WorldWideScience

Sample records for cellulolytic actinomycetethermobifida fusca

  1. Genome Sequence and Analysis of the Soil Cellulolytic ActinomyceteThermobifida fusca

    Energy Technology Data Exchange (ETDEWEB)

    Lykidis, Athanasios; Mavromatis, Konstantinos; Ivanova, Natalia; Anderson, Iain; Land, Miriam; DiBartolo, Genevieve; Martinez, Michele; Lapidus, Alla; Lucas, Susan; Copeland, Alex; Richardson, Paul; Wilson,David B.; Kyrpides, Nikos

    2007-02-01

    Thermobifida fusca is a moderately thermophilic soilbacterium that belongs to Actinobacteria. 3 It is a major degrader ofplant cell walls and has been used as a model organism for the study of 4secreted, thermostable cellulases. The complete genome sequence showedthat T. fusca has a 5 single circular chromosome of 3642249 bp predictedto encode 3117 proteins and 65 RNA6 species with a coding densityof 85percent. Genome analysis revealed the existence of 29 putative 7glycoside hydrolases in addition to the previously identified cellulasesand xylanases. The 8 glycosyl hydrolases include enzymes predicted toexhibit mainly dextran/starch and xylan 9 degrading functions. T. fuscapossesses two protein secretion systems: the sec general secretion 10system and the twin-arginine translocation system. Several of thesecreted cellulases have 11 sequence signatures indicating theirsecretion may be mediated by the twin-arginine12 translocation system. T.fusca has extensive transport systems for import of carbohydrates 13coupled to transcriptional regulators controlling the expression of thetransporters and14 glycosylhydrolases. In addition to providing anoverview of the physiology of a soil 15 actinomycete, this study presentsinsights on the transcriptional regulation and secretion of16 cellulaseswhich may facilitate the industrial exploitation of thesesystems.

  2. Hydrophobic nature and effects of culture conditions on biofilm formation by the cellulolytic actinomycete Thermobifida fusca

    Directory of Open Access Journals (Sweden)

    Almaris N. Alonso

    2015-09-01

    Full Text Available Thermobifida fusca produces a firmly attached biofilm on nutritive and non-nutritive surfaces, such as cellulose, glass, plastic, metal and Teflon®. The ability to bind to surfaces has been suggested as a competitive advantage for microbes in soil environments. Results of previous investigations indicated that a Gram-positive cellulolytic soil bacteria, Cellulomonas uda, a facultative aerobe, specifically adhered to nutritive surfaces forming biofilms, but cells did not colonize non-nutritive surfaces. Cell surface hydrophobicity has been implicated in the interactions between bacteria and the adhesion to surfaces. It was recently described that the cellulolytic actinomycete T. fusca cells hydrophobicity was measured and compared to the cellulolytic soil bacteria C. uda. Also, T. fusca biofilm formation on non-nutritive surface, such as polyvinyl chloride, was examined by testing various culture ingredients to determine a possible trigger mechanism for biofilm formation. Experimental results showed that partitioning of bacterial cells to various hydrocarbons was higher in T. fusca cells than in C. uda. The results of this study suggest that the attachment to multiple surfaces by T. fusca could depend on nutrient availability, pH, salt concentrations, and the higher hydrophobic nature of bacterial cells. Possibly, these characteristics may confer T. fusca a selective advantage to compete and survive among the many environments it thrives.

  3. Characterization of a chitinase from the cellulolytic actinomycete Thermobifida fusca.

    Science.gov (United States)

    Gaber, Yasser; Mekasha, Sophanit; Vaaje-Kolstad, Gustav; Eijsink, Vincent G H; Fraaije, Marco W

