el período más lluvioso del año. Por último, este estudio reafirma al quintal como modalidad de sistema agroforestal tradicional con bajo uso de insumos, alta diversidad de especies útiles y su múltiple funcionalidad: producción de frutas de origen extractivo, garantía de ingresos monetarios, seguridad alimentar y mantenimiento de relaciones de intercambio no monetario entre los comunitarios.In this study, 46 fruit-bearing species were inventoried in the black community of Itacoã, Acará ( Pará, Brazil, a few kilometers from the city of Belém in the Amazon estuary. The various productive activities carried out by families and their relationship to income generation were also investigated. The main methods used were interviews and visits to home gardens and other fruit production areas (floodplain forests and fallows, in order to identify and locate the fruit-bearing species. The main findings were: a high fruit

  10. AS CAUSAS DA EVASÃO ESCOLAR: estudo de caso de uma escola pública de Ensino Fundamental no município de Acará – PA

    Directory of Open Access Journals (Sweden)

    Marcos Jonatas Damasceno da Silva

    2017-03-01

    La educación brasileña presenta varios problemas y uno que más afecta a la escuela en Brasil es el absentismo escolar, como todos los años, en nuestras escuelas, un gran número de estudiantes que comienzan el año escolar y no concluye por varias razones. Este estudio tiene como objetivo identificar las principales razones por las cuales los estudiantes de cuatro clases de este deporte Educación de los Jóvenes y Adultos (EJA de la educación primaria en una escuela pública en el municipio de Acará, en el estado de Pará, no completar el año escolar 2015. En este sentido, se llevó a cabo una encuesta en los cuatro grupos, a saber, 3ª Etapa 01, 3ª Etapa 02, 4ª Etapa 01 y 4ª Etapa 02. Esta encuesta se realizó con 50 estudiantes escaparon universo. Los resultados mostraron que el 34% de los estudiantes entrevistados, la necesidad de trabajo fue la razón por no haber terminado el año escolar 2015; al 26% la razón fue la falta de maestros adecuados golpea la categoría; otro 26%, fue la falta de interés de los propios estudiantes para dar continuidad a los estudios y el 14% de los estudiantes, la causa por no haber completado el ciclo escolar fueron las dificultades en el seguimiento de los contenidos impartidos por los profesores. Por lo tanto, se necesitan esfuerzos en el tratamiento de este problema ya no puede limitarse a la clase y el profesor, pero deben compartirse de manera que pueda reducir el abandono escolar a través de los esfuerzos conjuntos del estado, la familia, el estudiante y la facultad. Palabras clave: Educación brasileña; Educación de los Jóvenes y Adultos; Abandono Escolar.

  11. Isolation and characterization of hemolytic bacteria Fish disc and Neon RainbowIsolamento e caracterização de bactérias hemolíticas de Acará Disco e Neon Arco-Íris

    Directory of Open Access Journals (Sweden)

    José Luiz Pedreira Mouriño

    2012-05-01

    Full Text Available The aim of this study was to isolate, identify and determine the ability of potential pathogenic bacteria hemolytic mite Disco (Symphysodon discus and Neon Rainbow (Melanotaenia praecox, and define which of the antibiotic Trimethoprim, Florfenicol, Chloramphenicol, Norfloxacin, Erythromycin, Bacitracin, Enrofloxacin, Tetracycline, and Furazolidone Clindamycin has better inhibitory effect in vitro, and determine the minimum inhibitory concentration (MIC for Chloramphenicol, Norfloxacin, Erythromycin and Enrofloxacin. In an outbreak of ornamental fish deaths were isolated nine strains of Gram negative, hemolytic where 3 were identified, two as Vibrio cholerae and one as Citrobacter braakii. With these strains were performed antibiogram and was determined the minimum inhibitory concentration at two different temperatures (22 and 30 ° C. Antibiotics Enrofloxacin, Norfloxacin, florfenicol, chloramphenicol and trimethoprim showed the best results in vitro inhibition against the Vibrio cholerae, and Citrobacter braakii. The MIC increased in 30 ° C for erythromycin and enrofloxacin against pathogens, while for Florfenicol and norfloxacin the MIC was not influenced by temperature.O objetivo deste estudo foi isolar, identificar e determinar a capacidade hemolítica de possíveis bactérias patogênicas do Acará Disco (Symphysodon discus e Neon Arco-íris (Melanotaenia praecox, e definir qual o antibiótico entre Trimetoprim, Florfenicol, Cloranfenicol, Norfloxacina, Eritromicina, Bacitracina, Enrofloxacina, Tetraciclina, Furazolidona e Clindamicina possui melhor efeito inibitório in vitro, e determinar a concentração inibitória mínima (MIC para Cloranfenicol, Norfloxacina, Eritromicina e Enrofloxacina. Em um surto de mortalidade de peixes ornamentais foram isoladas nove cepas de bactérias Gram negativas, onde três hemolíticas foram identificadas, duas como Vibrio cholerae e uma como Citrobacter braakii. Com estas foram realizados antibiogramas

  12. Human Papilloma Virus and HPV vaccine knowledge among Mustafa Kemal University Medical Students

    Directory of Open Access Journals (Sweden)

    Raziye Keskin Kurt

    2014-02-01

    Full Text Available Background: Human papilloma virus (HPV is regarded as the main cause in the etiology of cervical cancer. The purpose of our study is to assess the knowledge of medical students about HPV vaccine and to evaluate their opinion on this subject.   Material and Method: The study population consisted of 488 medical students. The survey was composed of questions intended   to obtain information about transmission route of HPV, types of HPV, role of HPV in cervical cancer, whether HPV is treatable or not, which types of HPV the HPV vaccine prevents, the age groups HPV vaccine is administered, the opinions on HPV vaccine and sufficiency of public health, whether female students have underwent vaccination and if not what their drawbacks are.   Results: Mean age of the students participating in the study was 21±4 and 58 % of the patients were female. Out of 448 medical students, 60% of them did not know that HPV was a sexually transmitted disease. Only 55% students knew about the association of HPV with cervical cancer and 52% participants stated that HPV vaccine could not be preventive against cervical cancer. None of female students had been immunized and 67% of female students did not consider getting immunized. Among those who did not consider getting immunized, 70% said they had worries about the safety of the vaccine. Conclusion: Our study results revealed that the knowledge of medical students about HPV is satisfactory, however their knowledge about HPV vaccine, immunization status and desire to be immunized were little.

  13. Gene : CBRC-ACAR-01-0971 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available vectensis] 3e-11 32% MLFLLEISTCAPWRLYGYLPPVMLFLLEISTCAPWRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLEISTC...APVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLITVAPAFRLI ...

  14. Gene : CBRC-ACAR-01-0755 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tical protein FLJ13236 [Homo sapiens] gb|AAH33236.1| Hypothetical protein FLJ13236 [Homo sapiens] gb|EAW5806...6.1| hypothetical protein FLJ13236, isoform CRA_a [Homo sapiens] gb|EAW58067.1| hypothetical protein FLJ1323...LGGPVGLHHLYLGRDNHALLWMLTLGGFGFGWLWELWMLPGWVAQANHPLEKRHNDPPSFNPVRFLGQALVGIYFGLVALVGLSTLPGFYILALPLAVGLGVHLVSAVGNQTSDLQATLMAAFVTAPI...6, isoform CRA_a [Homo sapiens] 2e-95 61% MWDATFYYSFLLRTSASQQDVPPFTVMAKRLLVAVAFWA

  15. Gene : CBRC-ACAR-01-0455 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available agalactiae PG2] 0.014 30% MLQLGHFGPLFRLVWSHFYCTIFIGLEPFLLYCTKIKLLLLLLLLILLLLILLLSWFIVAIILVGLEPFLSHWVIPVAFGSCLLLTWVGLEPFL...LLWVIAGPHLYWTRAISIALGHFLATVFIESEPFLLSWFIVATILVGLEPFLLPLHISIVFGSSWFTIW...VGSEPFRLHCPPLGLGWSPFCCVGSSLAHLFSGDQGHSYCIGLFLLHLGHVSSLLWWAWIHFYCIWVILVHHLGWVRAISVALSAFRIGLEPFLLRWVIFGPPFQWRS

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-0651 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive protein p120) emb|CAA71610.1| ankyrin-like protein [Homo sapiens] O75762 0.46 27% ...

  17. Development of 2D-ACAR apparatus using position-sensitive photomultiplier tubes

    Energy Technology Data Exchange (ETDEWEB)

    Nagai, Yasuyoshi; Saito, Haruo; Iwata, Tetsuya; Nagashima, Yasuyuki; Hyodo, Toshio [Tokyo Univ. (Japan). Coll. of Arts and Sciences; Uchida, Hiroshi; Omura, Tomohide

    1997-03-01

    A new two-dimensional angular correlation of annihilation radiation apparatus is described. Position-sensitive photomultiplier tubes coupled with two-dimensional arrays of small BGO scintillator blocks make simple and compact position-sensitive {gamma}-ray detectors. With a sample-detector distance of 5m, an angular resolution of 1.1 mrad FWHM and a coincidence count rate of {approx}2.4 c.p.s. per mCi are obtained. Its performance is demonstrated by the result of a test measurement for KI crystal in which non-localized positronium exists at low temperatures. (author)

  18. Comparison of Anger camera and BGO mosaic position-sensitive detectors for `Super ACAR`. Precision electron momentum densities via angular correlation of annihilation radiation

    Energy Technology Data Exchange (ETDEWEB)

    Mills, A.P. Jr. [Bell Labs. Murray Hill, NJ (United States); West, R.N.; Hyodo, Toshio

    1997-03-01

    We discuss the relative merits of Anger cameras and Bismuth Germanate mosaic counters for measuring the angular correlation of positron annihilation radiation at a facility such as the proposed Positron Factory at Takasaki. The two possibilities appear equally cost effective at this time. (author)

  19. CARMINIC ACID EXTRACTION FROM USING COCHINEAL CLEANER TECHNOLOGY

    OpenAIRE

    Erazo, Erazo; Cárdenas Ruiz, R.; Woolcott Hurtado, J.; y Caso Huamaní, J. C.; J., M.

    2014-01-01

    We present a new process for the extraction of carminic acid (ACAR) from cochineal using mass- separating agent R300 (MSA R300) and an organic solvent with affinity only with the ACAR. En este trabajo se presenta un nuevo procedimiento para la extracción de ácido carmínico (ACAR) a partir de la cochinilla utilizando un agente de separación másico R300 (MSA R300) y un solvente orgánico con afinidad sólo con el ACAR.

  20. Evaluation of Chromosomal Abnormalities and Common ...

    African Journals Online (AJOL)

    Evaluation of Chromosomal Abnormalities and Common Trombophilic Mutations in Cases with Recurrent Miscarriage. Ahmet Karatas, Recep Eroz, Mustafa Albayrak, Tulay Ozlu, Bulent Cakmak, Fatih Keskin ...

  1. Iraanis toimuvad presidendivalimised / Kalev Kask

    Index Scriptorium Estoniae

    Kask, Kalev

    2005-01-01

    Iraanis toimuvatest presidendivalimistest. Kaheksast kandidaadist on parimad väljavaated presidendiks saada endisel presidendil Akbar Hashemi Rafsanjanil ja endisel kultuuri- ja kõrgharidusministril Mustafa Moinil

  2. Usher syndrome associated with Fuchs’ heterochromic uveitis: a case report

    OpenAIRE

    Turan-Vural, Ece; Turan-Vural,Ece; TORUN ACAR,Banu; Tükenmez,Nejla

    2011-01-01

    Ece Turan-Vural, Banu Torun-Acar, Nejla Tükenmez, M Şahin Sevim, Bulent Buttanri, Suphi AcarOphthalmology Clinic, Haydarpasa Numune Education and Research Hospital, Istanbul, TurkeyAbstract: We report a case of Usher syndrome in association with unilateral Fuchs' heterochromic uveitis.Keywords: Fuchs’ heterochromic uveitis, Usher syndrome, deafness, blindness

  3. Usher syndrome associated with Fuchs’ heterochromic uveitis: a case report

    Directory of Open Access Journals (Sweden)

    Turan-Vural E

    2011-04-01

    Full Text Available Ece Turan-Vural, Banu Torun-Acar, Nejla Tükenmez, M Şahin Sevim, Bulent Buttanri, Suphi AcarOphthalmology Clinic, Haydarpasa Numune Education and Research Hospital, Istanbul, TurkeyAbstract: We report a case of Usher syndrome in association with unilateral Fuchs' heterochromic uveitis.Keywords: Fuchs’ heterochromic uveitis, Usher syndrome, deafness, blindness

  4. International Journal of Medicine and Health Development - Vol 16 ...

    African Journals Online (AJOL)

    Financing and delivery mechanisms for mosquito control tools in Sudan: A Strengths Weaknesses Opportunities and Threats (SWOT) analysis. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. OE Onwujekwe, OP Ezeoke, SH Mustafa, BSC Uzochukwu, OC Onwujekwe, M Mustafa, ...

  5. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Mustafa Salti. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 239-247 Research Articles. Møller's energy in the dyadosphere of a charged black hole · Oktay Aydogdu Mustafa Salti · More Details Abstract Fulltext PDF. We use the Møller ...

  6. Correction to

    DEFF Research Database (Denmark)

    Hakyemez, I N; Erdem, H; Beraud, G

    2018-01-01

    In the original version of this article, Mustafa Sunbul was not included in the list of authors for this article. The name has been added accordingly.......In the original version of this article, Mustafa Sunbul was not included in the list of authors for this article. The name has been added accordingly....

  7. Quality of School Work Life of Public School Teachers: Cases from Turkey and Pakistan

    Science.gov (United States)

    Akram, Muhammad; Ilgan, Abdurrahman; Ozu, Oyku; Shah, Ashfaque Ahmad

    2017-01-01

    The Quality of Work life (QWL) is the employees' feeling or perception of being comfortable with their work. The objective of the present study was to compare Quality of School Work Life (QSWL) of public school teachers from Turkey and Pakistan. A QSWL scale developed by Ilgan, Ata, Zepeda and Ozu-Cengiz (2014) having 30 items was used as the…

  8. Electron-positron momentium distribution measurements of high-Tc superconductors and related systems

    International Nuclear Information System (INIS)

    Wachs, A.L.; Turchi, P.E.A.; Howell, R.H.; Jean, Y.C.; Fluss, M.J.; West, R.N.; Kaiser, J.H.; Rayner, S.; Haghighi, H.; Merkle, K.L.; Revcolevshi, A.; Wang, Z.Z.

    1989-01-01

    The authors discuss measurements of the 2D-angular correlation of positron annihilation radiation (ACAR) in La 2 CuO 4 , YBa 2 Cu 3 O 7 (YBCO), and NiO. The measurements for NiO are the first such 2D-ACAR measurements; the YBCO results are of a higher statistical quality than previously reported. The data are compared with complementary theoretical calculations and with each other. The authors discuss the implication of this analysis for ACAR studies of similar and related systems

  9. 12th WINFOCUS world congress on ultrasound in emergency and critical care.

    Science.gov (United States)

    Acar, Yahya; Tezel, Onur; Salman, Necati; Cevik, Erdem; Algaba-Montes, Margarita; Oviedo-García, Alberto; Patricio-Bordomás, Mayra; Mahmoud, Mustafa Z; Sulieman, Abdelmoneim; Ali, Abbas; Mustafa, Alrayah; Abdelrahman, Ihab; Bahar, Mustafa; Ali, Osama; Lester Kirchner, H; Prosen, Gregor; Anzic, Ajda; Leeson, Paul; Bahreini, Maryam; Rasooli, Fatemeh; Hosseinnejad, Houman; Blecher, Gabriel; Meek, Robert; Egerton-Warburton, Diana; Ćuti, Edina Ćatić; Belina, Stanko; Vančina, Tihomir; Kovačević, Idriz; Rustemović, Nadan; Chang, Ikwan; Lee, Jin Hee; Kwak, Young Ho; Kim, Do Kyun; Cheng, Chi-Yung; Pan, Hsiu-Yung; Kung, Chia-Te; Ćurčić, Ela; Pritišanac, Ena; Planinc, Ivo; Medić, Marijana Grgić; Radonić, Radovan; Fasina, Abiola; Dean, Anthony J; Panebianco, Nova L; Henwood, Patricia S; Fochi, Oliviero; Favarato, Moreno; Bonanomi, Ezio; Tomić, Ivan; Ha, Youngrock; Toh, Hongchuen; Harmon, Elizabeth; Chan, Wilma; Baston, Cameron; Morrison, Gail; Shofer, Frances; Hua, Angela; Kim, Sharon; Tsung, James; Gunaydin, Isa; Kekec, Zeynep; Ay, Mehmet Oguzhan; Kim, Jinjoo; Kim, Jinhyun; Choi, Gyoosung; Shim, Dowon; Lee, Ji-Han; Ambrozic, Jana; Prokselj, Katja; Lucovnik, Miha; Simenc, Gabrijela Brzan; Mačiulienė, Asta; Maleckas, Almantas; Kriščiukaitis, Algimantas; Mačiulis, Vytautas; Macas, Andrius; Mohite, Sharad; Narancsik, Zoltan; Možina, Hugon; Nikolić, Sara; Hansel, Jan; Petrovčič, Rok; Mršić, Una; Orlob, Simon; Lerchbaumer, Markus; Schönegger, Niklas; Kaufmann, Reinhard; Pan, Chun-I; Wu, Chien-Hung; Pasquale, Sarah; Doniger, Stephanie J; Yellin, Sharon; Chiricolo, Gerardo; Potisek, Maja; Drnovšek, Borut; Leskovar, Boštjan; Robinson, Kristine; Kraft, Clara; Moser, Benjamin; Davis, Stephen; Layman, Shelley; Sayeed, Yusef; Minardi, Joseph; Pasic, Irmina Sefic; Dzananovic, Amra; Pasic, Anes; Zubovic, Sandra Vegar; Hauptman, Ana Godan; Brajkovic, Ana Vujaklija; Babel, Jaksa; Peklic, Marina; Radonic, Vedran; Bielen, Luka; Ming, Peh Wee; Yezid, Nur Hafiza; Mohammed, Fatahul Laham; Huda, Zainal Abidin; Ismail, Wan Nasarudin Wan; Isa, W Yus Haniff W; Fauzi, Hashairi; Seeva, Praveena; Mazlan, Mohd Zulfakar

    2016-09-01

    A1 Point-of-care ultrasound examination of cervical spine in emergency departmentYahya Acar, Onur Tezel, Necati SalmanA2 A new technique in verifying the placement of a nasogastric tube: obtaining the longitudinal view of nasogastric tube in addition to transverse view with ultrasoundYahya Acar, Necati Salman, Onur Tezel, Erdem CevikA3 Pseudoaneurysm of the femoral artery after cannulation of a central venous line. Should we always use ultrasound in these procedures?Margarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA4 Ultrasound-guided supraclavicular subclavian vein catheterization. A novel approach in emergency departmentMargarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA5 Clinical ultrasound in a septic and jaundice patient in the emergency departmentMargarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA6 Characterization of the eyes in preoperative cataract Saudi patients by using medical diagnostic ultrasoundMustafa Z. Mahmoud, Abdelmoneim SuliemanA7 High-frequency ultrasound in determining the causes of acute shoulder joint painMustafa Z. MahmoudA8 Teaching WINFOCUS Ultrasound Life Support Basic Level 1 for Providers in resource-limited countriesAbbas Ali, Alrayah Mustafa, Ihab Abdelrahman, Mustafa Bahar, Osama Ali, H. Lester Kirchner, Gregor ProsenA9 Changes of arterial stiffness and endothelial function during uncomplicated pregnancyAjda Anzic, Paul LeesonA10 Cardiovascular haemodynamic properties before, during and after pregnancyAjda Anzic, Paul LeesonA11 An old man with generalized weaknessMaryam Bahreini, Fatemeh RasooliA12 Ultrasonography for non-specific presentations of abdominal painMaryam Bahreini, Houman HosseinnejadA13 Introduction of a new imaging guideline for suspected renal colic in the emergency department: effect on CT Urogram utilisationGabriel Blecher, Robert Meek, Diana Egerton-WarburtonA14 Transabdominal ultrasound screening for pancreatic cancer in Croatian military

  10. Window least squares method applied to statistical noise smoothing of positron annihilation data

    International Nuclear Information System (INIS)

    Adam, G.; Adam, S.; Barbiellini, B.; Hoffmann, L.; Manuel, A.A.; Peter, M.

    1993-06-01

    The paper deals with the off-line processing of experimental data obtained by two-dimensional angular correlation of the electron-positron annihilation radiation (2D-ACAR) technique on high-temperature superconductors. A piecewise continuous window least squares (WLS) method devoted to the statistical noise smoothing of 2D-ACAR data, under close control of the crystal reciprocal lattice periodicity, is derived. Reliability evaluation of the constant local weight WLS smoothing formula (CW-WLSF) shows that consistent processing 2D-ACAR data by CW-WLSF is possible. CW-WLSF analysis of 2D-ACAR data collected on untwinned Y Ba 2 Cu 3 O 7-δ single crystals yields significantly improved signature of the Fermi surface ridge at second Umklapp processes and resolves, for the first time, the ridge signature at third Umklapp processes. (author). 24 refs, 9 figs

  11. Backup_of_Oke and Ayodele (17)

    African Journals Online (AJOL)

    Administrator

    In this paper, soil samples were collected from selected locations in Nigeria. Geotechnical ..... mathematical model, Taylor, Cassangrande, Acar et al, Azzouz et al, .... Figure 1(a) Particle Size Distribution of Soil Sample A. 60. 65. 70. 75. 80. 85.

  12. Impact of physico-chemical parameters on the physiological growth ...

    African Journals Online (AJOL)

    Impact of physico-chemical parameters on the physiological growth of Arthrospira (Spirulina platensis) exogenous strain UTEXLB2340. Yahia Mustafa A Fagiri, Aisha Salleh, Saifeldin Ahmed F El-Nagerabi ...

  13. Modified geometry three-layered tablet as a platform for class II ...

    African Journals Online (AJOL)

    Modified geometry three-layered tablet as a platform for class II drugs zero-order release system. Abdullah Monahi Albogami, Mustafa E. Omer, Abdulkareem M. Al Bekairy, Abdulmalik Alkatheri, Alaa Eldeen B. Yassin ...

  14. The comparison of high and standard definition computed ...

    African Journals Online (AJOL)

    The comparison of high and standard definition computed tomography techniques regarding coronary artery imaging. A Aykut, D Bumin, Y Omer, K Mustafa, C Meltem, C Orhan, U Nisa, O Hikmet, D Hakan, K Mert ...

  15. African Journal of Biotechnology - Vol 11, No 101 (2012)

    African Journals Online (AJOL)

    Protection of melon plants against Cucumber mosaic virus infection using Pseudomonas fluorescens biofertilizer · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Rakib A Al-Ani, Mustafa A Adhab, 16579-16585 ...

  16. Indications, outcome and complications of ureteroscopy, at Gezira ...

    African Journals Online (AJOL)

    Indications, outcome and complications of ureteroscopy, at Gezira Hospital for renal diseases and surgery, Sudan: a seven years 'experience. Mustafa O. Mansour, Sami M. Taha, Abd Elmahmood Abdallah, Mohammed El Imam ...

  17. The initial experience of trans-rectal ultrasound and biopsy in ...

    African Journals Online (AJOL)

    The initial experience of trans-rectal ultrasound and biopsy in diagnosis of carcinoma prostate in Gezira Hospital for Renal Disease and Surgery (GHRDS). Walaa Eldin Ibraheem, Sami Mahjoub Taha, Mustafa Omran Mansour, Mohammed El Imam Mohamed Ahmed ...

  18. Väike juveel Euroopa veere pääl / Thea Karin

    Index Scriptorium Estoniae

    Karin, Thea

    2012-01-01

    Küprose ajaloost, seal viibinud kuulsustest (Guido von Lusignan, Leonardo da Vinci, William Shakespeare, Lala Mustafa Paşa, Namik Kemal, Lawrence Durrell, Francis II Rakoczi) ning vaatamisväärsustest UNESCO pärandinimekirja kuuluvas Afroditele pühendatud Paphoses, pealinnas Nikosias, Girnes ja Famagustas, kus asuvad ka Shakespeare'i inspireerinud Othello torn ja Püha Nikolause katedraal, mis nüüd on Lala-Mustafa-Pasha mošee

  19. Microcomputer interfacing and applications

    CERN Document Server

    Mustafa, M A

    1990-01-01

    This is the applications guide to interfacing microcomputers. It offers practical non-mathematical solutions to interfacing problems in many applications including data acquisition and control. Emphasis is given to the definition of the objectives of the interface, then comparing possible solutions and producing the best interface for every situation. Dr Mustafa A Mustafa is a senior designer of control equipment and has written many technical articles and papers on the subject of computers and their application to control engineering.

  20. Comparison of three methods of tonometry in normal subjects: Goldmann applanation tonometer, non-contact airpuff tonometer, and Tono-Pen XL

    OpenAIRE

    Yilmaz, Ihsan; Altan,Cigdem; Aygit,Ebru Demet; Alagoz,Cengiz; Baz,Okkes; Ahmet,Sibel; Urvasizoglu,Semih; Yaşa,Dilek; Demirok,Ahmet

    2014-01-01

    Ihsan Yilmaz, Cigdem Altan, Ebru Demet Aygit, Cengiz Alagoz, Okkes Baz, Sibel Ahmet, Semih Urvasizoglu, Dilek Yasa, Ahmet DemirokBeyoglu Eye Training and Research Hospital, Istanbul, TurkeyObjective: We aimed to compare intraocular pressure (IOP) measurements via three different tonometers: the Goldmann applanation tonometer (GAT), the Tono-Pen® XL (TPXL), and a non-contact airpuff tonometer (NCT).Methods: This was a cross-sectional study of 200 eyes from 20...

  1. An abdominal tuberculosis case mimicking an abdominal mass

    African Journals Online (AJOL)

    An abdominal tuberculosis case mimicking an abdominal mass. Derya Erdog˘ an a. , Yasemin Ta ¸scı Yıldız b. , Esin Cengiz Bodurog˘lu c and Naciye Go¨nu¨l Tanır d. Abdominal tuberculosis is rare in childhood. It may be difficult to diagnose as it mimics various disorders. We present a 12-year-old child with an unusual ...

  2. Automated Filtering of Common Mode Artifacts in Multi-Channel Physiological Recordings

    Science.gov (United States)

    Kelly, John W.; Siewiorek, Daniel P.; Smailagic, Asim; Wang, Wei

    2014-01-01

    The removal of spatially correlated noise is an important step in processing multi-channel recordings. Here, a technique termed the adaptive common average reference (ACAR) is presented as an effective and simple method for removing this noise. The ACAR is based on a combination of the well-known common average reference (CAR) and an adaptive noise canceling (ANC) filter. In a convergent process, the CAR provides a reference to an ANC filter, which in turn provides feedback to enhance the CAR. This method was effective on both simulated and real data, outperforming the standard CAR when the amplitude or polarity of the noise changes across channels. In many cases the ACAR even outperformed independent component analysis (ICA). On 16 channels of simulated data the ACAR was able to attenuate up to approximately 290 dB of noise and could improve signal quality if the original SNR was as high as 5 dB. With an original SNR of 0 dB, the ACAR improved signal quality with only two data channels and performance improved as the number of channels increased. It also performed well under many different conditions for the structure of the noise and signals. Analysis of contaminated electrocorticographic (ECoG) recordings further showed the effectiveness of the ACAR. PMID:23708770

  3. Automated filtering of common-mode artifacts in multichannel physiological recordings.

    Science.gov (United States)

    Kelly, John W; Siewiorek, Daniel P; Smailagic, Asim; Wang, Wei

    2013-10-01

    The removal of spatially correlated noise is an important step in processing multichannel recordings. Here, a technique termed the adaptive common average reference (ACAR) is presented as an effective and simple method for removing this noise. The ACAR is based on a combination of the well-known common average reference (CAR) and an adaptive noise canceling (ANC) filter. In a convergent process, the CAR provides a reference to an ANC filter, which in turn provides feedback to enhance the CAR. This method was effective on both simulated and real data, outperforming the standard CAR when the amplitude or polarity of the noise changes across channels. In many cases, the ACAR even outperformed independent component analysis. On 16 channels of simulated data, the ACAR was able to attenuate up to approximately 290 dB of noise and could improve signal quality if the original SNR was as high as 5 dB. With an original SNR of 0 dB, the ACAR improved signal quality with only two data channels and performance improved as the number of channels increased. It also performed well under many different conditions for the structure of the noise and signals. Analysis of contaminated electrocorticographic recordings further showed the effectiveness of the ACAR.

  4. Off-line analysis of positron annihilation spectra. I. Signature of crystal symmetry

    International Nuclear Information System (INIS)

    Adam, Gh.; Adam, S.

    1997-01-01

    While the technique of 2-D angular correlation of the electron-positron annihilation radiation (2D-ACAR) yields data in the laboratory frame, consistent off-line data analysis requires their reformulation in the crystal frame. In the case of an n-axis projected 2D-ACAR spectrum (where n denotes a principal crystallographic axis) of a high-T c superconductor, the crystal frame derivation needs enhancement of information on spectrum symmetry. The concept of signature of crystal symmetry (SCS) in a 2D-ACAR histogram discussed in this paper is a basic ingredient to the consistent solution of the problem. The SCS in a row 2D-ACAR histogram is defined as a collection of chi-square sums over M max + 1 sets of sites inside the detector-defined histogram plane. The number M max is fixed by choice of the principal crystallographic axis n-vector and the angular aperture of the setup. The necessity of this concept is discussed in Section 2. The correct understanding of the meaning of the SCS results heavily relies of that of the various sources contributing to the symmetry a 2D-ACAR spectrum. This point is discussed in Section 3. The quantitative definition of the SCS is detailed in Section 4. Finally, Section 5 is devoted to a short consideration of the computation of the SCS numerical values

  5. Irradiation-induced defects in graphite and glassy carbon studied by positron annihilation

    International Nuclear Information System (INIS)

    Hasegawa, M.; Kajino, M.; Kuwahara, H.; Yamaguchi, S.; Kuramoto, E.; Takenaka, M.

    1992-01-01

    ACAR and positron lifetime measurements have been made on, HOPG, isotropic fine-grained graphites, glassy carbons and C 60 /C 70 . HOPG showed a marked bimodal ACAR distribution along the c-axis. By irradiation of 1.0 X 10 19 fast neutrons/cm 2 remarkable narrowing in the ACAR curves and disappearance of the bimodal distribution were observed. Lifetime in HOPG increased from 225 psec to 289 psec (positron-lifetime in vacancies and their small clusters) by the irradiation. The irradiation on isotropic graphites and glassy carbons, however, gave slight narrowing in ACAR curves and decrease in lifetimes (360 psec → 300psec). This suggests irradiation-induced vacancy trapping in crystallites. In C 60 /C 70 powder two lifetime components were detected: τ 1 =177psec, τ 2 =403psec (I 2 =58%). The former is less than the bulk lifetime of HOPG, while the latter being very close to lifetimes in the isotropic graphites and glassy carbons. This and recent 2D-ACAR study of HOPG surface [15] strongly suggest free and defect surface states around ''soccer ball'' cages

  6. Positron annihilation study of graphite, glassy carbon and C60/C70 fullerene

    International Nuclear Information System (INIS)

    Hasegawa, Masayuki; Kajino, Masahiro; Yamaguchi, Sadae; Iwata, Tadao; Kuramoto, Eiichi; Takenaka, Minoru.

    1992-01-01

    ACAR (Angular Correlation of Annihilation Radiation) and positron lifetime measurements have been made on, HOPG (Highly Oriented Pyrolytic Graphite), isotropic fine-grained graphite, glassy carbons and C 60 /C 70 powder. HOPG showed marked bimodality along the c-axis and anisotropy in ACAR momentum distribution, which stem from characteristic annihilation between 'interlayer' positrons and π-electrons in graphite. ACAR curves of the isotropic graphite and glassy carbons are even narrower than that of HOPG perpendicular to the c-axis. Positron lifetime of 420 and 390 - 480 psec, much longer than that of 221 psec in HOPG, were observed for the isotropic graphite and glassy carbons respectively, which are due to positron trapping in structural voids in them. Positron lifetime and ACAR width (FWHM) can be well correlated to void sizes (1.7 to 5.0 nm) of glassy carbons which have been determined by small angle neutron (SAN) scattering measurements. ACAR curves and positron lifetime of C 60 /C 70 powder agree well with those of glassy carbons. This shows that positron wave functions extend, as in the voids of glassy carbons, much wider than open spaces of the octahedral interstices of the face-centered cubic (FCC) structure of C 60 crystal and strongly suggests positron trapping in the 'soccer ball' vacancy. Possible positron states in the carbon materials are discussed with a simple model of void volume-trapping. Preliminary results on neutron irradiation damage in HOPG are also presented. (author)

  7. Signature of crystal symmetry in positron annihilation data

    International Nuclear Information System (INIS)

    Adam, G.; Adam, S.

    1994-12-01

    While the technique of two-dimensional angular correlation of the electron-positron annihilation radiation (2D-ACAR) yields data in a reference frame related to detectors, data interpretation is made in a reference frame related to the crystal. The paper shows that consistent reformulation of the 2D-ACAR data in the crystal frame can be obtained from the knowledge of the signature of crystal symmetry (SCS) in the data. Derivation of the SCS over variations M-Umklapp areas of the reciprocal lattice from a rigorous definition also results in an improved a posteriori criterion concerning the twinned or untwinned nature of the crystal under investigation. The analysis of a c-projected 2D-ACAR spectrum on Y Ba 2 Cu 3 O 7-δ , accurately establishes the untwinned nature of the used crystals and yields better resolved Fermi surface ridge signatures at 2- and 3- Umklapp processes. (author). 32 refs, 4 figs, 2 tabs

  8. Cost-Effectiveness of Saxagliptin versus Acarbose as Second-Line Therapy in Type 2 Diabetes in China.

    Science.gov (United States)

    Gu, Shuyan; Zeng, Yuhang; Yu, Demin; Hu, Xiaoqian; Dong, Hengjin

    2016-01-01

    This study assessed the long-term cost-effectiveness of saxagliptin+metformin (SAXA+MET) versus acarbose+metformin (ACAR+MET) in Chinese patients with type 2 diabetes mellitus (T2DM) inadequately controlled on MET alone. Systematic literature reviews were performed to identify studies directly comparing SAXA+MET versus ACAR+MET, and to obtain diabetes-related events costs which were modified by hospital surveys. A Cardiff Diabetes Model was used to estimate the long-term economic and health treatment consequences in patients with T2DM. Costs (2014 Chinese yuan) were calculated from the payer's perspective and estimated over a patient's lifetime. SAXA+MET predicted lower incidences of most cardiovascular events, hypoglycemia events and fatal events, and decreased total costs compared with ACAR+MET. For an individual patient, the quality-adjusted life-years (QALYs) gained with SAXA+MET was 0.48 more than ACAR+MET at a cost saving of ¥18,736, which resulted in a cost saving of ¥38,640 per QALY gained for SAXA+MET versus ACAR+MET. Results were robust across various univariate and probabilistic sensitivity analyses. SAXA+MET is a cost-effective treatment alternative compared with ACAR+MET for patients with T2DM in China, with a little QALYs gain and lower costs. SAXA is an effective, well-tolerated drug with a low incidence of adverse events and ease of administration; it is anticipated to be an effective second-line therapy for T2DM treatment.

  9. An Examination of Selected Datacom Options for the Near-Term Implementation of Trajectory Based Operations

    Science.gov (United States)

    Johnson, Walter W.; Lachter, Joel B.; Battiste, Vernol; Lim, Veranika; Brandt, Summer L.; Koteskey, Robert W.; Dao, Arik-Quang V.; Ligda, Sarah V.; Wu, Shu-Chieh

    2011-01-01

    A primary feature of the Next Generation Air Transportation System (NextGen) is trajectory based operations (TBO). Under TBO, aircraft flight plans are known to computer systems on the ground that aid in scheduling and separation. The Future Air Navigation System (FANS) was developed to support TBO, but relatively few aircraft in the US are FANSequipped. Thus, any near-term implementation must provide TBO procedures for non-FANS aircraft. Previous research has explored controller clearances, but any implementation must also provide procedures for aircraft requests. The work presented here aims to surface issues surrounding TBO communication procedures for non-FANS aircraft and for aircraft requesting deviations around weather. Three types of communication were explored: Voice, FANS, and ACARS,(Aircraft Communications Addressing and Reporting System). ACARS and FANS are datacom systems that differ in that FANS allows uplinked flight plans to be loaded into the Flight Management System (FMS), while ACARS delivers flight plans as text that must be entered manually via the Control Display Unit (CDU). Sixteen pilots (eight two-person flight decks) and four controllers participated in 32 20-minute scenarios that required the flight decks to navigate through convective weather as they approached their top of descents (TODs). Findings: The rate of non-conformance was higher than anticipated, with aircraft off path more than 20% of the time. Controllers did not differentiate between the ACARS and FANS datacom, and were mixed in their preference for Voice vs. datacom (ACARS and FANS). Pilots uniformly preferred Voice to datacom, particularly ACARS. Much of their dislike appears to result from the slow response times in the datacom conditions. As a result, participants frequently resorted to voice communication. These results imply that, before implementing TBO in environments where pilots make weather deviation requests, further research is needed to develop communication

  10. Positron annihilation studies of the electronic structure and fermiology of high-Tc superconductors

    International Nuclear Information System (INIS)

    Smedskjaer, L.C.; Bansil, A.

    1993-01-01

    We discuss the application of the positron annihilation angular correlation (ACAR) spectroscopy for investigating the electronic structure and Fermiology of high-Tc superconductors, with focus on the YBa 2 Cu 3 O 7 system where most of the experimental and theoretical work has to date been concentrated. Detailed comparisons between the measured 2D-ACAR positron spectra and the corresponding band theory predictions show a remarkable agreement (for the normal state), indicating that the electronic structure and Fermi surface of this material is described reasonably by the conventional picture. (orig.)

  11. Electron-positron momentum density in TTF-TCNQ

    DEFF Research Database (Denmark)

    Ishibashi, S.; Manuel, A.A.; Hoffmann, L.

    1997-01-01

    We present measurements of the positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) in TTF-TCNQ. We report also theoretical simulations of the 2D-ACAR in which the electron wave functions were expressed as TTF or TCNQ molecular orbitals obtained from self-consistent qu...... from a study of the Kohn anomaly. We investigate also the shape and position of the Fermi surface and conclude that a simple planar Fermi surface is consistent with our measurements....

  12. Momentum density and Fermi surface of Nd2-xCexCuO4-δ

    International Nuclear Information System (INIS)

    Shukla, A.; Barbiellini, B.; Hoffmann, L.; Manuel, A.A.; Sadowski, W.; Walker, E.; Peter, M.

    1996-01-01

    High-temperature positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) measurements have recently been succesfully applied to map parts of the Fermi surface of YBa 2 Cu 3 O 7-δ . Using the same principle, we have been able to observe with a bulk sensitive method, the Fermi surface of Nd 2-x Ce x CuO 4-δ . Although positron trapping by defects and correlation effects are strong, positron 2D-ACAR measurements provide a signal from the Fermi surface which agrees with band-structure calculations, confirming earlier surface sensitive photoemission experiments. copyright 1996 The American Physical Society

  13. Walking in two worlds: From e-learning paradise to technologically locked-in

    Directory of Open Access Journals (Sweden)

    Nazime Tuncay

    2010-09-01

    Full Text Available This paper presents an in-depth comparison of the impact of digital technologies on the educational experiences of studentswithin two disparate schools: Havering College (HC, England and Cengiz Topel Industrial Vocational High School (CTIVHS,Cyprus Evidence was collected through unstructured field observations, interviews were carried ouıt. Twenty teachers and 120students, in total, contributed to the evidence base. Some interesting results include CTIVHS teachers took studentsassignments as paper work (%90 however HC teachers took students assignments as emails from Blackboard.Recommendations on how to bridge this e-learning gap are presented.

  14. Hematological Parameters in the Volatile Substance Sniffers

    OpenAIRE

    Dündaröz, Ruşen; Ceylan, Süleyman; Denli, Metin; Açıkel, Cengizhan; Balım, Elvan; Özışık, Tahir

    2009-01-01

    SüleymanDemirel Üniversitesi TIP FAKÜLTESİ DERGİSİ: 1999 Eylül; 6(3) Hematological Parameters in the Volatile Substance Sniffers Ruşen Dündaröz, Süleyman Ceylan, Metin Denli, Cengiz Han Açıkel, Elvan Balım, Tahir Özışık Abstract Glue sniffing is a frequent problem among teenagers. Various chemical substances, especially toluene and benzene, contained in the glues kave been reported to be hematotoxic. The hematological parameters of 44 healthy teenagers ~...

  15. Ramachandran and his Map

    Indian Academy of Sciences (India)

    modeling as well as development of new algorithms useful for the conformational studies. C Ramakrishnan. Introduction. Professor G N Ramachandran was one ... peptide chains. Figure 3. A system of two frans-planar peptide units linked at the central a-car- bon atom. Ramachandran angles (¢;I '1') are shown. GENERAL I ...

  16. Reader reaction on the generalized Kruskal-Wallis test for genetic association studies incorporating group uncertainty.

    Science.gov (United States)

    Wu, Baolin; Guan, Weihua

    2015-06-01

    Acar and Sun (2013, Biometrics 69, 427-435) presented a generalized Kruskal-Wallis (GKW) test for genetic association studies that incorporated the genotype uncertainty and showed its robust and competitive performance compared to existing methods. We present another interesting way to derive the GKW test via a rank linear model. © 2014, The International Biometric Society.

  17. Reader Reaction On the generalized Kruskal-Wallis test for genetic association studies incorporating group uncertainty

    OpenAIRE

    Wu, Baolin; Guan, Weihua

    2014-01-01

    Acar and Sun (2013, Biometrics, 69, 427-435) presented a generalized Kruskal-Wallis (GKW) test for genetic association studies that incorporated the genotype uncertainty and showed its robust and competitive performance compared to existing methods. We present another interesting way to derive the GKW test via a rank linear model.

  18. Search for positron localization near transition-metal solutes of negative effective charge in Ni and Cu

    International Nuclear Information System (INIS)

    Hunter, D.M.; Grynszpan, R.I.; Arrott, A.S.

    1993-01-01

    Results of an early (1973) angular correlation (ACAR) study of dilute (0.5 at.%) Cu based alloys by a Japanese group were interpreted in terms of an attraction of e + by transition metal solutes of effective negative charge. Doppler Broadening (DB) measurements reveal no such an effect for Cu(Mn) and Cu(Ni) solid solutions as well as for Ni alloys with 3d, 4d and 5d transition metal solutes (0.1 to 1.5 at.%) i.e. no evidence of e + localization near these impurities is seen. Our results strongly suggest that the ACAR results are due to the metallurgical state of the samples. In contrast, significant DB lineshape parameter variations, observed for our Ni(Zr) alloys, are attributed to positron trapping in and near Ni 5 Zr precipitates. Our DB results for a series of Ni(Au) alloys are understood in terms of a combination of the effect of an overall lattice expansion and a positron preference for clusters of Au atoms. The above comparison between DB and ACAR results is supported by our 'spin polarized' DB results for a (001) Ni single crystal which resemble those obtained by other groups using a 'spin polarized' 2D-ACAR technique. (orig.)

  19. 78 FR 14166 - Clarification of Flight, Duty, and Rest Requirements

    Science.gov (United States)

    2013-03-05

    ... electronic means, such as Aircraft Communications Addressing and Reporting System (ACARS) and cell phone... FR 28763 (May 16, 2012). E. Fatigue Education and Awareness Training Program i. Whether the Program... education and awareness training program must be approved by the FAA Administrator while Sec. 117.9(c...

  20. PENGARUH TEKANAN WAKTU, RISIKO AUDIT, TINDAKAN SUPERVISI, DAN MATERIALITAS TERHADAP PENGHENTIAN PREMATUR ATAS PROSEDUR AUDIT (Studi Empiris pada BPK RI Perwakilan Provinsi Sulawesi Selatan)

    OpenAIRE

    IBRAHIM, KHAIRURRIJAL

    2015-01-01

    2015 ABSTRAK Pengaruh Tekanan Waktu, Risiko Audit, Tindakan Supervisi dan Materialitas terhadap Penghentian Prematur Atas Prosedur Audit (Studi Empiris pada BPK RI Perwakilan Provinsi Sulawesi Selatan) Khairurrijal Ibrahim Mushar Mustafa Asri Usman Penelitian ini bertujuan untuk mengetahui apakah tekanan waktu, risiko audit, tindakan supervisi, dan materilaitas berpengaruh terhadap penghentian premature atas prosedur audit yang dilakukan oleh auditor BPK RI Perwa...

  1. 2018-04-27T13:42:00Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    ... Concerning the Educational Process in General Practice, Does it Help? Mustafa, Abdel Rahman; MRCGP/INT, Family Practitioners, Senior trainers and examiners in Family Practice Specialty Training Program (FPSTP), Qadysia Family Practice Training Centre, Capital Health Region, Kuwait Madhi, Sawsan; MRCGP/INT, ...

  2. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    On the drop-weight testing of alumina/aluminum laminated composites · Mustafa Übeylı R Orhan Yildirim Bılgehan Ögel · More Details Abstract Fulltext PDF. Laminated composites with ceramic front layers and metallic or composite backing layers have gained attractiveness as lightweight armours, as they exhibit the same ...

  3. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 5. Effects of size on mass density and its influence on mechanical and thermal properties of ZrO 2 nanoparticles in different structures. BOTAN JAWDAT ABDULLAH QING JIANG MUSTAFA SAEED OMAR. Volume 39 Issue 5 September 2016 pp 1295-1302 ...

  4. The Examination of the Correlation between Social Physique Anxiety Levels and Narcissism Levels of the Students Who Studied at the SPES

    Science.gov (United States)

    Gezer, Engin

    2014-01-01

    The aim of the study was to discover the correlation between social physique anxiety levels and narcissism levels of the students of the school of the physical education and sports. A total of 308 students who studied at different academic departments of the school of the physical education and sports of Mustafa Kemal University participated in…

  5. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Integration of risk matrix and event tree analysis: a natural stone plant case · M KEMAL OZFIRAT ERKAN OZKAN BAYRAM KAHRAMAN BAHADIR SENGUN MUSTAFA E YETKIN · More Details Abstract Fulltext PDF. Machining has considerably increased with evolving technology and increasing demand in natural stone ...

  6. The Investigation of the Effects of Physical Education Lessons Planned in Accordance with Cooperative Learning Approach on Secondary School Students' Problem Solving Skills

    Science.gov (United States)

    Gorucu, Alpaslan

    2016-01-01

    The purpose of the present research was to investigate the effects of physical education lessons planned in accordance with cooperative learning approach on secondary school students' problem solving skills. The research was conducted on 48 students studying at Konya/Selçuklu Sehit Mustafa Çuhadar Secondary School in fall semester of 2015-2016…

  7. Information Operations in Pursuit of Terrorists

    Science.gov (United States)

    2007-09-01

    affairs in secrecy.” It was said in the proverbs, "The hearts of freemen are the tombs of secrets" and "Moslems’ secrecy is faithfulness, and talking...and prepare for new attacks.299 In May 2007, Al Qaeda named an Egyptian , Mustafa Ahmed Muhammad Uthman Abu al-Yazid, as the group’s leader for

  8. Human Brucellosis in Khartoum State: A Commonly ...

    African Journals Online (AJOL)

    Human Brucellosis in Khartoum State: A Commonly Underdiagnosed Disease. AAA Mustafa, HS Hassan. Abstract. Back ground: Human brucellosis is a major debilitating zoonotic disease. It is caused by bacteria of the genus Brucella Methods: The serum antibody titres to Brucella melitensis and Brucella abortus of one ...

  9. South African Journal of Agricultural Extension - Vol 39, No 1 (2011)

    African Journals Online (AJOL)

    An assessment of the adoption of compost manure by smallholder farmers in Balaka District, Malawi. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AK Mustafa-Msukwa, JK Mutimba, C Masangano, AK Edriss, 17-25 ...

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ASIYEH HABIBI1 S MOHAMMAD MOUSAVI KHOIE1 FARZAD MAHBOUBI1 MUSTAFA URGEN2. Department of Mining and Metallurgical Engineering, Amirkabir University of Technology, Tehran 15875-4413, Iran; Department of Metallurgical and Materials Engineering, Istanbul Technical University, Istanbul 34469, Turkey ...

  11. PENGARUH KOMPETENSI, AKUNTABILITAS, DAN ETIKA AUDITOR TERHADAP KUALITAS AUDIT (Studi Kasus Pada Perwakilan BPKP Provinsi Sul-Sel)

    OpenAIRE

    TANDIRERUNG, GLORIA

    2015-01-01

    2015 Pengaruh Kompetensi, Akuntabilitas, dan Etika Auditor terhadap Kualitas Audit (Studi Kasus Pada Perwakilan BPKP Provinsi Sulawesi Selatan) The Effect of Competence, Accountability, and Auditor Ethic on the Audit Quality (Case Study at BPKP Representative in South Sulawesi Province) Gloria Tandirerung Arifuddin Mushar Mustafa Tujuan dari penelitian ini adalah untuk menemukan bukti empiris bahwa kompetensi, a...

  12. The c.IVS1+1G>A mutation inthe GJB2 gene is prevalent and large ...

    Indian Academy of Sciences (India)

    IVS1+1G>A mutation inthe GJB2 gene is prevalent and large deletions involving the GJB6 gene are not present in the Turkish population. ASLI SIRMACI, DUYGU AKCAYOZ-DUMAN and MUSTAFA TEKIN∗. Division of Pediatric Molecular Genetics, Ankara University School of Medicine, Ankara 06100, Turkey. Introduction.

  13. Møller's energy in the dyadosphere of a charged black hole

    Indian Academy of Sciences (India)

    black hole. OKTAY AYDOGDU and MUSTAFA SALTI. (Pramana – J. Phys. 67, 239–247 (2006)). We have added references which had been missed in our article and have refreshed the reference list. We list below the new references and point out the place where these have been added. • S S Xulu, gr-qc/0304081 (ref.

  14. Analisis Perbandingan Cost Model dengan Revaluation Model dalam Penilaian Aset Tetap dan Pengaruhnya terhadap Laporan Posisi Keuangan pada PT. Mulia Industrindo Tbk

    OpenAIRE

    Alfian, Alfian

    2012-01-01

    2012 ABSTRAK ALFIAN, A311 06 036, Analisis Perbandingan Cost Model dengan Revaluation Model dalam Penilaian Aset Tetap dan Pengaruhnya terhadap Laporan Posisi Keuangan pada PT. Mulia Industrindo Tbk, dibimbing oleh Drs. Mushar Mustafa, MM., Ak. (Pembimbing I) dan Drs. Asri Usman, M.Si., Ak. (Pembimbing II). Kata kunci: Cost Model, Revaluation Model, Laporan Posisi Keuangan. Penelitian ini bertujuan untuk mengetahui apakah perbandingan ...

  15. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. BAYRAM KAHRAMAN. Articles written in Sadhana. Volume 42 Issue 10 October 2017 pp 1741-1749. Integration of risk matrix and event tree analysis: a natural stone plant case · M KEMAL OZFIRAT ERKAN OZKAN BAYRAM KAHRAMAN BAHADIR SENGUN MUSTAFA E YETKIN · More Details ...

  16. Sudan Journal of Medical Sciences - Vol 11, No 4 (2016)

    African Journals Online (AJOL)

    Indications, outcome and complications of ureteroscopy, at Gezira Hospital for renal diseases and surgery, Sudan: a seven years 'experience · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mustafa O. Mansour, Sami M. Taha, Abd Elmahmood Abdallah, Mohammed El Imam ...

  17. Metal concentration at surface water using multivariate analysis and ...

    African Journals Online (AJOL)

    Metal concentration at surface water using multivariate analysis and human health risk assessment. F Azaman, H Juahir, K Yunus, A Azid, S.I. Khalit, A.D. Mustafa, M.A. Amran, C.N.C. Hasnam, M.Z.A.Z. Abidin, M.A.M. Yusri ...

  18. Analog integrated circuit of a low level high voltage current source with capacitive load compensation

    OpenAIRE

    Öner, Mustafa Ertuğrul

    1997-01-01

    Ankara : Department of Electrical and Electronics Engineering and the Institute of Engineering and Sciences of Bilkent University, 1997. Thesis (Master's) -- Bilkent University, 1997. Includes bibliographical references leaves 77-79. Öner, Mustafa Ertuğrul M.S.

  19. bayram poyraz

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. BAYRAM POYRAZ. Articles written in Bulletin of Materials Science. Volume 40 Issue 4 August 2017 pp 699-710. Biofilms from micro/nanocellulose of NaBH$_4$-modified kraft pulp · AYHAN TOZLUOGLU BAYRAM POYRAZ ZEKI CANDAN MUSTAFA YAVUZ RECAI ARSLAN.

  20. The Use of Interactional Metadiscourse: A Comparison of Articles on Turkish Education and Literature

    Science.gov (United States)

    Kan, Mustafa Onur

    2016-01-01

    This study aims to determine the use of interactional metadiscourse in articles from the domains of Turkish language and literature. The study employed a descriptive research model to examine 20 articles from the "Mustafa Kemal University Journal of Social Sciences Institute" (all articles were published between 2010 and 2015 and each…

  1. Indialane tahab püstitada luulerekordit

    Index Scriptorium Estoniae

    2003-01-01

    India luuletaja Mustafa Arif luuletab peaministrist Atal Behari Vajpayeest ajavahemikul 15. augustist 25. detsembrini, lootes pääseda Guinnesi rekordiraamatusse. Luuletused kingib autor peaministrile 79. sünnipäevaks; vt. ka SL Õhtuleht, 8. nov., lk. 8

  2. Iisraeli-Palestiina vastasseis : kahe tõe võitlus määrib mõlemad verega / Ivar Soopan

    Index Scriptorium Estoniae

    Soopan, Ivar, 1971-

    2007-01-01

    Iisraeli-Palestiina konflikt alates 1967. aastast. Vt. samas: Minister kurdab apartheidi. Palestiina teabeminister Mustafa Barghouti ütles intervjuus ajalehele Palestine Times, et vastasseis Iisraeliga laheneks, kui Iisrael tunnistaks, et palestiinlased ja iisraellased on võrdsed inimesed võrdsete õigustega ja neil peaksid olema võrdsed võimalused. Tema sõnul on okupatsioon loonud Palestiinas apartheidi

  3. Evaluation of Atatürk' s Leadership Styles on The Base Of Autocratic And Democratic Leadership Behaviors

    OpenAIRE

    ARIKAN, Semra

    2001-01-01

     The mainpurpose of this study is to explain the concepts of leader and leadership andthen analyze the leadership styles of Mustafa Kemal Atatürk. Conclusively, itwas found out that Atatürk was a leader,who displayed both autocratic anddemocratic leadership behaviors whereby his democratic leadership attitudeswere distinctively predominating. 

  4. Electronic structure in Nd2-xCexCuO4 and Pr2-xCexCuO4 studied by two dimensional angular correlation of positron annihilation radiations

    International Nuclear Information System (INIS)

    Kondo, H.; Kubota, T.; Nakashima, H.; Tanigawa, S.; Hidaka, Y.

    1992-01-01

    The electronic structure in Nd 2-x Ce x CuO 4 and Pr 2-x Ce x CuO 4 , which are high-Tc-superconducting materials, was studied by two dimensional angular correlation of positron annihilation radiations (2D-ACAR). The 2D-ACAR measurements were carried out for the samples with and without the doping in the region of the normal conducting states. The three dimensional momentum density has been reconstructed by the image reconstruction technique based on a direct Fourier transformation. The electron momentum density has been reduced into that in the reduced zone scheme by using the LCW folding procedure. The reduced electron momentum density distributions are almost flat, so the electronic structure seem to be regarded as that in semiconductor or insulator. The differences in the density distributions between with and without the doping were observed. These are thought to represent the change of the electronic structure

  5. Positron two-dimensional angular-correlation-of-annihilation-radiation study of untwinned YBa2Cu3O6.9 in the a-axis projection

    International Nuclear Information System (INIS)

    Smedskjaer, L.C.; Bansil, A.; Welp, U.; Fang, Y.; Bailey, K.G.

    1992-01-01

    We present a two-dimensional (2D)-ACAR positron annihilation study of an untwinned YBa 2 Cu 3 O 6.9 metallic sample in the a-axis projection; all existing data from untwinned samples have employed the c projection. The data show a clear presence of the Cu-O chain related ridge Fermi surface extending along the ΓZ direction and two associated umklapp images at higher momenta. These results are consistent with the previously investigated c projection of the momentum density in YBa 2 Cu 3 O 6.9 and do not appear to indicate a strong localization of these electron states along the c direction. We compare and contrast the structures in 2D-ACAR's in the a and c projections, delineating similarities and differences between the results for the two projections

  6. Investigation of defects in electron-irradiated diamond of the type Ia by positron annihilation

    International Nuclear Information System (INIS)

    Novikov, N.V.; Ositinskaya, T.D.; Mikhalenkov, V.S.; Chernyashevskij, A.V.; Shakhovtsov, V.I.; AN Ukrainskoj SSR, Kiev; AN Ukrainskoj SSR, Kiev

    1997-01-01

    To produce vacancy defects, type Ia diamond was irradiated with 3.5 MeV electrons at doses of 5 centre dot 10 16 , 2 centre dot 10 17 , 4 centre dot 10 17 , and 2 centre dot 10 18 e/cm -2 . After each dose, the specimen was investigated using positron annihilation (ACAR), optical spectroscopy in IR, visible regions, and EPR. From ACAR spectra, the S-parameters were found and positron trapping rates were determined. Their behaviour with increasing irradiation doses shows that, in type Ia diamond along with neutral vacancies V degree, deeper traps of positrons are formed, which are most likely vacancies in the negative charge state V - . Specific trapping rates of the V 0 and V - defects are found to be 1.3 centre dot 10 15 and 3.8 centre dot 10 15 s -1 , respectively; trapping cross sections for these defects are also estimated

  7. Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities

    International Nuclear Information System (INIS)

    Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van

    2001-01-01

    The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)

  8. Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities

    Energy Technology Data Exchange (ETDEWEB)

    Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van [Interfaculty Reactor Inst., Delft Univ. of Technology (Netherlands)

    2001-07-01

    The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)

  9. A Rare Cause of Acute Abdomen: Diagnosis and Management of Adult Colonic Intussusception.

    Science.gov (United States)

    Sertkaya, Mehmet; Emre, Arif; Pircanoglu, Eyüp Mehmet; Yazar, Fatih Mehmet; Tepe, Murat; Cengiz, Emrah; Isler, Ali; Vicdan, Halit

    2016-01-01

    Intussusception in adults is very rarely seen, and this cause acute abdomen. A computed tomography (CT) scan, clinical suspicion, history, and a physical examination are important for the diagnosis. We present two cases of colonic intussusceptions induced by lipoma. The cases had similar locations, diagnoses, and management. Both lipomas were located close to the cecum in the ascending colon, and a right segmental colon resection was performed in both cases. The follow-up of both cases was uneventful. Although benign lesions can cause colonic intussusception, the high incidence of malignancy in colonic lesions should always be considered. Therefore, oncologic surgical procedures should be applied. The definitive diagnosis can be made by histopathology. Sertkaya M, Emre A, Pircanoglu EM, Yazar FM, Tepe M, Cengiz E, Isler A, Vicdan H. A Rare cause of Acute Abdomen: Diagnosis and Management of Adult Colonic Intussusception. Euroasian J Hepato-Gastroenterol 2016;6(2):179-182.

  10. Electronic structure of Mo and W investigated with positron annihilation

    Energy Technology Data Exchange (ETDEWEB)

    Dutschke, Markus [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Sekania, Michael [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Andronikashvili Institute of Physics, Tbilisi (Georgia); Benea, Diana [Faculty of Physics, Babes-Bolyai University, Cluj-Napoca (Romania); Department of Chemistry, Ludwig Maximilian University of Munich (Germany); Ceeh, Hubert; Weber, Joseph A.; Hugenschmidt, Christoph [FRM II, Technische Universitaet Muenchen, Garching (Germany); Chioncel, Liviu [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Augsburg Center for Innovative Technologies, University of Augsburg (Germany)

    2016-07-01

    We perform electronic structure calculations to analyze the momentum distribution of the transition metals molybdenum and tungsten. We study the influence of positron-electron and the electron-electron interactions on the shape of the two-dimensional angular correlation of positron annihilation radiation (2D-ACAR) spectra. Our analysis is performed within the framework of the combined Density Functional (DFT) and Dynamical Mean-Field Theory (DMFT). Computed spectra are compared with recent experimental investigations.

  11. Additive manufacturing of titanium alloy for aircraft components

    OpenAIRE

    Uhlmann, E.; Kersting, R.; Klein, T.B.; Cruz, M.F.; Borille, A.V.

    2015-01-01

    Selective Laser melting (SLM) is an additive manufacturing technology that uses laser as a power source to sinter powdered metals to produce solid structures. The application of SLM permits engineers to develop and implement components with topologically optimized designs and resultant material properties in comparison to conventionally produced casting parts. Current aviation programs as ACARE 2020 (Advisory Council for Aviation Research and Innovation in the EU) and Flightpath 2050 request ...

  12. Worldwide Crisis Alerting Network, Phase II. Task 2. Identification of Existing Communications Systems,

    Science.gov (United States)

    1980-04-01

    rent flable- De:)e conservarse mientras no se %igre el funcionamiento seguro del enlace VHF RTT FREDERIKSDAL- S..INDRE STROMFJORO. SANTA MARIA...Automatic Navigation and Fuel Management Computers, Weather Radar , Air Data Computer, ACARS and Voice Communications. The service most directly...this system are located at long-range radar sites. The second air/ground functional area is terminal communications; controller/pilot communications

  13. Special Issue: Adaptive/Smart Structures and Multifunctional Materials with Application to Morphing Aircraft

    Directory of Open Access Journals (Sweden)

    Rafic Ajaj

    2014-12-01

    Full Text Available Recent advances in smart structures and multifunctional materials have facilitated many novel aerospace technologies such as morphing aircraft. A morphing aircraft, bio-inspired by natural fliers, has gained a lot of interest as a potential technology to meet the ambitious goals of the Advisory Council for Aeronautics Research in Europe (ACARE Vision 2020 and the FlightPath 2050 documents. A morphing aircraft continuously adjusts its wing geometry to enhance flight performance, control authority, and multi-mission capability.[...

  14. Organization of the Integrated Photonics Topical Meeting Held in Victoria, British Columbia on 30 March-1 April 1998. Technical Digest Series. Volume 4. Postconference Edition

    Science.gov (United States)

    1999-03-22

    Pesquera, N. Mustafa, Instituto de Fisica de Cantabria, Spain; I. Esquivias, Univ. Politecnica de Madrid, Spain. We show that carrier transport has...Instituto de Fisica de Cantabria, Spain; J. Dellunde, Univ. Barcelona, Spain; K.A. Shore, Univ. Wales, U.K. Low mode partition noise of solitary multi...Continuous-wave measurement of the fiber nonlinear Index, D. Monzon, A.N. Starodumov.Yu.O. Barmenkov, I. Torres, Centro de Investigaciones en Optica

  15. Iraq Stability: Foreign Military Sales in a New War Environment

    Science.gov (United States)

    2015-05-06

    April2009, 6-10, Military & Government Collection, EBSCOhost (accessed November 6, 2014). l Eric Schmitt and Michael Gordon, "The Iraqi Army Was...transrers and seek to fill an open arms market . u Ibid. 1" DSCA website, "ResourcesfF AQ", hlt(t:lfwww.dsca.mil/resourceslfaq (accessed December I 0...supremacy and security cooperation. s Cordesman and Khazai, 222. 6 A wad Mustafa, "Russia Making Major Push Into Mideast Market ," Defense News, Oct

  16. Remarks on G-Metric Spaces

    Directory of Open Access Journals (Sweden)

    Bessem Samet

    2013-01-01

    Full Text Available In 2005, Mustafa and Sims (2006 introduced and studied a new class of generalized metric spaces, which are called G-metric spaces, as a generalization of metric spaces. We establish some useful propositions to show that many fixed point theorems on (nonsymmetric G-metric spaces given recently by many authors follow directly from well-known theorems on metric spaces. Our technique can be easily extended to other results as shown in application.

  17. The Importance of Turkish and US Relations: Contributing for Joint Objectives of a Secure Middle East

    Science.gov (United States)

    2017-03-31

    As a Muslim-majority country that is transitioning from being a secular democratic state toward its Islamic roots, a member of NATO, and a long...being a secular democratic state toward its Islamic roots, a member of NATO, and a long-standing US ally, Turkey is pivotal to the US strategy to shape...productive country needed education, so Kemal advocated a unified school system with secular, Turkish language schools.2 Under Mustafa Kemal’s leadership

  18. Opinions of Students Completing Master Thesis in Turkish Education Field about Academic Writing and Thesis Formation Process

    OpenAIRE

    Mustafa Onur KAN; Fatma Nur GEDİK

    2016-01-01

    The overall aim of this research is to evaluate opinions of students completing master thesis in the field of Turkish education about academic writing and process of forming thesis. The study has been devised using phenomenological design within the qualitative research methods. The study group of research is consisted of 9 participants completed master thesis in the field of Turkish education at Mustafa Kemal University Instıtute of Social Sciences in 2015. In this study, semi-structured int...

  19. A Case Study of Cultural Ethnicity and Enduring Social Patterns: The Kurds of Iraq

    Science.gov (United States)

    1990-06-01

    followings or charismatic influences. Once in power, these "strong leaders" often maintain their positions by authoritarian means. Opposition to the govern...with the father and to a lesser extent the paternal uncle. After the young woman is married this complex conven- tion of right and obligation passes...from 750 families in 1906 to approximately 2700 families by mid- century. A much younger brother, Mulla Mustafa, named Mullah after a maternal uncle

  20. Çin kaynaklarına göre Taoizm

    OpenAIRE

    Abudukelimu, Bumairimu

    2011-01-01

    ÖZET

    Çin kaynaklarına göre Taoizm

    Bumairimu Abudukelimu

    Doktora Tezi, Dinler Tarihi Anabilim Dalı

    Tez Danışmanı: Prof. Dr. Mustafa Erdem

    Aralık 2011, 162 sayfa

     

    ...

  1. A Foreword from the Editor

    OpenAIRE

    KAKİLLİ ACARAVCI, Songül

    2018-01-01

    It is my great pleasure to present the inaugural issue of Journal of Politics, Economy, and Management(JOPEM): an interdisciplinarypeer-reviewed academic journal of a new kind publishedbi-annually by the Faculty of Economics and Administrative Sciences in MustafaKemal University. The JOPEM providesa platform for academics, practitioners and policymakers to share theirresearch.Adouble-blind peer-review method is used in the acceptance of manuscripts, andcompilations, conceptual discussions, em...

  2. From academia to industry: The story of Google DeepMind

    OpenAIRE

    Legg, Shane

    2014-01-01

    Shane Legg left academia to cofound DeepMind Technologies in 2010, along with Demis Hassabis and Mustafa Suleyman. Their vision was to bring together cutting edge machine learning and systems neuroscience in order to create artificial agents with general intelligence. Following investments from a number of famous technology entrepreneurs, including Peter Thiel and Elon Musk, they assembled a team of world class researchers with backgrounds in systems neuroscience, deep learning, reinforcement...

  3. Egypt: Security, Political, and Islamist Challenges

    Science.gov (United States)

    2007-09-01

    Islamist militance has been developing in a wide variety of social and economic settings, including England, France , 6 Germany, and elsewhere. We might...political wedge between the United States and Egypt led to Nasir’s nationalization of the Suez Canal. Britain then plotted with France and Israel...than the membership, which, at the time, came from the petit bourgeoisie , or were migrants to urban areas. Shukri Mustafa, leader of TWH, was

  4. A three-term conjugate gradient method under the strong-Wolfe line search

    Science.gov (United States)

    Khadijah, Wan; Rivaie, Mohd; Mamat, Mustafa

    2017-08-01

    Recently, numerous studies have been concerned in conjugate gradient methods for solving large-scale unconstrained optimization method. In this paper, a three-term conjugate gradient method is proposed for unconstrained optimization which always satisfies sufficient descent direction and namely as Three-Term Rivaie-Mustafa-Ismail-Leong (TTRMIL). Under standard conditions, TTRMIL method is proved to be globally convergent under strong-Wolfe line search. Finally, numerical results are provided for the purpose of comparison.

  5. The effects of dictionary training on Turkish EFL students' reading comprehension and vocabulary learning

    OpenAIRE

    Altun, Arif

    1995-01-01

    Ankara : The Institute of Economic and Social Sciences of Bilkent Univ., 1995. Thesis (Master's) -- Bilkent University, 1995. Includes bibliographical references leaves 55-59 The present study investigated the effects of monolingual dictionary training on Turkish EFL students' reading comprehension and vocabulary learning. Thirty-seven intermediate-level Turkish EFL preparatory students in the Department of English Language Teaching at Mustafa Kemal University participated in this st...

  6. Dollar Summary of Prime Contract Awards with Principal Place of Performance Outside the U.S. by Country and Contractor, FY83.

    Science.gov (United States)

    1983-01-01

    52- MEHMET AKOENIZ IZOLASYON TAAHHUT TURKEY a8 96 MEHIET OZVEREN TURKEY 31 31 MINEX NUN MUT TURKEY 104 104 MITHAT YENIGUN TURKEY 1,640 1,640 I PRIME...CORP TURKEY 6,650 6,650 HUHENDISLIK ERE LTD STI TURKEY 130 130 MUSTAFA QOKALP TURKEY 109 109 NADIR SONEN TURKEY 30 30 ONAR I|NSAAV TI CARET VE SAAYII

  7. Assessment of the relationship between the engagement in leisure time and academic motivation among the students of faculty of education

    OpenAIRE

    SARI, Ihsan; CETIN, Mehmet; KAYA, Erdi; GULLE, Mahmut; KAHRAMANOĞLU, Recep

    2014-01-01

    The aim of the study was to determine the relationship between leisure time motivation and academic motivation among the students who studied at the Faculty of Education of Mustafa Kemal University. 260 students (Xyears: 21.29±2.11) constituted the sample of the study. For the analyses of the data; Leisure Motivation Scale and Academic Motivation Scale were employed. The data were analyzed using descriptive statistics, Pearson's correlation test and regression analysis. According to the ...

  8. Neighboring and Connectivity-Aware Routing in VANETs

    Directory of Open Access Journals (Sweden)

    Huma Ghafoor

    2014-01-01

    Full Text Available A novel position-based routing protocol anchor-based connectivity-aware routing (ACAR for vehicular ad hoc networks (VANETs is proposed in this paper to ensure connectivity of routes with more successfully delivered packets. Both buses and cars are considered as vehicular nodes running in both clockwise and anticlockwise directions in a city scenario. Both directions are taken into account for faster communication. ACAR is a hybrid protocol, using both the greedy forwarding approach and the store-carry-and-forward approach to minimize the packet drop rate on the basis of certain assumptions. Our solution to situations that occur when the network is sparse and when any (source or intermediate node has left its initial position makes this protocol different from those existing in the literature. We consider only vehicle-to-vehicle (V2V communication in which both the source and destination nodes are moving vehicles. Also, no road-side units are considered. Finally, we compare our protocol with A-STAR (a plausible connectivity-aware routing protocol for city environments, and simulation results in NS-2 show improvement in the number of packets delivered to the destination using fewer hops. Also, we show that ACAR has more successfully-delivered long-distance packets with reasonable packet delay than A-STAR.

  9. c-Axis projected electron-positron momentum density in YBa2Cu3O7

    International Nuclear Information System (INIS)

    Bansil, A.; Smedskjaer, L.C.

    1990-11-01

    The authors present the theoretical c-axis projected electron-positron momentum density N 2γ (P x ,p y ) in YBa 2 Cu 3 O 7 based on the local density approximation (LDA) framework along various lines in momentum space. The calculations use the Korringa-Kohn-Rostoker (KKR) band structure formalism. The anisotropic distribution defined by taking cuts through the calculated spectra along different lines in the (p x ,p y ) plane possesses complex structures which arise from both Fermi surface effects and the anisotropy of the smoothly varying underlying background from filled bands; the maximum size of the anisotropy is about 10% of N 2γ (0,0). The theoretically predicted N 2γ (p x , y ) distribution is compared with the measured 2D-ACAR spectrum. The considerations suggest that in interpreting the 2D-ACAR data on YBa 2 Cu 3 O 7 in terms of a band theory LDA picture, a substantial, largely isotropic, background should be subtracted from both the 2D-ACAR's and the associated LCW-folded spectra

  10. Electronic structure and orientation relationship of Li nanoclusters embedded in MgO studied by depth-selective positron annihilation two-dimensional angular correlation

    Science.gov (United States)

    Falub, C. V.; Mijnarends, P. E.; Eijt, S. W.; van Huis, M. A.; van Veen, A.; Schut, H.

    2002-08-01

    Quantum-confined positrons are sensitive probes for determining the electronic structure of nanoclusters embedded in materials. In this work, a depth-selective positron annihilation 2D-ACAR (two-dimensional angular correlation of annihilation radiation) method is used to determine the electronic structure of Li nanoclusters formed by implantation of 1016-cm-2 30-keV 6Li ions in MgO (100) and (110) crystals and by subsequent annealing at 950 K. Owing to the difference between the positron affinities of lithium and MgO, the Li nanoclusters act as quantum dots for positrons. 2D-ACAR distributions for different projections reveal a semicoherent fitting of the embedded metallic Li nanoclusters to the host MgO lattice. Ab initio Korringa-Kohn-Rostoker calculations of the momentum density show that the anisotropies of the experimental distributions are consistent with an fcc crystal structure of the Li nanoclusters. The observed reduction of the width of the experimental 2D-ACAR distribution is attributed to positron trapping in vacancies associated with Li clusters. This work proposes a method for studying the electronic structure of metallic quantum dots embedded in an insulating material.

  11. Magnetic focusing of an intense slow positron beam for enhanced depth-resolved analysis of thin films and interfaces

    CERN Document Server

    Falub, C V; Mijnarends, P E; Schut, H; Veen, A V

    2002-01-01

    The intense reactor-based slow positron beam (POSH) at the Delft research reactor has been coupled to a Two-Dimensional Angular Correlation of Annihilation Radiation (2D-ACAR) setup. The design is discussed with a new target chamber for the 2D-ACAR setup based on Monte Carlo simulations of the positron trajectories, beam energy distribution and beam transmission in an increasing magnetic field gradient. Numerical simulations and experiment show that when the slow positron beam with a FWHM of 11.6 mm travels in an increasing axial magnetic field created by a strong NdFeB permanent magnet, the intensity loss is negligible above approx 6 keV and a focusing factor of 5 in diameter is achieved. Monte Carlo simulations and Doppler broadening experiments in the target region show that in this configuration the 2D-ACAR setup can be used to perform depth sensitive studies of defects in thin films with a high resolution. The positron implantation energy can be varied from 0 to 25 keV before entering the non-uniform mag...

  12. 30 Ağustos Zafer Bayramı Kanunu, İlk Zafer Kutlaması ve Büyük Taarruz İle İlgili Bazı Bilgiler

    Directory of Open Access Journals (Sweden)

    Burhan Sayılır

    2014-04-01

    Full Text Available The decisive Turkish assault which resulted in Turkish victory was fought for five days from 26 to 30 August 1922. The preparations of the great assault were carried out confidentially the time fixed for the assault only by Mustafa Kemal and a limited number of people in high command. Mustafa Kemal was appointed as Commander in Chief by the parliament for the fourth time and despite the growing criticism by some members in the parliament the initiation and the success of the attack were eventually appreciated even by them. The breakthrought and decisive victory of the Turkish armies on August 30 were embraced and celebrated by the parliament press and Turkish people. Commander in Chief received many congratulatory addresses. Two years after the victory on 30 August 1924, a great commemorative ceremony was held in Dumlupınar. Fevzi Pasha addressed the audience describing the battle, victory and its significance for Turks. After other speeches, Mustafa Kemal was the last to delivet a speech in which he mentioned the importance of the great victory and guided the way of the young Turkish Republic in details. In the ceremony the construction of the “Monument of Unknown Soldier” was also started. Two years later, August 30 was officially proclaimed as the army’s festival. But no big ceremonies were held until 1930s, when Minister of War, Recep (PEKER published in a memorandum in which details of conducting of the ceremonies were described in accordance with the regulations in 1926.

  13. Manifestações emocionais e motoras de ribeirinhos expostos ao mercúrio na Amazônia

    Directory of Open Access Journals (Sweden)

    José Maria Farah Costa Junior

    Full Text Available RESUMO: Introdução: A investigação dos impactos clínico-neurológicos associados às concentrações de exposição ao mercúrio em populações expostas é necessária na Amazônia. Objetivo: Analisar as manifestações emocionais e motoras de ribeirinhos expostos pela dieta nos municípios de Itaituba e Acará, ambos no Pará. Método: Foram coletadas amostras de cabelo para a determinação de mercúrio total (HgT, obtidos dados demográficos e sintomatológicos emocionais (depressão, ansiedade e insônia e motores (parestesia, fraqueza muscular, desequilíbrio ao andar, tremor, dor nos membros e disartria. Resultados: A concentração mediana de HgT em Itaituba foi significativamente superior (p < 0,0001 àquela em Acará. As manifestações emocionais foram identificadas em 26 (26,5% participantes de Itaituba e em 24 (52,2% em Acará. Com relação às queixas motoras especificas, em Itaituba ocorreram em 63 (64,3% voluntários, sendo mais referidas a dor nos membros (36,7%, a parestesia (32,6% e a fraqueza muscular (27,5%. No Acará, 33 (71,7% participantes apresentaram manifestações motoras, com o maior número queixando de parestesia (54,3%, dor nos membros (52,2% e tremor (34,8%. As concentrações médias de HgT em Itaituba naqueles com manifestações emocionais e com manifestações motoras estiveram acima do considerado tolerável (6 µg/g pela Organização Mundial de Saúde. Conclusão: Os resultados revelaram que a concentração de mercúrio nas manifestações emocionais e motoras de Itaituba são maiores do que nos ribeirinhos do Acará. Novos estudos são necessários com a aplicação de testes convencionais qualitativos e/ou quantitativos específicos, assim como também a investigação de outros sinais clínicos.

  14. Positron spectroscopy studies of zeolites

    Science.gov (United States)

    Hung, Ku-Jung

    The lineshapes of two-dimensional angular correlation of electron-positron annihilation radiation (2D-ACAR) in alumina and several zeolites were measured as a function of internal surface areas. In all cases, the lineshape parameter S from 2D-ACAR spectra were found to vary proportionally with internal surface area. In order to investigate the Bronsted acidity in NaHY zeolite, the lineshape parameter evaluation from 2D-ACAR measurements for varied acidity in NaHY zeolites by ion-exchange and thermal desorption were presented. The result from this investigation has demonstrated that the Bronsted acidity in NaHY zeolite was found to vary linearly with the lineshape parameter of the angular correlation spectrum of the sample. The lineshapes of 2D-ACAR spectra were determined for different base adsorbed HY-zeolite samples under a temperature controlled heating system in order to investigate, in-situ, the acid strength and number of Bronsted acid sites in the sample. Results have shown that the lineshape parameter of the angular correlation spectrum of the sample increases with the strength of adsorbed base and decreases with the number of Bronsted acid sites in the sample. This indicated that the lineshape parameter is sensitive to all of the strengths and concentrations of Bronsted acid sites in the HY-zeolite samples. The result from this study has also demonstrated that the large size base, pyridine, would reduce the possibility of positronium formation in the sample by filling the cage to eliminate the internal surface areas where the positroniums are likely to form. However, the small size base, ammonia, did not show any effect on the internal surface areas. Owing to the fact that this technique monitors only the Bronsted acid sites that situate on the surface which relates to the catalytic activity, there is little ambiguity about the location of the source of information obtained. The findings presented in this dissertation point out the fact that such lineshape

  15. Environmental changes in the western Amazônia: morphological framework, geochemistry, palynology and radiocarbon dating data

    Directory of Open Access Journals (Sweden)

    Adriana M.C. Horbe

    2011-09-01

    Full Text Available The sediments from the Coari lake, a “terra firme” lake sculpted into Plio-Pleistocene deposits, and the Acará lake, a flooding-type lake developed on Quaternary sediments in the floodplain of the mid-Solimões river, in the western Amazônia, Brazil, were studied to investigate the environmental condition of their developing. This study includes mineral composition, geochemistry, Pb isotope, palinology, radiocarbon-age and morphological framework of the lakes obtained from SRTM satellite images. The geological and the environmental conditions in the two lakes are highly variable and suggest that their evolution reflect autogenic processes under humid rainforest condition. Although kaolinite, quartz, muscovite, illite, and smectite are the main minerals in both lakes, the geochemistry indicates distinct source, the Acará lake sediments have higher concentrations of Al2O3, Fe2O3, FeO, CaO, K2O, MgO, Na2O, P2O5, Ba, V, Cu, Ni, Zn, Pb, Sr, Li, Y and La and have more radiogenic Pb than the Coari lake sediments. The radiocarbon ages suggest that at 10160 yr BP the Coari lake started to be developed due to avulsion of the Solimões river, and the Acará lake was formed by the meander abandonment of Solimões river retaining its grass dominated shore at ca. 3710 yr BP.Os sedimentos do lago Coari, de ambiente de terra firme eesculpido nos depósitos do Plio-Pleistocenos, e o Acará, típico lago de várzea e ambos formados nos sedimentos quaternários da planície de inundação do médio Solimões, no oeste da Amazônia, Brasil, foram estudados para investigar as condições ambientais durante sua formação. Este estudo inclui dados da composição mineralógica, química, isótopos de Pb, palinologia, datações de radiocarbono e a configuração morfológica dos lagos obtida por imagens SRTM. As condições geológica e ambiental dos lagos variam e sugerem que suas evoluções refletem processos autogenéticos em condições de floresta úmida

  16. TAMBO VIEJO: UN ASENTAMIENTO FORTIFICADO EN EL VALLE DE ACARÍ, PERÚ (Tambo Viejo: A Fortified Settlement in the Acari Valley, Peru

    Directory of Open Access Journals (Sweden)

    Lidio M. Valdez

    2013-10-01

    Full Text Available La aparición de los asentamientos fortificados y el origen del conflicto violento son temas poco discutidos en el contexto de la arqueología peruana. Considero que es oportuno investigar y determinar cuándo y por qué surgieron los primeros asentamientos fortificados. El propósito central de este artículo está precisamente orientado a responder tales interrogantes y discutir el tema del conflicto violento en el valle de Acarí y, por extensión, en la costa sur del Perú. Las evidencias arqueológicas disponibles señalan que, durante el periodo Intermedio Temprano, Tambo Viejo fue un asentamiento defendido por varias estructuras perimétricas. Otros sitios contemporáneos de Tambo Viejo en Acarí también fueron fortificados. Además, existe en el mismo valle evidencia tangible de violencia en la forma de prisioneros que posteriormente fueron decapitados. En contraste a la evidencia proveniente de Acarí, no existen asentamientos del periodo Intermedio Temprano identificables como fortificaciones, lo que hace de los sitios de Acarí los primeros asentamientos fortificados de toda la costa sur. ENGLISH: The emergence of violent conflict and of fortified settlements is a subject little studied within Peruvian archaeology. However, I consider it vital to investigate and determine the time and the reasons under which fortified settlements were first established. The central aim of this paper is to discuss when and why fortified settlements emerged first in the Acari Valley and, by extension, in the south coast of Peru. Available archaeological evidence indicates that during the Early Intermediate Period, Tambo Viejo was a fortified settlement protected by several massive walls. Other neighbouring sites in Acari were also fortified. Furthermore, in Acari there is conclusive evidence for violence in the form of decapitated individuals. In contrast to evidence coming from Acari, not a single Early Intermediate Period settlement from other

  17. Reduced serum brain-derived neurotrophic factor in patients with first onset vitiligo

    OpenAIRE

    Erfan, Gamze; Yanik,M. Emin; Albayrak,Yakup; Aydin,Murat; Kulac,Mustafa; Kuloglu,Murat

    2014-01-01

    M Emin Yanik,1 Gamze Erfan,1 Yakup Albayrak,2 Murat Aydin,3 Mustafa Kulac,1 Murat Kuloglu4 1Department of Dermatology, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 2Department of Psychiatry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 3Department of Biochemistry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 4Department of Psychiatry, Faculty of Medicine, Akdeniz University, Antalya, Turkey Purpose: Vitiligo...

  18. Turkish Influence in the South Caucasus and Levant: The Consequences for NATO and the EU

    Science.gov (United States)

    2013-09-01

    Baran, “Turkey and the Caucasus,” in Turkish Foreign Policy in the Post-Cold War Era, ed. Idris Bal (Boca Raton, FL: Brown Walker, 2004), 269. 56 Gareth ...Bulut, et al., Turkish Foreign Policy in Post Post-Cold War Era, ed. Idris Bal (Boca Raton: Brown Walker, 2004); Ismael, Tareq and Mustafa Aydin. ed...the Caucasus.” in Turkish Foreign Policy in the Post-Cold War Era, edited by Idris Bal. (Boca Raton: Brown Walker, 2004). Barysch, Katinka

  19. The Military Commissions Act of 2009 (MCA 2009): Overview and Legal Issues

    Science.gov (United States)

    2014-03-07

    imprisonment, but credited with five years’ time served.12 Both men are now free from detention. Ali Hamza Ahmad Suliman al Bahlul of Yemen was found...Walid Muhammed Salih Mubarak Bin Attash, Ramzi Bin Al Shibh, Ali Abdul-Aziz Ali , and Mustafa Ahmed Al Hawsawi, to the Southern District of New York...Savage, Guantánamo Detainee Pleads Guilty in 2002 Attack on Tanker Off Yemen, NY TIMES, February 20, 2014. 24 One of these may have been Majid Shoukat

  20. Palestiinlaste katastroof : Iisraeli asundused ja äärmuslik Hamas / Ivar Soopan

    Index Scriptorium Estoniae

    Soopan, Ivar, 1971-

    2007-01-01

    Äärmusrühmituse Hamas võit 2006. aastal Palestiina parlamendivalimistel näitas, et rahvas oli väsinud korrumpeerunud võimust, samas ei pööratud tähelepanu sellele, et Hamas kasutab oma eesmärkide saavutamiseks vägivalda. Palestiina teabeminister Mustafa Barghout taunib, et Iisrael ei võta Palestiina valitsust kui ühtset võimu, vaid teeb vahet Hamasi ja teiste poliitiliste jõudude ministritel. Palestiinlane Ala Shehadeh palestiinlaste intifadadest, juudi asunduste probleemist. Vt. samas: Miks Palestiinas elatakse nagu sada aastat tagasi?

  1. Monuments on Gemiler Ada and Karacaören Ada

    OpenAIRE

    Masuda, Tomoyuki

    1995-01-01

    Contents : 1. Church I on Gemiler Ada, 2. Church II on Gemiler Ada, 3. Church III on Gemiler Ada, 4. Church IV on Gemiler Ada, 5. Basilica on Karacaören Ada, 6. Painted Tomb on Karacaören Ada, 7. The Baptistery and the Chronology of Construction of the Karacaören Ada Basilica Complex, 8. Ölüdeniz Beach Basilica, 9. Iskender Basilica on Ölüdeniz Lagoon, 10. Mustafa Basilica near Beştaş Cove.

  2. Local structure reconstruction in hydrogenated amorphous silicon from angular correlation and synchrotron diffraction studies

    International Nuclear Information System (INIS)

    Britton, D.T.; Minani, E.; Knoesen, D.; Schut, H.; Eijt, S.W.H.; Furlan, F.; Giles, C.; Haerting, M.

    2006-01-01

    Hydrogenated amorphous silicon (a-Si:H) is a widely used thin film semiconductor material which is still incompletely understood. It is generally assumed to form a continuous random network, with a high concentration of coordination defects (dangling bonds), which are hydrogen terminated. Neither the exact nature of these sites nor the degree of medium range order has been fully determined. In this paper, we present the first results for the local structure, from a combined study using angular correlation of positron annihilation radiation (ACAR) and synchrotron radiation diffraction. Reciprocal space information is obtained directly, for the mesoscale structure and the local defect structure, from the orientation dependent diffraction and 2D-ACAR patterns, respectively. Furthermore, inversion of both patterns yields a comparison of real space information through maps of the silicon-silicon pair correlation function and the electron-positron autocorrelation function B 2γ (r). From this information, it is possible to identify the dominant structural defect as a vacancy-size dangling bond cluster, around which the network strain is fully relaxed

  3. De novo biosynthesis of vanillin in fission yeast (Schizosaccharomyces pombe) and baker's yeast (Saccharomyces cerevisiae).

    Science.gov (United States)

    Hansen, Esben H; Møller, Birger Lindberg; Kock, Gertrud R; Bünner, Camilla M; Kristensen, Charlotte; Jensen, Ole R; Okkels, Finn T; Olsen, Carl E; Motawia, Mohammed S; Hansen, Jørgen

    2009-05-01

    Vanillin is one of the world's most important flavor compounds, with a global market of 180 million dollars. Natural vanillin is derived from the cured seed pods of the vanilla orchid (Vanilla planifolia), but most of the world's vanillin is synthesized from petrochemicals or wood pulp lignins. We have established a true de novo biosynthetic pathway for vanillin production from glucose in Schizosaccharomyces pombe, also known as fission yeast or African beer yeast, as well as in baker's yeast, Saccharomyces cerevisiae. Productivities were 65 and 45 mg/liter, after introduction of three and four heterologous genes, respectively. The engineered pathways involve incorporation of 3-dehydroshikimate dehydratase from the dung mold Podospora pauciseta, an aromatic carboxylic acid reductase (ACAR) from a bacterium of the Nocardia genus, and an O-methyltransferase from Homo sapiens. In S. cerevisiae, the ACAR enzyme required activation by phosphopantetheinylation, and this was achieved by coexpression of a Corynebacterium glutamicum phosphopantetheinyl transferase. Prevention of reduction of vanillin to vanillyl alcohol was achieved by knockout of the host alcohol dehydrogenase ADH6. In S. pombe, the biosynthesis was further improved by introduction of an Arabidopsis thaliana family 1 UDP-glycosyltransferase, converting vanillin into vanillin beta-D-glucoside, which is not toxic to the yeast cells and thus may be accumulated in larger amounts. These de novo pathways represent the first examples of one-cell microbial generation of these valuable compounds from glucose. S. pombe yeast has not previously been metabolically engineered to produce any valuable, industrially scalable, white biotech commodity.

  4. Studies on formation and structures of ultrafine Cu precipitates in Fe-Cu model alloys for reactor pressure vessel steels using positron quantum dot confinement in the precipitates by their positron affinity. JAERI's nuclear research promotion program, H11-034 (Contract research)

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Masayuki; Nagai, Yasuyoshi; Tang, Zheng; Yubuta, Kunio [Tohoku Univ., Sendai (Japan). Inst. for Materials Research; Suzuki, Masahide [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2003-03-01

    Positron annihilation experiments on Fe-Cu model dilute alloys of nuclear reactor pressure vessel (RPV) steels have been performed after neutron irradiation in JMTR. Nanovoids whose inner surfaces were covered by Cu atoms were clearly observed. The nanovoids transformed to ultrafine Cu precipitates by dissociating their vacancies after annealing at around 400degC. The nanovoids and the ultrafine Cu precipitates are strongly suggested to be responsible for irradiation-induced embrittlement of RPV steels. Effects of Ni, Mn and P addition on the nanovoid and Cu precipitate formations were also studied. The nanovoid formation was enhanced by Ni and P, but suppressed by Mn. The Cu precipitates after annealing around 400degC were almost free from these doping elements and hence were pure Cu in the chemical composition. Furthermore the Fermi surface of the 'embedded' Cu precipitates with a body centered cubic crystal structure was obtained from two dimensional angular correlation of annihilation radiation (2D-ACAR) in a Fe-Cu single crystal and was agreed well with that from a band structure calculation. Theoretical calculation of positron confinement in Fe-Cu model alloys showed that a positron quantum dot state induced by positron affinity is attained for the embedded precipitates larger than 1 nm. A new position sensitive detector with a function of one dimensional angular correlation of annihilation radiation (1D-ACAR) has been developed that enables high resolution experiments over wide ranges of momentum distribution. (author)

  5. A symmetry based study of positron annihilation spectra

    International Nuclear Information System (INIS)

    Adam, G.; Adam, S.; Inst. of Physics and Nuclear Engineering, Bucharest

    1995-01-01

    The authors describe a method for off-line analysis of spectra measured by two-dimensional angular correlation of annihilation radiation (2D-ACAR) positron spectroscopy. The method takes into account, at all its stages, two salient data features: the piecewise constant discretization of the 2D physical momentum distribution into square pixels, performed by the setup, and the occurrence of a characteristic 2D projected symmetry of the positron-electron pair momentum distribution. Several validating criteria are derived which secure significantly increased reliability of the output. The method is tested on 2D-ACAR spectra measured on (R)Ba 2 Cu 3 O 7-δ (R123; R = Y, Dy) single crystals. It resolves ridge Fermi surfaces (FS) up to 3rd Umklapp components on both kinds of R123 spectra. Moreover, on a c-axis-projected Y123 spectrum, measured at 300 K, it resolves a small but clear signature of the pillbox FS at the S point of the first Brillouin zone as well

  6. Positron annihilation in superconducting 123 compounds

    International Nuclear Information System (INIS)

    Peter, M.; Manuel, A.A.; Erb, A.

    1998-01-01

    After a brief review of the theory of angular correlation of positron annihilation radiation (ACAR), the authors illustrate experimental principles and give examples of successful determination of electron momentum density (EMD) and of positron lifetime in solids. The central question which the authors try to answer concerns the contribution of positron spectroscopy to the knowledge and understanding of the new high temperature superconducting oxides. They find that in these oxides also, partially filled bands exist and they can observe parts of their Fermi surface and measure lifetimes in accordance with band theoretical calculations. There are characteristic differences, however. The intensity of the anisotropy of the ACAR signal is below theoretical expectation and signals depend on sample preparation. Recent studies by the Geneva group have concerned dependence of the signals on impurities, on oxygen content and on the thermal history of preparation. Of particular interest are correlations between the variations of these signals and between the variations of structural and transport properties in these substances. Besides deliberate additions of impurities, the Geneva group also reports progress in the preparations of samples of highest purity (barium zirconate crucibles). The alloy series Pr x Y 1-x Ba 2 Cu 3 O 7-δ is of special interest because of exceptional transport properties. The recent positron results on these materials will be presented and commented in the light of theoretical models and in the light of the reported superconductivity of the Pr-compound

  7. PANDA II

    International Nuclear Information System (INIS)

    Rabou, L.P.L.M.; Zwart, P.; Langedijk, G.J.; Mijnarends, P.E.

    1988-11-01

    A full account is given of the design, construction and operation of an experimental apparatus for the measurement of the angular correlation of positron-annihilation radiation in two dimensions (2D ACAR). The 2D ACAR technique is insensitive to the electronic mean-free-path and can be applied to pure metals as well as non-dilute alloys and compounds to obtain valuable information on the band structure and Fermi-surface geometry. The apparatus consists of two 30 x 30 cm 2 hybrid (high-density) multi-wire-chamber γ detectors at variable distances from 5 to 12 m at opposite sides of a variable temperature cryostat which contains a 6.5 T superconducting magnet. The detectors, the coded centre-of-gravity position read-out method employed, the associated electronics and computer software are described in detail. Operational characteristics and results are presented. A net detection efficiency of 6% and an angular resolution of 0.21 x 0.31 mrad 2 (0.029 x 0.042 a.u. 2 ) are reproducibly obtained. Parameters affecting the performance of the system are discussed. An improvement of the efficiency to over 10% by relatively simple measures is foreseen

  8. Signature of Fermi surface jumps in positron spectroscopy data

    International Nuclear Information System (INIS)

    Adam, G.; Adam, S.

    1998-12-01

    A subtractionless method for solving Fermi surface sheets (FSS), from measured n-axis-projected momentum distribution histograms by two-dimensional angular correlation of the positron-electron annihilation radiation (2D-ACAR) technique, is discussed. The window least squares statistical noise smoothing filter described in Adam et al., NIM A, 337 (1993) 188, is first refined such that the window free radial parameters (WRP) are optimally adapted to the data. In an ideal single crystal, the specific jumps induced in the WRP distribution by the existing Fermi surface jumps yield straightforward information on the resolved FSS. In a real crystal, the smearing of the derived WRP optimal values, which originates from positron annihilations with electrons at crystal imperfections, is ruled out by median smoothing of the obtained distribution, over symmetry defined stars of bins. The analysis of a gigacount 2D-ACAR spectrum, measured on the archetypal high-T c compound Y Ba 2 Cu 3 O 7-δ at room temperature, illustrates the method. Both electronic FSS, the ridge along Γ Χ direction and the pillbox centered at the S point of the first Brillouin zone, are resolved. (author)

  9. Kemunduran Dan Perkembangan Politik Turki Uthmani

    Directory of Open Access Journals (Sweden)

    Bisri Djalil

    2017-03-01

    Full Text Available The Caliphs Rashidin era is a period where the expansion of Islam is increasing, this is followed by Daula Umayyad and Abbasid Daula. Furthermore, the Turkish Uthmani Empire replace The Daulah Abbasid with the breadth of his domain. Unfortunately during Uthmani Turkey is not a lot of developments in science are successfully obtained, not as much as during the Abbasid Daula. After the death of Sultan Sulayman al-Qanuni year 974 AH / 1566 AD As a huge kingdom, the Ottoman Turks gradually decline. Substitute Sultan Sulaiman al-Qanuni turned out to be more concerned with themselves, their morale even worse, so inevitably the Ottoman empire in decline. Sometimes the area is reduced due to losing the war, sometimes growing again, then decline again. This lasted until the XXI century. Mustafa Kemal Pasha was a brilliant military cadres in a career. With the concept, he wants to make Turkey a secular state that is no longer an empire. With all the efforts and the movement of his dreams come true. In 1924 the Republic of Turkey was proclaimed by Mustafa Kemal Pasha as President and as Prime Minister Ismet Inonu.

  10. The battle of Gallipoli: The politics of remembering and forgetting in Turkey

    Directory of Open Access Journals (Sweden)

    Yücel Yanıkdağ

    2015-02-01

    Full Text Available Differences in the competing versions of public memory for the Battle of Gallipoli have become more pronounced as we approach 18 March 2015 (in Turkey 18 March, the naval battle, marks the anniversary, not the landing of 25 April. For many decades, the official nationalist narrative portrayed Gallipoli as a “rehearsal” for or even as part of the War of Independence (1919-1922.  The victory was due almost solely to the military genius of Mustafa Kemal. This public memory might have been dominant for decades, but competing versions also developed. This article will largely deal with what can be called the Islamized or “religionised” memory of Gallipoli.  For some who adhere to this view, Gallipoli is where the “Turkish” soldier stopped the last Crusaders. For others, their version of the battle does not include Mustafa Kemal. Yet, both sides have something in common as they prepare to celebrate the victory. Both the nationalist and the Islamist memories ignore the possible connections to another event which is remembered on 24 April, the day before the Entente landing in Gallipoli: the order given for the deportation of Anatolian Armenians. The “celebration” for one is likely to overwhelm the remembrance and mourning of the other.