    2016-09-01

    Thermobifida fusca is a well-known cellulose-degrading actinomycete, which produces various glycoside hydrolases for this purpose. However, despite the presence of putative chitinase genes in its genome, T. fusca has not been reported to grow on chitin as sole carbon source. In this study, a gene encoding a putative membrane-anchored GH18 chitinase (Tfu0868) from T. fusca has been cloned and overexpressed in Escherichia coli. The protein was produced as SUMO fusion protein and, upon removal of the SUMO domain, soluble pure TfChi18A was obtained with yields typically amounting to 150mg per litre of culture. The enzyme was found to be relatively thermostable (apparent Tm=57.5°C) but not particularly thermoactive, the optimum temperature being 40-45°C. TfChi18A bound to α- and β-chitin and degraded both these substrates. Interestingly, activity towards colloidal chitin was minimal and in this case, substrate inhibition was observed. TfChi18A also cleaved soluble chito-oligosaccharides and showed a clear preference for substrates having five sugars or more. While these results show that TfChi18A is a catalytically competent GH18 chitinase, the observed catalytic rates were low compared to those of well-studied GH18 chitinases. This suggests that TfChi18A is not a true chitinase and not likely to endow T. fusca with the ability to grow on chitin. PMID:27108953

  4. Regulation of Biosynthesis of Individual Cellulases in Thermomonospora fusca

    OpenAIRE

    Spiridonov, Nikolay A.; Wilson, David B.

    1998-01-01

    Regulation of the biosynthesis of the six cellulases comprising the cellulolytic system of the thermophilic soil bacterium Thermomonospora fusca ER1 was studied. The levels of the individual enzymes produced on different noninducing and inducing carbon sources were determined. The lowest level of cellulase synthesis (3 nM) was observed with xylose as a carbon source, and the highest level (247 to 1,670 nM for different enzymes) was found in cultures grown on microcrystalline cellulose. Endoce...

  5. Gut microbiota of Busseola fusca (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Snyman, Maxi; Gupta, Arvind Kumar; Bezuidenhout, Cornelius Carlos; Claassens, Sarina; van den Berg, Johnnie

    2016-07-01

    Busseola fusca (Fuller) (Lepidoptera: Noctuidae) is a stemborer pest that attacks maize (Zea mays) throughout sub-Saharan Africa. Genetically modified maize has been shown to be effective against B. fusca. However, resistance of B. fusca against Bt-maize has developed and spread throughout South Africa. Previous studies suggested that gut microbiota contribute to mortality across a range of Lepidoptera. To fully assess the role of microbiota within the gut, it is essential to understand the microbiota harboured by natural B. fusca populations. This study aimed to identify the gut-associated bacteria by 16S rRNA gene sequencing. A total of 78 bacterial strains were characterised from the midgut of B. fusca larvae that were collected from 30 sites across the maize producing region of South Africa. Molecular phylogenetic analyses revealed bacteria affiliated to Proteobacteria, Actinobacteria, and Firmicutes. Taxonomic distribution placed these isolates into 15 different genera representing 20 species. The majority of bacteria identified belong to the genera Bacillus, Enterococcus, and Klebsiella. The B. fusca gut represents an intriguing and unexplored niche for analysing microbial ecology. The study could provide opportunities for developing new targets for pest management and contribute to understanding the phenomenon of resistance evolution of this species. PMID:27263010

  6. Isolation of Cellulolytic Actinomycetes from Marine Sediments

    OpenAIRE

    Veiga, Manuel; Esparis, Azucena; Fabregas, Jaime

    1983-01-01

    The cellulolytic activity of 36 actinomycetes strains isolated from marine sediments was investigated by the cellulose-azure method. Approximately 50% of the isolates exhibited various degrees of cellulolytic activity.

  7. Polypeptide from a cellulolytic fungus having cellulolytic enhancing activity

    Science.gov (United States)

    Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

    2008-04-22

    The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

  8. Technetium uptake by the green alga Chlorella fusca

    International Nuclear Information System (INIS)

    Astonishingly very small transfer factor of 0.16 ± 0.07 (Bq g-1 fresh algae: Bq ml-1 solution) was found for the uptake of TcO4- by the green alga Chlorella fusca. No dependency of the technetium concentration was observed. These results are in accordance with most other reported values for green algae. (author) 8 refs

  9. CORN FIBER HYDROLYSIS BY THERMOBIFIDA FUSCA EXTRACELLULAR ENZYMES

    Science.gov (United States)

    Thermobifida fusca was grown on cellulose (Solka-Flok), xylan, or corn fiber, and the supernatant extracellular enzymes were concentrated. SDS gels showed markedly different protein patterns for the three different carbon sources. Activity assays on a variety of synthetic and natural substrates sh...