  11. Generalized fault tree analysis combined with state analysis

    International Nuclear Information System (INIS)

    Caldarola, L.

    1980-02-01

    An analytical theory has been developed which allows one to calculate the occurrence probability of the top event of a fault tree with multistate (two or more than two states) components. It is shown that, in order to correctly describe a system with multistate components, a special type of boolean algebra is required. This is called 'boolean algebra with restrictions on variables' and its basic rules are the same as those of the traditional boolean algebra with some additional restrictions on the variables. These restrictions are extensively discussed in the paper. It is also shown that the boolean algebra with restrictions on variables facilitates the task of formally combining fault tree analysis with state analysis. The computer program MUSTAFA 1 based on the above theory has been developed. It can analyse fault trees of system containing statistically independent as well as dependent components with two or more than two states. MUSTAFA 1 can handle coherent as well as non coherent boolean functions. (orig.) 891 HP/orig. 892 MB [de

  12. İbrahim Süreyya Bey (Yiğit ’in Hayatı ve Parlamenter Faaliyetleri İbrahim Süreyya Bey (Yiğit’s Life And Parliamentary Activities

    Directory of Open Access Journals (Sweden)

    Vicdan ÖZTÜRK

    2013-07-01

    Full Text Available In this article, life and parliamentary activities of İbrahim Süreyya Yiğit who first saw the light of day in the last period of Ottoman Empire and who witnessed decline of the Empire and struggled to save it were addressed. Having graduated from Faculty of Political Sciences, İbrahim Süreyya entered upon his career in duty position. He lived out nearly best part of his life with risky adventures. During his biennial officialism process, his relationship with the Party of Union and Progress caused him to stay in Sinop prison in repressive days of the period of II. Abdülhamit. In subsequent years after his three year imprisonment, Party of Union and Progress came into power; therefore he continued his mission with administrative duties. While İbrahim Süreyya was a provincial district governor in one of Rumelian lands, Turco- Italian War broke out; therefore he resigned from his administrative duty without any hesitation and crusaded as a volunteer. In this war, he entered into Mustafa Kemal’s service and their friendship which would last for long years began. When İbrahim Süreyya was governor of Gallipoli during First World War years, their paths with Mustafa Kemal crossed again. İbrahim Süreyya experienced trashing of war actually and he was one of the people who commenced struggle in Anatolia by taking chances with his intimate friend Mustafa Kemal during catasrtophic days in which enemies were trying to split the country. İbrahim Süreyya who took sides with Mustafa Kemal even after War of Independence and who was one of the individuals having established a state from wrecks of the war, served in the government throughout his life lasting till 1950s. Bu makalede Osmanlı Devletinin son döneminde hayata gözlerini açan ve imparatorluğun çöküşüne şahitlik ederek, onu kurtarma mücadelesi veren İbrahim Süreyya Bey (Yiğit’in hayatı ve parlamenter faaliyetleri ele alınmaktadır. Mekteb-i Mülkiye’yi bitirdikten

  13. Politics of Counter-Memory in Turkey: Docudramatizing the Past as a Panacea for Official Discourses?

    Directory of Open Access Journals (Sweden)

    Nuran E. Işik

    2011-04-01

    Full Text Available Le passé de la République turque de même que la vie de Mustafa Kemal Atatürk (le fondateur de la République ont toujours été narrés à travers des rituels mémoriels, des discours et des annonces officielles, des célébrations, des films et des rapports qui ont créé un ensemble de pratiques redramatisant les événements et figures historiques. Les narrations historiques révèlent une lutte entre différentes voix et idéologies, lutte qui constitue une importante clé pour comprendre les projections sur l’avenir. La production du docudrame Mustafa fondée sur l’idée d’une lecture alternative de l’histoire de la République et d’Atatürk conduit à une individualisation de l’histoire. Le documentaire couvre la vie d’Atatürk’s de façon à révéler des détails ou des anecdotes inconnues sur sa vie privée qui n’ont jamais été couverts dans ce genre de production. Ce faisant, le texte se définit comme un contre discours en opposition aux discours officiels qui ont notamment célébré ses accomplissements militaires et son rôle dans l’établissement de l’État-nation. La première partie de l’article porte sur le background historique dans lequel l’historiographie turque a employé des formes symboliques de légitimation comme modes de pouvoir et de domination. En tant que réponse aux discours hégémoniques, une historiographie critique et démocratique a influencé des travaux en histoire populaire comme des documentaires, des biographies et autres genres. Dans la seconde partie du texte, Mustafa, en tant que discours d’une contre histoire, est décrit. Il est montré que la relecture proposée par le docudrame donne une opportunité pour comprendre les importantes divisions politiques et culturelles en Turquie. Nous terminons en soulignant que Mustafa nous aide à délimiter les lignes de pensée idéologiques autour de l’essentialisme et du relativisme qui sont tous les deux problématiques

  14. The Different Western Perception of the Oriental Moor in the Renaissance and the Twentieth Century: Shakespeare's Othello and Tayeb Salih's Season of Migration to the North: A Post-Colonial Critique

    Directory of Open Access Journals (Sweden)

    Hussein A. Alhawamdeh

    2013-05-01

    Full Text Available This paper comparatively explores the different experience of the Muslim Orient - namely, Othello in Shakespeare's Othello (1604 and Mustafa Saeed and the narrator in Salih's Season of Migration to the North (1966 - in the West. It aims at relocating the transformation of the discourse of Orientalism from Renaissance, as represented by Shakespeare's Othello, to the post-eighteenth century, as represented by Salih's Season of Migration to the North. By contrasting the West and the Crescent, from power relations' vantage, this study highlights the historical difference of the western perception of the Orient from a colonizer, liberator, and guide to the West, as in Shakespeare's Othello, to a colonized subject, as in the characters of Mustafa Saeed and the narrator in Season of Migration. This paper bridges the gap left by modern scholarship which either focuses only on applying post-colonial theory on Salih's novel or neglects its resonance to Shakespeare's Othello in terms of power relations' vantage. Salih's novel laments, rather than deconstructs, the Renaissance Shakespearean powerful Moor, as represented by Othello in Shakespeare's Othello.

  15. CENGİZ DAĞCI’NIN “O TOPRAKLAR BİZİMDİ” ROMANINA TARİH EDEBİYAT İLİŞKİSİ AÇISINDAN BİR YAKLAŞIM

    Directory of Open Access Journals (Sweden)

    Reyhan Celik

    2014-05-01

    Full Text Available It is wellknown that the literary texts are influenced by the history from past to the present. Everything as sociated with people is inside the history. Likewise, the main element of the literature is also human. While some of the literary texts have traces of the period it has been written, some of the mare influenced totally from the historical events of the period it was told. History, which is a leading factor in the life of the society and literature is reflected in a very impressive way by the Works of Cengiz Dağcı, the one of Cremiean - Tatar writers. The change of the Crimea and the Crimean people revealed in this period, who have passed from the protection of Russian under the protection of the German. In this work, the novel ‘That Land Was Ours’, which has been costructed on the events that has been experienced will be evaluated in terms of there lationship between history and literature.

  16. Viking gemiciliği

    OpenAIRE

    ÖZBEY, Muhammet Talha

    2015-01-01

    Moğolların, hükümdarları Cengiz Han (1206-1227) önderliğinde karada kat ettiği mesafenin bir benzerine, bundan yaklaşık dört yüzyıl önce İskandinavlar Viking çağında (İS. 793-1066) zamanın bilinen ve ötesindeki coğrafya içerisindeki akınlarıyla ulaşmışlardı. Farklı bölgelerdeki İskandinavların bir kısmı akıncı hüviyetine bürünmüşken bir diğer kısmı da tüccar kimliğindedir. Ticaret ile uğraşan İskandinavların yerleşimleri doğal sonuç olarak ortaya çıkarken, istilaları takip eden süreç...

  17. Osmanlı’da Bir Darbe ve Tahlili: Genç Osman Örneği A Coup in Ottoman Empire And Its Analysis: Genç Osman Example

    Directory of Open Access Journals (Sweden)

    Hasan YAŞAROĞLU

    2013-09-01

    Full Text Available The New Order (Nizam-ı Cedit movements started in period of Selim The third (III. Selim of Otttoman sultans, is an important step taken toward westernization. Some sultans in last period of Ottoman Empire have also strived to take similar steps. There are records of initiation for reform movements even during period of Mustafa The Third (III. Mustafa, father of Selim The Third (III. Selim. When we went back to more in time, The Lale Devri (The Tulip Period emerges. The Tulip Period (Lale Devri despite the term being at the forefront of pleasure and deligth, some steps have been taken at this time in the direction of the westernization/renewal. The period of Sultan Osman The Second (II Osman forms the first steps taken toward renewal. Unfortunately, an uprising movement has ended the mentioned period above. Both this first Ottoman innovation movement and the first Ottoman insurrection that terminated the innovation are of importance in terms of being sample for the next ones. After these events, most of the reform movements, which emerged in the Ottoman Empire, have shared the same fate as Genç Osman reform movement.Upon his uncle Mustafa The First (I. Mustafa being jailed, Genç Osman (Young Othman became the Ottoman Sultan, but Othman has soon attracted the wrath of Janissaries and the Ulema due to his tough attitude. This hatred increased in time when Sultan Othman personally assumed the supreme commander in chief of army and decided to go to Mecca for pilgimage and eventually turned into a rebellion. The coup that was started under the leadership of Janissary and Sipahi units, and the rebels, strengthened the next day with the participation of scholars, relied on the Palace’s door to inform their demands. Genç Osman (Young Othman initially rejected the demands of the rebels, but he but was unable to sustain his attitude over the time. The rebels, at the end, entered the Palace, and have taken the Sultan’s uncle Mustafa The first (I

  18. Nested Fermi surfaces and order in the rare earth nickel borocarbides and copper palladium alloys

    International Nuclear Information System (INIS)

    Wilkinson, Ian

    2002-01-01

    The electronic structure of two systems, each displaying a different type of order believed to derive from their respective Fermi surface topologies, has been investigated using the two-dimensional angular correlation of annihilation radiation (2D-ACAR) technique. A particular topological feature of a generic rare earth nickel borocarbide (general formula RNi 2 B 2 C) Fermi surface is popularly believed to be responsible for a particular modulated arrangement of local moments observed in several magnetic borocarbides. Accordingly, c-axis 2D-ACAR spectra were collected from four representative members of the series, namely the Er, Tm, Yb and Lu compounds. A further a-axis projection from LuNi 2 B 2 C provides an additional comparison with electronic structure calculations performed for this compound. The c-axis projected k-space electron occupancies reveal a fundamentally similar Fermi surface topology across the measured compounds. The a- and c-axis k-space occupancies obtained from LuNi 2 B 2 C showed exceptional qualitative agreement with the corresponding calculated electron occupancy. A number of edge-detection methods were employed to identify the projected Fermi surface, and the existence of the proposed feature was confirmed by direct observation in each of the measured compounds. Calipers of this feature were found to be in good general agreement with those predicted by relevant calculation and expected from indirect experimental evidence. The compositional phase behaviour of copper-palladium solid solutions is believed to be strongly influenced by the shape of their respective Fermi surfaces. In particular, the concentration-dependent positions of diffuse peaks in electron and X-ray diffraction patterns from disordered samples has been associated with the corresponding evolution of flat, parallel areas on the alloy Fermi surface. Electronic structure calculations indicate these areas to be maximal around 40 at. % Pd, and it has been further suggested that

  19. Analysis of sub-nano spaces by positron annihilation spectroscopy

    International Nuclear Information System (INIS)

    Jean, Y.C.; Liu, J.; Huang, C.M.; Dai, G.H.; Yuan, J.P.

    1994-01-01

    Positron annihilation spectroscopy (PAS) has been realized to be a novel and potentially powerful tool to evolve the open spaces in the range 1-20 angstrom in molecular systems. Due to the repulsive force between the positron (the anti-particle of the electron) and the cores, annihilation signals are solely contributed from the open spaces, such as vacancies, holes, and voids in the molecular subtracts under study. By further developing two PAS techniques, positron lifetime (PAL), and angular correlation (ACAR), the authors are able to obtain useful and important information of: hole sizes, distributions, hole fractions, and anisotropic structures at sub-nano scales. Applications of PAS to chemical analysis, surface chemistry of inner pores, and polymer sciences are discussed

  20. Recent developments in the theory of positrons at surfaces

    International Nuclear Information System (INIS)

    Walker, A.B.

    1989-01-01

    Positron beams of ever brighter intensity are now establishing themselves as a novel surface probe enabling a wide variety of spectroscopies. The production of high positron intensities and exploitation of the beams depends critically on our understanding of the complex behaviour of positrons at and near surfaces. I will review progress on the theory of positron-surface interactions and of the implantation and diffusion of low energy positrons. Applications of this theory to a variety of experimental techniques such as ACAR (Angular Correlation by Annihilation Radiation) spectra, angle resolved positronium (Ps) spectroscopy, REPELS (Reemitted Positron Energy Loss Spectroscopy), LEPD (Low Energy Positron Diffraction) and measurements of defect profiles will be discussed. 24 refs. (author)

  1. Electronic structure in Bi2Sr2CaCu2O8 studied by two dimensional angular correlation of positron annihilation radiations

    International Nuclear Information System (INIS)

    Kondo, H.; Kubota, T.; Nakashima, N.; Tanigawa, S.; Minami, F.; Takekawa, S.

    1992-01-01

    Electronic structure in one of high-Tc-sperconducting materials, Bi 2 Sr 2 CaCu 2 O 8 , was studied by two dimensional angular correlation of positron annihilation radiations (2D-ACAR). The measurements were performed for Bi 2 Sr 2 CaCu 2 O 8 at room temperature and 24K; in the normal and superconducting states. The three dimensional electron momentum density ρ(p) has been reconstructed by using the image reconstruction technique based on a direct Fourier transportation. The reconstructed electron momentum density ρ(p) has been reduced into the reduced electron momentum density n(k) by using the LCW folding procedure. They are compared with that for Cu and Si. The difference in the density distributions between both states was observed. This may be attributed to the smearing by the reduced thermal momenta of positrons. But there is a possibility that the difference is due to the phase transition

  2. Analysis on the Level of Assertiveness of the Athletes Took Part in Eliminations for Adults Taekwondo National Team

    Directory of Open Access Journals (Sweden)

    Taner YILMAZ

    2015-07-01

    Full Text Available Several elements may affect assertiveness. Woman's traditional sister or caretaker role causes her sometimes to become aggressive by behaving in a stiff, authoritarian way and sometimes passive. The aim of this study is to research the level of as sertiveness of the athletes took part in the Turkey Taekwondo National Team eliminations in 2014. 106 males at the average age of 21, 12 and 56 females at the average age of 20,39 took part in the research. RAE (Rathus Assertiveness Schedule developed by Rathus in 1977 and adapted to Turkish by Nilüfer Voltan Acar (1980 was used to determine the level of assertiveness. In conclusion, no significant difference was found between males and females in terms of assertiveness level scores.

  3. Study of the density of electrons in momentum space in the Al-Li-Cu icosahedral phase by means of positron annihilation

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Yoshikazu; Nanao, Susumu [Institute of Industrial Science, The University of Tokyo, Roppongi, Minato, Tokyo 106 (Japan); Tanigawa, Shoichiro [Institute of Materials Science, University of Tsukuba, Tsukuba, Ibaraki 305 (Japan)

    1997-12-15

    The three-dimensional momentum density of annihilating electron - positron pairs has been studied for a single Al-Li-Cu icosahedral quasicrystal. A direct Fourier transform method is employed to reconstruct the three-dimensional momentum density from measurements of the two-dimensional angular correlation of positron annihilation radiation (2 D-ACAR). The crystallographic anisotropy in the momentum density is observed to be very small. The asphericity of the Fermi surface is not found explicitly within the experimental resolution in the momentum space. The features of the three-dimensional electron - positron momentum density agree with those obtained by means of Compton profile measurement. It is suggested that a strong lattice - electron interaction at the Fermi level occurs in this icosahedral phase. (author)

  4. Lithium ion implantation effects in MgO(100)

    International Nuclear Information System (INIS)

    Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Labohm, F.; Schut, H.; Mijnarends, P.E.; Kooi, B.J.; Hosson, J.T.M. de

    2001-01-01

    Single crystals of MgO(100) were implanted with 10 16 6 Li ions cm -2 at an energy of 30 keV. After ion implantation the samples were annealed isochronally in air at temperatures up to 1200K. After implantation and after each annealing step, the defect evolution was monitored with optical absorption spectroscopy and depth-sensitive Doppler Broadening positron beam analysis (PBA). A strong increase in the S-parameter is observed in the implantation layer at a depth of approximately 100 nm. The high value of the S-parameter is ascribed to positron annihilation in small lithium precipitates. The results of 2D-ACAR and X-TEM analysis show evidence of the presence of lithium precipitates. The depth distribution of the implanted 6 Li atoms was monitored with neutron depth profiling (NDP). It was observed that detrapping and diffusion of 6 Li starts at an annealing temperature of 1200K. (orig.)

  5. Optimized coincidence Doppler broadening spectroscopy using deconvolution algorithms

    International Nuclear Information System (INIS)

    Ho, K.F.; Ching, H.M.; Cheng, K.W.; Beling, C.D.; Fung, S.; Ng, K.P.

    2004-01-01

    In the last few years a number of excellent deconvolution algorithms have been developed for use in ''de-blurring'' 2D images. Here we report briefly on one such algorithm we have studied which uses the non-negativity constraint to optimize the regularization and which is applied to the 2D image like data produced in Coincidence Doppler Broadening Spectroscopy (CDBS). The system instrumental resolution functions are obtained using the 514 keV line from 85 Sr. The technique when applied to a series of well annealed polycrystalline metals gives two photon momentum data on a quality comparable to that obtainable using 1D Angular Correlation of Annihilation Radiation (ACAR). (orig.)

  6. Positron-electron autocorrelation function study of E-center in phosphorus-doped silicon

    International Nuclear Information System (INIS)

    Ho, K.F.; Beling, C.D.; Fung, S.; Biasini, M.; Ferro, G.; Gong, M.

    2004-01-01

    Two dimensional fourier transformed angular correlation of annihilation radiation (2D-FT-ACAR) spectra have been taken for 10 19 cm -3 phosphorus-doped Si in the as grown state and after being subjected to 1.8 MeV e - fluences of 2 x 10 18 cm -2 . In the spectra of the irradiated samples, the zero-crossing points are observed to displace outwards from the bravais lattice positions. It is suggested that this results from positrons annihilating with electrons in localized orbitals at the defect site. An attempt is made to extract just the component of the defect's positron-electron autocorrelation function that relates to the localized defect orbitals. It is argued that such an extracted real-space function may provide a suitable means for obtaining a mapping of localized defect orbitals. (orig.)

  7. [The prevalence of intestinal parasitism in native villages of the Tembé tribe, the Brazilian eastern Amazon].

    Science.gov (United States)

    Miranda, R dos A; Xavier, F B; Nascimento, J R; de Menezes, R C

    1999-01-01

    To determine the prevalence of intestinal parasitism in the Tembé settlements, parasitological examination was performed in December 1996 in the entire population (93 Indians). Hookworms were found in 29.0%, A. lumbricoides in 34.4%, E. histolytica in 12.9%, and G. lamblia in 4.3% of the individuals. The Turé-Mariquita settlement had the highest prevalence of hookworms and A. lumbricoides, while Acará-Mirim had the highest prevalence of E. histolytica and G. lamblia. No differences in mean age were found between Indians with parasites and Indians without parasites. The association between intestinal parasites and sex was nonsignificant, except for the prevalence of hookworms, which was very high in males (38.6%) compared to females (20.4%). The study showed a high prevalence of some intestinal parasites in the Tembé settlements, indicating that primary and secondary health measures should taken immediately for the prevention of intestinal parasitoses.

  8. Turkish Independence War and its consequences

    Directory of Open Access Journals (Sweden)

    Alexandru‑Nicolae Cucu

    2014-11-01

    Full Text Available At the end of the First World War, the Ottoman Empire collapsed and the Great Powers came to take the control of its territories. Having a strategic position at the southern gate of Europe, all of Turkish lands were very important for the First World War winners, both to secure European borders and to develop the trade between Europe and Middle East. On the other side, under Mustafa Kemal Atatürk command, a new Turkey with a strong nationalist way decided to fight for emancipating. Winning the war with the Great Powers not only in a military way, but also from a diplomatic perspective, the new Turkey became a modern regional power, having institutions and laws that assured its prosperity and security. Taking into consideration the independence war evolution, this paper wants also to show the diplomatic capability of Turkish leaders to balance between powers involved in the region.

  9. Jejak Praktik Militerisme dalam Puisi Indonesia

    Directory of Open Access Journals (Sweden)

    Yulitin Sungkowati

    2007-12-01

    Full Text Available The existence of military in a country does not automatically mean militarism. However, during the New Order era, militarism was used to dominate political life and became a power shield as an excuse to maintain national stability. The military practice could be seen, among other things in Indonesian literary works, particularly in Wiji Thukul's, Rendra's, Eka Budianta's, and K.H. A. Mustafa Bisri's writing as a reflection of his period. These poems depict military action in the New Order power such as in the land reform case, workers protest, and the 27th of July incident. Military action has become a violent pattern to silence these unpleasant incidents. Some critical activists experienced these violent actions such as terror, kidnapping, and torturing,

  10. SOME WORKS ON CHILDEREN’S PHILOSOPHY IN MODERN CHILDEREN’S LITERATURE / GÜNÜMÜZ ÇOCUK EDEBİYATINDAN SEÇİLMİŞ ÇOCUK FELSEFESİ ÖRNEKLERİ

    Directory of Open Access Journals (Sweden)

    Assoc. Prof. Dr. Zeki KARAKAYA

    2006-12-01

    Full Text Available In this article, some works on children literature, which included children philosophy directly or indirectly by means of literary fiction, have been examined. The first work, Aşk Olsun Çocugum Aşk Olsun! of Mustafa Ruhi Sirin, is the first poem on children philosophy in Turkey. The second work, Sofi’nin Dünyası (Sofi’s World, is the novel of Jostein Gaarder that tells of the history of western philosophy through simple fiction. The processed third work is Küçük Prens (Small Prince by Antoine de Saint- Exupery. The last work, Gülibik, is a long story by Cetin Öner. To find out philosophical surface and deep structure in the literary works, the analytical methods of semiotics, text linguistics and pragmatics were used in this study.

  11. LA TURQUIE AU DEBUT DE CHEMIN 1919 - 1923

    Directory of Open Access Journals (Sweden)

    Ionuţ COJOCARU

    2010-11-01

    Full Text Available Decline of the Ottoman Empire has used its last sta ge when World War I until the proclamation of the Republic of Turkey on October 29, 1923. Political and social changes have marked the country into two camps: supporters of the Sultanate and the nationalists led by Mustafa Kemal. Lasting conflict, both the Greeks and the Franco-British nationalists have gained ground and tilted the scales in their favor to end dynasty succeeded Osman. On the morning of November 17, last Sultan and his son ascended the British ship "Malaya" and fled. After the conflict, the Turks were invited to Lausanne where they were presented to winners. From this position they began negotiations. For Romania, the Convention in its final form became beneficial, because our perspective was adopted, and our interest to take the path through the straits has been approved.

  12. MUSICAL TERMS IN DIVAN OF NEV'Î / NEV’Î DİVÂNI’NDA MÛSİKÎ TERİMLERİ

    Directory of Open Access Journals (Sweden)

    Mehmet Sait ÇALKA (M.A.H.

    2008-05-01

    Full Text Available Along with history, the music has taken an important place in Turkslife, as an expression of melancholy, happiness, heroism, exitement, and love.Music in Turks is old, as old as Turk history. Some history and musicscientists talk about 6000 years of Turkish Music History. Music took animportant place especially at the Ottoman Emperior Times. This situation ishappened at the times of II. Murat, II. Beyazıt, IV. Murat, II. Mustafa, III.Ahmet, III. Selim, II. Mahmut, due to their extra worth on music. Demand tomusic also effected the literature, and thus the divan poets used musicalterms in their performance.In our work, we are going to stress on 16th Century Divan PoetNev's musical components.

  13. Algorithms and programs for evaluating fault trees with multi-state components

    International Nuclear Information System (INIS)

    Wickenhaeuser, A.

    1989-07-01

    Part 1 and 2 of the report contain a summary overview of methods and algorithms for the solution of fault tree analysis problems. The following points are treated in detail: Treatment of fault tree components with more than two states. Acceleration of the solution algorithms. Decomposition and modularization of extensive systems. Calculation of the structural function and the exact occurrence probability. Treatment of statistical dependencies. A flexible tool to be employed in solving these problems is the method of forming Boolean variables with restrictions. In this way, components with more than two states can be treated, the possibilities of forming modules expanded, and statistical dependencies treated. Part 3 contains descriptions of the MUSTAFA, MUSTAMO, PASPI, and SIMUST computer programs based on these methods. (orig./HP) [de

  14. A tribute to friends

    CERN Multimedia

    2007-01-01

    CERN commemorates the lives of those who passed away in the Isparta plane crash on 30th November. The news of the untimely deaths of six Turkish physicists, Engin Arik, Berkol Dogan and Engin Abat from Bogazici University, and Senel Boydag, Iskender Hikmet and Mustafa Fidan from Dogus University, on a flight from Istanbul to Isparta on Friday 30th November was sad for us all, but felt especially by those who worked closely with them. The physicists were travelling to a workshop on the "Turkish Accelerator Centre", a project involving a collaboration of ten Turkish universities. Some of those who passed away were world-renowned physicists whilst others were young, talented and just starting their careers. Here they are remembered in tributes from those who knew them and worked beside them. In a message to the Turkish mission in Geneva, CERN Director General, Robert Aymar, expressed his sorrow at hearing the news: "This is a great loss ...

  15. Presentación. Alberto Elena y las miradas a los cines periféricos / Presentation. Alberto Elena and the Views on Peripheral Cinemas

    Directory of Open Access Journals (Sweden)

    Minerva Campos

    2016-12-01

    Full Text Available «Llegará un día en que el cine habrá cambiado el mundo más que la invención de la pólvora, la electricidad o el descubrimiento de nuevos continentes. El cine permitirá a la gente repartida por los más remotos confines de la Tierra conocerse y apreciarse mejor. El cine reconciliará las diferencias de opinión y contribuirá de forma decisiva a la realización de los ideales de la Humanidad. Es fundamental que concedamos al cine la importancia que merece». Mustafa Kemal Atatürk (1937

  16. Atatürk'ün Ekonomik Reformları ve Türkiye Ekonomisine Etkileri (1923-2002 = Economic Reforms of Ataturk and Their Effects on Turkish Economy (1923-2002

    Directory of Open Access Journals (Sweden)

    Esat ÇELEBİ

    2002-01-01

    Full Text Available At the end of I. World War, the economy of the Ottoman Empire was at the point of bankruptcy, just as were her educational and social institutes From the very first day of new Turkish Republic, Mustafa Kemal Atatürk, founder of the Turkish Republic launched new economical reforms, along with reshaping the social and educational institutes. The present study focuses in detail on the cited reforms. Moreover, Atatürk's new economical models, and strategies were also presented. Some important economical figures for the years from 1923 to 1938 along with their impact on the Turkish economy for the years 1938-2002, are also given. To comprehand and appreciate the meaning and importance of economical reforms to the country and people, todays, general economical picture, supported with some important data, are presented, emphasising the most recent bottlenecks of the Turkish economy.

  17. Türkiye Cumhuriyeti’nin İlk Yıllarında Türk-Rus Ticari ve Ekonomik İlişkileri Üzerine

    OpenAIRE

    KORHAN, Tugba

    2014-01-01

    Birinci Dünya Savası ve ardından imzalanan Sevr Barıs Antlasması’ndan sonra Mustafa Kemal Pasa önderliginde Milli Mücadele baslamıs ardından Genç Türkiye Cumhuriyeti kurulmustur. Yeni Devlet, Osmanlı Devleti’nden borçlu kalan ekonomik mirasın üzerinde, bir taraftan emperyalist güçlere karsı varlıgını devam ettirmeye çalısırken bir taraftan da sanayilesme yoluyla ekonomik kalkınmak için Rusya’dan destek almıs ve böylece iki ülke arasındaki tarihsel iliskililer ve komsuluk bagları dönemde...

  18. De Novo Biosynthesis of Vanillin in Fission Yeast (Schizosaccharomyces pombe) and Baker's Yeast (Saccharomyces cerevisiae) ▿

    Science.gov (United States)

    Hansen, Esben H.; Møller, Birger Lindberg; Kock, Gertrud R.; Bünner, Camilla M.; Kristensen, Charlotte; Jensen, Ole R.; Okkels, Finn T.; Olsen, Carl E.; Motawia, Mohammed S.; Hansen, Jørgen

    2009-01-01

    Vanillin is one of the world's most important flavor compounds, with a global market of 180 million dollars. Natural vanillin is derived from the cured seed pods of the vanilla orchid (Vanilla planifolia), but most of the world's vanillin is synthesized from petrochemicals or wood pulp lignins. We have established a true de novo biosynthetic pathway for vanillin production from glucose in Schizosaccharomyces pombe, also known as fission yeast or African beer yeast, as well as in baker's yeast, Saccharomyces cerevisiae. Productivities were 65 and 45 mg/liter, after introduction of three and four heterologous genes, respectively. The engineered pathways involve incorporation of 3-dehydroshikimate dehydratase from the dung mold Podospora pauciseta, an aromatic carboxylic acid reductase (ACAR) from a bacterium of the Nocardia genus, and an O-methyltransferase from Homo sapiens. In S. cerevisiae, the ACAR enzyme required activation by phosphopantetheinylation, and this was achieved by coexpression of a Corynebacterium glutamicum phosphopantetheinyl transferase. Prevention of reduction of vanillin to vanillyl alcohol was achieved by knockout of the host alcohol dehydrogenase ADH6. In S. pombe, the biosynthesis was further improved by introduction of an Arabidopsis thaliana family 1 UDP-glycosyltransferase, converting vanillin into vanillin β-d-glucoside, which is not toxic to the yeast cells and thus may be accumulated in larger amounts. These de novo pathways represent the first examples of one-cell microbial generation of these valuable compounds from glucose. S. pombe yeast has not previously been metabolically engineered to produce any valuable, industrially scalable, white biotech commodity. PMID:19286778

  19. Atividade pesqueira dos índios Mura no Lago Ayapuá, Baixo Rio Purus, Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Artur Bicelli Coimbra, M.Sc.

    2017-03-01

    Full Text Available The artisanal fisheries has great importance forthe Amazonian indigenous communities, as a form of subsistence, and for the cultural and tradition of these communities. In this study, we analyzed the fishery developed in four indigenous communities of the Mura people indigenous of the Lake Ayapuá Land,in the lower Purus River. The fishes were classified according to the composition and importance of the species in weight and number of DOI: http://dx.doi.org/10.20873/uft.2359-3652.2017v4n1p115Revista Desafios –v. 04, n. 1, 2017116individuals, structure and size of the individuals captured, and total weight of the catches, between October and December of 2008. The most commercialized species were the Aruanã (Osteoglossumbicirrhosum, the pescada (Plagioscionsquamosissimus, the "feras" or big catfish (dourada, Brachyplatystomarousseauxiiand the filhote Brachyplatystomafilamentosum and the tucunaré (Cichlamonoculus. The most commonly consumed species were aruanã, tucunaré, piranha-caju (Pygocentrusnattereri and acará-açu (Astronotuscrassipinni. Species such as tucunaré and pescada have catch sizes within the standards permitted by legislation. However, acará-açu, aruanã, tambaqui (Colossomamacropomum, surubim (Pseudoplatystomapunctifer, caparari (Pseudoplatystomatigrinum, filhote and dourada do not have the same legal standard. Most of the production (87% was destined for commercialization with Fish buyer. Preventive and mitigating measures are proposed to ensure the permanence of fish stocks and consequently the sustainability of fishing and the maintenance of the local population.

  20. a Positron Study of the Electronic Structure of Yttrium Barium Copper Oxide.

    Science.gov (United States)

    Haghighi, Hossein

    The work described in this thesis is concerned with a study of the electronic structure of the high T _{c} superconductor YBa _2Cu_3O _7 using the technique of two dimensional angular correlation of annihilation radiation (2D-ACAR). We have studied this compound with a view to clarifying whether YBa_2Cu_3O _7 possess a Fermi surface. The numerous different theories that have been proposed to explain the superconductivity phase of these types of materials can be classified into two main groups. The theories in the first group assume the existence of a conventional Fermi fluid and Fermi surface. The alternative more exotic models do not require a Fermi surface but are based on the Mott-Hubbard model of strongly correlated charge and spin excitations. Prior to this work all 2D-ACAR studies of YBa _2Cu_3O _7 involved twinned crystals and modest statistics and little of significance was learned other than that, consistent with that of predictions of theory, the positron was preferentially annihilating on the copper-oxygen chains. The studies of untwinned crystals of YBa_2Cu _3O_7, herein described are of much higher statistics and resulted in one of the clearest imaginable manifestations of a Fermi surface in the form of an extended discontinuity in the measured momentum spectrum. This discontinuity is even more apparent in the LCW-folded spectrum with a form and profile in substantial agreement with the theoretical predictions of a Gamma-X electron ridge Fermi surface section arising from states in the Cu-O chains.

  1. Off-line analysis of positron annihilation spectra. II. Defining crystal frame origin

    International Nuclear Information System (INIS)

    Adam, Gh.; Adam, S.

    1997-01-01

    This paper is devoted to the consistent definition of the origin Γ of the crystal frame (CF) of an n-axis-projected histogram (where n-vector denotes a principal crystallographic axis) obtained by the technique of the two dimensional angular correlation of positron-electron annihilation radiation (2D-ACAR). This is shown to need agreement with each other of two alternative definitions of Γ as center of symmetry and center of gravity of areas entering the signature of crystal symmetry (SCS) of the spectrum defined in a previous paper. This requirement singles out the projection of the first Brillouin zone onto the histogram plane as the area containing the information which is the least distorted by the instrumental artifacts. The derivation of Γ involves two steps described in Section 2 and 3, respectively. Consistency with each other of the obtained solutions provides a first family of validation tests. The CF validation is to be decided from the analysis of the artifact distribution in the Cf histogram. The histogram reformulation in the crystal frame is legitimate provided the Euler angle θ relating the crystal and laboratory frames is negligible . Among the criteria for the validation of the analysis of primary importance is the requirement of close agreement between the two alternative definitions of the zero-momentum projection of the momentum distribution onto the histogram plane. The histogram redefinition in the crystal frame results in specific discretization errors. To check there magnitude the SCS values are computed again and the derivation CF parameters repeated the convergence of this iterative refinement of the CF parameters offers a supplementary insight into the crystal-detector alignment and crystal quality. The described procedure is applied to three 2D-ACAR histograms

  2. Pre-Departure Clearance (PDC): An Analysis of Aviation Safety Reporting System Reports Concerning PDC Related Errors

    Science.gov (United States)

    Montalyo, Michael L.; Lebacqz, J. Victor (Technical Monitor)

    1994-01-01

    Airlines operating in the United States are required to operate under instrument flight rules (EFR). Typically, a clearance is issued via voice transmission from clearance delivery at the departing airport. In 1990, the Federal Aviation Administration (FAA) began deployment of the Pre-Departure Clearance (PDC) system at 30 U.S. airports. The PDC system utilizes aeronautical datalink and Aircraft Communication and Reporting System (ACARS) to transmit departure clearances directly to the pilot. An objective of the PDC system is to provide an immediate reduction in voice congestion over the clearance delivery frequency. Participating airports report that this objective has been met. However, preliminary analysis of 42 Aviation Safety Reporting System (ASRS) reports has revealed problems in PDC procedures and formatting which have caused errors in the proper execution of the clearance. It must be acknowledged that this technology, along with other advancements on the flightdeck, is adding more responsibility to the crew and increasing the opportunity for error. The present study uses these findings as a basis for further coding and analysis of an additional 82 reports obtained from an ASRS database search. These reports indicate that clearances are often amended or exceptions are added in order to accommodate local ATC facilities. However, the onboard ACARS is limited in its ability to emphasize or highlight these changes which has resulted in altitude and heading deviations along with increases in ATC workload. Furthermore, few participating airports require any type of PDC receipt confirmation. In fact, 35% of all ASRS reports dealing with PDC's include failure to acquire the PDC at all. Consequently, this study examines pilots' suggestions contained in ASRS reports in order to develop recommendations to airlines and ATC facilities to help reduce the amount of incidents that occur.

  3. Effect of vildagliptin add-on treatment to metformin on plasma asymmetric dimethylarginine in type 2 diabetes mellitus patients

    Directory of Open Access Journals (Sweden)

    Cakirca M

    2014-02-01

    Full Text Available Mustafa Cakirca,1 Cumali Karatoprak,1 Mehmet Zorlu,1 Muharrem Kiskac,1 Mustafa Kanat,2 Mehmet Ali Cikrikcioglu,1 Pinar Soysal,3 Mehmet Hursitoglu,4 Ahmet Adil Camli,1 Reha Erkoc,1 Muhammad Abdul-Ghani5 1Internal Medicine Clinic, Faculty of Medicine, Bezmialem Vakif University, 2Department of Internal Medicine, Medical Faculty, Istanbul Medipol University, 3Department of Geriatric Medicine, Medical Faculty, Dokuz Eylül University, 4Department of Internal Medicine, Kanuni Sultan Suleyman Training and Research Hospital, Istanbul, Turkey; 5Division of Medicine – Diabetes, University of Texas Health Science Center at San Antonio, San Antonio, TX, USA Aims: A close association has been demonstrated between increased cardiovascular risk and high asymmetric dimethylarginine (ADMA levels in type 2 diabetes mellitus (DM patients. We planned to measure serum ADMA levels in type 2 DM patients using vildagliptin, a dipeptidyl peptidase-4 (DPP-4 inhibitor. Materials and methods: A total of 68 type 2 DM patients who were on metformin were enrolled in the study. Based on the glycemic levels of patients, vildagliptin was added on to treatment in 33 patients. Patients were followed for 6 months. Serum ADMA, C-reactive protein, and fibrinogen levels were compared in groups of patients using metformin or metformin + vildagliptin, after 6 months. Results: Serum ADMA levels were found to be significantly lower in the group using vildagliptin compared to the group using metformin + vildagliptin (P<0.001. However, serum C-reactive protein and fibrinogen levels were statistically similar in the two study groups (P=0.34 and P=0.23, respectively. Conclusion: Metformin + vildagliptin treatment was observed to lower serum ADMA levels in type 2 DM patients. Our findings notwithstanding, large-scale prospective randomized controlled studies are warranted to conclude that vildagliptin provides cardiovascular protection along with diabetes regulation. Keywords: asymmetric

  4. Tasawuf Sunda dalam Naskah Asmarandana Ngagurit Kaburu Burit (OR. 7876

    Directory of Open Access Journals (Sweden)

    Jajang A. Rohmana

    2013-12-01

    Full Text Available Abstract:   The spread of Islam in the Archipelago was closely tied to the roles of Sufi ulama. The circulation of Sufi work in Nusantara proves a strong connection between this region and the Middle East. In West Java, a number of these work expose Sufi teachings in the form of Sundanese Sufi literature, such as the work by Haji Hasan Mustafa. He is considered the greatest Sundanese poet whose work features strong influences of wahdat al-wujud. This paper aims to examine Sundanese Sufism expressed in Mustafa’s work of Asmarandana Ngagurit Kaburu Burit. This study shows that this work contains Sufi’s path that explores the self and its encounters with Supreme Being and the self’s diffusion, where there is no longer existence except the One. Mustafa called his Sufi poetry imperfect suluk because it was written in late afternoon. His work reveals local Sufi accommodation to wah}dat al-wujud in Sundanese language and culture.Abstrak:   Seiringan dengan perkembangan Islam di Nusantara adalah beredarnya naskah-naskah tasawuf membuktikan adanya hubungan kuat tradisi tasawuf lokal dan Timur Tengah. Di tatar Sunda, sejumlah naskah tasawuf mengekspresikan ajarannya ke dalam bentuk sastra sufistik Sunda (dangding, guguritan. Artikel ini bertujuan untuk mengkaji ekspresi pengalaman tasawuf Sunda dalam naskah Asmarandana Ngagurit Kaburu Burit (Cod. Or. 7876 karya Haji Hasan Mustapa (1852-1930, sufi sekaligus pujangga Sunda yang dipengaruhi ajaran wa╪dah al-wujūd. Dalam naskah itu tergerai ungkapan perjalanan sufistik (susulukan sang penulisnya. Bermula pada tahap pencarian diri saat hingga mengalami pertemuan (pasamoan, sapatemon. Puncaknya adalah pengalaman membaurnya eksistensi diri (fanā’, pakula-kula dalam kesejatian sempurna di alam jatnika. Karya Mustapa ini mencirikan kreativitas lokal dalam menyerap pengaruh tasawuf wa╪dah al-wujud yang diekspresikan dengan bahasa sastra dan alam Sunda.

  5. Antileishmanial effect of silver nanoparticles and their enhanced antiparasitic activity under ultraviolet light

    Directory of Open Access Journals (Sweden)

    Allahverdiyev AM

    2011-11-01

    Full Text Available Adil M Allahverdiyev1, Emrah Sefik Abamor1, Malahat Bagirova1, Cem B Ustundag2, Cengiz Kaya2, Figen Kaya2, Miriam Rafailovich3 1Department of Bioengineering; 2Department of Metallurgical and Materials Engineering, Yildiz Technical University, Esenler, Istanbul, Turkey; 3Department of Materials Science and Engineering, Stony Brook University, Stony Brook, NY, USA Abstract: Leishmaniasis is a protozoan vector-borne disease and is one of the biggest health problems of the world. Antileishmanial drugs have disadvantages such as toxicity and the recent development of resistance. One of the best-known mechanisms of the antibacterial effects of silver nanoparticles (Ag-NPs is the production of reactive oxygen species to which Leishmania parasites are very sensitive. So far no information about the effects of Ag-NPs on Leishmania tropica parasites, the causative agent of leishmaniasis, exists in the literature. The aim of this study was to investigate the effects of Ag-NPs on biological parameters of L. tropica such as morphology, metabolic activity, proliferation, infectivity, and survival in host cells, in vitro. Consequently, parasite morphology and infectivity were impaired in comparison with the control. Also, enhanced effects of Ag-NPs were demonstrated on the morphology and infectivity of parasites under ultraviolet (UV light. Ag-NPs demonstrated significant antileishmanial effects by inhibiting the proliferation and metabolic activity of promastigotes by 1.5- to threefold, respectively, in the dark, and 2- to 6.5-fold, respectively, under UV light. Of note, Ag-NPs inhibited the survival of amastigotes in host cells, and this effect was more significant in the presence of UV light. Thus, for the first time the antileishmanial effects of Ag-NPs on L. tropica parasites were demonstrated along with the enhanced antimicrobial activity of Ag-NPs under UV light. Determination of the antileishmanial effects of Ag-NPs is very important for the further

  6. Zinc supplementation induces apoptosis and enhances antitumor efficacy of docetaxel in non-small-cell lung cancer

    Directory of Open Access Journals (Sweden)

    Kocdor H

    2015-07-01

    Full Text Available Hilal Kocdor,1,2 Halil Ates,1 Suleyman Aydin,3 Ruksan Cehreli,1 Firat Soyarat,2 Pinar Kemanli,2 Duygu Harmanci,2 Hakan Cengiz,2 Mehmet Ali Kocdor4 1Institute of Oncology, Dokuz Eylul University, 2Department of Molecular Medicine, Institute of Health Sciences, Dokuz Eylul University, Izmir Turkey; 3Department of Biochemistry, Firat University School of Medicine, Elazig, 4Department of Surgery, School of Medicine, Dokuz Eylul University, Izmir, Turkey Background: Exposure to exogenous zinc results in increased apoptosis, growth inhibition, and altered oxidative stress in cancer cells. Previous studies also suggested that zinc sensitizes some cancer cells to cytotoxic agents depending on the p53 status. Therefore, zinc supplementation may show anticancer efficacy solely and may increase docetaxel-induced cytotoxicity in non-small-cell lung cancer cells.Methods: Here, we report the effects of several concentrations of zinc combined with docetaxel on p53-wild-type (A549 and p53-null (H1299 cells. We evaluated cellular viability, apoptosis, and cell cycle progression as well as oxidative stress parameters, including superoxide dismutase, glutathione peroxidase, and malondialdehyde levels.Results: Zinc reduced the viability of A549 cells and increased the apoptotic response in both cell lines in a dose-dependent manner. Zinc also amplified the docetaxel effects and reduced its inhibitory concentration 50 (IC50 values. The superoxide dismutase levels increased in all treatment groups; however, glutathione peroxidase was slightly increased in the combination treatments. Zinc also caused malondialdehyde elevations at 50 µM and 100 µM.Conclusion: Zinc has anticancer efficacy against non-small-cell lung cancer cells in the presence of functionally active p53 and enhances docetaxel efficacy in both p53-wild-type and p53-deficient cancer cells. Keywords: lung cancer, zinc, docetaxel, A549, H1299

  7. From Editor vol 11, No.3

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2010-07-01

    students from the Department of City and Regional Development, Faculty of Architecture, Karadeniz Technical University, participated as subjects. The Second article is on “A Conceptual Model for Effective Distance Learning In Higher Education”, written by Mehran FARAJOLLAHI, Mohammad Reza SARMADI Department of Education, Payame Noor University, Tehran and Nahid ZARIFSANAEE, Center of Excellence for Elearning, Shiraz University of Medical Sciences, IRAN. The aim is that presenting a conceptual model for effective distance learning in higher education. Findings of this research shows that an understanding of the technological capabilities and learning theories especially constructive theory and independent learning theory and communicative and interaction theory in Distance learning is an efficient factor in the planning of effective Distance learning in higher education. Considering the theoretical foundations of the present research, in the effective distance learning model, the learner is situated at the center of learning environment. For this purpose, the learner needs to be ready for successful learning and the teacher has to be ready to design the teaching- learning activities when they initially enter the environment.The third articles are from Anadolu University, Turkey. The third one is on “A Blended Learning Model For Teaching Practice Course”, conducted by Mustafa CANER. In his paper discussed to introduce a blended learning environment and a model for pre-service teaching practice course in English Language Teacher Training Program at Anadolu University. It is supposed that providing a blended learning environment for teaching practice course would improve the practice and contribute to the professional growth of pre-service teachers. Since it will increase the contact hours among students and university supervisors and facilitate peer feedback among pre-service teachers, which in turn, create a productive learning environment for them. Also paper is

  8. From the Editor

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2013-10-01

    instrumental rather than social aims of education, and the use of cognitive rather than affective pedagogies. For ODL designers and teachers, this has resulted in a concentration on cognitive tasks and market-driven aspects of open and distance learning at the expense of the social harmony that might otherwise be achieved. The overarching ethical concern for ODL practitioners should be to implement an appropriate pedagogy that will satisfy both instrumental and social aims. While this can be achieved, in part, through the use of the pedagogies outlined in this paper, the problem is seen as being associated with deeply interwoven social and cultural contexts. Consequently, there is a greater responsibility for all ODL practitioners to ensure that the choices that they make are ethical at all times, irrespective of the demands of any employer, institution or authority. This paper deals with ethics in general, its role in distance education and its significance to educational institutions. The fourth article written on “E-LEARNING CHANGE MANAGEMENT: Challenges and opportunities” and written Alaattin PARLAKKILIC Departmant of Medical Informatics Gülhane Military Medical Academy, Ankara, Turkey. His paper discusses change management in transition to e-learning system considering pedagogical, cost and technical implications. It also discusses challenges and opportunities for integrating these technologies in higher learning institutions with examples from Turkey GATA (Gülhane Askeri Tıp Akademisi-Gülhane Military Medical Academy. The 5th article is arrived from again from Turkey which is written on “ Investigating Distance Education Students’ Study Skills”, written by Cengiz POYRAZ, From Hasan Ali Yucel Educational Faculty Department of Educational Sciences, Istanbul University, Istanbul He emhasis in his study that distance education, students and instructors reside in different locations. Students can learn at their pace and control their learning path, content and

  9. From Editor

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2013-10-01

    instrumental rather than social aims of education, and the use of cognitive rather than affective pedagogies. For ODL designers and teachers, this has resulted in a concentration on cognitive tasks and market-driven aspects of open and distance learning at the expense of the social harmony that might otherwise be achieved. The overarching ethical concern for ODL practitioners should be to implement an appropriate pedagogy that will satisfy both instrumental and social aims. While this can be achieved, in part, through the use of the pedagogies outlined in this paper, the problem is seen as being associated with deeply interwoven social and cultural contexts. Consequently, there is a greater responsibility for all ODL practitioners to ensure that the choices that they make are ethical at all times, irrespective of the demands of any employer, institution or authority. This paper deals with ethics in general, its role in distance education and its significance to educational institutions. The fourth article written on “E-LEARNING CHANGE MANAGEMENT: Challenges and opportunities” and written Alaattin PARLAKKILIC Departmant of Medical Informatics Gülhane Military Medical Academy, Ankara, Turkey. His paper discusses change management in transition to e-learning system considering pedagogical, cost and technical implications. It also discusses challenges and opportunities for integrating these technologies in higher learning institutions with examples from Turkey GATA (Gülhane Askeri Tıp Akademisi-Gülhane Military Medical Academy. The 5th article is arrived from again from Turkey which is written on “ Investigating Distance Education Students’ Study Skills”, written by Cengiz POYRAZ, From Hasan Ali Yucel Educational Faculty Department of Educational Sciences, Istanbul University, Istanbul He emhasis in his study that distance education, students and instructors reside in different locations. Students can learn at their pace and control their learning path, content and

  10. A pesca de pequena escala no rio Madeira pelos desembarques ocorridos em Manicoré (Estado do Amazonas, Brasil Small-scale fishery at Madeira River by fish landings in Manicoré city (Amazon State, Brazil

    Directory of Open Access Journals (Sweden)

    Renato Soares Cardoso

    2008-12-01

    Full Text Available O trabalho teve como objetivo analisar o desembarque da pesca comercial na região do Médio rio Madeira, tendo como área focal o município de Manicoré, buscando identificar as espécies explotadas, os locais de pesca e sua contribuição para o abastecimento local de pescado. O desembarque foi amostrado diariamente, utilizando questionários aplicados aos pescadores após a comercialização do pescado. Foram desembarcadas no ano de 2002 aproximadamente 225,4 toneladas de pescado. Canoas motorizadas efetuaram mais expedições de pesca, entretanto os barcos de pesca desembarcaram uma maior produção. Os valores médios de desembarque foram de 11,2; 5,4 e 2,4 toneladas por mês para barcos, canoas e compradores de pescado respectivamente, sendo as capturas compostas por 32 espécies ou grupo de espécies, sendo jaraqui (Semaprochilodus spp, pacu (Mylossoma duriventre, curimatá (Prochilodus nigricans, sardinha (Triportheus spp e jatuarana (Brycon spp, responsáveis por 75% do pescado desembarcado. Foram identificados 32 locais de pesca, sendo os mais explotados os rios Madeira e Manicoré, os lagos Acará e Boquerão e o igarapé Matupiri.The study aimed to analyze the landing of commercial fishing in Middle Madeira River, near Manicoré city, identifying the exploited species, fishing grounds and the contribution for the local supplying of fish. Fish landings were sampled daily, using questionnaires, given to fishermen after the fish sale. In 2002, 225.4 tons of fish were landed in Manicoré city. Motorized canoes undertook more fishing trips, but the higher fish landings were accomplished by boats. Mean values of fish landings were 11.2 tons/month, 5.4 tons/month and 2.4 tons/month for boats, motorized canoes and fish purchasers, respectively. 32 species or group of species were landed, with a predominance of jaraqui (Semaprochilodus spp, pacu (Mylossoma duriventre, curimatá (Prochilodus nigricans, sardinha (Triportheus spp e jatuarana

  11. Positron probing of electron momentum density in GaAs-AlAs superlattices and related materials

    International Nuclear Information System (INIS)

    Arutyunov, N.Y.; Sekkal, N.

    2008-08-01

    The band structure calculations based on the method proposed by Jaros et al. (Phys. Rev. B 31, 1205 (1985)) have been performed for the defect-free GaAs-AlAs superlattice and related AlAs and GaAs single crystals; the electron-positron momentum density distributions have been computed and analyzed. The results of calculations are in good agreement with the experimental data obtained ad hoc for GaAs and AlAs bulk materials by measuring the angular correlation of the annihilation radiation (ACAR). Small (but marked) features of the electron-positron momentum density of the valence band have been revealed both for constituent materials and GaAs-AlAs superlattice. The delocalization of positron in 'perfect' defect-'free' AlAs and GaAs single crystals to be observed experimentally is borne out by the results of pseudo-potential band calculations performed on the basis of method proposed by Sekkal et al. (Superlattices and Microstructures, 33, 63 (2003)). The prediction of the possibility of a certain confinement of positron in the interstitial area of GaAs- AlAs superlattice is confirmed by the agreement between the results of calculations and relevant experimental data obtained for GaAs and AlAs single crystals. No considerable effect of the enhancement of the annihilation rate (due to electron-positron interaction) upon the electron-positron momentum density distribution both in the superlattice and its constituent bulk materials has been found. The results of ACAR measurements and calculations performed suggest that a tangible improvement of the sensitivity of existing positron annihilation techniques is necessary for studying details of the electron-positron momentum density distributions in defect-'free' superlattices to be created on the basis of the diamond-like semiconductors possessing close values of the electron momentum densities. On the contrary, the positron-sensitive vacancy-type defects of various types in the superlattice may become a source of the

  12. Comparison of three methods of tonometry in normal subjects: Goldmann applanation tonometer, non-contact airpuff tonometer, and Tono-Pen XL

    Directory of Open Access Journals (Sweden)

    Yilmaz I

    2014-06-01

    Full Text Available Ihsan Yilmaz, Cigdem Altan, Ebru Demet Aygit, Cengiz Alagoz, Okkes Baz, Sibel Ahmet, Semih Urvasizoglu, Dilek Yasa, Ahmet DemirokBeyoglu Eye Training and Research Hospital, Istanbul, TurkeyObjective: We aimed to compare intraocular pressure (IOP measurements via three different tonometers: the Goldmann applanation tonometer (GAT, the Tono-Pen® XL (TPXL, and a non-contact airpuff tonometer (NCT.Methods: This was a cross-sectional study of 200 eyes from 200 patients. Right eyes of all patients were included in this study. IOP was measured via GAT, NCT, and TPXL by three physicians. Each physician used one of the tonometers. Measurements via the three devices were compared.Results: The mean IOP was 15.5±2.2 mmHg (range 10–22 with the GAT, 16.1±3.0 (range 9–25 with the TPXL, and 16.1±2.8 (range 10–26 with the NCT. Bland–Altman analysis showed that the mean difference between measurements from the NCT and the GAT was 0.6±2.3 mmHg. The mean difference between the TPXL and GAT measurements was 0.7±2.5 mmHg. The mean difference between the NCT and TPXL measurements was −0.02±3.0 mmHg. There was no significant difference between the groups according to a one-way analysis of variance (ANOVA test. P-values were 0.998 for NCT–TPXL, 0.067 for NCT–GAT, and 0.059 for TPXL–GAT.Conclusion: The NCT and TPXL provide IOP measurements comparable to those of the gold standard GAT in normotensive eyes.Keywords: tonometry, noncontact tonometry, Goldmann applanation tonometer, Tono-Pen

  13. High-resolution studies of momentum distributions using perfect crystal gamma diffractometry

    International Nuclear Information System (INIS)

    Krexner, G.; Bischof, G.; Jentschel, M.; Boerner, H.

    2006-01-01

    Full text: Positron annihilation spectroscopy has turned out to be highly successful in the investigation of Fermi surfaces, electronic structures and various kinds of defects. On the other hand, algorithms based on density functional theory have made enormous progress in recent years and calculations for the contributions of both delocalized and core electrons in a rapidly increasing number of systems is either already feasible today or to be expected in the near future. By comparison, over the last decades there has been little improvement in the experimental limitations which are still set by the energy resolution of germanium detectors (slightly above 1 keV for annihilation photons close to 500 keV) and the angular resolution in ACAR studies (superior by about one order of magnitude). In addition, coincidence techniques are hampered by low count rates. An alternative is suggested by the fact that, in principle, Bragg diffraction techniques using perfect single crystals provide a way for the precise determination of wavelengths corresponding to energies in the MeV range. The single crystal analyzer instrument PN3 at the Institute Laue-Langevin (Grenoble, France) offers the unique possibility to determine the energy of annihilation photons with an accuracy close to about 1 eV, i.e. an improvement of up to three orders of magnitude in comparison to conventional semiconductor detectors. We discuss possible applications of this spectrometer in high-resolution studies of momentum distributions for both delocalized and core electrons. (author)

  14. The Chaotic Prediction for Aero-Engine Performance Parameters Based on Nonlinear PLS Regression

    Directory of Open Access Journals (Sweden)

    Chunxiao Zhang

    2012-01-01

    Full Text Available The prediction of the aero-engine performance parameters is very important for aero-engine condition monitoring and fault diagnosis. In this paper, the chaotic phase space of engine exhaust temperature (EGT time series which come from actual air-borne ACARS data is reconstructed through selecting some suitable nearby points. The partial least square (PLS based on the cubic spline function or the kernel function transformation is adopted to obtain chaotic predictive function of EGT series. The experiment results indicate that the proposed PLS chaotic prediction algorithm based on biweight kernel function transformation has significant advantage in overcoming multicollinearity of the independent variables and solve the stability of regression model. Our predictive NMSE is 16.5 percent less than that of the traditional linear least squares (OLS method and 10.38 percent less than that of the linear PLS approach. At the same time, the forecast error is less than that of nonlinear PLS algorithm through bootstrap test screening.

  15. Induced cytochrome P450 1A activity in cichlid fishes from Guandu River and Jacarepaguá Lake, Rio de Janeiro, Brazil.

    Science.gov (United States)

    Parente, Thiago E M; De-Oliveira, Ana C A X; Paumgartten, Francisco J R

    2008-03-01

    The induction of cytochrome P4501A-mediated activity (e.g. ethoxyresorufin-O-deethylation, EROD) has been used as a biomarker for monitoring fish exposure to AhR-receptor ligands such as polycyclic aromatic hydrocarbons (PAH), polychlorinated biphenyls (PCB) and polychlorinated dibenzo-dioxins/furans (PCDD/Fs). In this study we found that hepatic EROD is induced in fish ("Nile tilapia", Oreochromis niloticus and "acará", Geophagus brasiliensis) from the Guandu River (7-17-fold) and Jacarepaguá Lake (7-fold), Rio de Janeiro, Brazil. Since both cichlid fish are consumed by the local population and the Guandu River is the main source of the drinking water supply for the greater Rio de Janeiro metropolitan area, pollution by cytochrome P4501A-inducing chemicals is a cause for concern and should be further investigated in sediments, water and biota. We additionally showed that EROD activity in the fish liver post-mitochondrial supernatant-simpler, cheaper and less time consuming to prepare than the microsomal fraction-is sufficiently sensitive for monitoring purposes.

  16. Developing a Data Record of Lower Troposphere Temperature Profiles for Diurnal Land-Atmosphere Coupling Investigations

    Science.gov (United States)

    Lin, Z.; Li, D.

    2017-12-01

    The lower troposphere, including the planetary boundary layer, is strongly influenced by the land surface at diurnal scales. However, investigations of diurnal land-atmosphere coupling are significantly hindered by the lack of profile measurements that resolve the diurnal cycle. This study aims to bridge this gap by developing a decade-long (from 2007 to 2016) data record of diurnal temperature profiles in the lower troposphere (from the surface to about 4 km above the surface), which is based on the Aircrafts Communications Addressing and Reporting System (ACARS) meteorological observations. We first identify the number of profiles within an hour for each airport over the CONUS. At each airport, only data that passed at least level-1 quality check are retained. 40 airports out of 275 are then selected, which have data for more than 12 hours per day. These selected airports are mainly located along the east and west coasts, as expected. Because the data are recorded at irregular heights, we resample each profile in the lowest 4 km or so to pre-defined vertical coordinates. These temperature profiles are further bias-corrected by comparing to collocated radiosonde observations. This consistent data record of diurnal temperature profiles in the lower troposphere can be also used for regional climatology research, short-term weather forecasts, and numerical model evaluation.

  17. Spontaneous multi-cystic peripheral ameloblastoma in the freshwater angelfish, from the Brazilian state of Pará

    Directory of Open Access Journals (Sweden)

    M. Videira

    2015-08-01

    Full Text Available Este trabalho registra a ocorrência espontânea de ameloblastoma em P. scalare. O tumor foi obtido a partir de um exemplar de Acará Bandeira, sendo fixado, seccionado, e os fragmentos processados para microscopia de luz e microscopia eletrônica de varredura (MEV. O exame macroscópico evidenciou uma massa tumoral que se estendia do rebordo alveolar do maxilar superior à face externa labial. À MEV, a neoplasia apresentou uma série de espículas. Microscopicamente, percebia-se um processo neoplásico constituído por tecido conjuntivo de característica mixoide, ricamente vascularizado, onde eram observados fragmentos de tecido osteoide. A amostra revelou proliferação neoplásica do epitélio odontogênico, onde as células neoplásicas se organizavam na forma de paliçada. Alterações histopatológicas em peixes têm sido úteis biomarcadores do efeito à exposição a substâncias tóxicas, sendo as neoplasias lesões específicas, comumente encontradas em peixes de áreas poluídas, revelando uma associação entre as lesões e a exposição a irritantes.

  18. Diagnosing early onset dementia and then what? A frustrating system of aftercare resources

    Directory of Open Access Journals (Sweden)

    Chemali Z

    2012-01-01

    Full Text Available Z Chemali1–3, S Schamber2, EC Tarbi2, D Acar1,2, M Avila-Urizar21Harvard Medical School, 2Departments of Neurology and Psychiatry, Division of Cognitive and Behavioral Neurology, Brigham and Women’s Hospital, 3Departments of Psychiatry and Neurology, Massachusetts General Hospital, Boston, MA, USAAbstract: Recent studies indicate that the prevalence of early onset dementia (EOD is more common than it was once presumed. As such, and considering the substantial challenges EOD presents to the patient, caregivers, and health care providers, this study sought to investigate the mechanism of care delivered to these patients. A medical record chart review was conducted for 85 patients attending a memory disorder unit who initially presented to rule out EOD as a working diagnosis. The results suggest that while the majority of these patients received an extensive work-up and were heavily medicated, they remained at home, where they lacked adequate age-related services and could not be placed, despite the crippling caregiver burden. This manuscript is a platform to discuss our current system limitations in the care of these patients with an eye on new opportunities for this challenging group.Keywords: early onset dementia, social work, services, caregiving

  19. DEVELOPING SUSTAINABILITY INDICATORS FOR WATER RESOURCES MANAGEMENT IN TIETÊ-JACARÉ BASIN, BRAZIL

    Directory of Open Access Journals (Sweden)

    Michele de Almeida Corrêa

    2013-01-01

    Full Text Available This paper describes a tool to assist in developing water resources management, focusing on the sustainability concept, by a Basin Committee. This tool consists of a set of sustainability indicators for water resources management denominated CISGRH, which was identified by a conceptual and empirical review to meet the specific needs of the study herein - the basin committee of Tietê-J acaré Rivers (CBH-TJ. The framework of CISGRH came about through consecutive consultation processes. In the first consultation, the priority problems were identified for the study objectives, listing some possible management sustainability indicators. These preliminary indicators were also submitted to academic specialists and technicians working in CBH-TJ for a new consultation process. After these consultation stages, the CISGRH analysis and structuring were introduced. To verify the indicators’ adaptation and to compose a group as proposed by the study, these were classified according to specific sustainability principles for water resources management. The objective of the CISGRH implementation is to diagnose current conditions of water resources and its management, as well as to evaluate future conditions evidenced by tendencies and interventions undertaken by the committee.

  20. Prevalência de parasitismo intestinal nas aldeias indígenas da tribo Tembé, Amazônia Oriental Brasileira

    Directory of Open Access Journals (Sweden)

    Miranda Rogério dos Anjos

    1999-01-01

    Full Text Available Para determinar a prevalência de enteroparasitismo nas aldeias Tembé, foi realizado um inquérito coproparasitológico em toda a população (93 índios, em dezembro de 1996. Os parasitos mais freqüentes foram ancilostomídeos (29,0%, Ascaris lumbricoides (34,4%, Entamoeba histolytica (12,9% e Giardia lamblia (4,3%. As maiores prevalências de ancilostomídeos e A. lumbricoides foram observadas na aldeia Turé-Mariquita, enquanto que as de E. histolytica e G. lamblia na Acará-Mirim. Não foi observada diferença significativa sob ponto de vista prático entre a média de idade dos índios parasitados e a dos não parasitados. Sexo esteve relacionado apenas a freqüência de ancilostomídeos, bem maior no sexo masculino. Desse modo, a prevalência de enteroparasitas ainda se encontra elevada para alguns agentes, sugerindo que as medidas de atenção devem ser imediatamente incrementadas a fim de se obterem resultados mais positivos no combate ao enteroparasitismo.

  1. Lithium ion implantation effects in MgO(100)

    Energy Technology Data Exchange (ETDEWEB)

    Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Labohm, F.; Schut, H.; Mijnarends, P.E. [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Kooi, B.J.; Hosson, J.T.M. de [Rijksuniversiteit Groningen (Netherlands). Materials Science Centre

    2001-07-01

    Single crystals of MgO(100) were implanted with 10{sup 16} {sup 6}Li ions cm{sup -2} at an energy of 30 keV. After ion implantation the samples were annealed isochronally in air at temperatures up to 1200K. After implantation and after each annealing step, the defect evolution was monitored with optical absorption spectroscopy and depth-sensitive Doppler Broadening positron beam analysis (PBA). A strong increase in the S-parameter is observed in the implantation layer at a depth of approximately 100 nm. The high value of the S-parameter is ascribed to positron annihilation in small lithium precipitates. The results of 2D-ACAR and X-TEM analysis show evidence of the presence of lithium precipitates. The depth distribution of the implanted {sup 6}Li atoms was monitored with neutron depth profiling (NDP). It was observed that detrapping and diffusion of {sup 6}Li starts at an annealing temperature of 1200K. (orig.)

  2. Influência do Aterro Municipal de Manaus sobre as águas superficiais da circunvizinhança: um enfoque ao estudo de metais pesados

    Directory of Open Access Journals (Sweden)

    Dorian Lesca de Oliveira

    2010-08-01

    Full Text Available Este estudo analisou as concentrações de metais pesados (Al, Ba, Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb e Zn por espectrometria de absorção atômica de chama (FAAS e variáveis físico-químicas (pH, condutividade elétrica e temperatura in situ em amostras de águas superficiais da circunvizinhança do Aterro Municipal de Manaus e chorume. Amostras de água e chorume foram coletadas no período de estiagem e chuvoso com o objetivo de verificar a influência antrópica sobre o sistema hídrico composto pelos Igarapés: Matrinxã, Aracu, Acará, e Bolívia. Os dados obtidos foram submetidos a duas análises estatísticas exploratórias: Análise de Componente Principal (PCA e Análise de Agrupamento Hierárquico (HCA. Os resultados indicaram concentrações de metais pesados distintos conforme a estação do ano e elemento. A PCA revelou correlações significativas entre: Al, Cd, Fe, Mn, Ni e Pb assim como Zn e Co. A HCA e PCA mostraram que as características do sistema hídrico são semelhantes ao chorume na estiagem.

  3. High-Resolution WRF Forecasts of Lightning Threat

    Science.gov (United States)

    Goodman, S. J.; McCaul, E. W., Jr.; LaCasse, K.

    2007-01-01

    Tropical Rainfall Measuring Mission (TRMM)lightning and precipitation observations have confirmed the existence of a robust relationship between lightning flash rates and the amount of large precipitating ice hydrometeors in storms. This relationship is exploited, in conjunction with the capabilities of the Weather Research and Forecast (WRF) model, to forecast the threat of lightning from convective storms using the output fields from the model forecasts. The simulated vertical flux of graupel at -15C is used in this study as a proxy for charge separation processes and their associated lightning risk. Initial experiments using 6-h simulations are conducted for a number of case studies for which three-dimensional lightning validation data from the North Alabama Lightning Mapping Array are available. The WRF has been initialized on a 2 km grid using Eta boundary conditions, Doppler radar radial velocity and reflectivity fields, and METAR and ACARS data. An array of subjective and objective statistical metrics is employed to document the utility of the WRF forecasts. The simulation results are also compared to other more traditional means of forecasting convective storms, such as those based on inspection of the convective available potential energy field.

  4. Positron annihilation studies of high dose Sb implanted silicon

    International Nuclear Information System (INIS)

    Schut, H.; Eijt, S.W.H.; Beling, C.D.; Ho, K.; Takamura, Y.

    2005-01-01

    The formation and evolution of vacancies and precipitates created by implantation of 60 keV, 2 x 10 16 cm -2 Sb + in pre-amorphized (0 0 1) Cz-Si is studied using the Doppler broadening (DB) and two-dimensional angular correlation of annihilation radiation (2D-ACAR) positron beam techniques. After implantation, samples were laser annealed (LTA) and subsequently thermal annealed at temperatures ranging from 400 to 1000 deg. C. Implantation-induced vacancy-type defects were detected up to a depth of 280 nm. After LTA, positron annihilation related to both Sb and remaining defects is observed in the first 100 nm below the surface. The deeper region only shows positron trapping at vacancy-type defects with strong reduced concentration. Complete removal is obtained after 600 deg. C anneal. At this temperature, the positron data for the upper region reveals trapping at Sb and Si sites only. With increasing annealing time (at 600 deg. C) or increasing temperature (up to 1000 deg. C) positron annihilation at Sb-sites associated with neighboring vacancies becomes apparent. Results are correlated with the observed Sb electrical deactivation above 600 deg. C, the shift from small Sb aggregates to precipitates and out-diffusion of Sb from the implantation region at higher temperatures

  5. The gamma-ray spectra of 5-carbon alkane isomers in the positron annihilation process

    International Nuclear Information System (INIS)

    Ma, Xiaoguang; Zhu, Yinghao; Liu, Yang

    2016-01-01

    The gamma-ray spectra of pentane (C_5H_1_2) and its two isomers, i.e., 2-Methylbutane (CH_3C(CH_3)HC_2H_5) and 2,2-Dimethylpropane (C(CH_3)_4) have been studied theoretically in the present work. The recent experimental gamma-ray spectra of these three molecules show that they have the same Doppler shifts, although their molecular structures are dramatically different. In order to reveal why the gamma-ray spectra of these molecules are less sensitive to the molecular structures, the one-dimensional gamma-ray spectra and spherically averaged momentum (SAM) distributions, the two-dimensional angular correlation of annihilation radiation (ACAR), and the three-dimensional momentum distributions of the positron–electron pair are studied. The one-centered momentum distributions of the electrons are found to play more important role than the multi-centered coordinate distributions. The present theoretical predictions have confirmed the experimental findings for the first time. The dominance of the inner valence electrons in the positron–electron annihilation process has also been suggested in the present work. - Highlights: • The structure effects only play a minor role in the one-dimension gamma-ray spectra. • The present study further confirms the dominance of the inner valence electrons in the positron–electron annihilation process. • The momentum distributions of the electrons play more important role than the coordinate distributions.

  6. Assessment of the Professional Training Course under Watershed Project at Fatehjang Field Station, Punjab, Pakistan

    International Nuclear Information System (INIS)

    Khan, M. N.; Hassan, T.; Shah, H.; Abid, S.; Raza, I.; Abbasi, S. S.

    2015-01-01

    Watershed Project organizing different professional trainings to create awareness about water saving technologies as solar powered irrigation system, drip irrigation, sprinkler irrigation, micro catchment, rooftop rainwater harvesting and irrigation scheduling. Therefore, the project activities also include the training of the professionals from the line departments for the demonstrated technologies to foster the process of adoption. For this purpose Climate and Alternate Energy Water Resources Institute, NARC, organized a professional training on Water Rehabilitation and Irrigation Technology Improvements in April, 2014 in collaboration with ICARDA and USDA. Twenty seven professionals from different organizations and departments namely; Al-Mustafa Development Network (ADN), Taleem Foundation, Islamic International University (IIUI) Islamabad, National Agricultural Research Centre (NARC), National Centre for Rural Development (NCRD), National Rural Support Programme (NRSP), On-Farm Water Management (OFWM), Water Management (WM), Potohar Organization for Development Advocacy (PODA), Quaid-i-Azam University (QAU) and Environmental Sciences actively participated in the professional training. The post-training assessment showed that it had positive impact on the awareness of professionals. Majority of the participants were strongly and merely agreed upon the training practicality, technologies adoption probability and its advantages at farmer's field. Overall, most of the training participants were satisfied with the knowledge sharing presentations about the specific technologies discussed during the training. (author)

  7. Opinions of Students Completing Master Thesis in Turkish Education Field about Academic Writing and Thesis Formation Process

    Directory of Open Access Journals (Sweden)

    Mustafa Onur KAN

    2016-12-01

    Full Text Available The overall aim of this research is to evaluate opinions of students completing master thesis in the field of Turkish education about academic writing and process of forming thesis. The study has been devised using phenomenological design within the qualitative research methods. The study group of research is consisted of 9 participants completed master thesis in the field of Turkish education at Mustafa Kemal University Instıtute of Social Sciences in 2015. In this study, semi-structured interview form developed by the researcher was used to collect data. In order to ensure the reliability of the scope and structure, table of specification was constituted and expert views were consulted. For analyzing data descriptive analysis method was used. According to results of the research, it was obtained that participants experience various diffuculties in writing the basic sections of the thesis. In addition, it was seen that participants can not benefit enough from the studies written in foreign language. Participants reported that they find themselves more enough about academic writing and process of forming thesis after postgraduate education, but also they stated that academic writing courses should take part in program.

  8. “Secularism”: A Key to Turkish Politics

    Directory of Open Access Journals (Sweden)

    Dietrich Jung

    2006-12-01

    Full Text Available Abstract: In posing Serif Mardin’s question of Turkey’s center-periphery relations in a revised version, this article considers secularism to be a key to understanding Turkish politics. It views the confrontation between secularists and Islamists in the light of Turkey’s center-periphery polarization and identifies the secularist doctrine of Kemalism as a major obstacle to democratic political change. The protection of Turkey’s secular order developed into the ideological cornerstone of Kemalist rule, which ranks prime amongst the ideological tools used to justify the political supremacy of the Turkish armed forces. Examining the interrelation between secularism and the almost religious cult around Mustafa Kemal Atatürk, the article concludes that the increasing visibility of Islamic symbols and practices in Turkey is a logical consequence of the country’s current European Union(EU reform process, rather than a sign of Turkey’s deviation from its political and societal modernization process.

  9. The Development of Polyphonic Music That Started During the Early Years of Republic of Turkey

    Directory of Open Access Journals (Sweden)

    Ilkay Ak

    2014-12-01

    Full Text Available The present study aimed at examining the development of conservatories which started to become institutionalized under the leadership of Mustafa Kemal in the early period of the Republic and which have brought polyphony to musical culture in our country. In line with this purpose, the following research questions were directed:   •          When did Interaction between Classical Western Music and Turkish Music start in our country? •          What were the attitudes towards artistic activities in the early period of the Republic? •          What are the contributions of Turkish composers to Modern Turkish Music who have an important place in the history of Turkish Music in our country?   In the study, the interaction between Turkish Music and Western Music in our country in the 17th century was examined. In addition, the present study also focused on related Turkish composers who became expert in their fields as well as on other related composers who came to Turkey from various European countries. The present study is limited to these data, and the purpose is to present the collected data to today’s musicians and to contribute to their professional developments.

  10. Developing Islamic Banking Performance Measures Based on Maqasid Al-Shari’ah Framework: Cases of 24 Selected Banks

    Directory of Open Access Journals (Sweden)

    Mustafa Omar Mohammed

    2015-08-01

    Full Text Available Islamic banking has achieved remarkable growth that has surpassed the growth of the conventional banking system. Yet, studies show that the performances of Islamic banks (IBs seem to be trailing behind the conventional banks (CBs. Is the poor performance of IBs the result of mismatch between their objectives and their performance measurement criteria or it is a reflection of their true performances? The objectives of Islamic banking had not been formally addressed. Mustafa and Taib (2009 derived the objectives of Islamic banking from Abu Zahara’s theory of the objectives of Shari’ah (Maqasid al-Shari’ah and, based on these Shari’ah objectives, developed a model of Islamic banking performance measures. They named it as Performance Measures based on Maqasid al-Shari’ah framework or the PMMS model. This paper has tested the PMMS model on a sample 24 banks (12 IBs and 12 CBs. The twenty four banks were also evaluated using the traditional conventional financial measures. Mann-Whitney U-Test results show IBs faring well in their performances when measured using the PMMS model than when they are measured using the conventional banking performance yardstick. Policy prescriptions and recommendations for further studies are provided at the concluding section of the paper.

  11. Coherent systems with multistate components

    International Nuclear Information System (INIS)

    Caldarola, L.

    1980-01-01

    The basic rules of the Boolean algebra with restrictions on variables are briefly recalled. This special type of Boolean algebra allows one to handle fault trees of systems made of multistate (two or more than two states) components. Coherent systems are defined in the case of multistate components. This definition is consistent with that originally suggested by Barlow in the case of binary (two states) components. The basic properties of coherence are described and discussed. Coherent Boolean functions are also defined. It is shown that these functions are irredundant, that is they have only one base which is at the same time complete and irredundant. However, irredundant functions are not necessarily coherent. Finally a simplified algorithm for the calculation of the base of a coherent function is described. In the case that the function is not coherent, the algorithm can be used to reduce the size of the normal disjunctive form of the function. This in turn eases the application of the Nelson algorithm to calculate the complete base of the function. The simplified algorithm has been built in the computer program MUSTAFA-1. In a sample case the use of this algorithm caused a reduction of the CPU time by a factor of about 20. (orig.)

  12. Tangible and Intangible Values of Atatürk Forest Farm as a Heritage of Ideas

    Directory of Open Access Journals (Sweden)

    Selin Çavdar Sert

    2017-12-01

    Full Text Available Within the shared boundaries of various disciplinary domains, there are a substantial number of studies dealing with the history of the establishment and socio-spatial values of Atatürk Forest Farm. The area is represented through the semantic field related to the venerable memory of Mustafa Kemal Atatürk and his heritage of ideas; the social, cultural and spatial goals of the republican revolution; the principles and procedures of being a modern and self-sufficient society; and the history of the establishment of Ankara as a capital. The Atatürk Forest Farm also comprises tangible cultural assets and natural systems – which transcend the borders of the site. Yet, there has not been any study identifying and associating the tangible and intangible values of the farm in a comprehensive way. This study aims to draw a layout for interdisciplinary conservation scenarios that would place the tangible and intangible assets of Atatürk Forest Farm – whose universalisation has been noticeably postponed – and the heritage of ideas bequeathed to future generations in the form of the forest and farm

  13. A Different Approach Towards Armenian Events of 1915

    Directory of Open Access Journals (Sweden)

    Nevzat Artuç

    2008-06-01

    Full Text Available The decision of Armenian dispatch of 1915 is a security measure taken against the rebellions of Armenians living within the boundaries of Ottoman state and their co-operations with Russians. Despite the worst conditions resulted by the war, leading cadres of Unionist, who are behind the dispatch decision, do their best to meet the needs of the Armenian convoys. Soon after the World War I, the events of 1915 bring into agenda by the Ottoman cabinets established under power of the Entente Powers and it transfermed to the court. Immediately. At the end of judgment verdict, it is accepted that some undersirable events happens during the dispatch. However, it is particularly stressed the fact that this is not done on purpose. On the other hand, Armenians protest the events of dispatch by joining voluntarily the British armies during the Channel expedition. The Armenian lobbies outside the Ottoman state want the leaders of Unionist cadres revenge on the Armenians who died during the dispatch by arranging plot attempts. Mustafa Kemal Pasha having no role in the decision of dispatch is also taken into the murder list. Thus, Armenian lobbies, who have seen the events as a cherish a vendetta, are responsible for the uncompromising policy of Armenia

  14. Individual Learner Differences In Web-based Learning Environments: From Cognitive, Affective and Social-cultural Perspectives

    Directory of Open Access Journals (Sweden)

    Mustafa KOC

    2005-10-01

    Full Text Available Individual Learner DifferencesIn Web-based Learning Environments:From Cognitive, Affective and Social-cultural Perspectives Mustafa KOCPh.D Candidate Instructional TechnologyUniversity of Illinois at Urbana-ChampaignUrbana, IL - USA ABSTRACT Throughout the paper, the issues of individual differences in web-based learning, also known as online instruction, online training or distance education were examined and implications for designing distance education were discussed. Although the main purpose was to identify differences in learners’ characteristics such as cognitive, affective, physiological and social factors that affect learning in a web-enhanced environment, the questions of how the web could be used to reinforce learning, what kinds of development ideas, theories and models are currently being used to design and deliver online instruction, and finally what evidence for the effectiveness of using World Wide Web (WWW for learning and instruction has been reported, were also analyzed to extend theoretical and epistemogical understanding of web-based learning.

  15. A new cooling technique for stingless bees hive

    Directory of Open Access Journals (Sweden)

    Ramli Ahmad Syazwan

    2017-01-01

    Full Text Available Stingless bees are a type of insect that are very sensitive to the changes of their surroundings, especially to severe heat wave. A report stated that at temperature as high as 38°C can cause death of bees especially to the pupae. Therefore, the objective of this research is to evaluate a new method in regulating the temperature in the hive. Greenroof, a type of roof which contains green vegetation and soil, was used as the cooling method in this study. Two units of MUSTAFA-hives were exposed under sunlight, one is without temperature control and another one was fitted greenroof. The temperatures inside each hive was measured at two points and was compared with the hive without temperature control. It was found that, for the hive integrated with greenroof, the average hive temperature was about 3°C and 6°C lower in the honey cassette and brood-cells compartment, respectively. Therefore, it can be concluded that the implementation of greenroof could solve the problem of stingless bee hive overheating, and the greenroof has an impressive cooling performance besides being an economic and simple solution.

  16. Changes in family functions in patients with secondary premature ejaculation

    Directory of Open Access Journals (Sweden)

    Mustafa Arı

    2011-06-01

    Full Text Available We aimed to inverstigate changes in family functions in patients with premature ejaculation.Materials and methods: In the present study, study group were randomly selected from Mustafa Kemal University Medical School Research and Training Hospital Urology Department outpatients clinic. Control group were selected among healthy volunteers. Totally 30 patients were included in the PE group and 30 healthy volunteers were included in the control group. Subjects were examined by the same psychiatrist. Beck Anxiety Inventory and Family Assessment Scale were applied to both groupsResults: Compared with the control group, premature ejaculation patients had significantly higher anxiety scores (p=0.001 and more deterioration in problem solving (p=0.001, communication (p=0.022, affective responsiveness (p=0.011, behavior control (p=0.032, and affective involvement in their families (p=0.011. There were no difference in terms of roles and general functions scores (p>0.05.Conclusion: It can be concluded that there is deterioration in family functions in patients with premature ejaculation, Therefore, approaches targeting family functions may be beneficial in the treatment of these patients.

  17. Contributions to The Morphology of Polyommatus (Agrodiaetus Alibalii Carbonell, 2015 (Lepidoptera, Lycaenidae Living Kahramanmaraş, Region, Turkey

    Directory of Open Access Journals (Sweden)

    Erol Atay

    2018-03-01

    Full Text Available Polyommatus (Agrodiaetus alibalii is a new butterfly species which was described by Frederic Carbonell in 2015. In the Carbonell’s article, since the descriptive information about the species is limited, a further redescription study has been aimed for more detailed identification the species. This study was conducted in two stages with the field works in Kırksu Highland in Geben village of Andırın district of Kahramanmaraş province in Turkey in July and August in 2016 and 2017, and then laboratory works in the Zoology Laboratory at Mustafa Kemal University in Hatay, Turkey. In the field, behaviors of the adults have been observed and recorded in their habitats, and eight male and five female specimens of the species were collected for laboratory works. In this paper, the external morphology and genital structure of the male and female of the species were described in detail. In addition to P. alibalii, the male genital preparations of the species of P. theresiae (Schurian et al., 1992, P. iphigenia (Herrich-Schaffer, 1847, P. wagneri (Forster, 1956 and P. eurypilos (Gerhard, 1851 were prepared.

  18. In vitro and in vivo anti-angiogenic activity of girinimbine isolated from Murraya koenigii

    Directory of Open Access Journals (Sweden)

    Iman V

    2015-03-01

    Full Text Available Venoos Iman,1 Hamed Karimian,1 Syam Mohan,2 Yahya Hasan Hobani,2 Mohamed Ibrahim Noordin,1 Mohd Rais Mustafa,3 Suzita Mohd Noor41Department of Pharmacy, Faculty of Medicine, University of Malaya, Kuala Lumpur, Malaysia; 2Medical Research Center, University of Jazan, Jazan, Saudi Arabia; 3Department of Pharmacology, Centre for Natural Products and Drug Discovery (CENAR, Faculty of Medicine, University of Malaya, Kuala Lumpur, Malaysia; 4Department of Biomedical Science, Faculty of Medicine, University of Malaya, Kuala Lumpur, MalaysiaAbstract: Girinimbine is a carbazole alkaloid isolated from the stem bark and root of Murraya koenigii. Here we report that girinimbine is an inhibitor of angiogenic activity both in vitro and in vivo. MTT results showed that girinimbine inhibited proliferation of human umbilical vein endothelial cells, while results from endothelial cell invasion, migration, tube formation, and wound healing assays demonstrated significant time- and dose-dependent inhibition by girinimbine. A proteome profiler array done on girinimbine-treated human umbilical vein endothelial cells showed that girinimbine had mediated regulation of pro-angiogenic and anti-angiogenic proteins. The anti-angiogenic potential of girinimbine was also evidenced in vivo in the zebrafish embryo model wherein girinimbine inhibited neo vessel formation in zebrafish embryos following 24 hours of exposure. Together, these results showed that girinimbine could effectively suppress angiogenesis, suggestive of its therapeutic potential as a novel angiogenesis inhibitor. Keywords: angiogenesis, inhibitor, carbazole alkaloid, zebrafish

  19. “Kayseri Hançerli Sultan Vakfı Bedesteni” in the Context of the Ottoman Bedestens

    Directory of Open Access Journals (Sweden)

    Fernaz ÖNCEL

    2014-02-01

    Full Text Available The deeply-rooted commercial structure tradition of Kayseri is based on the city’s constant and centuries-old role in international trade and commerce. Throughout the Seljuk period, Kayseri’s bazaars were located outside the city walls, in the immediate vicinity of the city. Building of commercial structures in the citadel itself and the centre of the city began during Ottoman times, the period in which the city’s traditional commercial structure began to appear and grow. In 1497, the Sanjak Bey of Kayseri, Mustafa bin Abdulhay, constructed the “Kayseri Hançerli Sultan Vakfı Bedesteni”, surrounded by 38 stores, and thus began the establishment of the commercial fabric of the city. Over time, the Bedesten has changed both physically and functionally. These changes have been for the worse and have led to the Bedesten and its surroundings being defined as an “area of declining trade”. Factors that have negatively affected the structure’s physical make-up include environment, natural disasters, improper restoration, deliberate corruption, and haphazard changes made by users. Economic factors playing a role in its decline include changes to its original function as a ‘shopping’ centre, its traditional customer base, and the type and quality of goods traded there. The Bedesten is discussed here under four headings; Introduction, Bedestens as Ottoman Commercial Structures, Kayseri Hançerli Sultan Wakf Bedesten, Evaluation, and Conclusions.

  20. I lære som Allahs ven: Selvets renselse på et islamisk universitet i Yemen

    DEFF Research Database (Denmark)

    Mathiesen, Kasper

    2013-01-01

    ) and who by that presence directs other people to Islam. This article uncovers life and learning in a leading Islamic institution of learning and analyzes the processes of self- transformation and education that constitute the foundation for the rise of a walî. It is based on my work on the Bâ ́Alawî......Islamic education and existential learning is directed at purifying the self (nafs) and the cultivation of certitude (yaqîn). A central aspiration in the learning process is to become an intimate friend of Allah (a walî), who embodies the prophetic presence (istihdâr al-nûr al- muhammadiyya...... tradition, one of the most influential Islamic traditions of learning and self-cultivation in the present age, since 2006 and in particular on my visit to the Islamic university Dar al-Mustafa in Yemen during the summer and the fall of 2011. The paradoxical tension between Sufism’s ideal of ascetic...

  1. Muhammad Rif`at dan Turath Bacaannya

    Directory of Open Access Journals (Sweden)

    WAN HILMI WAN ABDULLAH

    2013-12-01

    Full Text Available Shaykh Muhammad Rif`at is one of the famous reciters in Egypt in the era of the 90's. His stature continues evident after officially been invited as a qari to the opening ceremony of Qari al-Misriyyah Idha`at in 1934. During his involvement in the world of Quranic recitation, Shaykh Muhammad Rif`at had recited the Quran in the mosque of Fadil Basha for 25 years. His determinations to deliver and spread Holy Quran with an intermediate reading in mosques, haflah-haflah and ma’tam also have strongly influenced the next generations of qurra’. Many of the reciters like Shaykh Mustafa Isma`il, Shaykh Abu al-`Aynin Sha`isha', Shaykh `Abdul Fattah and others recognize that he has the greatness and uniqueness of its own in the art of reading the Quran. This is evidenced by some of the titles given to him as Amir al-Qurra’, Qitharah al-Sama’ and Sawt al-Malaikah by his contemporary reciters. After Shaykh Muhammad Rif`at died in 1950, then relics of his recited turath were uncovered which compiled by his friend, Zakaria Basha and compatriot Muhammad Khamis, as they managed to gather a total of 278 cds contains 19 chapters with the duration of 21 hours.

  2. Dardanel Wars

    Directory of Open Access Journals (Sweden)

    Ahmet EYİCİL

    2009-06-01

    Full Text Available The reason for the opening of the Dardanel Front was to establish a link between allies and Russia and to push The Ottoman Empire out of the war. In order to reach this cause, upon Churchill’s suggestion, the English War Commitee met on 28 January 1915 and decided to attack the Dardanels on February 19. The allies fleet tried to pass the Dardanels several times but they failed. Their biggest attack for the Straits took place on 18 March, which was failed and the fleet lost one third of its power. After the failure on the sea to pass the Straits the allies landed on Gallipoli to invade İstanbul. Landing took place from April 1 to December 22 the wars on lands lasted more than 8 months, during which Turkish army fought heroic battles. Fierce battles took place on Kabatepe, Seddülbahir, Alçıtepe, Kilitbahir, Anafartalar, Arıburnu. Upon failure on the land the allies started to withdraw from this front on 8 January 1915. The Dardanels wars which was lost by the allies caused the First World War to continue two more years. Tsarist regime was collapsed in Russia and its place Bolshevik regime came. The Turks put aside bad results of the Balkan Wars and became again a heroic nation. Because of his successes Mustafa Kemal became a genious commander. Most importantly Dardanels wars gave its honours to the Turkish army

  3. Assessment of the perioperative period in civilians injured in the Syrian Civil War

    Directory of Open Access Journals (Sweden)

    Sedat Hakimoglu

    2015-12-01

    Full Text Available BACKGROUND: wars and its challenges have historically afflicted humanity. In Syria, severe injuries occurred due to firearms and explosives used in the war between government forces and civilians for a period of over 2 years. MATERIALS AND METHODS: the study included 364 cases, who were admitted to Mustafa Kemal University Hospital, Medicine School (Hatay, Turkey, and underwent surgery. Survivors and non-survivors were compared regarding injury site, injury type and number of transfusions given. The mortality rate found in this study was also compared to those reported in other civil wars. RESULTS: the mean age was 29 (3-68 years. Major sites of injury included extremities (56.0%, head (20.1%, abdomen (16.2%, vascular structures (4.4% and thorax (3.3%. Injury types included firearm injury (64.4%, blast injury (34.4% and miscellaneous injuries (1.2%. Survival rate was 89.6% while mortality rate was 10.4%. A significant difference was observed between mortality rates in this study and those reported for the Bosnia and Lebanon civil wars; and the difference became extremely prominent when compared to mortality rates reported for Vietnam and Afghanistan civil wars. CONCLUSION: among injuries related to war, the highest rate of mortality was observed in head-neck, abdomen and vascular injuries. We believe that the higher mortality rate in the Syrian Civil War, compared to the Bosnia, Vietnam, Lebanon and Afghanistan wars, is due to seeing civilians as a direct target during war.

  4. Islamic Spirituality Movement and Its Implications on Social and Political Ethics in Indonesia

    Directory of Open Access Journals (Sweden)

    DALMERI

    2016-06-01

    Full Text Available In the nineteenth century, Islamic religious movements fell into three groups: First, those advocating salvation through revivalism as exemplified by Wahhabism; Second, salvation through the prophecy of divinely-sent leader (or guide as seen in the case of Mahdism; and third, salvation through ecstasy and loss of self-volition, such as in the Sufi Shaykh (charismatic leader, characteristic of the tariqa revival. This article explains about the attitudes of reformers towards Sufism varied from the hostility of Muhammad ibn ‘Abd al-Wahhab who was against bid‘a; the ‘Salafi’ movement, i.e Muhammad ‘Abduh and Rashid Rida, who were against Sufism but tolerated the ethical teachings of al-Ghazali; and Mustafa Kemal in Turkey who banned Sufi orders outright in 1925. In recent Indonesia milieu, some prominent figures have shown their interest in Sufism, but certain Muslim organizations or institutions to some extent are against it such as Hizbut Tahrir Indonesia, Sabili Magazine, Salafy Journal, Muhammadiyyah, and Persatuan Islam.

  5. An Investigation of effective factors on nurses\\' speech errors

    Directory of Open Access Journals (Sweden)

    Maryam Tafaroji yeganeh

    2017-03-01

    Full Text Available Background : Speech errors are a branch of psycholinguistic science. Speech error or slip of tongue is a natural process that happens to everyone. The importance of this research is because of sensitivity and importance of nursing in which the speech errors may be interfere in the treatment of patients, but unfortunately no research has been done yet in this field.This research has been done to study the factors (personality, stress, fatigue and insomnia which cause speech errors happen to nurses of Ilam province. Materials and Methods: The sample of this correlation-descriptive research consists of 50 nurses working in Mustafa Khomeini Hospital of Ilam province who were selected randomly. Our data were collected using The Minnesota Multiphasic Personality Inventory, NEO-Five Factor Inventory and Expanded Nursing Stress Scale, and were analyzed using SPSS version 20, descriptive, inferential and multivariate linear regression or two-variable statistical methods (with significant level: p≤0. 05. Results: 30 (60% of nurses participating in the study were female and 19 (38% were male. In this study, all three factors (type of personality, stress and fatigue have significant effects on nurses' speech errors Conclusion: 30 (60% of nurses participating in the study were female and 19 (38% were male. In this study, all three factors (type of personality, stress and fatigue have significant effects on nurses' speech errors.

  6. Effect of soap industry effluents on soil and ground water in Albageir area

    International Nuclear Information System (INIS)

    Awadalla, S. O.

    2004-02-01

    This study investigates the effect on soil and ground water produced by the effluent from soap industry discharged from Alsheikh Mustafa Alamin (SMA) factory, in Albageir industrial area, located 45 Km south of Khartoum. Soil samples were taken from the periphery of the effluent pond and from 25 and 50 cm depths from pits at different distances from the pond.The samples were analyzed for the following chemical and physical characteristics PH, EC, sodium, chloride ions and their grain size, in order to investigate any possible soil degradation. The results showed that there is an increase in soil salinity and sodicity resulting from the improper discharge of the liquid waste, and from lack of treatment before the discharge. Hence, there are definitive signs for soil degradation in the study area, which could reach a high magnitude in the long.This situation could be rectified by adopting updated techniques for treatment and disposal of effluent, and by regular inspection, by the authorities in order to make sure that the regulations are not violated. Chemical and physical analyses of ground water samples showed no signs of pollution. However, if the disposal practices are not revised, the possibility of pollution in the near future is likely to occur. A package of measurements is proposed in order to curb the impact of the industry on the environment. (Author)

  7. Investigation of the Visuals Associated with the National identity in Turkish Republic Revolution History and Kemalism Textbooks

    Directory of Open Access Journals (Sweden)

    Mehmet Elban

    2018-04-01

    Full Text Available In this research, images related to national identity were examined in history textbooks. In the first stage, nationalism, the historical course of the Turkish national identity and related literature were examined, and some components of national identity were determined. Various categories related to national identity have been formed from the elements obtained. The data about the categories were collected through document analysis. In the second phase, 8 history textbooks taught in the years 1930-2014 were selected as samples. Content analysis was used in the examination of the mentioned textbooks, and quantitative method was chosen in data analysis. In this context, data obtained by document analysis were analyzed with SPSS 13 statistical program. Chi-square tests, Bonferroni corrections for chi-square tests and graphs were used in the analyzes. The significance level for all analyzes was taken as .05. In the research, it was determined that republic values and revolutions, national struggle and the images related to the founder leader Mustafa Kemal Atatürk be a most used in Turkish Republic Revolution History and Kemalism textbooks concerning national identity. In addition, it has been found that the images of national symbols such as homeland maps, flag, parliament, and capital are used too much for the national identity.

  8. Die postpolitische Stadt

    Directory of Open Access Journals (Sweden)

    Erik Swyngedouw

    2013-12-01

    Full Text Available Die Polis ist tot, es lebe die kreative Stadt! Während die Stadt, zumindest in Teilen des städtischen Raums, blüht und gedeiht, scheint die Polis im idealisierten griechischen Sinn dem Untergang geweiht; in diesem Verständnis ist sie der Ort der öffentlichen politischen Auseinandersetzung und demokratischen Unterhandlung und somit eine Stätte (oft radikaler Abweichung und Unstimmigkeit, an der die politische Subjektivierung buchstäblich ihren Platz hat. Diese Figur einer entpolitisierten (oder postpolitischen und postdemokratischen Stadt im Spätkapitalismus bildet das Leitmotiv des vorliegenden Beitrags. Ich lehne mich dabei an Jacques Rancière, Slavoj Žižek, Chantal Mouffe, Mustafa Dikeç, Alain Badiou und andere Kritiker jenes zynischen Radikalismus an, der dafür gesorgt hat, dass eine kritische Theorie und eine radikale politische Praxis ohnmächtig und unfruchtbar vor jenen entpolitisierenden Gesten stehen, die in der polizeilichen Ordnung des zeitgenössischen neoliberalen Spätkapitalismus als Stadtentwicklungspolitik [urban policy] und städtische Politik [urban politics] gelten. Ziel meiner Intervention ist es, das Politische wieder in den Mittelpunkt der zeitgenössischen Debatten über das Urbane zu stellen. [...