  10. Short-chain aliphatic ester synthesis using Thermobifida fusca cutinase.

    Science.gov (United States)

    Su, Lingqia; Hong, Ruoyu; Guo, Xiaojie; Wu, Jing; Xia, Yongmei

    2016-09-01

    Short-chain aliphatic esters are commonly used as fruit flavorings in the food industry. In this study, Thermobifida fusca (T. fusca) cutinase was used for the synthesis of aliphatic esters, and the maximum yield of ethyl caproate reached 99.2% at a cutinase concentration of 50U/ml, 40°C, and water content of 0.5%, representing the highest ester yield to date. The cutinase-catalyzed esterification displayed strong tolerance for water content (up to 8%) and acid concentration (up to 0.8M). At substrate concentrations ⩽0.8M, the ester yield remained above 80%. Moreover, ester yields of more than 98% and 95% were achieved for acids of C3-C8 and alcohols of C1-C6, respectively, indicating extensive chain length selectivity of the cutinase. These results demonstrate the superior ability of T. fusca cutinase to catalyze the synthesis of short-chain esters. This study provides the basis for industrial production of short-chain esters using T. fusca cutinase. PMID:27041308

  11. EXTRACELLULAR CELLULOLYTIC COMPLEXES PRODUCTION BY MICROSCOPIC FUNGI

    Directory of Open Access Journals (Sweden)

    S. O. Syrchin

    2015-10-01

    Full Text Available The aim of this work was to screen and to study the effect of inducers on the synthesis of the cellulolytic enzyme complexes by microscopic fungi. Cellulolytic and xylanolytic activities were determined by reducing sugar with DNS reagent, and β-glucosidase activity by pNPG hydrolysis. The enzyme preparations were obtained by ammonium sulphate precipitation. Among 32 studied strains of microscopic fungi 14 produced cellulo- and xylanolytic enzyme complexes. Fusarium sp. 5 and Fennellia sp. 2806 demonstrated the highest levels of all studied enzyme activities. Enzyme preparations with high endo-, exoglucanase, xylanase and β-glucosidase activities were obtained from these strains. Fusarium sp. 5 and Fennellia sp. 2806 were active producers of cellulase enzyme complexes during growth on natural substrates. It was shown that inductors of cellulolytic enzymes in Fusarium sp. 5 and Fennellia sp. 2806 differed from the ones in Trichoderma reesei.

  12. Acid hydrolysis of kallar grass (leptochloa fusca) for the production

    International Nuclear Information System (INIS)

    Acid hydrolysis of kallar grass (leptochloa fusca) was carried of with various concentrations of sulphuric acid, ortho phosphoric acid and hydrochloric acid to produce furfural. The study revealed that activity of various hydrolysing acids to produce furfural from kallar grass was of the following order H/sub 2/SO/sub 4/ > H/sub 3/PO/sub 4/ > HCl. Optimum yield (4.78%) of the produce was obtained when the material was digested with 19% H/sub 2/SO/sub 4/ for a period of 20 minutes. (author)

  13. Effect of mycoparasitic fungi on the development of Sphaerotheca fusca in melon leaves.

    Science.gov (United States)

    Romero, Diego; Rivera, M Eugenia; Cazorla, Francisco M; de Vicente, Antonio; Pérez-García, Alejandro

    2003-01-01

    We evaluated the possibilities of exploitation of several mycoparasitic fungi in the biocontrol of cucurbit powdery mildew (Sphaerotheca fusca) in melon greenhouses. To simplify the screening, an in vitro biological control test on detached leaves of melon has been used and a detailed microscopic analysis of the interactions between mycoparasites and S. fusca conducted. In this context, the effect of mycoparasitic fungi on the formation of infection structures of S. fusca such as haustoria, conidia and conidiospores has been quantified. On the basis of the microscopic data, effect of mycoparasites on severity and incidence of cucurbit powdery mildew has been discussed. Our results show that, under controlled environmental conditions, Acremonium alternatum, Ampelomyces quisqualis and especially Lecanicillium lecanii, when applied in early stages of infection, were able to significantly reduce cucurbit powdery mildew symptoms and S. fusca development on melon leaves. These results indicate that these mycoparasites are promising candidates for the biocontrol of cucurbit powdery mildew in melon greenhouses. PMID:12735245