  9. Reflections of Izmir’s Liberation Anniversaries on Izmir Press (1923 - 1938

    Directory of Open Access Journals (Sweden)

    Mustafa MUTLU

    2015-07-01

    Full Text Available The dates May 15, 1919 and September 9, 1922 stand as a climax for Izmir. The invasion begins with the Greek army’s entering in Izmir and ends with the eliminat ion of the Greek army in Izmir, as well. September 9 is the anniversary of the event in which Turkish army reached at the first target and the motherland was liberated, while 15 May is the anniversary of the date in which Greeks attacked motherland. Regard ing these, the value of these days is quite great for Turkish People and especially for the people in Izmir. In my study, it was analyzed how the independence anniversary of Izmir (1923 - 1938 takes place in Izmir's press. When we focus on 9th September, we may realise independence story of Izmir, preparations for festival, the festival itself, proses and poems ab out the importance of the day on the newspapers. In addition to this, the architecture of this successful story Mustafa Kemal Ataturk and his friends were honoured in the newspapers. Thus, Izmir Press contributes to the comprehension of these two dates by people by means of the thoughts and ideas written in articles.

  10. A Painted House In Ankara: Dedebayrak House

    Directory of Open Access Journals (Sweden)

    Muzaffer Karaaslan

    2016-06-01

    Full Text Available The conservative family lifestyle in the Ottoman State affected the ways that houses were planned and decorated. Different decorative programs emerged with major differences in each period. New techniques and styles began to be seen in the 18th century thanks to the influence of the West. This article will focus on the decoration of Dedebayrak House in Ankara. Decoration in the architecture found within the boundaries of Ankara consist mostly of geometrical or floral decorations and various inscriptions. The Dedebayrak House not only has these kind of decorations, but also it has these decorations in its architectural descriptions, so it makes this house the only one to have survived in Ankara. Moreover, this building is especially important as the décor included work belonging to Nakkaş Mustafa. However, these decorative features do not remain today. The situation in Turkey is such that architecture is not conserved, which leads to many historically important buildings vanishing. Neither local authorities, nor the owner of these buildings look after these buildings properly, leading their specific historical features to be lost. This situation both damages the urban fabric and harms the historical heritage of the city. Therefore, decorative features in the building will be analysed both on their own and compared to other buildings in Ankara in order to create an overall picture.

  11. ATATÜRK and TURKEY FROM AN ENGLISH DIPLOMAT’S VIEW (1933-1939 / BIR INGILIZ DIPLOMATIN GÖZÜYLE ATATÜRK ve TÜRKIYE (1933–1939

    Directory of Open Access Journals (Sweden)

    Dr. Esra SARIKOYUNCU DEĞERLI

    2008-09-01

    Full Text Available Sir Percy Loraine was an assignment to the Embassy inAnkara, with the rank of Ambassador, which he took up at the end of1933. His mission lasted till May 1939. Mentioned diplomat, duringhis mission carefully observed internal and external events of Turkeyand informed the Foreign Ministry of United Kingdom and thuscontrıbuted to the development of Turkısh and England Relatıons.Healso had good relations with Mustafa Kemal Atatürk who founder of the Turkish Republic and its first president. He filled with admirationfor Atatürk’s personality and his Turkish Revolution. As a one of theEnglish diplomat Loraine, continued to do various speeches andwriting articles about Atatürk and Turkish Republic, after his missionended in Ankara. Loraine, has been opposite of the various accusationagainst Atatürk, especially “dictatorship” and “anti-religion” issues.Because of this, he made a lot of correspond with statesman andauthor also with some formal association about Atatürk.In our study, Sir Percy Loraine’s autobiography and hisopinion about Atatürk and Turkey will be expressed to take advantageof English archives documents.

  12. Using portable negative pressure wound therapy devices in the home care setting

    Directory of Open Access Journals (Sweden)

    Burke JR

    2014-12-01

    Full Text Available Joshua R Burke, Rachael Morley, Mustafa Khanbhai Academic Surgery Unit, Education and Research Centre, University Hospital of South Manchester, Manchester, UK Abstract: Negative pressure wound therapy (NPWT is the continuous or intermittent application of subatmospheric pressure to the surface of a wound that improves the wound environment, accelerates healing, and reduces wound closure time. Since its first documented use, this technology has lent itself to a number of adaptations, most notably, the development of portable devices facilitating treatment in the home care setting. With advancing surgical standards, wound healing is an important rate-limiting factor in early patient discharge and often a major cost of inpatient treatment. The efficacy of NPWT in the home care setting has been investigated through rate of wound closure, time in care, and patient experience. Rate of wound closure is the most appropriate primary end point. Much can be gleaned from patient experience, but the future success of portable NPWT will be measured on time in care and therefore cost effectiveness. However, there is a lack of level 1a evidence demonstrating increased efficacy of portable over inpatient NPWT. The development of portable NPWT is an encouraging innovation in wound care technology, and extending the benefits to the home care setting is both possible and potentially more beneficial. Keywords: portable, negative pressure wound therapy, vacuum-assisted closure, topical negative pressure therapy

  13. TBMM’DEKİ İLK KADIN MİLLETVEKİLLERİNDEN ESMA NAYMAN VE MECLİS’TEKİ FAALİYETLERİ

    OpenAIRE

    Çanak, Erdem

    2016-01-01

    Türkiye Cumhuriyeti, Mustafa Kemal Atatürk öndeliğinde emperyalist devletlere karşı verilen bir bağımsızlık mücadelesi neticesinde kurulmuştur. Bu nedenle Atatürk, bağımsızlık mücadelesinin kazanılmasından sonra ülkeyi muasır medeniyetler seviyesine çıkarmak için bir dizi inkılâp gerçekleştirmiştir. İnkılâpları yaparken ülkesinin bağımsızlığı için varını yoğunu ortaya koyarak mücadele etmiş olan Türk kadınını da unutmamıştır. Bu bağlamda kadınlara, çeşitli hakların yanı sıra 1934 yılında da m...

  14. Perspectives on extended Deterrence

    International Nuclear Information System (INIS)

    Tertrais, Bruno; Yost, David S.; Bunn, Elaine; Lee, Seok-soo; Levite, Ariel e.; Russell, James A.; Hokayem, Emile; Kibaroglu, Mustafa; Schulte, Paul; Thraenert, Oliver; Kulesa, Lukasz

    2010-05-01

    In November 2009, the Foundation for Strategic Research (Fondation pour la recherche strategique, FRS) convened a workshop on 'The Future of extended Deterrence', which included the participation of some of the best experts of this topic, from the United States, Europe, the Middle East and East Asia, as well as French and NATO officials. This document brings together the papers prepared for this seminar. Several of them were updated after the publication in April 2010 of the US Nuclear Posture Review. The seminar was organized with the support of the French Atomic energy Commission (Commissariat a l'energie atomique - CEA). Content: 1 - The future of extended deterrence: a brainstorming paper (Bruno Tertrais); 2 - US extended deterrence in NATO and North-East Asia (David S. Yost); 3 - The future of US extended deterrence (Elaine Bunn); 4 - The future of extended deterrence: a South Korean perspective (Seok-soo Lee); 5 - Reflections on extended deterrence in the Middle East (Ariel e. Levite); 6 - extended deterrence, security guarantees and nuclear weapons: US strategic and policy conundrums in the Gulf (James A. Russell); 7 - extended deterrence in the Gulf: a bridge too far? (Emile Hokayem); 8 - The future of extended deterrence: the case of Turkey (Mustafa Kibaroglu); 9 - The future of extended deterrence: a UK view (Paul Schulte); 10 - NATO and extended deterrence (Oliver Thraenert); 11 - extended deterrence and assurance in Central Europe (Lukasz Kulesa)

  15. Estudo de metais pesados (Co, Cu, Fe, Cr, Ni, Mn, Pb e Zn na Bacia do Tarumã-Açu Manaus (AM Heavy metal (Co, Cu, Fe, Cr, Ni, Mn, Pb e Zn study in the Tarumã-Açu Basin Manaus (AM

    Directory of Open Access Journals (Sweden)

    Genilson Pereira Santana

    2007-01-01

    Full Text Available Os resíduos gerados em domicílios incluem diversos produtos, como pesticidas, produtos farmacêuticos, detergentes, óleos de cozinha, metais pesados contidos em baterias e outros utensílios. Esses resíduos são lançados continuamente em aterro sanitário ou lixões em cidades como Manaus. O chorume produzido nesses aterros, quando não tratados, contamina recursos hídricos superficiais e subterrâneos. Neste estudo foi feita uma avaliação das conseqüências da liberação do chorume no sistema hídrico da bacia do Tarumã-Açu. Amostras de água e sedimento foram coletadas nos igarapés Matrinxã, Acará, Bolívia, bacia do Tarumã-Açu e dentro do aterro sanitário (Manaus - Amazonas - Brasil em março 2001. As amostras de água foram filtradas em filtro Milipore (0,45 mm de poro e, em seguida, tratadas com HNO3 concentrado. As amostras de sedimento foram peneiradas em malha de 0,053 mm e digeridas com HCl:HNO3 (1:3 a 150ºC. As concentrações de alguns metais pesados (Co, Cu, Fe, Cr, Ni, Mn, Pb e Zn foram determinadas nas amostras de água e sedimento por espectrometria de absorção atômica de chama. Os resultados revelaram que a concentração dos metais pesados é muito acima dos permitidos pela resolução 357/2005 do CONAMA em praticamente todos os locais amostrados, mostrando que o Aterro Sanitário é um dos principais responsáveis pelo impacto ambiental observado nos corpos hídricos estudados. As análises dos componentes principais (PCA e hierárquica de cluster (HCA, revelam que os pontos de coleta localizados dentro do aterro sanitário apresentam características diferentes dos outros locais amostrados. Além disso, o HCA e PCA mostraram que existe uma similaridade entre os pontos de coleta localizados fora do aterro o que permite afirmar que o chorume do aterro se dissolve por todo corpo hídrico estudado.Domestic sewage involves several products, such as pesticides, pharmaceutics products, detergents, soybean oil

  16. Effect of picroside II on hind limb ischemia reperfusion injury in rats

    Directory of Open Access Journals (Sweden)

    Kılıç Y

    2017-06-01

    Full Text Available Yiğit Kılıç,1 Abdullah Özer,1 Tolga Tatar,1 Mustafa Hakan Zor,1 Mehmet Kirişçi,2 Hakan Kartal,3 Ali Doğan Dursun,4 Deniz Billur,5 Mustafa Arslan,6 Ayşegül Küçük7 1Department of Cardiovascular Surgery, Gazi University Medical Faculty, Ankara, 2Department of Cardiovascular Surgery, Kahramanmaras Sutcu Imam Medical Faculty, Kahramanmaras, 3Department of Cardiovascular Surgery, Ardahan State Hospital, Ardahan, 4Department of Physiology, Ankara University Medical Faculty, 5Department of Histology and Embryology, Ankara University Medical Faculty, 6Department of Anaesthesiology and Reanimation, Gazi University Medical Faculty, Ankara, 7Department of Physiology, Dumlupinar University Medical Faculty, Kütahya, Turkey Introduction: Many structural and functional damages are observed in cells and tissues after reperfusion of previously viable ischemic tissues. Acute ischemia reperfusion (I/R injury of lower extremities occurs especially when a temporary cross-clamp is applied to the abdominal aorta during aortic surgery. Research regarding the treatment of I/R injury has been increasing day-by-day. In this study, we aimed to investigate the effect of picroside II on skeletal muscle of rats experiencing simulated I/R.Materials and methods: Twenty-four male Wistar albino rats weighing between 210 and 300 g were used in this study. Rats were randomly divided into 4 groups of 6 rats each (control, I/R, control + picroside II, and I/R + picroside II. The infrarenal section of the abdominal aorta was occluded with an atraumatic microvascular clamp in I/R group. The clamp was removed after 120 minutes and reperfusion was provided for a further 120 minutes. Picroside II (10 mg kg–1 was administered intraperitoneally to the animals in control + picroside II and I/R + picroside II groups. At the end of the study, skeletal muscle tissue was obtained for the determination of total oxidant status (TOS and total antioxidant status (TAS levels

  17. Comparison of cellular effects of starch-coated SPIONs and poly(lactic-co-glycolic acid matrix nanoparticles on human monocytes

    Directory of Open Access Journals (Sweden)

    Gonnissen D

    2016-10-01

    Full Text Available Dominik Gonnissen,1 Ying Qu,1,2 Klaus Langer,3 Cengiz Öztürk,4 Yuliang Zhao,2 Chunying Chen,2 Guiscard Seebohm,5 Martina Düfer,6 Harald Fuchs,1 Hans-Joachim Galla,7 Kristina Riehemann11Center for Nanotechnology, Institute of Physics, University of Münster, Münster, Germany; 2National Center for Nanoscience and Technology, Chinese Academy of Sciences, Beijing, People’s Republic of China; 3Institute of Pharmaceutical Technology and Biopharmacy, University of Münster, Münster, 4chemicell GmbH, Berlin, 5Department of Cardiovascular Medicine, Institute for Genetics of Heart Diseases, University Hospital Münster, 6Department of Pharmacology, Institute of Pharmaceutical and Medicinal Chemistry, 7Department of Cell Biology/Biophysics, Institute of Biochemistry, University of Münster, Münster, GermanyAbstract: Within the last years, progress has been made in the knowledge of the properties of medically used nanoparticles and their toxic effects, but still, little is known about their influence on cellular processes of immune cells. The aim of our comparative study was to present the influence of two different nanoparticle types on subcellular processes of primary monocytes and the leukemic monocyte cell line MM6. We used core-shell starch-coated superparamagnetic iron oxide nanoparticles (SPIONs and matrix poly(lactic-co-glycolic acid (PLGA nanoparticles for our experiments. In addition to typical biocompatibility testing like the detection of necrosis or secretion of interleukins (ILs, we investigated the impact of these nanoparticles on the actin cytoskeleton and the two voltage-gated potassium channels Kv1.3 and Kv7.1. Induction of necrosis was not seen for PLGA nanoparticles and SPIONs in primary monocytes and MM6 cells. Likewise, no alteration in secretion of IL-1β and IL-10 was detected under the same experimental conditions. In contrast, IL-6 secretion was exclusively downregulated in primary monocytes after contact with both

  18. Relationship between Emotional Intelligence and Aggression on Boxers

    Directory of Open Access Journals (Sweden)

    Hande Baba Kaya

    2017-09-01

    Full Text Available Emotional Quotient is defined as the ability to perceive, use, manage and understand the emotions, which is associated with the better psychological adjustment. Analyzing studies in the literature, an inverse relationship was observed between emotional quotient and aggressive behavior. Therefore, the purpose of this study is examining the relationship between emotional quotient and aggression on boxers. This study is important for the boxers. That is why emotion management has a great role for the success in the ring. Boxing sport is based on the technical implementation. During the game boxer must control the emotions, which push him to the aggression. If emotions are not able to control during the game, anger and aggression will prevent the success. The findings of this study will demonstrate the relationship between the sports environment and emotional intelligence, in particular inferences to be made about the boxer. The sample of their search consists of 200 boxers who do sports in the districts of Eskişehir, Zonguldak, Bolu, Bursa, Ankara, Sakarya, Gaziantep and Antalya in Turkey. In this study, variation of demographic characteristics are determined Personal Information form, Bar-on Emotional Quotient Scale to determine the emotional quotient [Bar-On 1997; Acar, 2001], and Aggression Inventory were used which was developed by Kocatürk [Kocatürk, 1982]. The relationship between emotional quotient and aggression were analyzed Pearson product moment correlation coefficients. The function of emotional intelligence explanation for aggression was tested by stepwise multiple regression analysis. According to findings of the research have meaningful negative relationship between aggression and all dimensions of the emotional quotient. In addition, coping with stress and interpersonal relationships significant size aggression scores (R2 = .26, F (2,197 = 34,252, p <.001 were found to explain. As a result, boxer aggression in terms of emotional

  19. Toward reduced transport errors in a high resolution urban CO2 inversion system

    Directory of Open Access Journals (Sweden)

    Aijun Deng

    2017-05-01

    Full Text Available We present a high-resolution atmospheric inversion system combining a Lagrangian Particle Dispersion Model (LPDM and the Weather Research and Forecasting model (WRF, and test the impact of assimilating meteorological observation on transport accuracy. A Four Dimensional Data Assimilation (FDDA technique continuously assimilates meteorological observations from various observing systems into the transport modeling system, and is coupled to the high resolution CO2 emission product Hestia to simulate the atmospheric mole fractions of CO2. For the Indianapolis Flux Experiment (INFLUX project, we evaluated the impact of assimilating different meteorological observation systems on the linearized adjoint solutions and the CO2 inverse fluxes estimated using observed CO2 mole fractions from 11 out of 12 communications towers over Indianapolis for the Sep.-Nov. 2013 period. While assimilating WMO surface measurements improved the simulated wind speed and direction, their impact on the planetary boundary layer (PBL was limited. Simulated PBL wind statistics improved significantly when assimilating upper-air observations from the commercial airline program Aircraft Communications Addressing and Reporting System (ACARS and continuous ground-based Doppler lidar wind observations. Wind direction mean absolute error (MAE decreased from 26 to 14 degrees and the wind speed MAE decreased from 2.0 to 1.2 m s–1, while the bias remains small in all configurations (< 6 degrees and 0.2 m s–1. Wind speed MAE and ME are larger in daytime than in nighttime. PBL depth MAE is reduced by ~10%, with little bias reduction. The inverse results indicate that the spatial distribution of CO2 inverse fluxes were affected by the model performance while the overall flux estimates changed little across WRF simulations when aggregated over the entire domain. Our results show that PBL wind observations are a potent tool for increasing the precision of urban meteorological reanalyses

  20. Use of High-Resolution WRF Simulations to Forecast Lightning Threat

    Science.gov (United States)

    McCaul, E. W., Jr.; LaCasse, K.; Goodman, S. J.; Cecil, D. J.

    2008-01-01

    Recent observational studies have confirmed the existence of a robust statistical relationship between lightning flash rates and the amount of large precipitating ice hydrometeors aloft in storms. This relationship is exploited, in conjunction with the capabilities of cloud-resolving forecast models such as WRF, to forecast explicitly the threat of lightning from convective storms using selected output fields from the model forecasts. The simulated vertical flux of graupel at -15C and the shape of the simulated reflectivity profile are tested in this study as proxies for charge separation processes and their associated lightning risk. Our lightning forecast method differs from others in that it is entirely based on high-resolution simulation output, without reliance on any climatological data. short [6-8 h) simulations are conducted for a number of case studies for which three-dmmensional lightning validation data from the North Alabama Lightning Mapping Array are available. Experiments indicate that initialization of the WRF model on a 2 km grid using Eta boundary conditions, Doppler radar radial velocity fields, and METAR and ACARS data y&eld satisfactory simulations. __nalyses of the lightning threat fields suggests that both the graupel flux and reflectivity profile approaches, when properly calibrated, can yield reasonable lightning threat forecasts, although an ensemble approach is probably desirable in order to reduce the tendency for misplacement of modeled storms to hurt the accuracy of the forecasts. Our lightning threat forecasts are also compared to other more traditional means of forecasting thunderstorms, such as those based on inspection of the convective available potential energy field.

  1. Effect of caffeic acid phenethyl ester on bone formation in the expanded inter-premaxillary suture

    Directory of Open Access Journals (Sweden)

    Kazancioglu HO

    2015-12-01

    Full Text Available Hakki Oguz Kazancioglu,1 Sertac Aksakalli,2 Seref Ezirganli,1 Muhammet Birlik,2 Mukaddes Esrefoglu,3 Ahmet Hüseyin Acar1 1Department of Oral and Maxillofacial Surgery, 2Department of Orthodontics, Faculty of Dentistry, 3Department of Histology, Faculty of Medicine, Bezmialem Vakif University, Istanbul, Turkey Background: Narrow maxilla is a common problem in orthodontics and dentofacial orthopedics. To solve this problem, a procedure called rapid maxillary expansion (RME has been used. However, relapse tendency is a major problem of RME. Although relapse tendency is not clearly understood, various treatment procedures and new application has been investigated. The present study aimed to investigate the possible effectiveness of caffeic acid phenethyl ester (CAPE on new bone formation in rat midpalatal suture after RME.Materials and methods: Twenty male Sprague Dawley rats were used in this study. The animals were randomly divided into two groups as control and CAPE group. In CAPE group, CAPE was administered systemically via intraperitoneal injection. RME procedure was performed on all animals. For this purpose, the springs were placed on the maxillary incisors of rats and activated for 5 days. After then, the springs were removed and replaced with short lengths of rectangular retaining wire for consolidation period of 15 days. At the end of the study, histomorphometric analysis was carried out to assess of new bone formation.Results: New bone formation was significantly greater in CAPE group than the control group (P<0.05. CAPE enhances new bone formation in midpalatal suture after RME.Conclusion: These results show that CAPE may decrease the time needed for retention. Keywords: rapid maxillary expansion, bone formation, caffeic acid phenethyl ester, midpalatal suture, histopathology

  2. Positron and positronium studies of irradiation-induced defects and microvoids in vitreous metamict silica

    International Nuclear Information System (INIS)

    Hasegawa, M.; Saneyasu, M.; Tabata, M.; Tang, Z.; Nagai, Y.; Chiba, T.; Ito, Y.

    2000-01-01

    To study irradiation-induced defects and structural microvoids in vitreous silica (v-SiO 2 ), positron lifetime, angular correlation of positron annihilation radiation (ACAR), and electron spin resonance (ESR) were measured on v-SiO 2 and quartz (c-SiO 2 ) samples irradiated with fast neutrons up to a dose of 4.1x10 20 n/cm 2 . Two kinds of positron-trapping defects have been found to form in v-SiO 2 by fast neutron irradiation: type-I and type-II defects. Similar defects also appear in the irradiated c-SiO 2 , indicating that both the defects are common in v-SiO 2 and c-SiO 2 . The detailed annealing and photo-illumination studies of positron annihilation and ESR for these two defects suggest that the type-I defects are non-bridging oxygen hole centers (NBOHC), while the type-II defects are oxygen molecules which cannot be detected by ESR. Higher dose irradiation than 1.0x10 20 n/cm 2 causes c-SiO 2 to change to metamict (amorphous) phase (m-SiO 2 ). Positronium (Ps) atoms are found to form in microvoids with an average radius of about 0.3 nm in the v-SiO 2 and m-SiO 2 . This suggests that microvoids proved by Ps are structurally intrinsic open spaces and reflect the topologically disordered structure of these phases in the subnanometer scale

  3. The Use of the Data Assimilation Research Testbed for Initializing and Evaluating IPCC Decadal Forecasts

    Science.gov (United States)

    Raeder, K.; Anderson, J. L.; Lauritzen, P. H.; Hoar, T. J.; Collins, N.

    2010-12-01

    DART (www.image.ucar.edu/DAReS/DART) is a general purpose, freely available, ensemble Kalman filter, data assimilation system, which is being used to generate state-of-the-art, partially coupled, ocean-atmosphere re-analyses in support of the decadal predictions planned for the next IPCC report. The resulting gridded product is directly comparable to the state variables output by POP and CAM (oceanic and atmospheric components of NCAR's Community Earth System Model climate model) because those are the assimilating models. Other models could also benefit from comparison against these reanalyses, since the ocean analyses are at the leading edge of ocean state estimation, and the atmospheric analyses are competitive with operational centers'. Such comparisons can reveal model biases and predictability characteristics, and do so in a quantitative way, since the ensemble nature of the analyses provides an objective estimate of the analysis error. The analyses will also be used as initial conditions for the decadal forecasts because they are the most realistic available. The generation of such analyses has revealed errors in model formulation for several versions of the finite volume core CAM, which has led to model improvements in each case. New models can be incorporated into DART in a matter of weeks, allowing them to be compared directly against available observations. The observations currently used in the assimilations include, for the ocean; temperature and salinity from the World Ocean Database (floats, drifters, moorings, autonomous pinipeds, and others), and for the atmosphere; temperature and winds from radiosondes, satellite drift winds, ACARS and aircraft. Observations of ocean currents and atmospheric moisture and pressure are also available. Global Positioning System profiles of atmospheric temperature and moisture are available for recent years. All that is required to add new observations to the suite is the forward operator, which generates an estimate

  4. Prevention of Pazopanib-Induced Prolonged Cardiac Repolarization and Proarrhythmic Effects

    Directory of Open Access Journals (Sweden)

    Tulay Akman

    2014-11-01

    Full Text Available Background: Pazopanib (PZP may induce prolonged cardiac repolarization and proarrhythmic effects, similarly to other tyrosine kinase inhibitors. Objectives: To demonstrate PZP-induced prolonged cardiac repolarization and proarrhythmic electrophysiological effects and to investigate possible preventive effects of metoprolol and diltiazem on ECG changes (prolonged QT in an experimental rat model. Methods: Twenty-four Sprague-Dawley adult male rats were randomly assigned to 4 groups (n = 6. The first group (normal group received 4 mL of tap water and the other groups received 100 mg/kg of PZP (Votrient® tablet perorally, via orogastric tubes. After 3 hours, the following solutions were intraperitoneally administered to the animals: physiological saline solution (SP, to the normal group and to the second group (control-PZP+SP group; 1 mg/kg metoprolol (Beloc, Ampule, AstraZeneca, to the third group (PZP+metoprolol group; and 1mg/kg diltiazem (Diltiazem, Mustafa Nevzat, to the fourth group (PZP+diltiazem group. One hour after, and under anesthesia, QTc was calculated by recording ECG on lead I. Results: The mean QTc interval values were as follows: normal group, 99.93 ± 3.62 ms; control-PZP+SP group, 131.23 ± 12.21 ms; PZP+metoprolol group, 89.36 ± 3.61 ms; and PZP+diltiazem group, 88.86 ± 4.04 ms. Both PZP+metoprolol and PZP+diltiazem groups had significantly shorter QTc intervals compared to the control-PZP+SP group (p < 0.001. Conclusion: Both metoprolol and diltiazem prevented PZP-induced QT interval prolongation. These drugs may provide a promising prophylactic strategy for the prolonged QTc interval associated with tyrosine kinase inhibitor use.

  5. The Effect of Oxygen Inhalation Plus Oxytocin Compared with Oxytocin Only on Postpartum Haemorrhage: A Randomized Clinical Trial.

    Science.gov (United States)

    Suhrabi, Zainab; Taghinejad, Hamid; Direkvand-Moghadam, Ashraf; Akbari, Malihe

    2016-09-01

    Post Partum Haemorrhage (PPH) is the leading cause of maternal mortality across the world, mainly in the developing countries. The present study was conducted with the aim to investigate effect of oxygen inhalation plus oxytocin compared with oxytocin only on PPH. This study was a clinical trial which was performed in Shahid Mustafa Khomieni Teaching Hospital of Ilam (western Iran) from April 2012 to Nov 2013. One hundred and twenty pregnant women who were referred to delivery ward for normal vaginal delivery were selected with convenience sampling method and they were randomly assigned into two groups. For both groups management of the third stage of labour was done using 1000CC Ringer and 20 units of Oxytocin. In the intervention group, in addition to the routine administration, 8 liters of oxygen via face mask was used continuously until 2 hours after delivery. Blood loss was determined by regular weighing of the buttocks that were previously weighted. The difference was calculated before and after weighing (1 gram increasing of weight was considered to be equivalent to 1CC blood loss). Data were analysed by SPSS 16 version using Student- t and Chi-square tests. The two groups were homogenous in regard to all the base line variables. The study results indicated that the mean of blood loss were (256.16±97) ml at two hours after delivery in the control group and (149.5±46.49) ml in the intervention group. There was a significant difference between PPH of the two groups (poxytocin infusion during 2hours later resulted in a significant decreasing in the amount of bleeding after normal vaginal delivery.

  6. Assessment of the perioperative period in civilians injured in the Syrian Civil War.

    Science.gov (United States)

    Hakimoglu, Sedat; Karcıoglu, Murat; Tuzcu, Kasım; Davarcı, Isıl; Koyuncu, Onur; Dikey, İsmail; Turhanoglu, Selim; Sarı, Ali; Acıpayam, Mehmet; Karatepe, Celalettin

    2015-01-01

    wars and its challenges have historically afflicted humanity. In Syria, severe injuries occurred due to firearms and explosives used in the war between government forces and civilians for a period of over 2 years. the study included 364 cases, who were admitted to Mustafa Kemal University Hospital, Medicine School (Hatay, Turkey), and underwent surgery. Survivors and non-survivors were compared regarding injury site, injury type and number of transfusions given. The mortality rate found in this study was also compared to those reported in other civil wars. the mean age was 29 (3-68) years. Major sites of injury included extremities (56.0%), head (20.1%), abdomen (16.2%), vascular structures (4.4%) and thorax (3.3%). Injury types included firearm injury (64.4%), blast injury (34.4%) and miscellaneous injuries (1.2%). Survival rate was 89.6% while mortality rate was 10.4%. A significant difference was observed between mortality rates in this study and those reported for the Bosnia and Lebanon civil wars; and the difference became extremely prominent when compared to mortality rates reported for Vietnam and Afghanistan civil wars. among injuries related to war, the highest rate of mortality was observed in head-neck, abdomen and vascular injuries. We believe that the higher mortality rate in the Syrian Civil War, compared to the Bosnia, Vietnam, Lebanon and Afghanistan wars, is due to seeing civilians as a direct target during war. Copyright © 2014 Sociedade Brasileira de Anestesiologia. Published by Elsevier Editora Ltda. All rights reserved.

  7. Microstructural and mechanical characterization of melt spun process Sn-3.5Ag and Sn-3.5Ag-xCu lead-free solders for low cost electronic assembly

    Energy Technology Data Exchange (ETDEWEB)

    Mostafa Shalaby, Rizk; Kamal, Mustafa [Metal Physics Laboratory, Physics Department, Faculty of Science, Mansoura University, P.O.Box: 35516, Mansoura (Egypt); Ali, Esmail A.M. [Basic Science Department, Faculty of Engineering, University of Science & Technology (Yemen); Gumaan, Mohammed S., E-mail: m.gumaan1@gmail.com [Metal Physics Laboratory, Physics Department, Faculty of Science, Mansoura University, P.O.Box: 35516, Mansoura (Egypt); Basic Science Department, Faculty of Engineering, University of Science & Technology (Yemen)

    2017-04-06

    This paper aims to investigate the reliability of mechanical and creep behavior for the eutectic Sn-Ag and Sn-Ag-Cu Solder joints rapidly solidified after hot compressing (HC) in terms of structural changes and its relationship with thermal behavior, which has been discussed and compared with their properties before HC process by Mustafa et al. (2016) . These solder joints were prepared by melt-spinning technique and tested by HC at 30 MPa pressure and 150 °C for 90 min, their structural, mechanical and thermal properties after HC process have been investigated by X-ray diffraction (XRD), dynamic resonance techniques (DRT) and differential scanning calorimetry (DSC) techniques respectively and compared with these solders before HC. The results revealed that the pressure caused some fractures on the solders morphology surfaces. But some benefits for these solders have been occurred, like eliminating the internal stresses through recrystallization process whose evidence by the particle size increases after they HC, stabilized structure after HC was due to the metastable phases rearrangements, new intermetallic compounds (IMCs) formation, decreasing, melting temperature range (∆T), lattice strains (ƹ) and entropy change (S). These sequential benefits are considered to be the main reasons which lead to decreasing energy loss (Q{sup −1}), creep rate (É›) and thermal stability enhancement. Elastic modulus increment might be due to low elastic lattice distortions after HC, while the stress exponent (n) reduction refers to viscous glide mechanism of deformation after HC instead of climb deformation mechanism before HC.

  8. SEROPREVALANCE OF TOXOPLASMA IgG AMONG PREGNANT WOMEN IN THE PROVINCE OF HATAY AND CONTRIBUTION OF AVIDITY TEST TO THE DIAGNOSE

    Directory of Open Access Journals (Sweden)

    Ayşe Güler Okyay

    2013-09-01

    Full Text Available Objective: Toxoplasma gondii, an obligate intracellular parasite, is a common zoonosis in the world and causes toxoplasmosis. The infection is usually asymptomatic and if it occurs during pregnancy it may cause congenital anomalies, miscarriage, stillbirth and premature delivery. In this study, determination of seroprevalance of Toxoplazma IgG and IgM among pregnant women in the province of Hatay was aimed. In addition, IgG avidity test was performed in subjects who had positive test results for both of the two antibodies. Design: In this study, 3340 pregnant women who admitted to the outpatient clinic of gynecelogy and obstetrics department of Mustafa Kemal University/Hatay between the years of 2007 and 2012were included. Toxoplazma IgM and IgG antibody test results of the subjects were examined retrospectively by screening the records of microbiology laboratory of the hospital. Additionally, IgG avidity test was performed in 114 cases whoose test results for both Toxoplazma IgM and IgG were positive. Main outcome measures: IgM and IgG seropositivity rates were found as 3.6% (n = 120 and 57% (n = 1910, respectively. The rate of new infection was detected with avidity test as 31%. Conclusions: Remarkably high seropositivity rate was observed in the Mediterranean region especially in the province of Hatay. Antibody testing for Toxoplasma gondii may be useful during routine examinations of women who are in the first trimester of pregnancy and who plan gestation. In addition, measures should be taken to raise awareness of hygiene in our region in terms of water and sanitation.

  9. ONE OF THE TURKISH-ARABIC VERSE DICTIONARIES: SÜBHA-İ SIBYÁN -1- (INVESTIGATION / TÜRKÇE-ARAPÇA MANZUM SÖZLÜKLERDEN SÜBHA-İ SIBYÁN -1- (İNCELEME

    Directory of Open Access Journals (Sweden)

    Assoc. Prof. Dr. Atabey KILIÇ

    2006-12-01

    Full Text Available We learn from sourches that many dictionaries had been written for Turkish, Arabic and Persian. But we must make it clear that there is a tradition of writing verse dictionary in the Classical Turkish Poem which is not seen in the other literatures. According to many sources we understand these dictionaries are not known and they are far from being significant and persuasive sources in science. These dictionaries have importance for children to learn “aruz/prosody” and also Arabic, Persian words and their meanings in Turkish. Children learn these words easily with the help of these dictionaries. So they take attention from this point. İt is an important point that in many verse dictionaries’ foreword part it is said that “lugat ilmi/dictionary science” make people clever and poets say that even they memorized at least one verse dictionary in their childhood. When we published Mustafa b. Osman Keskin’s “Manzûme-i Keskin” called Turkish-Arabic-Persian verse dictionary in 2001, we saw that there are verse dictionaries more than 30 in Classical Turkish Literature. We believe in it is possible that there are many unknown verse dictionaries.In this article we aim to give knowledge about Sübha-i Sıbyân Turkish-Arabic verse dictionary which has at least 50-60 copies in libraries and which has been published 30 times between 1801-1900. This dictionary has about 460 couplets and had been used as a text-book in Sıbyân Schools.

  10. [Assessment of the perioperative period in civilians injured in the Syrian Civil War].

    Science.gov (United States)

    Hakimoglu, Sedat; Karcıoglu, Murat; Tuzcu, Kasım; Davarcı, Isıl; Koyuncu, Onur; Dikey, İsmail; Turhanoglu, Selim; Sarı, Ali; Acıpayam, Mehmet; Karatepe, Celalettin

    2015-01-01

    Wars and its challenges have historically afflicted humanity. In Syria, severe injuries occurred due to firearms and explosives used in the war between government forces and civilians for a period of over 2 years. The study included 364 cases, who were admitted to Mustafa Kemal University Hospital, Medicine School (Hatay, Turkey), and underwent surgery. Survivors and non-survivors were compared regarding injury site, injury type and number of transfusions given. The mortality rate found in this study was also compared to those reported in other civil wars. The mean age was 29 (3-68) years. Major sites of injury included extremities (56.0%), head (20.1%), abdomen (16.2%), vascular structures (4.4%) and thorax (3.3%). Injury types included firearm injury (64.4%), blast injury (34.4%) and miscellaneous injuries (1.2%). Survival rate was 89.6% while mortality rate was 10.4%. A significant difference was observed between mortality rates in this study and those reported for the Bosnia and Lebanon civil wars; and the difference became extremely prominent when compared to mortality rates reported for Vietnam and Afghanistan civil wars. Among injuries related to war, the highest rate of mortality was observed in head-neck, abdomen and vascular injuries. We believe that the higher mortality rate in the Syrian Civil War, compared to the Bosnia, Vietnam, Lebanon and Afghanistan wars, is due to seeing civilians as a direct target during war. Copyright © 2014 Sociedade Brasileira de Anestesiologia. Publicado por Elsevier Editora Ltda. All rights reserved.

  11. The Literary Legacy Inherited by Ankara of the Republican Era: Literary Life and Milieux in Ankara until the Republic Era

    Directory of Open Access Journals (Sweden)

    Necati Tonga

    2014-12-01

    Full Text Available Ankara became one of the most important circles of literary activities after the establishment of the Republic of Turkey in 1923. In this era, the most prevalent factor for this nourishment was that Ankara was chosen as the capital city and Turkey would be governed from Ankara from then on. Besides this fact, before being the capital, Ankara had a rich background in terms of literature. The city had a strong tradition of Divan and Sufi literature in the ruling periods of Seljuks and Ottomans. Many Divan poets and minstrels lived in Ankara throughout history. In those times, in addition to madrasahs, dervish lodges and mosques, there were taverns, inns, mansions, coffeehouses, vineyards and gardens that were used for gatherings where poems were recited and talks about literature took place. Before the establishment of the Republic, in the years between 1919 and 1922, Mustafa Kemal Atatürk proclaimed Ankara as the headquarters of the national movements. This choice brought out a liveliness to Ankara in terms of literature. In this period until the Republic, many places serving as dervish lodges, coffeehouses, restaurants, gardens, taverns, and shops, and newspaper editorials such as Tâceddin Dergâhı (Taceddin’s Lodge, Kuyulu Kahve (Coffee-shop, Merkez Kıraathanesi (Central coffee-shop, Hakimiyet-i Milliye and Yenigün Newspaper Editorial Offices, Anadolu Lokantası (Anadolu Restaurant, Teceddüt Lokantası (Teceddüt Restaurant, Abdullah Efendi Lokantası (Abdullah Efendi Restaurant, Muallimler Birliği (Teachers Union, Şehir Bahçesi (City Garden, Dayko’nun Tütüncü Dükkânı (Dayko’s Tobacco Shop and Efe Haydar’ın Meyhanesi (Efe Haydar’s Tavern were prominent gathering places that flourished in the literary activities of Ankara.

  12. Development of a potent invigorator of immune responses endowed with both preventive and therapeutic properties

    Directory of Open Access Journals (Sweden)

    Talwar GP

    2017-05-01

    Full Text Available Gursaran P Talwar,1 Jagdish C Gupta,1 Abu S Mustafa,2 Hemanta K Kar,3 Kiran Katoch,4 Shreemanta K Parida,5 Prabhakara P Reddi,6 Niyaz Ahmed,7 Vikram Saini,8 Somesh Gupta9 1Talwar Research Foundation, New Delhi, India; 2Department of Microbiology, Kuwait University, Kuwait; 3Department of Dermatology, Paras Hospital, Gurgaon, 4National JALMA Institute of Leprosy and Other Mycobacterial Diseases, Agra, India; 5German Centre of Infection, Justus Liebig University, Giessen, Germany; 6Department of Comparative Biosciences, University of Illinois Urbana Champaign, IL, USA; 7Department of Biotechnology and Bioinformatics, University of Hyderabad, Hyderabad, India; 8Department of Microbiology, University of Alabama, Birmingham, AL, USA; 9Department of Dermatology and Venereology, All India Institute of Medical Sciences, New Delhi, India Abstract: This article reviews briefly the making of an immunoprophylactic-cum-immunotherapeutic vaccine against leprosy. The vaccine is based on cultivable, heat-killed atypical mycobacteria, whose gene sequence is now known. It has been named Mycobacterium indicus pranii. It has received the approval of the Drug Controller General of India and the US Food and Drug Administration. Besides leprosy, M. indicus pranii has found utility in the treatment of category II (“difficult to treat” tuberculosis. It also heals ugly anogenital warts. It has preventive and therapeutic action against SP2/O myelomas. It is proving to be a potent adjuvant for enhancing antibody titers of a recombinant vaccine against human chorionic gonadotropin, with the potential of preventing pregnancy without derangement of ovulation and menstrual regularity in sexually active women. Keywords: leprosy, tuberculosis, anogenital warts, myeloma, adjuvant

  13. Case Report of Bullous Pemphigoid following Fundus Fluorescein Angiography

    Directory of Open Access Journals (Sweden)

    Goktug Demirci

    2010-05-01

    Full Text Available Purpose: To report a first case of bullous pemphigoid (BP following intravenous fluorescein for fundus angiography. Clinical Features: A 70-year-old male patient was admitted to the intensive care unit with BP and sepsis. He reported a history of fundus fluorescein angiography with a pre-diagnosis of senile macular degeneration 2 months prior to presentation. At that time, fluorescein extravasated at the antecubital region. Following the procedure, pruritus and erythema began at the wrists bilaterally, and quickly spread to the entire body. The patient also reported a history of allergy to human albumin solution (Plamasteril®; Abbott 15 years before, during bypass surgery. On dermatologic examination, erythematous patches were present on the scalp, chest and anogenital region. Vesicles and bullous lesions were present on upper and lower extremities. On day 2 of hospitalization, tense bullae appeared on the upper and lower extremities. The patient was treated with oral methylprednisolone 48 mg (Prednol®; Mustafa Nevzat, topical clobetasol dipropionate 0.05% cream (Dermovate®; Glaxo SmithKline, and topical 4% urea lotion (Excipial Lipo®; Orva for presumptive bullous pemphigoid. Skin punch biopsy provided tissue for histopathology, direct immunofluorescence examination, and salt extraction, which were all consistent with BP. After 1 month, the patient was transferred to the intensive care unit with sepsis secondary to urinary tract infection; he died 2 weeks later from sepsis and cardiac failure. Conclusions: To our knowledge, this is the first reported case of BP following fundus fluorescein angiography in a patient with known human albumin solution allergy. Consideration should be made to avoid fluorescein angiography, change administration route, or premedicate with antihistamines in patients with known human albumin solution allergy. The association between fundus fluorescein angiography and BP should be further investigated.

  14. Altered diastolic function and aortic stiffness in Alzheimer’s disease

    Directory of Open Access Journals (Sweden)

    Çalık AN

    2014-07-01

    Full Text Available Ali Nazmi Çalik,3 Kazim Serhan Özcan,4 Gülbün Yüksel,2 Baris Güngör,1 Emre Arugarslan,1 Figen Varlibas,2 Ahmet Ekmekci,1 Damirbek Osmonov,1 Mustafa Adem Tatlisu,1 Mehmet Karaca,1 Osman Bolca,1 Izzet Erdinler1 1Department of Cardiology, Siyami Ersek Cardiovascular and Thoracic Surgery Center, Istanbul, Turkey; 2Department of Neurology, Haydarpasa Numune Training and Research Hospital, Istanbul, Turkey; 3Department of Cardiology, Yozgat State Hospital, Yozgat, Turkey; 4Department of Cardiology, Derince Training and Research Hospital, Kocaeli, Turkey Background: Alzheimer’s disease (AD is closely linked to cardiovascular risk factors.Methods: Echocardiographic studies were performed, including left ventricular diastolic functions, left and right atrial conduction times, and arterial stiffness parameters, namely stiffness index, pressure-strain elastic modulus, and distensibility, on 29 patients with AD and 24 age-matched individuals with normal cognitive function.Results: The peak mitral flow velocity of the early rapid filling wave (E was lower, and the peak velocity of the late filling wave caused by atrial contraction (A, deceleration time of peak E velocity, and isovolumetric relaxation time were higher in the AD group. The early myocardial peak (Ea velocity was significantly lower in AD patients, whereas the late diastolic (Aa velocity and E/Ea ratio were similar between the two groups. In Alzheimer patients, stiffness index and pressure-strain elastic modulus were higher, and distensibility was significantly lower in the AD group compared to the control. Interatrial electromechanical delay was significantly longer in the AD group.Conclusion: Our findings suggest that patients with AD are more likely to have diastolic dysfunction, higher atrial conduction times, and increased arterial stiffness compared to the controls of same sex and similar age. Keywords: diastolic dysfunction, atrial conduction timeA Letter to the Editor has been

  15. Detection of Trichomonas Vaginalis in Vaginal Speciemens from Women by Wet Mount, Culture and PCR

    Directory of Open Access Journals (Sweden)

    Gulnaz Culha

    2014-03-01

    Full Text Available Aim: Trichomoniasis, a sexually transmitted infection (STI caused by Trichomonas vaginalis, affects 180 million people worldwide and causes significant morbidity. Infection with T. vaginalis has been associated with vaginitis, exocervicitis, and urethritis in women. Material and Method: In this study, we aim to investigate the presence of T. vaginalis by using three different methods for comparing the results. Two hundred T. vaginalis isolates taken from swap samples were collected in Medical Faculty, Department of Gynecology, Mustafa Kemal University Polyclinic, and examined genotypically and phenotypically to identify T. vaginalis in Parasitology Department. This research is unique in terms of its contribution to patient treatment, being the first molecular study in Turkey/Hatay to determine Trichomonas (TV genes stemming from Trichomonas vaginalis strains. Result: 56 out of 200 patients examined were identified as positive and 24 (42.8% of these were identified through microscopy, 18 (32,1% with culture and 24 (42,8% with PCR. The number of those identified through all these methods is 14 (25%. In this study, difference was calculated using three methods (p=0.022 with Cochran%u2019s Q test. When compared with McNemar two by two, no superiority in T. vaginalis diagnosis was found between microscopy and culture (p=0.5, microscopy and PCR (p=0.063, or culture and PCR (p=0.25 methods. Discussion: Culture method is not used in routine laboratory procedures and has contamination risk. PCR method shows directly the parasite of DNAs, and so it is thought to be more reliable compared to the other two methods.