  14. Screening genus Penicillium for producers of cellulolytic and xylanolytic enzymes

    DEFF Research Database (Denmark)

    Krogh, Kristian Bertel Rømer; Mørkeberg, Astrid; Frisvad, Jens Christian;

    2004-01-01

    For enzymatic hydrolysis of lignocellulosic material, cellulolytic enzymes from Trichoderma reesei are most commenly used, but, there is a need for more efficient enzyme cocktails. In this study, the production of cellulolytic and xylanolytic enzymes was investigated in 12 filamentous fungi from...

  15. Effects of the ant Formica fusca on the transmission of microsporidia infecting gypsy moth larvae.

    Science.gov (United States)

    Goertz, Dörte; Hoch, Gernot

    2013-06-01

    Transmission plays an integral part in the intimate relationship between a host insect and its pathogen that can be altered by abiotic or biotic factors. The latter include other pathogens, parasitoids, or predators. Ants are important species in food webs that act on various levels in a community structure. Their social behavior allows them to prey on and transport larger prey, or they can dismember the prey where it was found. Thereby they can also influence the horizontal transmission of a pathogen in its host's population. We tested the hypothesis that an ant species like Formica fusca L. (Hymenoptera: Formicidae) can affect the horizontal transmission of two microsporidian pathogens, Nosema lymantriae Weiser (Microsporidia: Nosematidae) and Vairimorpha disparis (Timofejeva) (Microsporidia: Burenellidae), infecting the gypsy moth, Lymantria dispar L. (Lepidoptera: Erebidae: Lymantriinae). Observational studies showed that uninfected and infected L. dispar larvae are potential prey items for F. fusca. Laboratory choice experiments led to the conclusion that F. fusca did not prefer L. dispar larvae infected with N. lymantriae and avoided L. dispar larvae infected with V. disparis over uninfected larvae when given the choice. Experiments carried out on small potted oak, Quercus petraea (Mattuschka) Liebl. (Fagaceae), saplings showed that predation of F. fusca on infected larvae did not significantly change the transmission of either microsporidian species to L. dispar test larvae. Microscopic examination indicated that F. fusca workers never became infected with N. lymantriae or V. disparis after feeding on infected prey. PMID:23926361

  16. Bactericidal and cytotoxic effects of Erythrina fusca leaves aquadest extract

    Directory of Open Access Journals (Sweden)

    Janti Sudiono

    2013-03-01

    Full Text Available Background: Empirically, Erythrina fusca has been used as traditional herb for its antibacterial and antiinflammation properties. Periodontal disease is one of the most oral infectious diseases with microorganism predominated as the contributing factors. Porphyromonas gingivalis (P. gingivalis is one of the main bacteria pathogen found in periodontal diseases. Purpose: The purpose of this study was to examine the bactericidal effect of Erythrina fusca Leaves Aquadest Extract (EFLAE at various concentrations on P. gingivalis and cytotoxic effect on fibroblast. Methods: Pure P. gingivalis was cultured in Brain Heart Infusion (BHI medium for 24 hours with or without various concentrations of treatment of EFLAE. Calculation and statistical analysis of remaining bacteria were performed by inhibitory zone method to evaluate the EFLAE bactericidal effect and compared to chlorhexidine as positive control. To evaluate the cytotoxic effect, NIH 3T3 cells were cultured in Dulbecco’s Modification of Eagle’s Medium (DMEM containing of 10% fetal bovine serum (FBS and 1% penicillin-streptomycin, pH 7.2, in 5% CO2, and stored in humidified incubator under temperature 370 C. Cells were treated with/without various concentrations of EFLAE for 48 hours. The viable cells were then counted using 3-(4,5- Dimethylthiazol-2-yl-2,5 diphenyl tetrazodium bromide (MTT method. Results: EFLAE have bactericidal effect on P. gingivalis in a concentration dependent manner starting from 78%. The concentration of 90% EFLAE had stronger bactericidal effect (35.004 ± 1.546 than those of chlorhexidine as positive control (32.313 ± 1.619. One-way ANOVA showed significant bactericidal effect differences among concentrations of EFLAE and chlorhexidine (p<0.05 while Tuckey HSD test showed significant difference only between lower concentration of EFLAE (78%, 79% and chlorhexidine. With the highest concentration of EFLAE (100% applied in the bactericidal test, no cytotoxic effect