  16. TWO IMPORTANT DEVELOPMENT THROUGHT THE TUSKISH HISTORY IN THE 20 TH CENTURY: THE RISING OF AVIATION AND A LEADER TÜRK TARİHİ BAKIMINDAN 20. YÜZYILDA İKİ ÖNEMLİ GELİŞME:“HAVACILIĞIN VE BİR LİDERİN DOĞUŞU”

    Directory of Open Access Journals (Sweden)

    Osman YALÇIN

    2011-06-01

    Full Text Available Planes are one of the most important discoveries of the 20th century. This was the last period of the Ottman Empire. This was also the first years of Mustafa Kemal Atatürk’s military life.Turkish government used the airplane in military field firstly in Balkan Wars. Ottoman Empire bought about 450-500 airplanes between 1912-1918 years. Turkish air forces was the one of the first establishments that constituted by parlement at the independence war years. Ever pressed Greek air force, enemy planes were not adducted to Turkish frontline. Ottoman aviation was abolished in 1920. Atatürk became aware of the aviation with his for seeing and the experiences that for he considered important of aviation for making the country strong and independent during his life. But he also foresaw his country insufficiency at substructure and between 1923-1938 air war industry consider important. Therefore flying of younger generation has been seen as a security of the Turkey sky.One of the mottos of Mustafa Kemal ATATURK “Future is in the skies” was also a sign of his foreseing as a strategist which effects continues even today Uçaklar 20. yüzyılın başında icat edilen önemli gelişmelerden biridir. Bu tarih Osmanlı Devleti’nin son zamanlarına denk gelmektedir. Mustafa Kemal Atatürk’ün ise mesleki hayatının ilk yıllarına rastlamıştır.Türk Devleti uçağı askeri alanda ilk defa Balkan Savaşlarında kullanmıştır. Osmanlı Devleti ordusu envanterine 1912–1918 arasında yaklaşık 450–500 uçak alınmıştır. Osmanlı havacılığı 1920 yılında lağv edilmiştir. İstiklâl Savaşı yıllarında Büyük Millet Meclisi’nin teşkilatını kurduğu ilk birimlerden biri Hava Kuvvetleri Teşkilatı olmuştur. İstiklâl Savaşı’nda, Yunanlıların hava gücü daima baskı altında tutulmuş, düşman uçakları Türk cephesine yaklaştırılmamıştır. Atatürk, askerlik hayatındaki tecrübeleri ve öngörüleri ile havac

  17. Spatial variation, speciation and sedimentary records of mercury in the Guanabara Bay (Rio de Janeiro, Brazil)

    Science.gov (United States)

    Covelli, Stefano; Protopsalti, Ioanna; Acquavita, Alessandro; Sperle, Marcelo; Bonardi, Maurizio; Emili, Andrea

    2012-03-01

    As part of the "TAGUBAR" (TAngential GUanabara Bay Aeration Recovery) project, surface and long core sediments of the Guanabara Bay (Rio de Janeiro, Brazil) were investigated for mercury (Hg). The main, but not the only, input of Hg into the Bay's waters is known to be a Chlor-Alkali Plant (CAP) located in the Acarì-São João de Merití River system, on the northwestern side of the Bay. Mercury distribution in surface sediments (<0.1-3.22 mg kg-1, average 0.87±0.80, n=40) seems to be controlled by the organic component, along with sulfur rather than grain-size, where Hg concentrations are less than 1 mg kg-1. Conversely, where the metal contents are higher than 1 mg kg-1, accumulation in surface sediments is mostly related to the presence of nearby contamination sources, such as industrial and urban settlements in the western sector of the Bay. Although total Hg contents in surface sediments exceed the values suggested by the effects-based standard quality guidelines as potentially toxic for the benthic community, results from a sequential extraction procedure showed that the contribution of the more soluble, easily exchangeable and eventually bioavailable Hg phases was found almost negligible (<0.1%). Most of the metal is strongly bound to the mineral lattice of the sedimentary matrix and should therefore be considered almost immobilized. The reduction in Hg accumulation in bottom sediments, expected as a consequence of the adoption of contamination control policies (i.e. Hg-free technologies in the CAP and sewage treating facilities), has not been clearly observed in the core profiles. Current estimates of Hg accumulation rates at the core top range from approximately 1 to 18 mg m-2 yr-1. Pre-industrial bottom core samples indicate that the central and northeastern sectors of the Bay are strongly affected by Hg enrichment: concentrations exceed the estimated baseline concentration by up to 20 factors. A cumulative Hg inventory suggests that the metal content

  18. Use of the isolated problem approach for multi-compartment BEM models of electro-magnetic source imaging

    International Nuclear Information System (INIS)

    Gencer, Nevzat G; Akalin-Acar, Zeynep

    2005-01-01

    The isolated problem approach (IPA) is a method used in the boundary element method (BEM) to overcome numerical inaccuracies caused by the high-conductivity difference in the skull and the brain tissues in the head. Haemaelaeinen and Sarvas (1989 IEEE Trans. Biomed. Eng. 36 165-71) described how the source terms can be updated to overcome these inaccuracies for a three-layer head model. Meijs et al (1989 IEEE Trans. Biomed. Eng. 36 1038-49) derived the integral equations for the general case where there are an arbitrary number of layers inside the skull. However, the IPA is used in the literature only for three-layer head models. Studies that use complex boundary element head models that investigate the inhomogeneities in the brain or model the cerebrospinal fluid (CSF) do not make use of the IPA. In this study, the generalized formulation of the IPA for multi-layer models is presented in terms of integral equations. The discretized version of these equations are presented in two different forms. In a previous study (Akalin-Acar and Gencer 2004 Phys. Med. Biol. 49 5011-28), we derived formulations to calculate the electroencephalography and magnetoencephalography transfer matrices assuming a single layer in the skull. In this study, the transfer matrix formulations are updated to incorporate the generalized IPA. The effects of the IPA are investigated on the accuracy of spherical and realistic models when the CSF layer and a tumour tissue are included in the model. It is observed that, in the spherical model, for a radial dipole 1 mm close to the brain surface, the relative difference measure (RDM*) drops from 1.88 to 0.03 when IPA is used. For the realistic model, the inclusion of the CSF layer does not change the field pattern significantly. However, the inclusion of an inhomogeneity changes the field pattern by 25% for a dipole oriented towards the inhomogeneity. The effect of the IPA is also investigated when there is an inhomogeneity in the brain. In addition

  19. Safety re-evaluation of the HOR reactor

    International Nuclear Information System (INIS)

    Verkooijen, A.H.M.; Vries, J.W. de

    2001-01-01

    The HOR reactor of the Interfaculty Reactor Institute (IRI) of Delft University of Technology has been in operation since 1963. This swimming pool type reactor is the main experimental facility of the institute. It is used for a broad range of both fundamental and applied research. Originally the reactor was intended to serve the Dutch universities. While retaining this inter-university character many of the research themes are carried out with both national and international scientific partners. Gradually the power of the reactor was increased to 3MW maximum operational power. In 1969 a licence was obtained for that power level. Ever since the reactor is operated at a nominal power level of 2 MW. In 1980 a permit was obtained for a new control room and for extension and renewal of the reactor instrumentation. Those modifications were finished in 1982. In the early nineties it became apparent that further modifications and extensions were necessary. As a consequence of the policy of the US government on proliferation the conversion of HEU to LEU was a prerequisite for the availability of fresh fuel and the return of spent fuel to the US. At the same time the development of new instruments for neutron scattering and positron annihilation asked for a new beam hall. Therefore a renewal of the permit was necessary. After extensive studies in which a safety report and an environmental impact statement were made, the application for a new licence was submitted in 1995. The new licence was granted in 1996. However, due to legal actions by individuals. the licence did not become effective until 1997. The beam hall was inaugurated in 1998. In the same year the conversion from HEU to LEU was started. In June 2000 the 'Delft Positron Centre' was officially opened. Here a unique high intensity positron beam serves the 2D-ACAR and Lifetime instruments. The legal procedures lasted until fall 2000 when all objections raised against the new licence were dismissed by the Council of

  20. FOREWORD Foreword

    Science.gov (United States)

    Kuriplach, Jan; Procházka, Ivan

    2011-01-01

    The 6th International Workshop on Positron Studies of Defects (PSD) took place in Prague, Czech Republic, from September 1 to 5, 2008. It was hosted by the Faculty of Mathematics and Physics of the Charles University in Prague. The PSD Workshop brought together positron scientists interested in studying various defects in mainly crystalline materials, and provided an opportunity to report on new results and achievements as well as on novel experimental and theoretical methods in this field. The workshop topics can be characterized as follows: Defect formation, migration, agglomeration and annealing Momentum distribution studies of defects: Doppler broadening, angular correlation of annihilation radiation (ACAR) Slow positron beam studies of defects at surface and near surface regions Theoretical calculations and simulations of momentum distributions, positron lifetimes and other characteristics for defects Defects in unusual materials: quasicrystals, nanostructures Advances in positron experimental methods applicable to defect studies Complementary experimental methods in defect studies (TEM, XRD, AP, SANS, DLTS, PL and others) Industrial applications of positron defect studies The first PSD workshop was organized in Wernigerode, Germany in 1987. The next four workshops were held in Halle, Germany (1994), Hamilton, ON, Canada (1999), Sendai, Japan (2002) and Pullman, WA, USA (2004) under the name Positron Studies of Semiconductor Defects (PSSD). As studying defects in metals is once again gaining importance - as is also documented in these Proceedings - the name of the Workshop in Prague was changed to the original version PSD. The PSD workshops will be organized every three years and the next one will be held in Delft, The Netherlands at the turn of August and September, 2011. We would like to express our gratitude to all of the workshop participants for their presentations and contributions to discussions, which made the PSD Workshop a successful scientific event

  1. A one day workshop on scientific writing: Brief report

    Directory of Open Access Journals (Sweden)

    PR Shankar

    2010-04-01

    Full Text Available A one-day workshop on scientific writing was held at KISTMedical College, Lalitpur, Nepal on Saturday, 27th February2010. Topics covered were ‘Writing an original researcharticle’, ‘Writing an abstract’, ‘Why articles are rejected –views from a reviewer’, ‘Tips for effective scientific writing’,‘Writing a case report’ and ‘Journals where you can publishyour work’. The various sections of an original research articleare abstract, introduction, materials and methods, results,discussion, conclusion, acknowledgements, references andfigures and tables. Let us now examine the first section of apaper, the abstract. An abstract can be regarded as anabbreviated and accurate representation of the papercontents. Abstracts can be unstructured, in IMRaD format(Introduction, Methods, Results and Discussion or in an eightheading format. Key words help in indexing and retrieval.Common reasons why articles are rejected are that they aresent to the wrong journal, the article does not follow the wordlimits of the journal or is not prepared in accordance with thejournal instructions, errors with presentation, grammar andlanguage, problems with the theoretical framework,references to appropriate literature are lacking or there areserious methodological flaws. A narrative structure should linktogether various parts of the paper. Sentences should beshort, written in active voice and address one thought at atime. Unnecessary words should be deleted and short andsimple words used instead of long and complicated ones.While writing an original article most authors start with theMethods section and then write the Results. Ensure that thearticle conforms to the journal’s guidelines for authors.Plagiarism should be avoided and previous studies read,understood and then paraphrased in the writer’s own words.A case report, one of the forms of scientific writing is acarefully documented scientific observation useful foreducation, research, practice

  2. P-wave and QT dispersion in patients with conversion disorder

    Directory of Open Access Journals (Sweden)

    Izci F

    2015-03-01

    Full Text Available Filiz Izci,1 Hilal Hocagil,2 Servet Izci,3 Vedat Izci,4 Merve Iris Koc,5 Rezzan Deniz Acar3 1Department of Psychiatry, Istanbul Bilim University, Sisli Florence Nightingale Hospital; 2Department of Emergency, Faculty of Medicine Hospital Zonguldak Bulent Ecevit University, Zonguldak, Turkey; 3Department of Cardiology, Kosuyolu High Specialization Training and Research Hospital, Istanbul, Turkey; 4Department of Emergency, Kartal Training and Research Hospital, Istanbul, Turkey; 5Department of Psychiatry, Erenköy Training and Research Hospital for Psychiatry, Istanbul, Turkey Objective: The aim of this study was to investigate QT dispersion (QTd, which is the noninvasive marker of ventricular arrhythmia and sudden cardiac death, and P-wave dispersion, which is the noninvasive marker of atrial arrhythmia, in patients with conversion disorder (CD.Patients and methods: A total of 60 patients with no known organic disease who were admitted to outpatient emergency clinic and were diagnosed with CD after psychiatric consultation were included in this study along with 60 healthy control subjects. Beck Anxiety Inventory and Beck Depression Scale were administered to patients and 12-lead electrocardiogram measurements were obtained. Pd and QTd were calculated by a single blinded cardiologist.Results: There was no statistically significant difference in terms of age, sex, education level, socioeconomic status, weight, height, and body mass index between CD patients and controls. Beck Anxiety Inventory scores (25.2±10.8 and 3.8±3.2, respectively, P<0.001 and Beck Depression Scale scores (11.24±6.15 and 6.58±5.69, respectively, P<0.01 were significantly higher in CD patients. P-wave dispersion measurements did not show any significant differences between conversion patients and control group (46±5.7 vs 44±5.5, respectively, P=0.156. Regarding QTc and QTd, there was a statistically significant increase in all intervals in conversion patients (416

  3. Evaluation of the cardiovascular effects of varenicline in rats

    Directory of Open Access Journals (Sweden)

    Selçuk EB

    2015-10-01

    Full Text Available Engin Burak Selçuk,1 Meltem Sungu,2 Hakan Parlakpinar,3 Necip Ermiş,4 Elif Taslıdere,5 Nigar Vardı,5 Murat Yalçinsoy,6 Mustafa Sagır,3 Alaaddin Polat,7 Mehmet Karatas,8 Burcu Kayhan-Tetik11Department of Family Medicine, 2Inonu University Medical Faculty, Malatya, Turkey; 3Department of Pharmacology, 4Department of Cardiology, 5Department of Histology and Embryology, 6Department of Pulmonary Medicine, 7Department of Physiology, 8Department of Medical Ethics, Inonu University Medical Faculty, Malatya, TurkeyBackground: Cardiovascular disease is an important cause of morbidity and mortality among tobacco users. Varenicline is widely used worldwide to help smoking cessation, but some published studies have reported associated cardiovascular events.Objective: To determine the cardiovascular toxicity induced by varenicline in rats.Materials and methods: We randomly separated 34 rats into two groups: 1 the control group (given only distilled water orally, n=10 and the varenicline group (given 9 µg/kg/day varenicline on days 1–3, 9 µg/kg twice daily on days 4–7, and 18 µg/kg twice daily on days 8–90 [total 83 days], n=24. Each group was then subdivided equally into acute and chronic subgroups, and all rats in these groups were euthanized with anesthesia overdose on days 45 and 90, respectively. Body and heart weights, hemodynamic (mean oxygen saturation, mean blood pressure, and heart rate, electrocardiographic (PR, QRS, and QT intervals biochemical (oxidants and antioxidants, and histopathological analyses (including immunostaining were performed.Results: Acute varenicline exposure resulted in loss of body weight, while chronic varenicline exposure caused heart weight loss and decreased mean blood pressure, induced lipid peroxidation, and reduced antioxidant activity. Both acute and chronic varenicline exposure caused impairment of mean oxygen saturation. QT interval was prolonged in the chronic varenicline group, while PR interval

  4. Assessment of suicidality in children and adolescents with diagnosis of high functioning autism spectrum disorder in a Turkish clinical sample

    Directory of Open Access Journals (Sweden)

    Karakoç Demirkaya S

    2016-11-01

    Full Text Available Sevcan Karakoç Demirkaya,1 Mustafa Deniz Tutkunkardaş,2 Nahit Motavalli Mukaddes3 1Department of Child Psychiatry, Adnan Menderes University School of Medicine, Aydin, 2Department of Child Psychiatry, Istanbul School of Medicine, Istanbul University, Istanbul, 3Istanbul Institute of Child and Adolescent Psychiatry, Istanbul, Turkey Objectives: Considering that suicide is one of the most common reasons of adolescent death worldwide, there is a lack of clinical awareness on suicidal behaviors of children and adolescents with autism spectrum disorder (ASD. The present study aims to assess the rate of suicidality (suicidal ideation, behaviors and attempts and associated risk factors for suicidality in high functioning ASD.Methods: Medical records of 55 adolescents (six girls, 49 boys, aged between 7–20 years, with diagnosis of ASD were reviewed. The participants were all able to speak fluently and had no significant limitations in intellectual functioning. Clinical assessment of participants was carried out on the basis of Diagnostic and Statistical Manual of Mental Disorders 4th Edition, Text Revision criteria and Schedule for Affective Disorders and Schizophrenia for School-Age Children-Present and Lifetime Version. Eskin’s Suicide Screening Questionnaire and sociodemographic data form including detailed history of suicidal behaviors were used. The study group was also divided into suicidal and non-suicidal groups for the purpose of comparing the results.Results: The rate of suicidal behaviors was 29% and suicide attempt was 12.7%. Types of suicidality were behaviors (43.7%, thoughts (37.5%, and verbal declarations (18.7%. A number of bizarre acts were recorded. Rates of comorbid psychiatric disorders such as mood disorders, anxiety disorders and disruptive behaviors were 23.6%, 43.6% and 65.4% respectively. Groups with the psychotic features, positive family history for suicidal behaviors and completed suicide showed more suicidality than

  5. Possible association between vitamin D deficiency and restless legs syndrome

    Directory of Open Access Journals (Sweden)

    Oran M

    2014-05-01

    Full Text Available Mustafa Oran,1 Cuneyt Unsal,2 Yakup Albayrak,2 Feti Tulubas,3 Keriman Oguz,4 Okan Avci,1 Nilda Turgut,4 Recep Alp,4 Ahmet Gurel3 1Department of Internal Medicine, 2Department of Psychiatry, 3Department of Biochemistry, 4Department of Neurology, Namik Kemal University, Faculty of Medicine, Tekirdağ, Turkey Background and aim: Restless legs syndrome (RLS is a distressing sleep disorder that occurs worldwide. Although there have been recent developments in understanding the pathophysiology of RLS, the exact mechanism of the disease has not been well elucidated. An increased prevalence of neurologic and psychiatric diseases involving dopaminergic dysfunction in vitamin D-deficient patients led us to hypothesize that vitamin D deficiency might result in dopaminergic dysfunction and consequently, the development of RLS (in which dopaminergic dysfunction plays a pivotal role. Thus, the aim of this study was to evaluate the relationship between vitamin D deficiency and RLS. Methods: One hundred and fifty-five consecutive patients, 18–65 years of age, who were admitted to the Department of Internal Medicine with musculoskeletal symptoms and who subsequently underwent neurological and electromyography (EMG examination by the same senior neurologist, were included in this study. The patients were divided into two groups according to serum 25-hydroxyvitamin D (25(OHD (a vitamin D metabolite used as a measure of vitamin D status level: 36 patients with serum 25(OHD levels ≥20 ng/mL comprised the normal vitamin D group, and 119 patients with serum 25(OHD levels <20 ng/mL comprised the vitamin D deficiency group. The two groups were compared for the presence of RLS and associated factors. Results: The two groups were similar in terms of mean age, sex, mean body mass index (BMI, and serum levels of calcium, phosphate, alkaline phosphatase (ALP, and ferritin. The presence of RLS was significantly higher in the vitamin D deficiency group (χ2=12.87, P<0

  6. Famine foods in eastern regions of the Sudan

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Badawi Ibrahim [Department of Biochemistry and Soil Sciences, Faculty of Agriculture, University of Khartoum, Khartoum (Sudan)

    1995-01-01

    A questionnaire was prepared for the collection of data concerning famine in eastern regions. Some of the data collected were concerning the availability and distribution of famine foods and their roles in times of famine. Mal-nutrition problems that a rise from the consequences of drought and famine were discussed in this study. In achieving this piece of current study on famine foods, a thorough computer literature search for each individual famine food was made for the last 15 years. During the field investigation 12 pieces of famine foods were found to grow in eastern regions. The chemical compositions for these famine foods were determined. Uncultivated cereals grains, difra and adar, were compared as regards their usage and chemical composition with some of local cultivated cereals dura and dukhn. The protein percentage of adar is 15.6%. This value is higher than that of dura variety safra. The crude fibre values of all studied plants were higher compared to cereal foods, ranging between 3.1-22.5%. Kawal in this study showed the highest value of protein but its unpleasant smell limits its consumption. The crude proteins of nabag, laloub pulp and doum exceeds the protein content of dates variety bentamoda as determined by Mustafa (1986). Arak, tondub, kawal, laloub leaves and nabag are high levels of sodium were found in doum, tondub and kawal. Fruit pulps of laloub, nabag, doum and arak are characterized by having a high proportion of sugars which are mostly non-reducing sugars. A high concentrations of arabinose were found in doum and difra. Other sugars detected were glucose, galactose and rhamnose. High levels of alcohol insoluble solids were found in molokhiat elkhalla, moliata, tamaleika and laloub leaves. Doum, laloub leaves, tamaleika were found to have high proportions of k {sup +} content, while high levels of Mg {sup +2} were found in kawal, difra, doum, tamaleika and laloub leaves. Total and reducing sugars were determined by titration and neutral

  7. Oxidative damage parameters in renal tissues of aged and young rats based on gender

    Directory of Open Access Journals (Sweden)

    Uzun D

    2013-06-01

    Full Text Available Duygu Uzun,1 Gülcan Güntas Korkmaz,2 Mustafa Erinç Sitar,3 Tamer Cebe,4 Karolin Yanar,3 Ufuk Çakatay,3 Seval Aydin3 1Istanbul University, Istanbul Faculty of Medicine, Istanbul, Turkey; 2Kirklareli University, School of Health, Kirklareli, Turkey; 3Istanbul University, Cerrahpasa Faculty of Medicine, Department of Medical Biochemistry, Istanbul, Turkey; 4Istanbul University Cerrahpasa Faculty of Medicine, Istanbul, Turkey Purpose: Aging is characterized by a gradual functional decrease of all systems including the kidneys. Growing evidence links altered lipid protein redox-homeostasis with renal dysfunction. The effect of sexual dimorphism on the lipid protein redox-homeostasis mechanisms in the aging kidney is obscure. In the current study, we aimed to investigate redox homeostasis as it related to sexual dimorphism on protein oxidation and lipid peroxidation parameters, as protein carbonyl (PCO, total thiol (T-SH, advanced oxidation protein products (AOPP, malondialdehyde, glutathione (GSH, and superoxide dismutase (SOD activity, as potential aging biomarkers, which may contribute to an analysis of the free radical theory of aging. Materials and methods: The study was carried out with 16 naturally aged rats (24 months old; eight males and eight females and their corresponding young rat groups as controls (6 months old; eight males and eight females. All of the aforementioned parameters (PCO, T-SH, AOPP, MDA, GSH, SOD were measured manually instead of automated devices or ELISA kits. Results: PCO, AOPP, and malondialdehyde levels in aged rats were significantly higher in the older rat group than in the younger rat group, whereas SOD activities were significantly lower in old rats. T-SH levels were not significantly different in male groups; however, T-SH levels were lower in the aged female group than in the young female control group. In addition, GSH levels were significantly different between the aged rat group and the corresponding

  8. Ginger components as new leads for the design and development of novel multi-targeted anti-Alzheimer’s drugs: a computational investigation

    Directory of Open Access Journals (Sweden)

    Azam F

    2014-10-01

    Full Text Available Faizul Azam,1,2 Abdualrahman M Amer,1 Abdullah R Abulifa,1 Mustafa M Elzwawi1 1Faculty of Pharmacy, Misurata University, Misurata, Libya; 2Department of Pharmaceutical Chemistry, Nims Institute of Pharmacy, Nims University, Jaipur, Rajasthan, India Abstract: Ginger (Zingiber officinale, despite being a common dietary adjunct that contributes to the taste and flavor of foods, is well known to contain a number of potentially bioactive phytochemicals having valuable medicinal properties. Although recent studies have emphasized their benefits in Alzheimer’s disease, limited information is available on the possible mechanism by which it renders anti-Alzheimer activity. Therefore, the present study seeks to employ molecular docking studies to investigate the binding interactions between active ginger components and various anti-Alzheimer drug targets. Lamarckian genetic algorithm methodology was employed for docking of 12 ligands with 13 different target proteins using AutoDock 4.2 program. Docking protocol was validated by re-docking of all native co-crystallized ligands into their original binding cavities exhibiting a strong correlation coefficient value (r2=0.931 between experimentally reported and docking predicted activities. This value suggests that the approach could be a promising computational tool to aid optimization of lead compounds obtained from ginger. Analysis of binding energy, predicted inhibition constant, and hydrophobic/hydrophilic interactions of ligands with target receptors revealed acetylcholinesterase as most promising, while c-Jun N-terminal kinase was recognized as the least favorable anti-Alzheimer’s drug target. Common structural requirements include hydrogen bond donor/acceptor area, hydrophobic domain, carbon spacer, and distal hydrophobic domain flanked by hydrogen bond donor/acceptor moieties. In addition, drug-likeness score and molecular properties responsible for a good pharmacokinetic profile were calculated

  9. Management of cancer pain: 1. Wider implications of orthodox analgesics

    Directory of Open Access Journals (Sweden)

    Lee SK

    2014-01-01

    Full Text Available Susannah K Lee,1 Jill Dawson,2 Jack A Lee,3 Gizem Osman,4 Maria O Levitin,5 Refika Mine Guzel,5 Mustafa BA Djamgoz5,61Pomona College, Claremont, CA, USA; 2Healthcare Communications Consultancy, Danville, CA, USA; 3College of Arts and Sciences, Vanderbilt University, Nashville, TN, USA; 4Department of Chemical Engineering, Loughborough University, Loughborough, UK; 5Division of Cell and Molecular Biology, Neuroscience Solutions to Cancer Research Group, South Kensington Campus, Imperial College London, London, UK; 6Cyprus International University, Biotechnology Research Centre, Haspolat, North Cyprus, Mersin, TurkeyAbstract: In this review, the first of two parts, we first provide an overview of the orthodox analgesics used commonly against cancer pain. Then, we examine in more detail the emerging evidence for the potential impact of analgesic use on cancer risk and disease progression. Increasing findings suggest that long-term use of nonsteroidal anti-inflammatory drugs, particularly aspirin, may reduce cancer occurrence. However, acetaminophen may raise the risk of some hematological malignancies. Drugs acting upon receptors of gamma-aminobutyric acid (GABA and GABA “mimetics” (eg, gabapentin appear generally safe for cancer patients, but there is some evidence of potential carcinogenicity. Some barbiturates appear to slightly raise cancer risks and can affect cancer cell behavior in vitro. For cannabis, studies suggest an increased risk of squamous cell carcinoma of the tongue, larynx, and possibly lung. Morphine may stimulate human microvascular endothelial cell proliferation and angiogenesis; it is not clear whether this might cause harm or produce benefit. The opioid, fentanyl, may promote growth in some tumor cell lines. Opium itself is an emerging risk factor for gastric adenocarcinoma and possibly cancers of the esophagus, bladder, larynx, and lung. It is concluded that analgesics currently prescribed for cancer pain can

  10. Effects of caffeic acid phenethyl ester on palatal mucosal defects and tooth extraction sockets

    Directory of Open Access Journals (Sweden)

    Günay A

    2014-10-01

    Full Text Available Ahmet Günay,1 Osman Fatih Arpağ,2 Serhat Atilgan,3 Ferhan Yaman,3 Yusuf Atalay,4 İzzet Acikan3 1Department of Periodontology, Faculty of Dentistry, Dicle University, Diyarbakir, Turkey; 2Department of Periodontology, Faculty of Dentistry, Mustafa Kemal University, Hatay, Turkey; 3Department of Maxillofacial Surgery, Faculty of Dentistry, Dicle University, Diyarbakir, Turkey; 4Department of Maxillofacial Surgery, Faculty of Dentistry, Kocatepe University, Afyon, Turkey Aim: The purpose of this study was to evaluate the effects of caffeic acid phenethyl ester (CAPE on palatal mucosal defects and tooth extraction sockets in an experimental model.Materials and methods: Forty-two male Sprague-Dawley rats with a mean age of 7 weeks and weighing 280–490 g were used in this study. The rats were randomly divided into two groups: group A (the control group, n=21 and group B (the experimental group, n=21. Under anesthesia with ketamine (8 mg/100 g, intraperitoneally, palatal mucosal defects were created and tooth extraction was performed in the rats in groups A and B. Group A received no treatment, whereas group B received CAPE. CAPE was injected daily (10 µmol/kg, intraperitoneally. The rats were killed on days 7, 14, and 30 after the procedures. Palatal mucosa healing and changes in bone tissue and fibrous tissue were evaluated histopathologically.Result: Pairwise comparisons showed no statistically significant difference between days 7 and 14 in either group (P>0.05. At day 30, bone healing was significantly better in group B (CAPE than in group A (control (P<0.05. Fibrinogen levels at day 30 were significantly higher in group A (control than in group B (CAPE (P<0.05. Pairwise comparisons showed no statistically significant difference in palatal mucosa healing levels between days 7 and 14 in both groups (P>0.05.Conclusion: In conclusion, the findings of this study suggest that CAPE can significantly improve tooth socket healing. Keywords: caffeic

  11. The efficacy of the semi-blind approach of transversus abdominis plane block on postoperative analgesia in patients undergoing inguinal hernia repair: a prospective randomized double-blind study

    Directory of Open Access Journals (Sweden)

    Salman AE

    2013-01-01

    Full Text Available A Ebru Salman,1 Fahri Yetisir,2 Banu Yürekli,3 Mustafa Aksoy,1 Murat Yildirim,2 Mehmet Kiliç21Anesthesiology and Reanimation Department, 2General Surgery Department, Atatürk Research and Training Hospital, Ankara, Turkey; 3Endocrinology Department, Bozyaka Research and Training Hospital, Izmir, TurkeyPurpose: In this prospective, randomized, double-blind study, our aim was to compare the analgesic efficacy of the semi-blind approach of transversus abdominis plane (TAP block with a placebo block in patients undergoing unilateral inguinal hernia repair.Methods: After receiving hospital ethical committee approval and informed patient consents, American Society of Anesthesiologists (ASA I–III patients aged 18–80 were enrolled in the study. Standard anesthesia monitoring was applied to all patients. After premedication, spinal anesthesia was administered to all patients with 3.5 mL heavy bupivacaine at the L3-L4 subarachnoid space. Patients were randomly allocated into 2 groups. Group I (n = 32 received a placebo block with 20 mL saline, Group II (n = 32 received semi-blind TAP block with 0.25% bupivacaine in 20 mL with a blunt regional anesthesia needle into the neurofascial plane via the lumbar triangle of Petit near the midaxillary line before fascial closure. At the end of the operation, intravenous (IV dexketoprofen was given to all patients. The verbal analog scale (VAS was recorded at 2, 4, 6, 12, and 24 hours postoperatively. Paracetamol IV was given to patients if their VAS score > 3. A rescue analgesic of 0.05 mg/kg morphine IV was applied if VAS > 3. Total analgesic consumption and morphine requirement in 24 hours were recorded.Results: TAP block reduced VAS scores at all postoperative time points (P < 0.001. Postoperative analgesic and morphine requirement in 24 hours was significantly lower in group II (P < 0.01.Conclusion: Semi-blind TAP block provided effective analgesia, reducing total 24-hour postoperative analgesic

  12. Is hypertriglyceridemia a prognostic factor in sepsis?

    Directory of Open Access Journals (Sweden)

    Cetinkaya A

    2014-02-01

    Full Text Available Ali Cetinkaya,1 Abdulsamet Erden,1 Deniz Avci,1 Hatice Karagoz,1 Samet Karahan,1 Mustafa Basak,1 Kadir Bulut,1 Vedat Gencer,1 Hasan Mutlu2 1Internal Medicine Department, Kayseri Training and Research Hospital, Kayseri, Turkey; 2Medical Oncology Department, Acibadem Kayseri Hospital, Kayseri, Turkey Introduction: Sepsis and septic shock are important causes of mortality in intensive care unit patients, hence early diagnosis and therapy are important in management of their treatment. The available information on sepsis patients is not enough to recommend or to discard the routine evaluation of triglyceride (TG levels at the onset of sepsis. The aim of this study was to investigate the association of hypertriglyceridemia and clinical outcome (or mortality in patients with severe sepsis. Materials and methods: Between January 1 and December 31, 2011, a total of 84 patients with sepsis from the intensive internal care unit at the Kayseri Training and Research Hospital, Kayseri, Turkey, were investigated retrospectively. Sepsis was defined according to the American College of Chest Physicians/Society of Critical Care Medicine/European Society of Intensive Care Medicine consensus conference definitions. For each patient, survival was recorded at the end of the last day of hospitalization as dead or alive. The TG values were taken retrospectively from the records, which were performed routinely for each patient with sepsis at the time of diagnosis. TG >150 mg/dL was considered as hypertriglyceridemia. Results: The percentages of male and female patients were 44% and 56%, respectively. The mean age of patients was 71.49±11.071 years. The percentage of patients with TG values more than 150 mg/dL was 81% (25/31 in the non-survivor group and 19% (6/31 in the survivor group. There was a significant difference regarding TG values between groups (P=0.039. Discussion: It was observed in this study that patients in the intensive care unit with sepsis had high

  13. Development and evaluation of thymoquinone-encapsulated chitosan nanoparticles for nose-to-brain targeting: a pharmacoscintigraphic study

    Directory of Open Access Journals (Sweden)

    Alam S

    2012-11-01

    Full Text Available Sanjar Alam,1 Zeenat I Khan,1 Gulam Mustafa,1 Manish Kumar,2 Fakhrul Islam,3 Aseem Bhatnagar,4 Farhan J Ahmad11Department of Pharmaceutics, Faculty of Pharmacy, Jamia Hamdard, Hamdard Nagar, New Delhi, India; 2Advanced Instrumentation Research Facility, Jawaharlal Nehru University, New Delhi, India; 3Department of Medical Elementology and Toxicology, Neurotoxicology Laboratory, Jamia Hamdard, Hamdard Nagar, New Delhi, India; 4Government of India, Ministry of Defence, Institute of Nuclear Medicine and Allied Sciences, Brig SK Mazumdar Marg, Delhi, IndiaAbstract: Chitosan (CS nanoparticles of thymoquinone (TQ were prepared by the ionic gelation method and are characterized on the basis of surface morphology, in vitro or ex vivo release, dynamic light scattering, and X-ray diffractometry (XRD studies. Dynamic laser light scattering and transmission electron microscopy confirmed the particle diameter was between 150 to 200 nm. The results showed that the particle size of the formulation was significantly affected by the drug:CS ratio, whereas it was least significantly affected by the tripolyphosphate:CS ratio. The entrapment efficiency and loading capacity of TQ was found to be 63.3% ± 3.5% and 31.23% ± 3.14%, respectively. The drug-entrapment efficiency and drug-loading capacity of the nanoparticles appears to be inversely proportional to the drug:CS ratio. An XRD study proves that TQ dispersed in the nanoparticles changes its form from crystalline to amorphous. This was further confirmed by differential scanning calorimetry thermography. The flat thermogram of the nanoparticle data indicated that TQ formed a molecular dispersion within the nanoparticles. Optimized nanoparticles were evaluated further with the help of scintigraphy imaging, which ascertains the uptake of drug into the brain. Based on maximum concentration, time-to-maximum concentration, area-under-curve over 24 hours, and elimination rate constant, intranasal TQ

  14. Road Traffic Injury in Lagos, Nigeria: Assessing Prehospital Care.

    Science.gov (United States)

    Ibrahim, Nasiru A; Ajani, Abdul Wahab O; Mustafa, Ibrahim A; Balogun, Rufai A; Oludara, Mobolaji A; Idowu, Olufemi E; Solagberu, Babatunde A

    2017-08-01

    (1.9%) died in the emergency room while 235 bodies were brought in dead. Less than three percent among the victims of road crashes had formal prehospital care and shorter hospital arrival time. Current facilities for emergency prehospital care in Lagos are inadequate and require improvement. Training lay first-responders, who bring the majority of the injured to hospital, in basic first-aid may improve prehospital care in Lagos. Ibrahim NA , Ajani AWO , Mustafa IA , Balogun RA , Oludara MA , Idowu OE , Solagberu BA . Road traffic injury in Lagos, Nigeria: assessing prehospital care. Prehosp Disaster Med. 2017;32(4):424-430.

  15. Rationale, design, and cohort enrolment of a prospective observational study of the clinical performance of the new contraceptive implant (Femplant in Pakistan

    Directory of Open Access Journals (Sweden)

    Azmat SK

    2014-05-01

    Full Text Available Syed Khurram Azmat,1 Waqas Hameed,1 Anja Lendvay,2 Babar Tasneem Shaikh,3 Ghulam Mustafa,1 Muhammad Ahmed Siddiqui,1 Sajid Brohi,1 Asif Karim,1 Muhammad Ishaque,1 Wajahat Hussain,1 Mohsina Bilgrami,1 Paul J Feldblum2 1Research, Monitoring and Evaluation Department, Marie Stopes Society, Karachi, Pakistan; 2FHI 360, Durham, NC, USA; 3Health Services Academy, Islamabad, Pakistan Introduction: The use of hormonal implants has gained positive traction in family planning programs in recent times. Compared to other popular methods, such as long-term reversible intrauterine devices, the use of hormonal implants as a family planning method has distinct advantages in terms of long-term efficiency and better user compliance and availability. This paper presents a study protocol to document and evaluate the efficacy, safety, and acceptability of Femplant (contraceptive implant in Pakistan during the first year of its use among married women of reproductive age (18–44 years at clinics in two provinces of Pakistan (Sindh and Punjab. Materials and methods: A total of 724 married women were enrolled in a noncomparative prospective observational study. The study involved six government clinics from the Population Welfare Department in Sindh Province and 13 clinics run by the Marie Stopes Society (a local nongovernmental organization in both provinces. The participation of women was subject to voluntary acceptance and medical eligibility. All respondents were interviewed at baseline and subsequently at each scheduled visit during the study period. Side effects, complications and adverse events, if any, were recorded for every participant at each visit to the facility. Discussion: Over the next 5-year period (2013–2018, 27 million hormonal implants will be made available in lower- to middle-income countries by international donors and agencies. The evidence generated from this study will identify factors affecting the acceptability and satisfaction of end

  16. A novel educational tool for teaching ocular ultrasound

    Directory of Open Access Journals (Sweden)

    Mustafa MS

    2011-06-01

    Full Text Available MS Mustafa1, J Montgomery2, HR Atta11Department of Ophthalmology, Aberdeen Royal Infirmary, UK; 2Medi-CAL, College of Life Sciences and Medicine, University of Aberdeen, Foresterhill, Aberdeen, UKAbstract: Ocular ultrasound is now in increasing demand in routine ophthalmic clinical practice not only because it is noninvasive but also because of ever-advancing technology providing higher resolution imaging. It is however a difficult branch of ophthalmic investigations to grasp, as it requires a high skill level to interface with the technology and provide accurate interpretation of images for ophthalmic diagnosis and management. It is even more labor intensive to teach ocular ultrasound to another fellow clinician. One of the fundamental skills that proved difficult to learn and teach is the need for the examiner to “mentally convert” 2-dimensional B-scan images into 3-dimensional (3D interpretations. An additional challenge is the requirement to carry out this task in real time. We have developed a novel approach to teach ocular ultrasound by using a novel 3D ocular model. A 3D virtual model is built using widely available, open source, software. The model is then used to generate movie clips simulating different movements and orientations of the scanner head. Using Blender, Quicktime motion clips are choreographed and collated into interactive quizzes and other pertinent pedagogical media. The process involves scripting motion vectors, rotation, and tracking of both the virtual stereo camera and the model. The resulting sequence is then rendered for twinned right- and left-eye views. Finally, the twinned views are synchronized and combined in a format compatible with the stereo projection apparatus. This new model will help the student with spatial awareness and allow for assimilation of this awareness into clinical practice. It will also help with grasping the nomenclature used in ocular ultrasound as well as helping with localization of

  17. Outcomes of trochanteric femoral fractures treated with proximal femoral nail: an analysis of 100 consecutive cases

    Directory of Open Access Journals (Sweden)

    Korkmaz MF

    2014-04-01

    Full Text Available Mehmet Fatih Korkmaz,1 Mehmet Nuri Erdem,2 Zeliha Disli,3 Engin Burak Selcuk,4 Mustafa Karakaplan,1 Abdullah Gogus5 1Department of Orthopedics and Traumatology, Inonu University School of Medicine, Malatya, Turkey; 2Department of Orthopedics and Traumatology, Nisantasi University School of Medicine, Istanbul, Turkey; 3Department of Anesthesiology, Malatya Government Hospital, Malatya, Turkey; 4Department of Family Medicine, Inonu University School of Medicine, Malatya, Turkey; 5Department of Orthopedics and Traumatology, Florence Nightingale Hospital, Istanbul, Turkey Purpose: In this study, we aimed to report the results of a retrospective study carried out at our institute regarding cases of patients who had suffered proximal femoral fractures between January 2002 and February 2007, and who were treated with a proximal femoral nail. Materials and methods: One hundred consecutive cases were included in the study. A case documentation form was used to obtain intraoperative data including age, sex, mechanism of injury, type of fracture according to Association for Osteosynthesis/Association for the Study of Internal Fixation (AO/ASIF classification and the American Society of Anesthesiologists' (ASA physical status classification (ASA grade. Clinical and radiographic examinations were performed at the time of admission and at the 6th week; subsequent visits were organized on the 3rd month, 6th month, and 12th month, and in patients with longer follow-up and annually postoperatively. The Harris score of hip function was used, and any change in the position of the implants and the progress of the fracture union, which was determined radiologically, was noted. Results: The mean age of the patients was 77.66 years (range: 37–98 years, and the sex distribution was 32 males and 68 females. Seventy-three fractures were reduced by closed means, whereas 27 needed limited open reduction. The mean follow-up time for the study group was 31.3 months (range

  18. The prevalence and assessment of blood transfusions in newborns

    Directory of Open Access Journals (Sweden)

    Hajieh Borna

    2017-06-01

    Full Text Available Background: Blood transfusion is common in infants. Due to the weakened immune system of newborns and the risk of blood transfusion complications, it is necessary to pay more attention following or after to blood transfusion. The aim of this study was to evaluate the frequency and risk factors of blood transfusions in hospitalized neonates. Methods: A cross-sectional study was performed on 1106 infants admitted in the neonatal intensive care unit (NICU of Mustafa Khomeini University Hospital, Tehran, Iran, from spring 2009 to 2012. Frequency and the reason for of blood components transfusion including fresh frozen plasma, platelets, whole blood, packed red blood cells, cryoprecipitate and relationship with gestational age, sex, birth weight, Apgar score, duration of hospitalization, use of mechanical ventilation were assessed. Statistical analysis was performed with SPSS statistical software, version 16 (IBM, Armonk, NY, USA and statistical test, chi-square test, independent t-test and analysis of variance (ANOVA. Results: Among 1106 infants admitted to the neonatal intensive care unit, 221 infants (%19.98 received blood products. 82 of all (37% were female and 139 (%63 were female. 113 (51% of neonate were preterm and 108 (48% were term. From 361 times of blood transfusions, 121 infant (54.75% received at least one blood product. The frequency of blood transfusion was between 39 and 1 times, with an average of 3.65 times per infant. Frequency of fresh frozen plasma infusion was 173 (47.9%, packed cell 122 (33%, platelet 32 (8.8%, cryoprecipitate 20 (5.1% and whole blood 3 unit (0.83%. The most common causes for fresh frozen plasma transfusion was replacement therapy 140 (80%, for packed cell, to correct symptomatic anemia 68 (55.6%, for platelet transfusions was to prevent bleeding in  neonates with thrombocytopenia 20 (62.5% and cryoprecipitate for bleeding caused by DIC in 18 infant (90%. There was significant relation between frequency of

  19. Detection of subclinical atherosclerosis and diastolic dysfunction in patients with schizophrenia

    Directory of Open Access Journals (Sweden)

    Ünsal C

    2013-10-01

    Full Text Available Cüneyt Ünsal,1 Mustafa Oran,2 Hande Oktay Tureli,3 Seref Alpsoy,4 Sema Yesilyurt,5 Mehtap Arslan,6 Birol Topcu,7 Osman Karakaya,8 Erhan Kurt6 1Department of Psychiatry, Namik Kemal University, School of Medicine, Tekirdag, Turkey; 2Department of Internal Medicine, Namik Kemal University, School of Medicine, Tekirdag, Turkey; 3Department of Cardiology, Bakirkoy Dr Sadi Konuk Education and Research Hospital, Istanbul, Turkey; 4Department of Cardiology, Namik Kemal University, School of Medicine, Tekirdag, Turkey; 5Department of Psychiatry, Bağcilar Training and Research Hospital, Istanbul, Turkey; 6Department of Psychiatry, Bakirkoy Training and Research Hospital for Psychiatry Neurology and Neurosurgery, Istanbul, Turkey; 7Department of Biostatistics, Namik Kemal University, School of Medicine, Tekirdag, Turkey; 8Department of Social Service, Yalova University, Faculty of Economics and Administrative Sciences, Yalova, Turkey Background: Patients with schizophrenia have a higher risk for cardiovascular diseases, which is associated with early mortality compared with the nonschizophrenic population. Early diagnosis of cardiovascular diseases in asymptomatic periods in patients with schizophrenia would enhance their quality of life and reduce mortality. Echocardiography, carotid ultrasonography, and ankle brachial index (ABI measurement are known to be beneficial methods of detecting subclinical cardiovascular diseases and of risk stratification. The present study investigated carotid intima media thickness (CIMT and ABI and echocardiographic parameters measured via conventional and tissue Doppler echocardiography in patients with schizophrenia in comparison with a control group. Methods: The present case-control study included 116 patients with schizophrenia and 88 healthy patients. Participants with any current comorbid psychiatric disorder, current or lifetime neurological and medical problems, current coronary artery disease, diabetes

  20. Polymorphism of CYP3A4 and ABCB1 genes increase the risk of neuropathy in breast cancer patients treated with paclitaxel and docetaxel

    Directory of Open Access Journals (Sweden)

    Kus T

    2016-08-01

    Full Text Available Tulay Kus,1 Gokmen Aktas,1 Mehmet Emin Kalender,1 Abdullah Tuncay Demiryurek,2 Mustafa Ulasli,1 Serdar Oztuzcu,3 Alper Sevinc,1 Seval Kul,4 Celaletdin Camci1 1Department of Internal Medicine, Division of Medical Oncology, University of Gaziantep, Gaziantep Oncology Hospital, Gaziantep, Turkey; 2Department of Medical Pharmacology, 3Department of Medical Biology, Faculty of Medicine, University of Gaziantep, Gaziantep, Turkey; 4Department of Biostatistics, Faculty of Medicine, University of Gaziantep, Gaziantep, Turkey Background: Interindividual variability of pharmacogenetics may account for unpredictable neurotoxicities of taxanes. Methods: From March 2011 to June 2015, female patients with operable breast cancer who had received docetaxel- or paclitaxel-containing adjuvant chemotherapy were included in this study. All patients were treated with single-agent paclitaxel intravenously (IV 175 mg/m2 every 3 weeks for four cycles, or IV 80 mg/m2 weekly for 12 cycles, and IV 100 mg/m2 docetaxel for four cycles as adjuvant treatment. We evaluated the relationship between neurotoxicity of taxanes and single-nucleotide polymorphisms of ABCB1, CYP3A4, ERCC1, ERCC2, FGFR4, TP53, ERBB2, and CYP2C8 genes. Taxane-induced neurotoxicity during the treatment was evaluated according to the National Cancer Institute Common Toxicity Criteria version 4.03 prior to each cycle. Chi-squared tests were used to compare the two groups, and multivariate binary logistic regression models were used for determining possible risk factors of neuropathy. Results: Pharmacogenetic analysis was performed in 219 females. ABCB1 3435 TT genotype had significantly higher risk for grade ≥2 neurotoxicity (odds ratio [OR]: 2.759, 95% confidence interval [CI]: 1.172–6.493, P: 0.017 compared to TC and CC genotype, and also CYP3A4 392 AA and AG genotype had significantly higher risk for grade ≥2 neurotoxicity (OR: 2.259, 95% CI: 1.033–4.941, P: 0.038 compared to GG genotype. For

  1. Being a neighbor to Syria: a retrospective analysis of patients brought to our clinic for cranial gunshot wounds in the Syrian civil war.