  17. Evaluation of cellulolytic activity in insect digestive fluids.

    Science.gov (United States)

    Su, L-J; Zhang, H-F; Yin, X-M; Chen, M; Wang, F-Q; Xie, H; Zhang, G-Z; Song, A-D

    2013-01-01

    Efficient and low-cost cellulolytic enzymes are urgently needed to degrade recalcitrant plant biomass during the industrial production of lignocellulosic biofuels. Here, the cellulolytic activities in the gut fluids of 54 insect species that belong to 7 different taxonomic orders were determined using 2 different substrates, carboxymethyl cellulose (CMC) (approximating endo-β-1,4-glucanase) and filter paper (FP) (total cellulolytic activities). The use of CMC as the substrate in the zymogram analysis resulted in the detection of distinct cellulolytic protein bands. The cellulolytic activities in the digestive system of all the collected samples were detected using cellulolytic activity analysis. The highest CMC gut fluid activities were found in Coleoptera and Orthoptera, while FP analysis indicated that higher gut fluid activities were found in several species of Coleoptera and Lepidoptera. In most cases, gut fluid activities were higher with CMC than with FP substrate, except for individual Lepidoptera species. Our data indicate that the origin of cellulolytic enzymes probably reflects the phylogenetic relationship and feeding strategies of different insects. PMID:23315870

  18. An Efficient and Improved Methodology for the Screening of Industrially Valuable Xylano-Pectino-Cellulolytic Microbes

    OpenAIRE

    Avtar Singh; Amanjot Kaur; Anita Dua; Ritu Mahajan

    2015-01-01

    Xylano-pectino-cellulolytic enzymes are valuable enzymes of the industrial sector. In our earlier study, we have reported a novel and cost effective methodology for the qualitative screening of cellulase-free xylano-pectinolytic microorganisms by replacing the commercial, highly expensive substrates with agricultural residues, but the microorganisms with xylanolytic, pectinolytic, cellulolytic, xylano-pectinolytic, xylano-cellulolytic, pectino-cellulolytic, and xylano-pectino-cellulolytic pot...

  19. Screening genus Penicillium for producers of cellulolytic and xylanolytic enzymes

    DEFF Research Database (Denmark)

    Krogh, Kristian Bertel Rømer; Mørkeberg, Astrid; Frisvad, Jens Christian; Olsson, Lisbeth

    2004-01-01

    For enzymatic hydrolysis of lignocellulosic material, cellulolytic enzymes from Trichoderma reesei are most commenly used, but, there is a need for more efficient enzyme cocktails. In this study, the production of cellulolytic and xylanolytic enzymes was investigated in 12 filamentous fungi from...... genus Penicillium and compared with that of T. reesei. Either Solka-Floc cellulose or oat spelt xylan was used as carbon source in shake flask cultivations. All the fungi investigated showed coinduction of cellulolytic and xylanolytic enzymes during growth on cellulose as well as on xylan. The highest...

  20. Production of cellulolytic enzymes from ascomycetes

    DEFF Research Database (Denmark)

    Hansen, Gustav Hammerich; Lübeck, Mette; Frisvad, Jens Christian;

    2015-01-01

    Optimizing production of cellulose degrading enzymes is of great interest in order to increase the feasibility of constructing biorefinery facilities for a sustainable supply of energy and chemical products. The ascomycete phylum has a large potential for the production of cellulolytic enzymes....... Although numerous enzymatic profiles have already been unraveled, the research has been covering only a limited number of species and genera, thus leaving many ascomycetes to be analyzed. Such analysis requires choosing appropriate media and cultivation methods that ensure enzyme profiles with high...... specificities and activities. However, the choice of media, cultivation methods and enzyme assays highly affect the enzyme activity profile observed. This review provides an overview of enzymatic profiles for several ascomycetes covering phylogenetically distinct genera and species. The profiles of cellulose...