    Science.gov (United States)

    Aras, M; Altaş, M; Yilmaz, A; Serarslan, Y; Yilmaz, N; Yengil, E; Urfali, B

    2014-10-01

    Toward the end of 2010, the Arab spring, the waves of revolutionary demonstrations and protests influenced also Syria, where violent clashes turned into a civil war. Hundreds of thousands of people became refugees. The use of excessive force unfortunately culminated in numerous deaths and injuries in many cities. Being the closest city to Aleppo, Damascus and Homs, the biggest cities of Syria, Antioch/Hatay has been the city where initial emergency treatments were performed. For this reason, we examined and retrospectively analyzed the medical records of the patients treated in the clinics of our hospital due to cranial gunshot wounds during the war. The medical records of 186 patients who were injured in the Syrian War and brought to, followed up and treated in the Neurosurgery Clinic of Mustafa Kemal University, Faculty of Medicine in Hatay, a Turkish city on the Syrian border, between April 2011 and June 2013. A total of 186 patients were evaluated in a period of more than 2 years. Of all 91.4% of the patients were adults (male/female: 152/18) and 8.6% of them were pediatric patients (male/female: 14/2). The average age of the patients was 31 years, with an age range of between 2 months and 67 years. According to Glasgow coma score (GCS) of the patients at the time of admission, GCS was 3 in 32 patients (17.2%), between 4 and 7 in 70 patients (37.6%), and between 8 and 15 in 84 patients (45.1%). We observed that the patients with GCS of 4-7 had a significantly lower mortality among the 56 patients treated surgically compared with the 14 patients treated medically. Cranial gunshot wounds are responsible for high mortality and morbidity. A multiplicity of factors plays a role on morbidity and mortality. These are the duration of transport, the injury pattern, the velocities of the weapons used, and the Glasgow Coma Scales of the patients at the time of admission. The authors recommend that the patients with cranial gunshot wounds who has GCS of 4-7 should be

  2. Surgical outcomes of a civil war in a neighbouring country.

    Science.gov (United States)

    Akkucuk, Seckin; Aydogan, A; Yetim, I; Ugur, M; Oruc, C; Kilic, E; Paltaci, I; Kaplan, A; Temiz, M

    2016-08-01

    The civil war in Syria began on 15 March 2011, and many of the injured were treated in the neighbouring country of Turkey. This study reports the surgical outcomes of this war, in a tertiary centre in Turkey. 159 patients with civilian war injuries in Syria who were admitted to the General Surgery Department in the Research and Training Hospital of the Medical School of Mustafa Kemal University, Hatay, Turkey, between 2011 and 2012 were analysed regarding the age, sex, injury type, history of previous surgery for the injury, types of abdominal injuries (solid or luminal organ), the status of isolated abdominal injuries or multiple injuries, mortality, length of hospital stay and injury severity scoring. The median age of the patients was 30.05 (18-66 years) years. Most of the injuries were gunshot wounds (99 of 116 patients, 85.3%). Primary and previously operated patients were transferred to our clinic in a median time of 6.28±4.44 h and 58.11±44.08 h, respectively. Most of the patients had intestinal injuries; although a limited number of patients with colorectal injuries were treated with primary repair, stoma was the major surgical option due to the gross peritoneal contamination secondary to prolonged transport time. Two women and 21 men died. The major cause of death was multiorgan failure secondary to sepsis (18 patients). In the case of civil war in the bordering countries, it is recommended that precautions are taken, such as transformation of nearby civilian hospitals into military ones and employment of experienced trauma surgeons in these hospitals to provide effective medical care. Damage control procedures can avoid fatalities especially before the lethal triad of physiological demise occurs. Rapid transport of the wounded to the nearest medical centre is the key point in countries neighbouring a civil war. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  3. Early predictors of brain damage in full-term newborns with hypoxic ischemic encephalopathy

    Directory of Open Access Journals (Sweden)

    Alkholy UM

    2017-08-01

    Full Text Available Usama M Alkholy,1 Nermin Abdalmonem,1 Ahmed Zaki,2 Yasser F Ali,1 Soma Abdalla Mohamed,3 Nasser I Abdelsalam,1 Mustafa Ismail Abu Hashim,1 Mohamed Abou Sekkien,3 Yasser Makram Elsherbiny4 1Pediatric Department, Zagazig University, Egypt; 2Pediatric Department, Mansoura University, Egypt; 3Pediatric Department, Al Azhar University, Egypt; 4Clinical Pathology Department, Menoufia University, Egypt Objective of the study: To evaluate the value of serum creatine phosphokinase-brain specific (CK-BB and urinary lactate/creatinine (L/C ratio as early indicators of brain damage in full-term newborns with hypoxic ischemic encephalopathy (HIE.Patients and methods: A case–control study including 25 full-term new-born infants with perinatal asphyxia who were admitted to neonatal intensive care unit (NICU with a proven diagnosis of HIE, compared to 20 healthy age- and sex-matched full-term newborns. All newborn infants were subjected to full history taking, clinical examination, routine investigations (cord blood gases and complete blood picture, and assessment of serum CK-BB (cord blood, 6 and 24 hours after birth and urinary L/C ratio (collected within the first 6 hours, on the 2nd and 3rd day after birth.Results: The serum CK-BB and urinary L/C ratio in infants with HIE were significantly higher in samples collected throughout the monitoring period when compared with the control group (all P<0.001. The cord CK-BB and urinary L/C ratio within the first 6 hours were significantly higher in infants with severe HIE than in infants with mild and moderate HIE (P<0.001. Cord CK-BB level at 12.5 U/L had 100% sensitivity and 84% specificity in the detection of severe HIE infants. Urinary L/C ratio of more than 10.5 collected within the first 6 hours after birth had 100% sensitivity and 78% specificity for the detection of severe HIE infants.Conclusion: The serum CK-BB and urinary L/C ratio in HIE infants were significantly increased early in the course of the

  4. On the influence of Vatin and Verbicioara cultures in the finds of the Gamzigrad cultural group

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2009-01-01

    Full Text Available The Timočka Krajina region has not been sufficiently investigated archaeologically, which coupled with the fact that a very small number of metal finds and remains have been discovered, makes the reconstruction of the start and end of the Bronze Age that much more difficult. Identification work in the area around Romuliana on two occasions in 2001 and 2008 led to the discovery of another 10 predominantly multi-layered sites dating back to the Bronze Age, of which 7 are highland settlements while 3 are lowland settlements located in the immediate vicinity of the Timok river or its tributaries. The discovered sites 1. Varsari, 2. Đokin Vis, 3. Kravarnik, 4. Mustafa, 5. Nikolov Savat, 6. Njiva Zore Brzanović, 7. Petronj, 8. Potes-Petronj, 9. Strenjak and 10. Zvezdan; bare the characteristics of the material culture of the »Gamzigrad group« of the Middle Iron Age. Besides known ceramic forms and characteristic ornamentation of this culture, there is a visibly strong influence of the Vatin (Crvenka-Cornesþi and Verbicioara elements to a greater extent, and Paraćin cultural elements to a lesser extent. Given that this material was collected during identification work, we are now aware of the stratigraphic relations between these elements, and have devoted more attention to common characteristics and interconnections from which certain conclusions can be drawn. Based on the finds from archaeological sites that have been excavated it can be concluded that the distribution of sites with Gamzigrad cultural characteristics is limited to a very small area, i.e. only to the vicinity of the Crni Timok river. Nearly at all sites, both highland and lowland, Vatin and Verbicioara elements are strongly visible on the ceramic materials. The geographic position of the Crni Timok, which is located in the area where the Paraćin, Vatin and Verbichoar cultures connected and overlapped, could contribute to shedding light on the origin and characteristics of this

  5. Predictors of quality of life among hospitalized geriatric patients with diabetes mellitus upon discharge

    Directory of Open Access Journals (Sweden)

    Johari N

    2016-10-01

    Full Text Available Nuruljannah Johari,1 Zahara Abdul Manaf,1 Norhayati Ibrahim,2 Suzana Shahar,1 Norlaila Mustafa3 1Dietetics Programme, 2Health Psychology Programme, Faculty of Health Sciences, 3Medical Department, Faculty of Medicine, Hospital Canselor Tuanku Muhriz, Universiti Kebangsaan Malaysia, Kuala Lumpur, Malaysia Purpose: Diabetes mellitus is prevalent among older adults, and affects their quality of life. Furthermore, the number is growing as the elderly population increases. Thus, this study aims to explore the predictors of quality of life among hospitalized geriatric patients with diabetes mellitus upon discharge in Malaysia. Methods: A total of 110 hospitalized geriatric patients aged 60 years and older were selected using convenience sampling method in a cross-sectional study. Sociodemographic data and medical history were obtained from the medical records. Questionnaires were used during the in-person semistructured interviews, which were conducted in the wards. Linear regression analyses were used to determine the predictors of each domain of quality of life. Results: Multiple regression analysis showed that activities of daily living, depression, and appetite were the determinants of physical health domain of quality of life (R2=0.633, F(3, 67=38.462; P<0.001, whereas depression and instrumental activities of daily living contributed to 55.8% of the variability in psychological domain (R2=0.558, F(2, 68=42.953; P<0.001. Social support and cognitive status were the determinants of social relationship (R2=0.539, F(2, 68=39.763; P<0.001 and also for the environmental domain of the quality of life (R2=0.496, F(2, 68=33.403; P<0.001. Conclusion: The findings indicated different predictors for each domain in the quality of life among hospitalized geriatric patients with diabetes mellitus. Nutritional, functional, and psychological aspects should be incorporated into rehabilitation support programs prior to discharge in order to improve patients

  6. Famine foods in eastern regions of the Sudan

    International Nuclear Information System (INIS)

    Ahmed, Badawi Ibrahim

    1995-01-01

    A questionnaire was prepared for the collection of data concerning famine in eastern regions. Some of the data collected were concerning the availability and distribution of famine foods and their roles in times of famine. Mal-nutrition problems that a rise from the consequences of drought and famine were discussed in this study. In achieving this piece of current study on famine foods, a thorough computer literature search for each individual famine food was made for the last 15 years. During the field investigation 12 pieces of famine foods were found to grow in eastern regions. The chemical compositions for these famine foods were determined. Uncultivated cereals grains, difra and adar, were compared as regards their usage and chemical composition with some of local cultivated cereals dura and dukhn. The protein percentage of adar is 15.6%. This value is higher than that of dura variety safra. The crude fibre values of all studied plants were higher compared to cereal foods, ranging between 3.1-22.5%. Kawal in this study showed the highest value of protein but its unpleasant smell limits its consumption. The crude proteins of nabag, laloub pulp and doum exceeds the protein content of dates variety bentamoda as determined by Mustafa (1986). Arak, tondub, kawal, laloub leaves and nabag are high levels of sodium were found in doum, tondub and kawal. Fruit pulps of laloub, nabag, doum and arak are characterized by having a high proportion of sugars which are mostly non-reducing sugars. A high concentrations of arabinose were found in doum and difra. Other sugars detected were glucose, galactose and rhamnose. High levels of alcohol insoluble solids were found in molokhiat elkhalla, moliata, tamaleika and laloub leaves. Doum, laloub leaves, tamaleika were found to have high proportions of k + content, while high levels of Mg +2 were found in kawal, difra, doum, tamaleika and laloub leaves. Total and reducing sugars were determined by titration and neutral sugars were

  7. Colchicine intoxication: a report of two suicide cases

    Directory of Open Access Journals (Sweden)

    Erden A

    2013-12-01

    Full Text Available Abdulsamet Erden,1 Hatice Karagoz,1 Hasan Hüseyin Gümüscü,1 Samet Karahan,1 Mustafa Basak,1 Fatma Aykas,1 Kadir Bulut,1 Ali Cetinkaya,1 Deniz Avci,1 Orhan Kürsat Poyrazoglu2 1Internal Medicine Department, 2Gastroenterology Department, Kayseri Training and Research Hospital, Kayseri, Turkey Abstract: Colchicine, an old and well-known drug, is an alkaloid extracted from Colchicum autumnale and related species. Colchicine inhibits the deposition of uric acid crystals and is an inhibitor of mitosis. Nausea, vomiting, abdominal pain, and diarrhea, with a massive loss of fluid and electrolytes are the first clinical symptoms of colchicine poisoning. Stomach lavage and rapid gastric decontamination with activated charcoal are crucial. An acute dose of about 0.8 mg/kg of colchicine is presumed to be fatal. We report the clinical outcomes of two different cases of colchicine intoxication for attempted suicide. The dose required for morbidity or mortality varies significantly. The dose of 1 mg/kg in the first case was directly related with mortality, while the dose of 0.2 mg/kg in the second was related with survival. The other difference between the patients was the time of arrival to hospital after ingestion. This period was 4 hours for case 1 and only 1, hour for case 2. The initiation of treatment later than 2 hours after ingestion of colchicine may significantly impair treatment because the absorption time for colchicine after oral administration is about 30–120 minutes. The rising lactate level and high anion gap metabolic acidosis in our patient (case 1 were attributed to lactic acidosis, so hemodialysis was performed, and the duration of hemodialysis was prolonged. Lactic acidosis in the first case was one of the reasons for mortality. The most important parameters which define the chance of survival are the dose of ingested drugs and the arrival time to hospital after ingestion. The patients must be monitored closely for lactic acidosis

  8. Effect of sitagliptin on hepatic histological activity and fibrosis of nonalcoholic steatohepatitis patients: a 1-year randomized control trial

    Directory of Open Access Journals (Sweden)

    Alam S

    2018-04-01

    Full Text Available Shahinul Alam,1 Jhumur Ghosh,1 Golam Mustafa,1 Mohammad Kamal,2 Nooruddin Ahmad1 1Department of Hepatology, 2Department of Pathology, Bangabandhu Sheikh Mujib Medical University, Dhaka, Bangladesh Background/purpose: Dipeptidyl peptidase 4 (DPP-4 expression is directly associated with hepatic lipogenesis and liver injury in nonalcoholic steatohepatitis (NASH. This study has been designed to elucidate the histological improvement of NASH with the DPP-4 inhibitor sitagliptin. Materials and methods: In this open-label randomized control trial, paired liver biopsy was taken from 40 NASH patients. Sitagliptin 100 mg was given once daily to the SL group and no sitagliptin was given to the L group for 1 year. Patients from both groups were encouraged to exercise moderately and advised to avoid saturated fat, excessive sugar, soft drinks, fast food, and refined carbohydrates to reduce weight. Results: Steatosis improved in the SL group (from 2.3±0.6 to 1.2±0.8; P=0.000 and the L group (from 2.1±0.6 to 1.6±0.9; P=0.008, ballooning decreased from 1.8±0.6 to 1.3±06 (P=0.002 in the SL group, but not in the L group. Nonalcoholic fatty liver disease activity score (NAS attenuated in both groups: the SL group (from 5.8±0.9 to 3.9±1.4; P=0.000 and the L group (from 5.3±0.6 to 4.6±1.2; P=0.009. NAS improvement was much higher in the SL group (1.9±1.4 than in the L group (0.7±1.1 (P=0.006, with NAS improving by ≥2 in 13 patients from the SL group and five patients from the L group (P=0.01. Improvement was irrespective of diabetes. Regression analysis explored that sitagliptin had odds of 6.38 and weight reduction had odds of 4.51 for NAS reduction. Conclusion: Sitagliptin 100 mg once daily for 1 year ameliorates NAS by improving steatosis and ballooning, irrespective of diabetes. Sitagliptin has stronger efficacy than that of weight reduction. Keywords: fatty liver, NASH, sitagliptin, NAS, fibrosis, steatosis, ballooning, histological activity

  9. Gender Differences in and the Relationships Between Social Anxiety and Problematic Internet Use: Canonical Analysis.

    Science.gov (United States)

    Baloğlu, Mustafa; Özteke Kozan, Hatice İrem; Kesici, Şahin

    2018-01-24

    conclusion is that there is a substantial amount of association between social anxiety and PIU and the association is stronger for men than it is for women. We advise that future research continue to investigate PIU and social anxiety as multidimensional constructs. ©Mustafa Baloğlu, Hatice İrem Özteke Kozan, Şahin Kesici. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 24.01.2018.

  10. IUD discontinuation rates, switching behavior, and user satisfaction: findings from a retrospective analysis of a mobile outreach service program in Pakistan

    Directory of Open Access Journals (Sweden)

    Azmat SK

    2013-01-01

    Full Text Available Syed Khurram Azmat, Waqas Hameed, Ghulam Mustafa, Wajahat Hussain, Aftab Ahmed, Mohsina BilgramiMarie Stopes Society, Research and Metrics Department, Technical Services, Karachi, Sindh, PakistanBackground: In Pakistan, the uptake rate for the intrauterine device (IUD is very low at 2.5%. The most popular modern contraceptive methods in Pakistan are female sterilization and use of condoms. The Marie Stopes Society established its mobile outreach service delivery program with the aim of increasing use of modern quality contraceptive services, including the long-term reversible IUD, by women living in hard-to-reach areas. The present study attempts to assess IUD discontinuation rates and associated factors, including switching behavior and level of satisfaction with this type of service delivery.Methods: Using a cross-sectional approach, we contacted 681 women who had received an IUD from the Marie Stopes Society mobile outreach program during July and August 2009. Successful interviews were conducted with 639 of these women using a structured questionnaire. The data were analyzed with Stata 11.2 using simple descriptive Chi-square and Cox proportional techniques.Results: Analysis revealed that 19.4% (95% confidence interval 16.3–22.5 of the women discontinued use of their IUD at 10 months and, of these women, the majority (69.4% cited side effects as the main reason for discontinuation. Other factors, such as geographical catchment province, age of the woman, history of contraceptive use before IUD insertion, and side effects following insertion of the device, were found to be significantly associated with IUD. Amongst the women who had their IUD removed, 56.5% did not switch to any other contraceptive method, while 36.3% switched to either short-term or traditional methods, such as withdrawal, rhythm, and folk methods. Degree of satisfaction with the device was also significantly associated with discontinuation.Conclusion: Early

  11. Uzm Dr Sebahattin Okumuş 05-09-1937 - 14-03-2003

    Directory of Open Access Journals (Sweden)

    Veli Özdemir

    2003-12-01

    Full Text Available 1993 yılının Temmuz ayında tanıştık. Otopsisi ertesi güne kalan bir cenazenin başında beklerken, Fatih Adli Tabibi olduğunu anladığım iriyarı ve göbekli bir kişi kendine has yürüyüşüyle cenaze başına geldi. Daha tanışamadan elindeki dörde katlanmış ve “A4” olduğu belli olan kağıda hızlı bir biçimde not almaya başladı. Çevresiyle bağını koparmış, dış muayeneye ve elindeki kağıda konsantre olmuştu; birşey soranları “dur şimdi zamanı değil!” biçiminde geri çeviriyordu. Bu cümlenin, kendisinin her zaman kullandığı bir deyim olduğunu tanıyanlar bilir. Sonunda muayene bitti ve tanıştık; Dr. Sebahattin Okumuş imiş. “Sebahattin” olan adının “Sabahattin” olarak telaffuz edilmesine ve yazılmasına çok kızardı. Bunu ilk tanıştığımız gün anladım. Daha soma kendisiyle sık sık görüşmemizin dışmda, 1998-1999 yıllarında Fatih Adli Tabipliğinde çok yakından tanımamı sağlayacak 1 yıl kadar birlikte çalıştık... Kendi sağlığına pek dikkat etmez ve hele KOAH'lı (Kronik Obstrüktif Akciğer Hastahğı olmasına karşın ilaçlarım düzenli almaz ve bir hekim olmasına karşın doktor korkusundan dolayı kontrole gitmekten çekinirdi. Hastalığmın alevlendiği dönemlerde, ölü muayenesi için 1 kat merdiven çıkmak zorunda kalacağı için Cerrahpaşa Tıp Fakültesi'nin morguna gitmek istemezdi. 1999 yılı itibariyle 15 yıllık KOAH'lı olması ve tam konulduğu gün 20 yıh aşkın süre boyunca günde 2-3 paket kullandığı sigarayı birden bırakması (zorunda kalması dışında sağhğma pek dikkat etmemesi bildiğim en kötü yanıydı... Evine sürekli bir şeyler taşıması, oğlunun üzerine titremesi, eşi ve oğlu ile telefondaki diyaloglarından kendisinin evine pek düşkün olduğu, iyi bir “aile babası” ve “aile reisi” olduğu anlaşılıyordu. Evi ve işi dışında zaman geçirdiği tek yer Cengiz Ağabeyin (Uz

  12. Diversidade de Larvas de Leptophlebiidae (Insecta: Ephemeroptera da Reserva Florestal Adolpho Ducke, Manaus, AM.

    Directory of Open Access Journals (Sweden)

    Claudio Rabelo dos Santos-Neto

    2008-03-01

    Full Text Available ResumoA Reserva Florestal Adolpho Ducke (RFAD é um fragmento de 10.000 hectares em conflito geográfico com a cidade de Manaus. O conhecimento da diversidade dos Ephemeroptera na RFAD é fundamental uma vez que estes organismos são elementos biológicos importantes; como importante fonte de alimento e, por seu potencial como indicadores das perturbações antropogênicas. Neste estudo teve-se como objetivo o levantamento da fauna de Leptophlebiidae (Ephemeroptera das duas bacias hidrográficas, comparando a diversidade entre as bacias e entre os períodos seco e chuvoso. Coletou-se em 38 pontos dos igarapés das bacias Leste (Ipiranga, Uberê e Tinga e a Oeste (Acará e Bolívia da RFAD com rede entomológica aquática (rapiché. Para verificar diferenças na riqueza das duas bacias e, comparar a riqueza nos períodos seco e chuvoso foi feito o Índice de Riqueza de Jackknife. Foram obtidas 804 larvas de Leptophlebiidae sendo identificados 368 indivíduos e reconhecidos sete gêneros: Hagenulopsis Ulmer (35%; n=128; Thraulodes Ulmer (34%; n=124; Farrodes Peters (13%; n=48; Miroculis Edmunds Jr (12%; n=45; Hydrosmilodon Flowers & Dominguez (5%; n=19; Hermanella Needham & Murphy (0.8%; n=3, Microphlebia Savage & Peters (n=1. Este representa o primeiro registro de Hydrosmilodon, Hermanella e Microphlebia para a RFAD. Na comparação entre as bacias Leste e Oeste, o Índice de Riqueza de Jackknife não indicou diferença significativa na riqueza de gêneros. Hermanella e Hydrosmilodon não ocorreram na bacia Oeste e, Microphlebia não ocorreu na bacia Leste, no entanto estas ausências não representam diferença significativa na riqueza taxonômica das bacias. A comparação na riqueza de espécie de Leptophlebiidae considerando o período seco e chuvoso revelou uma diferença significativa entre os períodos. Cerca de 68% dos indivíduos foram coletados no período seco provavelmente porque neste período a água fica restrita ao canal do igarap

  13. 1925 Yılında İstanbul Erkek Lisesinde Öğrencilere Verilen Bir Sürgün Cezası ve Dönemin Eğitim Anlayışı An Exile Of Istanbul Boys' High School Students In 1925 And The Policy Of Education

    Directory of Open Access Journals (Sweden)

    Doğan DUMAN

    2013-03-01

    Full Text Available One of the main strategies for political parties is to use educationas a means to achieve their aims. The founders of the Republic wereinvolved in the educational activities and changes and endeavored toincrease the number of school, staff and students. The main concernwas teacher education and national education system as teachingprofession was one of the most significant indicators of modernity. Evenduring the independence war, there were remarkable efforts to persuadeteachers and to get their support the Turkish Grand National Assembly.This priority prevailed in the first years of the Republic and the stepswere taken to ameliorate their salaries and enhance their standing inthe society. Teachers were seen as representatives of the regime in theschools and society as their mission was to spread the values of therepublic to every strata of the society. Teachers managed to achieve thismission successfully and played a significant role in establishing therevolutions and foundation of the republic.Education was considered as the most influential transformativepower in the society in the first decade of the Republic, hence the needarose to strengthen the stance of teachers. During the term whenMustafa Necati served as a minister of education, the profession kept itsdignity and attempts were thwarted to ruin the image of teachingprofession. This study aims at evaluating and assessing disciplinepunishments and educational policy of Turkey revolving around thecase study of a disrespectful attitude of students towards their Arabicteacher in Istanbul Boys' School in 1925. Eğitimi toplumsal değişimde bir araç olarak kullanmak birçoksiyasal iktidarın başvurduğu bir yöntemdir. Cumhuriyet’in kurucularıda eğitimin bu işlevinden yararlanabilmek için eğitim faaliyetleriyleyakından ilgilenmiş; okul, öğretmen ve öğrenci sayısını artırmaya çabagöstermişlerdir. Özellikle öğretmenlik mesleğinin tüm dünyadaçağdaşlaşmanın en

  14. Yeni Harflerin Kabulü Ve Adana Basını’na Yansıması: “Yeni Adana” ve “Türk Sözü” Gazetesi The Acceptance Of New Letters And Reflection Of Them To The Adana Press: “Yeni Adana” And “Türk Sözü”

    Directory of Open Access Journals (Sweden)

    Şeyda ÖZÇELİK

    2013-09-01

    Full Text Available The reflection of social, political, cultural, economic and religious developments in a country has been by the media like television, radio, newspaper and magazine. The role of the media in the years of liberation and foundation of Turkish Republic was also very important.Especially the newspapers provided psychological support to the publicin the time of the National Struggle played an active role instrengthening the national feelings, strengthening the unity andsolidarity. The local press as well as the national press informed thepeople of the region and got the people to become conscious about theNational Struggle during the War of Independence. The political andcultural vision of the new regime of Turkish Republic established afterthe War of Independence was involved in national and local mediamoment by moment. The changes and the transformations afterfoundation of state were delivered to the public through the press. Atthis stage, to be understood of Atatürk’s revolutions which were thehistoric moment for the Turkish Republic in becoming contemporarysociety was entrusted a major task of the press. It was the newspapersof the period which was one of the institutions working actively in theannouncement stage of the Letter Revolution one of the revolutions ofAtatürk. The introduction of new letters, the teaching to the public, theopinions of Mustafa Kemal and intellectuals about Latin letters oftenwere been involved in the press. In the study it will benefit from thefunctions of Yeni Adana established in 1918 and was the local media ofAdana and Türk Sözü began broadcasting in 1923. It will be exposedthe announcing of Letter Revolution, introducing of new letters and theroles in the process of implementation of these newspapers. Bir ülkedeki toplumsal, siyasal, kültürel, ekonomik ve dini gelişmelerin halka yansıması televizyon, radyo, gazete, dergi gibi basın yayın araçlarıyla olmuştur. Türkiye Cumhuriyeti Devleti

  15. Myndos (Asar Adası Geç Antik Dönem Seramikleri / Late Antiquity Pottery Of (Asar Island Myndos

    Directory of Open Access Journals (Sweden)

    Sinan Mimaroğlu

    2017-10-01

    Full Text Available Ancient city of Myndos was one of Carian Cities in the antiquity and is located within the administrative boundaries of Gumusluk locality of Bodrum District in modern Turkey’s Mugla Province. Apart from information recounted in works of antique and modern travelers, the very first study on this city was the underwater exploration conducted in and around Myndos by INA (Institute of Nautical Archaeology in 1980 whereupon 10 amphoras, similar to those found in Yassiada Shipwreck which were aged for 4th century A.D. Underwater and surface studies were carried out between 2004 and 2006 which were led by Prof. Dr. Mustafa Sahin. The ground surveys carried out in 2008 revealed a monumental structure on Asar Island whereupon first scientific excavation works have started in 2009.* The layers of structures beginning earliest from the Hellenistic period were revealed by the studies on the hill. In the Late Antiquity, basilica and houses and cisterns were built on top of the hill. The most recent layer features fortified walls dating the Late Byzantium Era. Present study is the first that focuses on ceramics that were excavated between the years 2009-2013 from Asar Island (a.k.a. Rabbit Island which overlooks the Myndos. The ceramics examined in this study are from Late Antiquity of common wares and include cooking and heating pots, lids and Late Roman Red-Slip Wares. The ceramics provide important data concerning Late Antique settlements in the site and clues much needed to understand the fabric of the settlement. [TR: Antik coğrafyada Karia kentlerinden birisi olan Myndos Antik Kenti, günümüzde Muğla İli, Bodrum İlçesi, Gümüşlük Beldesi sınırları içerisinde yer almaktadır. Kent hakkında antik ve modern seyyahların verdikleri bilgiler dışında ilk bilimsel çalışma 1980 yılında INA (Institute of Nautical Archaeology tarafından Myndos’ta ve çevresinde gerçekleştirilen sualtı araştırmasıdır. Bu araştırmalar esnas

  16. “Beyhude Ömrüm” Adlı Hikâyenin Greımas’ın Eyleyenler Modeline Göre İncelenmesi Analysıs Of Story “Beyhude Ömrüm” Accordıng To Greımas’ Actants Model

    Directory of Open Access Journals (Sweden)

    Hatice ALTUNKAYA

    2012-12-01

    Full Text Available The art of story is a form of narrative that is not independent from its creator, namely the narrator, and created within the theme fictionalized by its narrator. When the work is created, it is the reader’s turn to interpret and give meaning to it. The reader’s duty is to reinterpret, transform the structures in the text and themes as well as unveiling the meaning connections between those. Semiology derivedfrom Ancient Greek word semeion meaning sign and logos meaningscience is known as science of signs in Turkish.Two people should be mentioned as founders of Semiology. Theseare Charles Sanders Peirce and Swiss linguist Ferdinand de Saussure.Saying “Although the universe is not entirely made up of signs, itoverflows with signs”, Peirce expresses that all objects can be subject ofSemiology.The goal of this study is to analyze Mustafa Kutlu’s story titled“Beyhude Ömrüm” according to the Greimas’ analysis method ofactants model. A.J. Greimas argues that an incident starting the storyand an element transforming the initial status are required for creatingthe narrative. The study divided the story into five sections byconsidering that the said incident and transforming elements areavailable. The sections confirmed that six actants of the actants modelare available; manipulation, competence and performance of narrativeroutine as well as stages of sanction routine are available and thesubjects of actants model realized competence, conclusive andhonorable experiences. Besides, it is seen that using the expression “Idied” is not an appropriate form of narrative used by the author tellingthe story as a narrator using pronoun I. Hikâye sanatı, onu meydana getiren anlatıcısından bağımsız olmayan, anlatıcısının kurguladığı izlencede meydana gelen bir anlatı türüdür. Eser meydana geldikten sonra eseri yorumlama, anlamlandırma sırası okura gelir. Metnin içerdiği yapıları, izlekleri yeniden yorumlamak, d

  17. San Remo Konferansı’nda İngiltere’nin Ermeni Politikası (18-26 Nisan 1920 Britain’s Armenian Policy on San Remo Conference (18-26 April 1920

    Directory of Open Access Journals (Sweden)

    Evren KÜÇÜK

    2012-09-01

    Full Text Available Between 18-26 April 1920, The Allied Powers came together in San Remo, Italy to impose their demands on the Ottoman Empire. During these negotiations called San Remo Conference, Boghos Nubar Pasha and Avetis Ahoranian representing Armenia went on to put forward territorial claims on the Ottoman Empire. In order to materialise these demands, a mandatory power was needed to defend, develop and finance the Armenian existence. This situation resulted in Britain’s diplomatic manoeuvre. As the Mesopotamia region was also particularly important for Britain, the mandatory role in Anatolia was to be given to the United States of America. In case the USA denied the role, the Turkish-Armenian border was proposed to be resolved under the arbitration of the United States President Wilson. In San Remo, however, presidents of other states enounced that they were troubled with the responsibility of undertaking the mandatory of Armenia and would not be providing any financial or military aid as well. These demographically baseless and impracticable demands could not be expected to be approved by the movement led by Mustafa Kemal Pasha. Moreover, the military triumphs in the Eastern Front resulted in the failure of Britain’s Armenian policy and by-passed United States President Wilson’s 22 November 1920 dated report about the Turkish-Armenian border, prepared according to 89th clause of the Treaty of Sevres as well. On one hand, this war of survival led to the break up of the Allied Powers in the end and resulted in even Italy and France's backing the national struggle movement. On the other hand, it brought an end to both Lloyd George Government and Ottoman Imperialism. Müttefik Devletler, Osmanlı Devleti’ne isteklerini kabul ettirebilmek için 18-26 Nisan 1920 tarihleri arasında İtalya’nın San Remo şehrinde toplanmışlardır. San Remo Konferansı olarak adlandırılan bu görüşmelerde Ermenileri temsilen Boghos Nubar Paşa ile Avetis

  18. Parasitic fauna of eight species of ornamental freshwater fish species from the middle Negro River in the Brazilian Amazon Region Fauna parasitária de oito espécies de peixes ornamentais de água doce do médio Rio Negro na Amazônia brasileira

    Directory of Open Access Journals (Sweden)

    Marcos Tavares-Dias

    2010-06-01

    (Lebiasinidae e 13 acará-bandeira Pterophyllum scalare (Cichlidae foram coletados no médio Rio Negro, estado do Amazonas, Brasil. Em um total de 223 peixes examinados, 143 (64,1% estavam parasitados por pelo menos uma espécie de parasito. A maior taxa de prevalência foi de Monogenea (36,7%, seguida de Ichthyophthirius multifiliis (Ciliophora (20,6%, Trichodina spp. (Ciliophora (4,0%, Piscinoodinium pillulare (Dinoflagellida (1,3%, Tetrahymena sp. (Ciliophora (0,89% e Procamallanus sp. (Nematoda (0,4%. Todas as oito espécies de peixes mostraram Monogenea (Gyrodactylidae and Dactylogyridae nas brânquias, mas a maior prevalência ocorreu em P. scalare e menor em P. axelrodi e C. strigata. Porém, maior intensidade média de Monogenea foi encontrada em P. scalare e A. hoplogenys. O protozoário I. multifiliis ocorreu nas seis espécies de peixes ornamentais examinadas, porém C. strigata e C. martae tiveram a maior prevalência e intensidade média. Trichodina spp. foram encontradas somente nas brânquias de C. strigata, C. martae e N. eques, mas a maior intensidade média foi em C. strigata. Por outro lado, o protozoário P. pilullare foi encontrado somente nas brânquias de C. martae. No Brasil, este é o primeiro relato de Tetrahymena sp. e ocorreu nas brânquias de C. strigata.

  19. Release of the 2008 Evaluated Nuclear Data Library (ENDL2008)

    Energy Technology Data Exchange (ETDEWEB)

    Brown, D A; Descalle, M; Hoffman, R; Kelley, K; Navratil, P; Pruet, J; Summers, N; Thompson, I; Vogt, R

    2009-05-08

    Livermore's N-Division is now releasing the first version of a major new nuclear data library. This includes some 500 evaluations (roughly four times the number in the previous standard) and many physics improvements important for calculating weapon performance, output effects, attribution signatures, key radiochemical diagnostics and performance of conventional and hybrid fission/fusion reactors. As this library is more extensive and on a much firmer nuclear physics footing than the previous ENDL99 it should become, after a period of trial use by the applied community, the new standard for programmatic applications at Livermore. This work was supported by ASC-PEM and Campaign 4. Our basic philosophy in this release was to adopt the best work of the world's different nuclear data efforts. We have drawn heavily from the U.S. ENDF project (led by Brookhaven), the Japanese JENDL project (JAEA), and the European JEFF project (NEA). Because those efforts tend to focus on reactor applications they do not include an account of the charged particles emitted following a reaction. To enable broader applications we have used theory-based calculations to add a complete description of charged particles in all evaluations in the new library. This release also includes results from the last ten years of theory and experimental work here at Livermore. Some of the most important results include the surrogate campaign for unstable uranium isotopes, the LLNL/LANL 239Pu(n,2n) evaluation, the 241Am(n,2n) evaluation validated by the recent Livermore-led experiments, and measurements of 48Ti(n,2n). As well, we have adopted more than a hundred theory-based evaluations for radiochemical diagnostics completed by R. Hoffman and M. Mustafa and that use improved optical models, level densities, and decay scheme evaluations from the theory effort. These were extended to be transport complete (they now include a description of all of the particles emitted in reactions) to enable their

  20. FROM THE EDITOR

    Directory of Open Access Journals (Sweden)

    Cemil Ozturk

    2014-10-01

    ısı” (Social Studies Teachers’ Perceptions of Tolerance and Feryal Çubukçu “Values Education Through Literary Texts”. These valuable papers have potential to contribute the literature on social studies education. One of the main aims of ASSE was to establish a regular scientific event through which social studies educators from Turkey and abroad get together to share their academic works and ideas. In conjunction with the Faculty of Education of Bolu Abant Izzet Baysal University we are organizing the Fourth International Symposium on Social Studies Education (ISSE in April 2015. The main theme of ISSE the 4th is “Peace Education”. The preference of this theme emphasizes on our hopes and determination for our envision for peace in the late Ottoman geography, in which guns have still been on fire and people have still been shedding tears. And this could be regarded as something similar to the action of Mustafa Kemal Pasha who thought of about the reconstruction of the country after the war and assembled an “Educational Congress” in Ankara to discuss educational issues, during the most difficult days of the War of Independence in 1921. Adopting this approach, we have been considering putting effort to institutionalize the values of democracy, human rights, justice, freedom of thought and freedom of conscience. As a final remark, I would like to thank everyone who contributed to the production of this issue and special thanks to Assoc. Prof. Dr. Erkan Dinç who acted as issue editor. Best regards and hope to meet you in ISSE the 4th…

  1. Individual Differences in the Relationship Between Attachment and Nomophobia Among College Students: The Mediating Role of Mindfulness.

    Science.gov (United States)

    Arpaci, Ibrahim; Baloğlu, Mustafa; Özteke Kozan, Hatice İrem; Kesici, Şahin

    2017-12-14

    mindfulness were not significant (F 4,448 =3.45, P=.69). On the other hand, results do show significant gender differences in nomophobia (F 4,445 =2.71, P=.03, Wilk λ=.98, partial η 2 =.02) where women scored significantly higher than men. In general, individuals who are emotionally more dependent and crave more closeness and attention in the relationship tend to display higher levels of fear or discomfort when they have no access to their mobile phones. However, gender has a differential impact on the relationship between avoidant attachment and nomophobia. This study establishes the impact of mindfulness on nomophobia for women; therefore, future studies should test the effectiveness of mindfulness-based therapy approaches and confirm whether they are effective and efficient. On the basis of significant gender difference in nomophobia and attachment, we conclude that gender should be taken into account in mindfulness-based treatments dealing with nomophobia. ©Ibrahim Arpaci, Mustafa Baloğlu, Hatice İrem Özteke Kozan, Şahin Kesici. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 14.12.2017.

  2. An overview of the results of dissertation research in the field of nanotechnology and nanomaterials. Part 2

    Directory of Open Access Journals (Sweden)

    KARPOV Alexey Ivanovich

    2015-08-01

    Full Text Available To popularize scientific achievements the main results of Russian and foreign scientists’ research are published in the form of abstract. The research «Increasing of concrete strength with carbon nanotubes by means of hydrodynamic cavitation» contains the calculation of prime cost of the main raw components which are necessary to produce fine-grained concrete with strength class B55, that demonstrates the economic efficiency of application of CNT as modifying additive for cement composites. Modification of concrete matrix with CNT leads to higher breaking point of compressive strength and that makes it possible to reduce discharge intensity of cement by the strength unit of the material. In this case introduction of 0,05% initial CNT of binder mass into concrete led to 1,5 times increased strength-to-weight ratio. The amount of saved resources was determined as the cost difference between amount of raw materials which are necessary to produce concrete B55 class of traditional composition and the concrete similar by the class obtained due to introduction of carbon nanomodifier into it. The choice of the cost of 1 gram of multilayer CNT was based on the analysis of commercial offers of Russian and foreign companies that are specilized in manufacture and realization of carbon nanomaterials. The specialists may be also interested in the research held by Podgorny I.I. «Materials of autoclave hardening with the use of nanostructured modifier based on magnetic rock of acid content», Satjukov А.B. «Nanomodified composite binder for special construction mortars», Hammadi Mustafa Abdul Madzhid Hamid «The method to nanomodify cement concretes with nanomortar», Altynnik N.I. «Aeroconcrete of autoclave hardening with the use of nanostructured modifier», Volkov D.S. «Complex approaches to characterization of nanodiamonds of detonation synthesis and their colloid solutions», Ermolin М.S. «Rectification of nano- and microparticles in rotating

  3. Field studies on long term ecosystem consequences of ionising radiation and chemical pollutants (EANOR Project)

    Energy Technology Data Exchange (ETDEWEB)

    Oughton, D. [Centre for Environmental Radioactivity - CERAD (Norway); Evseeva, T. [Institute of Biology RAS (Russian Federation); Erenturk, S. [Istanbul Technical University (Turkey)

    2014-07-01

    -barcoding, invertebrate DNA barcoding, DNA methylation, and other molecular endpoints is ongoing, together with studies of possible adaptation of plants, invertebrates and microorganisms. Preliminary results show significant differences in diversity for many species between contaminated and reference sites. However, more research is needed to draw conclusions about the cause of such observations. Nevertheless, by combining a through site characterisation and exposure assessment with a variety of ecologically relevant biomarker and endpoint measurements, the data produced should be a valuable contribution to international activities looking at the impacts of chronic exposure of ionising radiation on non-human species. Project participants: Elena Belykh, Anna Kaneva, Boris Kondratenok, Alla Kolesnikova, Alexey Kurdin, Tatinana Majstrenko, Taskayeva Anastasia Oleshya Vakhrusheva, Illa Velegzhaninov, Vladimir Zainullin (IoB, Komi Republic, Russia); S. Haciyakupoglu (Istanbul Technical University, Turkey); Rahime Oral, Sabriye Yusan, Filiz Gur Filiz (Ege University, Turkey); Murat Belivermis, Onder Kilic (Istanbul University, Turkey); Fatma Kocbas (Celal Bayar University, Turkey); Mustafa Akiner, (Rize University, Turkey); Claire Coutris, Erik Joner (Bioforsk, Norway); Turid Hertel-Aas, Emmanuel Lapied, Yevgeniya Tomkiv, Brit Salbu, Lindis Skipperud (Centre for Environmental Radioactivity, UMB, Norway). Document available in abstract form only. (authors)

  4. Yüksek Ziraat Enstitüsünün Öyküsü

    Directory of Open Access Journals (Sweden)

    Arif Akman

    2015-02-01

    Full Text Available 20. yüzyıl başlarında doğmuş olan bizim kuşak, yani Osmanlı İmparatorluğunun çocukları, biri son derece acı ve  hazin;  ötekisi  ise  son  derece  sevindirici ve mutlu iki olayı  hem de çok kısa aralıklarla birlikte yaşamıştır. Bu iki son derece önemli olaydan acı olanı, 700 yıllık o koca Osmanlı İmparatorluğunun çöküşünü yaşamak talihsizliği; sevinç ve mutluluk dolu ikinci olay ise, o vatanı kurtaran Atatürk sayesinde yepyeni ve dinamik bir Cumhuriyet’in Türkiye Cumhuriyet’inin doğuşunu, yaşamak olmuştur. Kurtuluş Savaşı, düşmanın denizi dökülmesiyle sonuçlandığı mutlu günün hemen arkasından İzmir’e gelen Başkomutan Mareşal Mustafa Kemal Paşa, yanındakilerin “Çok şükür bitti” dediklerini işitince, “Asıl işimiz şimdi başlıyor” demişti. Atatürk bu sözleriyle, belki ta Harbiye’deki  öğrenciliği ve uzun süren askerlik yaşamı boyunca yapmayı tasarlayıp kafasında biçimlendirdiği devrim ve reformları kastediyordu. Atatürk, gençliğinden beri Hilafet, Saltanat, batı uygarlığı ve cumhuriyet hakkındaki düşünce ve tasarımlarını, Kurtuluş Savaşı boyunca kimseye açmamış ve âdeta bir sır gibi kendi içinde saklamıştır. Vakte ki memleket kurtulup Lozan Barış Anlaşması da yapıldıktan sonra barış dönemi başlayınca; artık tasarladığı devrim ve reformları yapmak zamanının geldiğine karar vererek bunları uygulamaya koymuştur. Bildiğimiz bu devrim ve reformlar da 1923 ile 1928 yılları arasında olmak üzere, topu topu 5 yıl içinde gerçekleştirilmiştir.

  5. Assessment of the effects of levosimendan and thymoquinone on lung injury after myocardial ischemia reperfusion in rats

    Directory of Open Access Journals (Sweden)

    Sezen SC

    2018-05-01

    Full Text Available Şaban Cem Sezen,1 Aysegul Kucuk,2 Abdullah Özer,3 Yiğit Kılıç,4 Barış Mardin,3 Metin Alkan,5 Fatmanur Duruk Erkent,5 Mustafa Arslan,5 Yusuf Ünal,5 Gürsel Levent Oktar,3 Murat Tosun6 1Department of Histology and Embryology, Kirikkale University Medical Faculty, Kirikkale, Turkey; 2Department of Physiology, Dumlupinar University Medical Faculty, Kutahya, Turkey; 3Department of Cardiovascular Surgery, Gazi University Medical Faculty, Ankara, Turkey; 4Pediatric Cardiovascular Surgery Clinic, Dr Siyami Ersek Cardiovascular and Thoracic Surgery Training and Research Hospital, Istanbul, Turkey; 5Department of Anaesthesiology and Reanimation, Gazi University Medical Faculty, Ankara, Turkey; 6Department of Histology and Embryology, Afyon Kocatepe University Medical Faculty, Afyonkarahisar, Turkey Aim: The aim of this study was to investigate the effects of levosimendan and thymoquinone (TQ on lung injury after myocardial ischemia/reperfusion (I/R. Materials and methods: Twenty-four Wistar albino rats were included in the study. The animals were randomly assigned to 1 of 4 experimental groups. In Group C (control group, left anterior descending artery was not occluded or reperfused. Myocardial I/R was induced by ligation of the left anterior descending artery for 30 min, followed by 2 h of reperfusion in the I/R, I/R-levosimendan (24 μg/kg (IRL group, and I/R-thymoquinone (0.2 mL/kg (IRTQ group. Tissue samples taken from the lungs of rats were histochemically stained with H&E and immunohistochemically stained with p53, Bcl 2, Bax, and caspase 3 primer antibodies. Results: Increased expression of p53 and Bax was observed (4+, especially in the I/R group. In IRTQ and IRL groups, expression was also observed at various locations (2+, 3+. H&E staining revealed that that the lungs were severely damaged and the walls of the alveoli were too thick, the number of areas examined was increased during the evaluation. Caspase 3 expression was observed to

  6. Clinical factors and comorbidities affecting the cost of hospital-treated COPD

    Directory of Open Access Journals (Sweden)

    Deniz S

    2016-12-01

    Full Text Available Sami Deniz,1 Aysun Şengül,2 Yusuf Aydemir,3 Jülide Çeldir Emre,4 Mustafa Hikmet Özhan5 1Clinics of Chest Diseases, Dr Suat Seren Chest Diseases and Thoracic Surgery Education and Research Hospital, İzmir, 2Clinics of Chest Diseases, Kocaeli Derince Research and Education Hospital, Kocaeli, 3Department of Chest Diseases, Sakarya University Faculty of Medicine, Sakarya, 4Clinics of Chest Diseases, Turgutlu State Hospital, Manisa, 5Department of Chest Diseases, Faculty of Medicine, Ege University İzmir, Turkey Purpose: We aimed to assess the effects of comorbidities on COPD costs and to investigate the relationship between comorbidities and clinical variables.Patients and methods: All patients hospitalized with a diagnosis of COPD exacerbation between January 1, 2014, and December 31, 2014, at all state hospitals of Aydin province, a city located in the western part of Turkey, were included in this study. The costs examined in the study pertained to medications, laboratory tests, hospital stays, and other treatment-related factors, such as consumption of materials, doctor visits, and consultation fees.Results: A total of 3,095 patients with 5,237 exacerbations (mean age, 71.9±10.5 years; 2,434 males and 661 females were evaluated. For 880 of the patients (28.9%, or 3,852 of the exacerbations (73.1%, at least one comorbid disease was recorded. The mean cost of each exacerbation was $808.5±1,586, including $325.1±879.9 (40.7% for hospital stays, $223.1±1,300.9 (27.6% for medications, $46.3±49.6 (0.9% for laboratory expenditures, and $214±1,068 (26.5% for other treatment-related factors, such as consumption of materials, doctor visits, and consultation fees. The cost of each exacerbation was $1,014.9 in patients with at least one comorbidity, whereas it was $233.6 in patients without comorbidity (P<0.001. Age >65 years, female gender, hospitalization in an intensive care unit, invasive or noninvasive mechanical ventilation, and a

  7. The role of blood groups in the development of diabetes mellitus after gestational diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Karagoz H

    2015-10-01

    Full Text Available Hatice Karagoz,1 Abdulsamet Erden,2 Ozerhan Ozer,2 Kubra Esmeray,2 Ali Cetinkaya,2 Deniz Avci,2 Samet Karahan,2 Mustafa Basak,2 Kadir Bulut,2 Hasan Mutlu,3 Yasin Simsek4 1Internal Medicine Department, Acibadem Kayseri Hospital, 2Internal Medicine Department, 3Medical Oncology Department, 4Endocrinology Department, Kayseri Training and Research Hospital, Kayseri, Turkey Introduction: Gestational diabetes mellitus (GDM is a common condition that is defined as glucose intolerance of varying degree with onset or first recognition during pregnancy and it affects approximately 5% of all pregnancies all over the world. GDM is not only associated with adverse pregnancy outcomes such as macrosomia, dystocia, birth trauma, and metabolic complications in newborns, but it is also a strong predictor of transitioning to overt DM postpartum. The association of ABO blood groups with DM has been observed before in several epidemiological and genetic studies and resulted with inconsistent findings, but still there are not enough studies in the literature about the association of ABO blood groups with GDM. In this study, we aimed at investigating any possible relationship between the ABO blood group system and GDM and also the transitioning of GDM to overt DM postpartum, in Turkey.Patients and methods: A total of 233 patients with GDM from Kayseri Training and Research Hospital between 2002 and 2012 were included in the study. The cases that have serologically determined blood groups and Rh factor in the hospital records were included in the study, and the patients with unknown blood groups were excluded. Patients were classified according to blood groups (A, B, AB, and O and Rh status (+/-. GDM was diagnosed based on the glucose cut-points of the International Association of the Diabetes and Pregnancy Society Groups. The distributions of blood groups of the patients with GDM were compared with the distribution of blood groups of 17,314 healthy donors who were

  8. Prognostic impact of initial maximum standardized uptake value of 18F-FDG PET/CT on treatment response in patients with metastatic lung adenocarcinoma treated with erlotinib

    Directory of Open Access Journals (Sweden)

    Kus T

    2015-12-01

    Full Text Available Tulay Kus,1 Gokmen Aktas,1 Alper Sevinc,1 Mehmet Emin Kalender,1 Mustafa Yilmaz,2 Seval Kul,3 Serdar Oztuzcu,4 Cemil Oktay,5 Celaletdin Camci1 1Department of Internal Medicine, Division of Medical Oncology, Gaziantep Oncology Hospital, 2Department of Nuclear Medicine, 3Department of Biostatistics, Faculty of Medicine, 4Department of Medical Biology, Faculty of Medicine, University of Gaziantep, Gaziantep, 5Department of Radiology, Faculty of Medicine, University of Akdeniz, Antalya, Turkey Purpose: To investigate whether the initial maximum standardized uptake value (SUVmax on fluorine-18 fluorodeoxyglucose positron emission tomography/computed tomography (18F-FDG PET/CT has a prognostic significance in metastatic lung adenocarcinoma.Patients and methods: Sixty patients (24 females, mean age: 57.9±12 years with metastatic stage lung adenocarcinoma who used erlotinib and underwent 18F-FDG PET/CT at the time of diagnosis between May 2010 and May 2014 were enrolled in this retrospective study. The patients were stratified according to the median SUVmax value, which was found as 11. Progression-free survival (PFS rates for 3, 6, and 12 months were examined for SUVmax values and epidermal growth factor receptor (EGFR mutation status.Results: The number of EGFR-sensitizing mutation positive/negative/unknown was 26/17/17, respectively, and the number of patients using erlotinib at first-line, second-line, and third-line therapy was 15, 31, and 14 consecutively. The PFS rates of EGFR mutation positive, negative, and unknown patients for 3 months were 73.1%, 35.3%, and 41.2% (P=0.026, odds ratio [OR]=4.39; 95% confidence interval [CI]: 1.45–13.26, respectively. The PFS rates of EGFR positive, negative, and unknown patients for 6 months were 50%, 29.4%, and 29.4% (P=0.267, OR: 2.4; 95% CI: 0.82–6.96, respectively. The PFS rates of EGFR positive, negative, and unknown patients for 12 months were 42.3%, 29.4%, 23.5% (P=0.408, OR: 2.0; 95% CI: 0.42

  9. The Importance of Nutrition Journal Publication

    Directory of Open Access Journals (Sweden)

    Saptawati Bardosono

    2017-09-01

    Full Text Available The rapid increase of nutrition journal publications indicate on the urgency of the problems in the world of nutrition. Research scientists had published various condition related to nutritional status and determined the cause of this problem. Expanding populations, newly achieved national freedoms, and the urge for a better life in the developing countries of Asia, Africa, and Latin America, together with food surpluses, enlightened self-interest, and awakened conscience in the more privileged countries of Europe, North America and Oceania have contributed to resurgence of interest in the world of health and nutrition problems.1 Indonesian Nutrition Association (registered as Perhimpunan Nutriti Indonesia, which was founded in 2011, has been continuing visions and misions to continue and develop the work of late Dr. Iqbal Mustafa, MD, PhD, FCCM. He encouraged the evolution of multidisciplinary Critical Care Systems in developing countries to provide benefit for great number of recipients at the lowest affordable cost. His interest in Nutritional Support had become a foundation to INA.2 To continue his legacy, INA has financially support the publishing of Journal Critical Care and Shock, the spreading of research to meet the needs of population. Since 2011, INA has taken an active role in all aspects of education and post-graduate trainings, practices, researches, and publications in nutrition disciplines. It also fosters collaboration among professionals involved in nutrition sciences. The yearly event held by INA, Nutri Symposium, has been running for 12 years. As part of this activity, we gather all participants to submit oral or poster presentation, which will also be published in form of abstracts in proceeding book. The demand from nutrition researchers and scientists to join the Nutri Symposium as a platform to publish their work has encouraged INA to create an International Journal focus on Nutrition, entitled World Nutrition Journal

  10. VIth EUROPEAN SPORTS MEDICINE CONGRESS October 14-18 2009, Antalya/Turkey

    Directory of Open Access Journals (Sweden)

    2009-12-01

    Full Text Available On behalf of Turkish Sports Medicine Association, we are proud to host 6th. EFSMA European Sports Medicine Congress in Antalya, Turkey; a country founded in Anatolia with a ten thousand year old cultural heritage, acting as a geographic and socio-cultural link between West and East.The choice of Antalya as the venue of our Congress is to provide a unique ambiance with the incomparable historic presence, natural beauty and cultural charm of this part of Anatolia. We hope that this Congress in the land of pioneers of medicine such as Avicenna and Hipocrates inspires and stimulates you. Surrounded by amazing scenery of sharp contrasts, Antalya, Turkey’s principal resort, is an attractive city with shady palm-lined boulevards and a prize-winning marina. Antalya has been continuously inhabited since its founding in 159 BC by Attalos II, a King of Pergamum, who named the city Attaleia after himself.The Romans, Byzantines and Seljuks successively inhabited in Antalya before Ottomans ruled the territory.Today, Antalya is a famous tourism center in Mustafa Kemal Ataturk’s modern Turkish Republic, providing a premium touristic service mainly to Europe.We would like to welcome you to share the recent scientific developments in the area of sports medicine. We believe this Congress provides a high quality scientific environment for the presentation of new research and exchange of information by all disciplines related to sports and medicine.In recent years, the EFSMA has grown and developed into what is now a leading and dynamic force in Sports Medicine in Europe. It is with the same dynamism and expertise that are the hallmarks of a high calibre and carefully arranged scientific programme. A thorough discussion and critical evaluation of the latest advancements in sports medicine are key features of the scientific programme. The sessions, which will include educational courses, state-of-the-art lectures, panel and round table discussions and symposia

  11. Działania krymskotatarskiego ruchu narodowowyzwoleńczego w warunkach aneksji Krymu (na przykładzie blokady półwyspu

    Directory of Open Access Journals (Sweden)

    Oksana Voytyuk

    2016-08-01

    Full Text Available The actions of Crimean Tatars national liberation movement under сonditions of annexation of the Crimea (example of Crimea blockade In 2015, due to the rapidly changing political and economic situation in the world, the issue of annexation of the Crimea gave way to such news as the political situation in Syria, and Russia's participation in hostilities in this country, the imposition of sanctions on Russia and their impact on the Russian economy, falling oil prices and its effects, the situation with refugees in the European Union. To draw attention to the problem of the annexation of the Crimea and Crimean Tatars Mejlis and its chairman Refat Chubarov and political leader of the Crimean Tatars Mustafa Dzhemilev initiated a peace action of blockade of Crimea. Blockade had two stages – transporto and food blockade and energy blockade. The action ended with the start of 2016 year. Regardless that Crimean Tatars failed to achieve the main goal - to release all political prisoners, blockade showed how high there is peninsula’s dependence from Ukraine's economy.   Działania krymskotatarskiego ruchu narodowowyzwoleńczego w warunkach aneksji Krymu (na przykładzie blokady półwyspu W 2015 roku, w związku z dynamicznie zmieniającą się sytuacją polityczną i gospodarczą na świecie, kwestia aneksji Krymu ustąpiła miejsca takim wiadomościom jak sytuacja w Syrii i udział Rosji w działaniach wojennych na terenie tego kraju, nałożenie sankcji na Rosję oraz ich wpływ na rosyjską gospodarkę, spadek cen ropy naftowej i jego skutki, sytuacja z uchodźcami w Unii Europejskiej. Celem zwrócenia uwagi na aneksję Krymu i problem Tatarów Krymskich, Medżlis z siedzibą w Kijowie przewodniczącym Refatem Czubarowym i politycznym przywódcą Tatarów Krymskich Mustafą Dżemilewym inicjowali bezterminową pokojową akcję blokady Krymu. Blokada miała dwa etapy – transportowo-towarowy i energetyczny. Akcja zakończyła się wraz z rozpocz

  12. Release of the 2008 Evaluated Nuclear Data Library (ENDL2008)

    International Nuclear Information System (INIS)

    Brown, D.A.; Descalle, M.; Hoffman, R.; Kelley, K.; Navratil, P.; Pruet, J.; Summers, N.; Thompson, I.; Vogt, R.

    2009-01-01

    Livermore's N-Division is now releasing the first version of a major new nuclear data library. This includes some 500 evaluations (roughly four times the number in the previous standard) and many physics improvements important for calculating weapon performance, output effects, attribution signatures, key radiochemical diagnostics and performance of conventional and hybrid fission/fusion reactors. As this library is more extensive and on a much firmer nuclear physics footing than the previous ENDL99 it should become, after a period of trial use by the applied community, the new standard for programmatic applications at Livermore. This work was supported by ASC-PEM and Campaign 4. Our basic philosophy in this release was to adopt the best work of the world's different nuclear data efforts. We have drawn heavily from the U.S. ENDF project (led by Brookhaven), the Japanese JENDL project (JAEA), and the European JEFF project (NEA). Because those efforts tend to focus on reactor applications they do not include an account of the charged particles emitted following a reaction. To enable broader applications we have used theory-based calculations to add a complete description of charged particles in all evaluations in the new library. This release also includes results from the last ten years of theory and experimental work here at Livermore. Some of the most important results include the surrogate campaign for unstable uranium isotopes, the LLNL/LANL 239Pu(n,2n) evaluation, the 241Am(n,2n) evaluation validated by the recent Livermore-led experiments, and measurements of 48Ti(n,2n). As well, we have adopted more than a hundred theory-based evaluations for radiochemical diagnostics completed by R. Hoffman and M. Mustafa and that use improved optical models, level densities, and decay scheme evaluations from the theory effort. These were extended to be transport complete (they now include a description of all of the particles emitted in reactions) to enable their use in

  13. 16th International Conference on Micro and Nanotechnology for Power Generation and Energy Conversion Applications (PowerMEMS 2016)

    International Nuclear Information System (INIS)

    2016-01-01

    , JAPAN Reza Ghodssi - University of Maryland Einar Halvorsen - Grenoble Alpes Université, FRANCE Hiroki Kuwano-Tohoku University, JAPAN Jeff Lang - Massachusetts Institute of Technology, USA Carol Livermore - Northeastern University, USA Ryutaro Maeda - National Institute of Advanced Industrial Science and Technology, JAPAN Kazusuke Maenaka - University of Hyogo, JAPAN Paul Mitcheson - Imperial College London, UK Yuji Suzuki - University of Tokyo, JAPAN Shuji Tanaka -Tohoku University, JAPAN Luis Velásquez-García - Massachusetts Institute of Technology, USA Peter Woias - University Freiburg-IMTEK, GERMANY Eric Yeatman - Imperial College London, UK Technical Program Committee Mahmoud Almasri, University of Missouri, USA David Arnold, University of Florida, USA Mustafa Beyaz, Antalya International University, TURKEY Danick Briand, EPFL, SWITZERLAND Stephen Burrow, Univesrity of Bristol, UK Francesco Cottone, University of Perugia, ITALY Alper Erturk, Georgia Institute of Technology, USA Luis Fonseca, IMB-CNM (CSIC)Micro-Nanosytems, SPAIN Takayuki Fujita, University of Hyogo, JAPAN Dimitri Galayko, UPMC-Sorbonne, FRANCE Tzeno Galchev, Analog Devices Inc., USA Gideon Gouws, Victoria University of Wellington, NEW ZEALAND Andrew Holmes, Imperial College London, UK Yoshihiro Kawahara, The University of Tokyo, JAPAN Sang-Woo Kim, Sungkyunkwan University, SOUTH KOREA Jeffrey Lang, Massachusetts Institute of Technology, USA Janet Ledesma-García, Universidad Autónoma de Querétaro, MEXICO Carol Livermore, Northeastern University, USA Yiannos Manoli, University of Freiburg, GERMANY Jianmin Miao, Nanyang Technological University, SINGAPORE Paul Mitcheson, Imperial College London, UK Koji Miyazaki, Kyushu Institute of Technology, JAPAN Jaeyeong Park, Kwangwoon University, KOREA Michael Renaud, Holst Centre-lmec NL, NETHERLANDS Paul Ronney, University of Southern California, USA Shad Roundy, University of Utah, USA Tomonori Seki, OMRON Corporation, JAPAN Yuji Suzuki, The

  14. Üniversite öğrencilerinde madde kullanımı, şiddet ve bazı psikolojik özellikler

    Directory of Open Access Journals (Sweden)

    Ebru Turhan

    2011-06-01

    Full Text Available ÖzetAmaç: Madde bağımlılığı günümüzde önemli bir halk sağlığı sorunudur. Bu çalışma, üniversite öğrencilerinde sigara, alkol ve uyuşturucu madde kullanımının yaygınlığını ve bunu etkileyen faktörleri araştırmak amacı ile yapıldı. Yöntem: Kesitsel tipteki bu araştırmada veriler, Hatay Mustafa Kemal Üniversitesi Eğitim Fakültesi, Ziraat Fakültesi ve Reyhanlı Sağlık Meslek Yüksek Okulu öğrencilerinden elde edildi.  Her fakülte ya da yüksek okuldan bir, iki, üç ve dördüncü sınıflardan birer şube seçildi ve sınıflarda ½ sistematik örneklem ile de öğrenciler seçildi. Çalışmaya toplam 396 öğrenci katıldı. Araştırmaya katılmayı kabul edenlere gözlem altında soru kağıdı uygulandı. Bulgular: Katılan öğrencilerin yaş ortalaması 20.9±2.3 ve %55.1’i erkektir.  Yaşam boyu sigara, alkol ve uyuşturucu madde kullanımı sırasıyla %73.2, %56.6 ve %9.6 idi. Erkeklerde sigara, alkol ve uyuşturucu madde kullanımı daha yüksek bulundu. Babasında ve kardeşinde sigara ve alkol kullanımı öyküsü olanlarda sigara ve alkol kullanımı daha yüksek saptandı.  Yakın akrabalarında uyuşturucu madde kullanımı bildirenlerde, uyuşturucu madde kullanımı daha fazla bulundu. Sigara kullananlarda şiddete uğrama ve şiddet uygulama, sigara içmeyenlere göre daha yüksek idi (p<0.001. Hayat boyu şiddete uğrayanların özgüven ve sosyal destek skorları düşük, sürekli kaygı puanları yüksek bulundu (p<0.01. Uçucu madde kullananlarda sürekli kaygı puanı yüksek (p<0.05, sosyal destek puanı düşük idi (p<0.05. Sonuç: Sigara içme, alkol ve uyuşturucu madde kullanımı Hatay’da üniversite öğrencilerinde yaygındır. Bulgularımız uçucu madde kullanımı ile yüksek sürekli kaygı ve düşük sosyal destek arasında ilişki olduğunu desteklemektedir.Anahtar Kelimeler: Madde kullanımı, üniversite öğrencileri, özsaygı, özgüven, kaygı,

  15. ISU-ISU PEMBAHARUAN ISLAM DI BEBERAPA NEGARA PERSPEKTIF SEJARAH

    Directory of Open Access Journals (Sweden)

    Rusmala Dewi

    2016-07-01

    Full Text Available The collapse of the Abbasid sovereignty at the end of the period 635 H / 1258 AD political Islam has caused the loss of influence in the world. Even after the fall of the Abbasid caliphate was established in the form of several dynasties and kingdoms, such as; Mughal empire in India, Safavid empire in Persia and the Ottoman Empire in Turkey. However, the establishment of the dynasty and the government is not much help because it only operates in the field of internal development of science. In fact even the emergence of dynasties that only widen the political disintegration of the Muslim world. No doubt in the last phase of the decline of the Islamic caliphate, the Ottoman Caliphate since turned into a secular country that pioneered by Mustafa Kemal. The chronic backwardness of Islam, on the other hand Europe (Western World revolutionized civilization as aukflarung renaissance, and rationalism that gives excesses of the industrial revolution in Europe. This article will discuss about the issues of reform in the Islamic world historical perspective. تسبب انهيار لسيادة العباسية في نهاية الفترة 635 ه / 1258 م الإسلام السياسي فقدان نفوذها في العالم. حتى بعد قيام سقوط الخلافة العباسية في شكل عدة السلالات والممالك، مثل: إمبراطورية المغول في الهند، الإمبراطورية الصفوية في بلاد فارس والإمبراطورية العثمانية في تركيا. ومع ذلك، وإنشاء أسرة والحكومة لا تساعد كثيرا لأنها تعمل فقط في مجال التنمية الداخلية من العلم.في الواقع حتى ظهور السلالات التي توسع فقط التفكك السياسي للعالم الإسلامي.لا شك في المرحلة الأخيرة من ضعف الخلافة الاسلامية، الخلافة العثمانية

  16. Cumhuriyet Dönemi Eğitim Politikalarının İdeolojik Temelleri Ideologic Basics Of Educational Policies In Republican Period

    Directory of Open Access Journals (Sweden)

    Ufuk ŞİMŞEK

    2012-12-01

    olgudur. Bu bağlamda Cumhuriyetin kurucu kadrosu, istenilen yeniden inşayı gerçekleştirmek için modern devletin tüm olanaklarını (eğitim, aile, hukuk, ordu, polis, iletişim, ulaşım vb. kullanmıştır. Bu araçlar içerisinde en önemli olmasa bile en kritik olan unsurlardan birisi de eğitimdir. Devleti inşa edenler, devlet ideolojisinin bireylere tam manasıyla özümsetilmesini ve bu ideolojinin meşru gösterilmesinde eğitimi bir araç olarak kullanmışlardır. Bundan dolayı mevcut yapının sistematik bir biçimde değiştirilmesi ya da yenilenmesinde eğitim unsurundan her yeni kurulmuş devlet gibi Türkiye Cumhuriyeti devleti de faydalanmıştır. Bu çalışmada, Cumhuriyet döneminde çağa uygun bir ideoloji benimsenmiş midir? Benimsenen ideolojinin içeriği nedir? sorularına cevap aranacaktır. Bu araştırmada betimsel bir yöntem benimsenmiştir. Betimsel araştırma olayların, objelerin, varlıkların, kurumların ve çeşitli alanların ne olduğunu açıklamaya çalışır (Kaptan, 1998: 59. Çalışma sonucunda, Cumhuriyetin eğitim ideolojisinin, dönemin dünyası bağlamında anlaşıldığı görülmektedir. Mustafa Kemal (Atatürk döneminde ‘Modern Batı’yı eğitimin kullanımı bağlamında ilerleme, bütünleşme, ulusçuluk, sekülerleşme ve birliği temel alan tutarlı ve pragmatik bir eğitim politikasının benimsendiği anlaşılmaktadır.

  17. Bilimsel Toplantı Duyuruları

    Directory of Open Access Journals (Sweden)

    Adli Tıp Uzmanları Derneği ATUD

    1998-08-01

    rkiye Solunum Araştırmaları Derneği İletişim: Prof. Dr. Mustafa Yaman (Tel: 0212- 5861563, Faks: 0212-5295868 / Excon Turizm, Tel-Faks: 0212-2304050 9\t1. Ulusal Tıbbi Etik Kongresi 9-11 Haziran 1999 Yer: Süleyman Demirel Kültür Merkezi, Yahyakaptan - İzmit Düzenleyen kurum: Kocaeli Üniversitesi Tıp Fakültesi İletişim: Yard. Doç. Dr. Ümit N. Gündoğmuş (Tel: 0262 - 2335482, Faks: 0262-2335488, 0262- 2335463 10\tGenel Anestezikler, Organofosfatlar ve Salon Bitkileri ile Zehirlenmeler 11-\t13 Haziran 1999 Yer: Mudanya Montania Otel-Bursa Düzenleyen: Klinik Toksikoloji Derneği İletişim: Prof. Dr. Gürayten Özyurt, Klinik Toksikoloji Derneği, Uludağ Üniv. Tıp Fakültesi, Görükle Kampüsü 16059 BURSA Tel: 0224 - 442 82 93 11\t3- Ulusal Travma ve Acil Cerrahi Kongresi (Uluslararası Katılımlı 31 Ağustos - 4 Eylül 1999 Yer: Talya Otel, Antalya Düzenleyen kurum: Travma ve Acil Cerrahi Derneği Bilimsel Sekreterlik: Doç.Dr. Cemalettin Ertekin, İ.Ü. İstanbul Tıp Fakültesi Travma ve Acil Cerrahi Birimi, Tel: 0212-5311246

  18. Book Reviews

    Directory of Open Access Journals (Sweden)

    Dieuwke Wendelaar Bonga

    1998-10-01

    Hahl, Gouverneursjahre in Neuguinea. Edited by Wilfried Wagner. Hamburg: Abera Verlag Meyer, 1997, xxxi + 230 pp. - Elly Touwen-Bouwsma, Dieuwke Wendelaar Bonga, Eight prison camps; A Dutch family in Japanese Java. Athens, Ohio: University Center for International Studies, 1996, xii + 219 pp. - Freek Colombijn, Anthony J. Whitten, The ecology of Sumatra. Yogyakarta: Gadjah Mada University Press, 1987 [First edition 1984], xxiii + 583 pp., photographs, figures, tables, index., Sengli J. Damanik, Jazanul Anwar (eds. - David Henley, Anthony J. Whitten, The ecology of Sulawesi. Yogyakarta: Gadjah Mada University Press, 1987, xxi + 777 pp., Muslimin Mustafa, Gregory S. Henderson (eds. - Peter Boomgaard, Tony Whitten, The ecology of Java and Bali. [Singapore]: Periplus Editions, 1996, xxiii + 969 pp. [The Ecology of Indonesia Series 2.], Roehayat Emon Soeriaatmadja, Surya A. Afiff (eds. - Han Knapen, Kathy MacKinnon, The ecology of Kalimantan. [Singapore]: Periplus Editions, 1996, xxiv + 802 pp., tables, figures, boxes, index. [The Ecology of Indonesia Series 3.], Gusti Hatta, Hakimah Halim (eds. - Bernice de Jong Boers, Manon Ossewiejer, Kathryn A. Monk, The ecology of Nusa Tenggara and Maluku. [Singapore]: Periplus Editions, Oxford: Oxford University Press, 1997, xvii + 966 pages, tables, figures, boxes, annexes, appendixes, index. [The Ecology of Indonesia Series 5.], Yance de Fretes, Gayatri Reksodiharjo-Lilley (eds. - Freek Colombijn, Tomas Tomascik, The ecology of the Indonesian seas [2 volumes]. Hong Kong: Periplus, 1997, xiv + vi + 1388 pp., photographs, figures, tables, indexes. [The Ecology of Indonesia Series 7-8.], Anmarie Janice Mah, Anugerah Nontji (eds.

  19. The 13th International Conference on Micro and Nanotechnology for Power Generation and Energy Conversion Applications (PowerMEMS 2013)

    Science.gov (United States)

    Mitcheson, Paul; Beeby, Steve

    2013-12-01

    Institute of Technology, USA Ryutaro Maeda, National Institute of Advanced Industrial Science and Technology, Japan Kazusuke Maenaka, University of Hyogo, Japan Paul Mitcheson, Imperial College London, UK Albert Pisano, UC San Diego, USA Susumu Sugiyama, Ritsumeikan University, Japan Yuju Suzuki, University of Tokyo, Japan Shuji Tanaka, Tohoku University, Japan Miwako Waga, Susano Berkeley LLC, Japan Peter Woias, University Freiburg IMTEK, Germany Technical Program Committee David Arnold, University of Florida, USA Seiji Aoyagi, Kansai University, Japan Skandar Basrour, Tima Laboratory, France Philippe Basset, Université Paris Est/ESIEE Paris, France Mustafa Ilker Beyaz, Antalya International University, Turkey Danick Briand, École Polytechnique Fédérale de Lausanne (EPFL), Switzerland Steve Burrow, University of Bristol, UK Luc Fréchette, University of Sherbrooke, Canada Takayuki Fujita, University of Hyogo, Japan Florian Herrault, Georgia Institute of Technology, USA Andrew Holmes, Imperial College London, UK Hanseup Kim, University of Utah, USA Seong-Hyok Kim, Georgia Institute of Technology, USA Sejin Kwon, KAIST, South Korea Carol Livermore, Northeastern University, USA Matthew McCarthy, Drexel University, USA Jae Park, Kwangwoon University, South Korea Paul Ronney, University of Southern California, USA Nico de Rooij, École Polytechnique Fédérale de Lausanne (EPFL), Switzerland Yuji Suzuki, University of Tokyo, Japan Shuji Tanaka, Tohoku University, Japan Luis Velasque-Garcia, Massachusetts Institute of Technology, USA Huib Visser, Imec Netherlands Ruud Vullers, Imec, Netherlands C Mike Waits, US Army Research Laboratory, USA Xiaohong Wang, Tsinghua University, China David Yates, Imperial College London, UK Local Organising Committee Dibin Zhu, University of Southampton, UK Alex Weddell, University of Southampton, UK Tzern Toh, Imperial College London, UK Michail Kiziroglou, Imperial College London, UK Christopher Kwan, Imperial College London, UK

  20. Osmanlı Bahriyesi’nde Yabancı Danışmanlar (1808-1918 Foreign Advisors in the Ottoman Navy (1808-1918

    Directory of Open Access Journals (Sweden)

    Yaşar BEDİRHAN

    2013-07-01

    Full Text Available The Ottoman State proved unable to adapt to the changing conditions or to grasp the emerging technological assets of Europe, partly because they had failed to overcome the political and economic problems in the XVIII. century. In July 1770, the Ottoman Navy of 26 ships was completely defeated and destroyed by a surprise attack by the Russian Navy in Çeşme in İzmir. Heeding the warning of that defeat, Sultan Mustafa III (1757-1774 decided to educate and train naval officers in contemporary techniques. Baron de Tott, a French engineer, was employed to supervise the rehabilitation efforts of the Ottoman Navy. Starting from Selim III (1789-1807 and following with Sultan Mahmud II (1808-1839, especially English technical personel were placed in Ottoman Navy. Even while the reconstruction efforts of the Ottoman Army were underway in the XIX. century, the Ottoman Navy continued to face some great disasters. The Crimean War demonstrated that the survival of the Ottoman Empire could not be preserved without a credible Navy. Sultan Abdülaziz (1861-1876 did his utmost to improve and modernize the Ottoman Navy. During the reign of Abdülhamid II, the Ottoman Navy, which was regarded as one of the most powerful navies in the world at least in terms of quantity, was deactivated and kept at the Golden Horn for 33 years.In parallel with the efforts of creating the financial resources to support the Navy, a committee under the presidency of an English sailor, Admiral Gamble, was tasked with investigating the world’s maritime innovations. This laid the foundations for the Ottoman Navy on contemporary and fundamental principles and developed a new doctrine for the education and training of its personnel. Just after the beginning of the First World War, in concert with the political inclination of the Empire, a committee from Germany was assigned to reorganize the Ottoman Navy. XVIII.yüzyılda Osmanlı Devleti kendi içerisindeki siyasi veekonomik sorunlar

  1. Tanggalkan Khalifah di Bumi Ini: Membaca Narasi Sukarno Tentang Sekularisme Turki

    Directory of Open Access Journals (Sweden)

    al makin

    2016-12-01

    الملخص: حاول هذا المقال إعادة القراءة لمقال كتبه سوكارنو في صحيفة " لواء الإسلام" سنة 1940م  تحت العنوان " لما فصلت تركيا بين الدين والدولة ". ولا يزال هذا المقال يواكب السياق الإندونيسي بما فيها من ظاهرة الأصولية والمحافظة على التراث، ومن مطالباتها إقامة الخلافة والرد على الديموقراطية الحرّة. ردّ سوكارنو منذ بضع وخمسين سنة نظام الخلافة القديمة. رأى سوكارنو هذا في قضية مصطفى كمال أتترك الذي قضى على الخلافة وأقام الديموقراطية في تركيا، وقال " إن فصل الدين عن الدولة " أمر لازم لتقدّم كلّ منهما. و بالاضافة ذكر تاريخ الخلافة أنها كنظام تمزيجي –كنظام الدولة- بقيم من اليونان والروم حيث أن الدين أداة لشرعية القوة السياسية لهؤلاء الامبراطور . يظهر من هذا، أن حجة سوكارنو عن الإسلام والتاريخ والسياسة يمكن أن تكون أسسا لمن أراد معرفة الارتباط بين الدين والدولة.   Abstrak: Artikel ini membaca kembali tulisan Sukarno yang berjudul “Apa Sebab Turki Memisah Agama Dan Negara” terbit di Panji Islam, 1940, yang tetap relevan dalam konteks Indonesia yang saat ini menyaksikan penguatan radikalisasi dan konservatisme, diantara tuntutannya adalah penegakan khalifah dan penolakan demokrasi bebas. Lebih dari lima puluh tahun yang lalu Sukarno menolak sistem khalifah yang kuno. Sukarno melihat ini dalam kasus Turki dengan Mustafa Kemal Ataturk yang membubarkan khalifah dan menegakkan demokrasi di sana. Bagi Sukarno pemisahan agama dan negara merupakan keniscayaan untuk kemajuan

  2. Closing Remarks of the Workshop OnGlobal University System & E-Learning

    Directory of Open Access Journals (Sweden)

    Ali YAIZCI

    2007-01-01

    Research & Development. He started his speech by reviewing the trends of the 21st Century in accordance with the technology and education. The shift of technology from analog to digital; change of the culture, commerce and life style from local to global; and the emergence of new knowledge as a result of human’s creativity as opposed to obedience in the past were emphasized. As a result of this shift, it was mentioned that yesterday’s industrial society turned to be a modern knowledge society and innovation was the obvious result of “freedom of thought” and “independent thinking”. He mentioned 3B’s (Bed-Bus-Bathroom as usual places to start innovative ideas. He also talked about the creativity process and described 3T’s of it as being “talent”, “technology” and “tolerance”. In the second part of his speech, Professor Utsumi described the so called Global University System (GUS. It is a worldwide consortium to eradicate poverty and isolation in the world by offering a world wide learning network to the isolated parts of the world. Its ultimate aim is to offer a GUS degree that would be recognized all over the world. He explained two of the approaches put into action, GLOBAL GRID Network and GLOBAL LECTURE HALL systems, to realize GUS. He emphasized the importance of Optical Fiber Networks. At the end of his speech, he talked about the African Consortium GLORIAD, and added that a similar infrastructure can be established in Turkey by starting GUS working Groups within the country. He also pointed about various financial aid programs by the Japanese Government and others to support GUS related projects.The third talk was presented by Dr. Cengiz Ultav of Vestel Company. He gave an over all view of his company and its research and development efforts. He stated that, Vestel, being a major export company of household products and digital equipment in Turkey, is already part of globalization efforts and will continue his support to research in e

  3. EDITORIAL: Focus on Micro- and Nanofluidics FOCUS ON MICRO- AND NANOFLUIDICS

    Science.gov (United States)

    Ajdari, Armand; Stone, Howard A.

    2009-07-01

    -aspect-ratio microchannels Aman Russom, Amit K Gupta, Sunitha Nagrath, Dino Di Carlo, Jon F Edd and Mehmet Toner Capillary instability on a hydrophilic stripe Raymond L Speth and Eric Lauga Universal nanocolloid deposition patterns: can you see the harmonics of a Taylor cone? Xinguang Cheng and Hsueh-Chia Chang Osmotic manipulation of particles for microfluidic applications B Abécassis, C Cottin-Bizonne, C Ybert, A Ajdari and L Bocquet Scaling the drop size in coflow experiments E Castro-Hernández, V Gundabala, A Fernández-Nieves and J M Gordillo Pattern formation during the evaporation of a colloidal nanoliter drop: a numerical and experimental study Rajneesh Bhardwaj, Xiaohua Fang and Daniel Attinger Topology and shape optimization of induced-charge electro-osmotic micropumps M M Gregersen, F Okkels, M Z Bazant and H Bruus Fabrication of multiphasic and regio-specifically functionalized PRINT® particles of controlled size and shape H Zhang, J K Nunes, S E A Gratton, K P Herlihy, P D Pohlhaus and J M DeSimone Using TIRF microscopy to quantify and confirm efficient mass transfer at the substrate surface of the chemistrode Delai Chen, Wenbin Du and Rustem F Ismagilov Nonlinear electrokinetics at large voltages Martin Z Bazant, Mustafa Sabri Kilic, Brian D Storey and Armand Ajdari Interdiffusion of liquids of different viscosities in a microchannel J Dambrine, B Géraud and J-B Salmon Microfluidic fabrication of microparticles with structural complexity using photocurable emulsion droplets Shin-Hyun Kim, Jae Won Shim, Jong-Min Lim, Su Yeon Lee and Seung-Man Yang

  4. EDITORIAL: Plasmas and plasmons: links in nanosilver Plasmas and plasmons: links in nanosilver

    Science.gov (United States)

    Demming, Anna

    2013-03-01

    relationship between plasma electrochemical synthesis and the plasmonic properties of nanoparticles have been limited until now. Yet Kostya Ostrikov and colleagues place particular emphasis on the potential of research at 'the intersection of reactive plasma chemistry and plasmonics'. While navigating the maze of intertwining disciplines that feed into nanotechnology research can be daunting, as this research highlights, great insights and advances may be gained where the different strands of research connect. References [1] Huang X Z, Zhong X X, Lu Y, Li Y S, Rider A E, Furman S A and Ostrikov K 2013 Plasmonic Ag nanoparticles via environment-benign atmospheric microplasma electrochemistry Nanotechnology 24 095604 [2] Sun Y and Xia Y 2002 Shape-controlled synthesis of gold and silver nanoparticles Science 298 2176-9 [3] Hulteen J C, Treichel D A, Smith M T, Duval M L, Jensen T R and Van Duyne R P 1999 Nanosphere lithography: size-tunable silver nanoparticle and surface cluster arrays J. Phys. Chem. B 103 3854-63 [4] Huang J et al 2007 Biosynthesis of silver and gold nanoparticles by novel sundried Cinnamomum camphora leaf Nanotechnology 18 105104 [5] Ma K, Cui Q, Liu G, Wu F, Xu S and Shao Y 2011 DNA abasic site-directed formation of fluorescent silver nanoclusters for selective nucleobase recognition Nanotechnology 22 305502 [6] Ali M E, Hashim U, Mustafa S, Che Man Y B, Yusop M H M, Bari M F, Islam Kh N and Hasan M F 2011 Nanoparticle sensor for label free detection of swine DNA in mixed biological samples Nanotechnology 22 195503 [7] Berini P, Olivieri A and Chen C 2012 Thin Au surface plasmon waveguide Schottky detectors on p-Si Nanotechnology 23 444011 [8] Reilly T H III, Van De Lagemaat J, Tenent R C, Morfa A J and Rowlen K L 2008 Surface-plasmon enhanced transparent electrodes in organic photovoltaics Appl. Phys. Lett. 92 243304 [9] Bialiayeu A, Bottomley A, Prezgot D, Ianoul A and Albert J 2012 Plasmon-enhanced refractometry using silver nanowire coatings on tilted

  5. Kongre İzlenimleri

    Directory of Open Access Journals (Sweden)

    Yasemin Balcı

    2007-12-01

    İstanbul Üniversitesi Yard. Doç. Dr Hülya Yükseloğlu, Phd. İstanbul Üniversitesi Araştırma Gör. Şebnem Özcan İstanbul Üniversitesi Doktora Öğr. Itır Tan İstanbul Üniversitesi Prof. Dr. Ümit Biçer Kocaeli Üniversitesi Prof. Dr. Kemalettin Acar Pamukkale Üniversitesi Güney Ersoy ATUD (2 yaşındaki en küçük katılımcımız, Özlem & Gökhan çiftinin oğlu Sözlü Bildiriler 1-\tEffects of ambulance craches on transporting patient’s death. E. Özlem, E. Gökhan, AE. Ülker, K. Gülay, E. Süheyla, Y. Özlem 2-\tEvaluation of deaths after immunization. E. Gökhan, Y. Özlem, T. Sad, B. Ersin 3-\tThe importance of measuring intraocular pressure (IOP using a tonometer in order to estimate the post-mortem interval. Y. Balcı, H. Başmak, B. Kenan Kocatürk, A. Şahin, K. Özdamar 4-\tNatural childhood and adolescant deaths in medicolegal autopsy cases in Adana- Turkey. GM. Korkut, M. Demet, A. Ramazan, Ç. Nemci, H. Ahmet 5-\tSudden cardiac death and Glycoprotein iib/iia polymorphism. P. Öncü, P. Danae,, Y. Kocias, KF. Elena, E. Abacı Kalfaoğlu, M. Panagiotis, S. Atasoy, M. Emmanuel 6-\tWhat about the forensic toxicology in Adana-Tur-key. B. Dilek, GM. Korkut, D. Nebile, H. Abmet. 7-\tThe significance of the prolanged hungers in forensic medicine. N. Küçükçallı, Ü. Biçer, C. Yorulmaz, Ö. Özkalıpçı Poster Bildirileri T Intrafamilier violence cases of Pamukkale University, School of Medicine, Department of Forensic Medicine between May 2003-July 2004. B. Boz, K. Acar, A. Kurtuluş 2-\tThe use of cannines in forensics: a Turkey perspective. S. Şebnem Özcan, H. Akın, H. Bayram, M. Baş, A. Yıldız, A. Özdemiroğlu 3-\tCrime Scene investigation in Adana-Turkey-“An analyses for yesterday, today and tomorrow. MK. Gülmen, H. Kaygısız, B. Gönültaş, D. Meral, R. Akcan 4-\tAllele frequencies for 15 STR loci of Çukurova Region from Turkey: Preliminary study. C. Hüsniye, S. Ayşe, A. Behnan 5-\tFemale homicide victimization

  6. Fnom Editor

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2006-01-01

    project, Socrates programmes, the Common European Framework for Languages and the European Language Portfolio. The paper discusses the role of electronic learning in in-service training in both ongoing and one-shot teacher training programmes. This article should be evaluated fort he responsibiliyt of distance education function and advntage for givin en education to the teacher for new curriculumn understnding and application fort o integrated EU EFL teacher training in due course. And, the fifteenth as the latest article which is from United Kingdom which was titled as “Theories of Learning and Their Implications for On-Line Assessment”, written By Anthony Francis UNDERHILL, BA MA Cert. Ed ILTM, University of Central England, Birmingham. This paper briefly reviews the theories of learning and their relationship with traditional forms of assessment and seeks to argue for the need to further develop online assessment tools to further facilitate the growth in process based learning activities such as collaborative and cooperative group work consistent with a socio-constructivist pedagogy. Four book reviews were on “Authentic Learning Environments in Higher Education”, edited by Edited by Anthony Herrington and Jan Herrington and, published by Information Science Publishing in 2005. Other one is “Online Assessment, Measurement and Evaluation Case Studies from Higher Education, K-12 and Corporate”, “Online assessment, measurement and evaluation”. These three books reviewed by Dr. Adnan BOYACI, Anadolu University, Eskisehir-TURKEY. And “Global Peace through the Global University System”, edited by Edited by Tapio Varis, Takeshi Utsumi, William Klemm, 2003, published Research Centre for Vocational Education (RCVE and reviewed by Reviewed by Dr. Cengiz Hakan AYDIN, Anadolu University, and Eskisehir-TURKEY. Reviewer Dr. Boyaci indicates in his review that “Authentic learning has been growing in importance and popularity as a learning approach for last

  7. From Editor

    Directory of Open Access Journals (Sweden)

    Ugur DEMIRAY

    2012-07-01

    acceptance and WPCK towards WBI. As a result of the research, behavioral and contextual beliefs in WBI beliefs were medium level. The 4th article from Turkey, Anadolu Univesity. Suzan DUYGU ERIŞTI has written on A Multi-Cultural Interaction Through Video Conferencing In Primary Schools. Her study investigated Turkish and Canadian primary school students’ ways of expressing their perception of cultural understanding through video conferencing and that of cultural interaction through video conferencing. Most of the students indicated that videoconferencing encouraged them to learn and understand about different cultures, helped them develop cultural awareness, attracted their attention and increased their motivation.The 5th article is join(bu kelimeden emin değilim joint olabilir! study from Bengaldesh and India. It is titled as “Teaching English Through Open Non-Formal Education (Onfe in Bangladesh With An Effective Integration of ICT To Support Learning”, written by Mizanoor RAHMAN, Bengaldesh and Santosh PANDA from India. They analyzed the program which is entitled “English in Action (EIA”, 9 year period DFID funded project in Bangladesh, was launched in 2008, for the desire to bring a change in the learning of English language. EIA works to reach a total of 25 million primary and secondary students and adult learners through communicative language learning techniques and the use of ICT, textbooks and supplementary materials in an innovative way. The 6th article is experienced as PhD research and summarized for TOJDE by Serpil KOCDAR and Cengiz Hakan AYDIN from Anadolu University Faculty of Open Education, TURKEY, conducted on “Accreditation of Open And Distance Learning: A Framework for Turkey”. The purpose of this study is to develop a framework for the accreditation of higher open and distance learning (ODL programs in Turkey. The 7th article is from Spain and entitled as “Critical Reading of Research Articles As Oral Activator In The Language Class

  8. From the Editor

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2005-09-01

    changes in teaching and course structure cannot be made with summative evaluations. Formative evaluations in online education can result in candid responses from students if a third-party facilitator is involved in the process” Second article is from Mustafa Koc. He is Turkish but he is studying in USA as doctorate candidate. His subject is dealing with “Individual Learner Differences in Web-based Learning Environments: From Cognitive, Affective and Social-cultural Perspectives”. He points out in his article that “….individual differences in web-based learning, also known as online instruction, online training or distance education were examined and implications for designing distance education” for discussing in the field. It is really good article for contemporary discussion for me and for our readers. And than third article is about “Media in Distance Learning: The Nigerian National Teachers Institute Distance Education Programme” which is written by Mudasiru Olalere YUSUF (Ph.D and Ayotunde Atanda FALADE from Department of Curriculum Studies and Educational Technology, Faculty of Education University of Ilorin, of Nigeria. They mentioned in their article that “…investigated the use of media by distance learners enrolled in the NTI distance education programme. Two hundred and fifty five distance learners drawn from Oyo State, Nigeria, completed a questionnaire to determine the use of media, and factors militating against their effective use by distance learners”. The results are very interesting. The fourth article is dealt with “Analyzing E-mail communication of prospective learners”, by Dr. Vibha and Anurag, from India. In this article; Vibha and Anurag mentioned their thoughts that computer has replaced all means of communication significantly. E-mail is the most popular means of communication through computers. It has vanished the boundaries between the cities, countries and continents. So, their study tries to analyze the e

  9. Bilimsel Toplantı Duyuruları

    Directory of Open Access Journals (Sweden)

    Adli Tıp Uzmanları Derneği ATUD

    1999-04-01

    -SAMSUN Tel:0-362- 457 60 93 9\t3- Travma ve Acil Cerrahi Kongresi 31 Ağustos - 4 Eylül 1999 Talya Otel-Antalya, İletişim: Prof. Dr. Mehmet Kurtoğlu, Travma ve Acil Cerrahi Derneği Millet Cad. Aydın Apt. No.131/10 Çapa 34390 İSTANBUL Tel: 0-212- 531 12 46 10\tV. Estetik Plastik Cerrahi Kongresi ve II. Estetik Cerrahi Eğitim Kursu 1-4 Eylül 1999, Hacettepe Üniv. Tıp Fakültesi Merkez Kampüs Salonları-Ankara İletişim:Estetik Plastik Cerrahi Derneği, Prof. Dr. Erdem Yormuk, Tunalı Hilmi Cad. No. 105/2 06700 Kavaklıdere-ANKARA Tel:426 31 31 11\t6. Ulusal Halk Sağlığı Günleri-Türkiye’de 2000’e Doğru Bulaşıcı Hastalıklar Sorunu 1-4 Eylül 1999, Malatya, İnönü Üniv. Tıp Fakültesi Halk Sağlığı AD. İletişim: Doç. Dr. Erkan Pehlivan, İnönü Üniv. Tıp Fakültesi Dahili Tıp Bilimleri Bölümü Halk Sağlığı AD.-MALATYA Tel: 0-422-341 00 36 12\tDermatopathology in Anatolia: IIIrd Regional Clinicopathological Colloquim & IInd Platform on the Progress of Dermatology and Dermatopathology in Middle- Eastern, Balkanian and Caucasian Countries 3-6 Eylül 1999, Adora Golf Resort Hotel -Antalya İletişim: Dermatopatoloji Derneği. Prof. Dr. Cengizhan Erdem, A. Ü. T. F.Dermatoloji AD. Tel: 324 57 24 13\t35-Ulusal Psikiyatri Kongresi ve Uluslararası Kros-Kültürel Psikiyatri Uydu Sempozyumu 6-12 Eylül 1999, Karadeniz Teknik Üniversitesi Atatürk Kültür Merkezi-Trabzon İletişim: Türkiye Psikiyatri Derneği, Yıd. Doç. Dr. Mustafa Bilici, Karadeniz Teknik Üniv. Tıp Fakültesi Psikiyatri AD.Trabzon Tel:0-462-325 8011/5495 14\t4th International Symposium Advances in Legal Medicine (ISALM 22-25 September 1999 Information: Congress Secreteıiat, Isalm 1999, Institute of Legal Medicine, Am Pulverturm 3, D-55131 Mainz, Germany Tel: + 49 6131 177387 Fax:+ 49 6131 393183 Http://www. uni-mainz./DE/FB/ Medizin/ Rechtsmedizin /Isalm 15\tXVII. Çocuk Cerrahisi Kongresi 26-\t30 Eylül 1999, Limra Otel-Kemer-Antalya, Türkiye İletişim:

  10. Selected Abstracts of the 2nd Congress of joint European Neonatal Societies (jENS 2017; Venice (Italy; October 31-November 4, 2017; Session "Neurology and Follow-up"

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2017-10-01

    EXTRAUTERINE GROWTH OF THE CEREBELLUM • A.I. Toma, I. Cuzino, A. Cozinov, R.G. OlteanuABS 63. CAN DIFFERENCES IN EARLY FUNCTIONAL CONNECTIVITY IN HEALTHY NEWBORNS EXPOSED TO OLFACTORY STIMULATION HELP US UNDERSTAND CRYING BEHAVIOUR AT 6 WEEKS OF LIFE? • L. Freitas, A. Adam-Darque, F. Grouiller, J. Sauser, F. Lazeyras, P. Pollien, C.L. Garcia-Rodenas, G. Bergonzelli Degonda, D. Van De Ville, P. Hüppi, R. Ha-Vinh LeuchterABS 64. LESS INVASIVE SURFACTANT ADMINISTRA­TION (LISA NOT ONLY IMPROVES MORTALITY AND MORBIDITY BUT ALSO NEURO­DEVELOP­MENTAL OUTCOME OF PRETERM INFANTS • K. Klebermass-Schrehof, A. Grill, M. Hayde, N. Haiden, A. Flunt, R. Fuiko, S. Brandstetter, A. BergerABS 65. REDUCED PREVALENCE OF SEVERE INTRA­VENTRICULAR HEMORRHAGE IN VERY PRE­TERM INFANTS DELIVERED AFTER MATERNAL PREECLAMPSIA • E. Morsing, K. Maršál, D. LeyABS 66. COGNITIVE STABILITY IN CHILDREN WITH CONGENITAL HEART DISEASE • N. Naef, C. Schaefer, V. Rousson, R. Liamlahi, S. Polentarutti, I. Beck, V. Bernet, H. Dave, W. Knirsch, B. LatalABS 67. PERIPHERAL T CELL DEPLETION BY FINGOLI­MOD IS ASSOCIATED WITH EXACERBATED HYPOXIC-ISCHEMIC BRAIN INJURY IN NEO­NATAL MICE • I. Bendix, M. Crasmöller, C. Köster, M. Serdar, U. Felderhoff-Müser, J. HerzABS 68. DIFFERENTIATING THE PRETERM PHENO­TYPE: DISTINCT PROFILES OF DEVELOP­MENT AF­TER LATE AND MODERATELY PRETERM BIRTH • S. Johnson, G. Waheed, B.N. Manktelow, D. Field, N. Marlow, E.S. Draper, E.M. BoyleABS 69. NEONATAL NEUROIMAGING IN SYMPTOMATIC CONGENITAL CMV (cCMV AND ITS CORRELATION WITH OUTCOME: EMPHASIS ON WHITE MATTER DISEASE • A. Alarcon, A. Garcia-Alix, M. Martinez-Biarge, I. van Straaten, F. Cabañas, J. Quero, L. de VriesABS 70. INTRANASALLY APPLIED MESENCHYMAL STEM CELLS MIGRATE TO INJURED BRAIN REGIONS OF NEWBORN NON-HUMAN PRIMATES • N. Wagenaar, F. van Bel, M. Benders, C. Blanco, D. McCurmin, S. Mustafa, F. Groenendaal, L. de Vries, C. Heijnen, C. NijboerABS 71. EARLY CRANIAL ULTRASOUND AND MRI AT TERM IN VERY

  11. From Editor

    Directory of Open Access Journals (Sweden)

    Ugur Demiray

    2013-07-01

    interviews. Frequencies and percentages were used to analyze the categorical data. Moreover, the qualitative data was analyzed via content analysis. According to the findings of the study, students needed to get support about education directives, career guidance, technical equipment, and personal problems. In this issue we published two book reviews. The first issue on “UNIVERSITY TEACHING IN FOCUS:A Learning-centred Approach” which is edited by Lynne HUNT and Denise CHALMERS and reviewed by S. K. PULIST from india. He empasises about the book that The book as the name depicts, focuses on different aspects of university teaching from learner-centred point of view. A wise range of issues has been highlighted and properly addressed by the authors in a very diligent manner. It will help the teachers in constructively engaging the students in effective learning. It is a step forward towards empowering the upcoming teachers with necessary strategies and stand point so that they are able to help the students in enhancing their quality learning. The book would be helpful not only to the novice teachers who have just stepped in the teaching profession but also other stakeholders of higher education system. 2nd book review is on “TRENDS AND ISSUES IN DISTANCE EDUCATION: International Perspectives, Second Edition”, edited by Lya Visser, Yusra Visser, Ray Amirault & Michael Simonson and Reviewed by Dr. Dilek ALTUNAY from Mustafa Kemal University, Hatay, TURKEY. She mentioned about the book that this book makes a contribution to the field of distance education by offering a comprehensive overview and analysis of the current trends and issues in distance education. In addition, the book is well-organized and coherent in terms of presentation. The reader is guided by section editors who provides introduction to the section and an overview of the chapters in the section, which makes the book reader-friendly. To receive further information and to send your recommendations and

  12. Selected Abstracts of the 2nd Congress of joint European Neonatal Societies (jENS 2017; Venice (Italy; October 31-November 4, 2017; Session "Neonatal Pulmonology, Neonatal Respiratory Support, Resuscitation"

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2017-10-01

    , P. Amess, N. Aiton, N. Bhat, R. Bomont, N. Drenchev, C. Garland, C. Lawn, B. Reulecke, R. Watkins, R. FernandezABS 56. THE COMPARISON OF HEATED HUMIDIFIED HIGH-FLOW NASAL CANNULA VERSUS NASAL CONTINUOUS POSITIVE AIRWAY PRESSURE FOR RESPIRATORY SUPPORT IN NICU • K.Y. Chao, C.E. Chiang, Y.L. Chen, L.Y. Tsai, Y.H. Chien, S.C. MuABS 57. COMPARISON BETWEEN OUTCOMES OF MINIMALLY INVASIVE TECHNIQUE AND IN­TUBATION SURFACTANT EXTUBATION IN PRE­TERM INFANTS LESS THAN 1,500 GRAMS IN A DEVELOPING COUNTRY • W.A. Gonçalves-Ferri, P. Paiva, L. Scalioni, E. Sacramento, C. Calixto, A.C. Hallak, D.C. AragonABS 58. PREMATURE INFANTS WITH VERY LOW WEIGHT WITH APNEA HAVE POOR RESULTS DESPITE TREATMENT • A.B. Gonçalves, M.M. Lourenço, L. Scacioli, E. Sacramento, C. Calixto, D.C. Aragon, W.A. Gonçalves-FerriABS 59. BOCHDALEK HERNIA WITH INTRATHORACIC KIDNEY ASSOCIATED WITH AORTIC COARC­TATION • B. Skenderi Mustafa, H. Ismaili, F. Kajtazi, G. Hazbahta, F. KrasniqiABS 60. INHALED NITRIC OXIDE IN CONGENITAL DIAPHRAGMATIC HERNIA – RESULTS FROM THE EUROPEAN INHALED NITRIC OXIDE REGISTRY • R. Kettle, N.V. SubhedarABS 61. EARLY HIGH FREQUENCY VENTILATION – A PROMISE OF PROTECTIVE VENTILATION? • W.A. Gonçalves-Ferri, M. Bertoldi, A.B. Gonçalves, E. Sacramento, C. Calixto, D.C. AragonABS 62. INHALED NITRIC OXIDE AND PRETERMS: DOOM, GLOOM OR RIGHT? 11 YEARS’ EX­PERIENCE AT TERTIARY CENTRE • E. Syrimi, H. Warwick, P. Satodia, P. NathABS 63. IS APGAR SCORE A PREDICTOR OF SEVERITY IN PRETERM INFANTS? • W.A. Gonçalves-Ferri, P.P. Paiva, A.B. Gouvea, E. Sacramento, C. Calixto, D.C. AragonABS 64. CURRENT PRACTICE OF NEURALLY AD­JUSTED VENTILATOR ASSIST IN THE NEONATAL INTENSIVE CARE UNIT: A TAIWAN SURVEY • C.E. Chiang, Y.L. Chen, L.Y. Tsai, Y.H. Chien, S.C. Mu, K.Y. ChaoABS 65. LUNG ULTRASOUND FOR THE DIAGNOSIS OF PULMONARY CONSOLIDATIONS IN PATIENTS WITH BRONCHOPULMONARY DYSPLASIA • I. Koltunov, M. Degtyareva, A. Mazaev, A. Gorbunov, A. ErokhinaABS 66. NON