  1. Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yu; Tang, Lan; Henriksen, Svend Hostgaard Bang

    2016-05-17

    The present invention provides isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

  2. Cellulase production from treated oil palm empty fruit bunch degradation by locally isolated Thermobifida fusca

    Directory of Open Access Journals (Sweden)

    M. Nazli Naim

    2013-02-01

    Full Text Available The aim of this research was to evaluate the production of cellulases from locally isolated bacteria, Thermobifida fusca, using thermal and chemical treated oil palm empty fruit bunch (OPEFB as substrate in liquid-state fermentation (LSF. T. fusca was successfully isolated and was a dominant cellulase producer in OPEFB composting at the thermophilic stage. Analysis of the surface morphology of OPEFB samples using Scanning Electron Microscopy (SEM showed that the most significant changes after the combination of thermal and chemical pretreatment was the removal of silica bodies, and this observation was supported by X-ray Diffraction analysis (XRD, Fourier Transform Infrared (FTIR, and Thermogravimetric analysis (TG showing changes on the hemicelluloses, cellulose, and lignin structures throughout the pretreatment process. As a result of the pretreatment, higher cellulase production by T. fusca was obtained. The highest activity for CMCase, FPase, and β-glucosidase using optimally treated OPEFB were 0.24 U/mL, 0.34 U/mL, and 0.04 U/mL, respectively. Therefore, it can be suggested that the combination of chemical and thermal pretreatments enhances the degradation of OPEFB for subsequent use as fermentation substrate, contributing to a higher cellulases yield by T. fusca.

  3. Cellulolytic Enzymes Production by Solid State Culture

    Directory of Open Access Journals (Sweden)

    Miguel A. Medina-Morales

    2011-01-01

    Full Text Available Problem statement: Great interest in the use of lignocellulosic biomass is increasing in order to diminish the accumulation of residues, such as pecan nut shells. One of the alternatives is the fungal degradation of these residues. Approach: The capacity of Trichoderma (coded as T1, T2 and T3 strains to produce cellulase and xylonite was evaluated. Results: Pecan nut shell fibers were used as sole carbon source. The fiber characterization study showed that cellulose levels were of 0.1% while hemicellulose was up to 25 %. Three Trichoderma strains were used on solid fungal cultures using the fibers as sole carbon and inductor source for the production of cellulolytic enzymes. The behavior of the sugars liberated by the fungi showed that the strain T2 is able to accumulate more monomeric reducing sugars than the other two strains, this could be attributed at this strain has a higher sugar liberation rate and slower sugar consumption rate. This strain also expressed more cellulase and xylanase activity. The low quantity of cellulose registered in the fibers can still be used to induce cellulase activity. Conclusion: The T2 strain had the highest level of enzymatic activity both cellulase and xylanase.

  4. Plant regeneration from immature inflorescence derived callus cultures of salt tolerant kallar grass (Leptochloa fusca L.)

    OpenAIRE

    M.Praveena; Giri, C. C.

    2012-01-01

    Efficient plant regeneration has been achieved from immature inflorescence derived callus cultures of salt tolerant grass Leptochloa fusca (L.). Young inflorescence explants displayed wide-ranging responses for callus induction and plant regeneration when subjected to different cold treatment durations and without cold treatment exposure (control) prior to its inoculation to MS medium supplemented with different concentrations/combinations of plant growth regulators (PGRs). The PGRs included ...

  5. Community structure of gut microbes in Busseola fusca (Lepidoptera: Noctuidae) / Maxi Snyman

    OpenAIRE

    Snyman, Maxi

    2015-01-01

    Bt-maize is engineered to express insecticidal toxins derived from the bacterium Bacillus thuringiensis and has been shown to be very effective against pests like Busseola fusca. However, resistance of this pest against Bt-maize has developed and spread throughout South Africa. This study was inspired by the lack of knowledge over the microorganisms associated with the gut of these insects as they play a vital role in insect growth and development. Microbial-derived enzymes may...

  6. Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

    Science.gov (United States)

    Schnorr, Kirk; Kramer, Randall

    2016-04-05

    The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

  7. Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yu; Duan, Junxin; Tang, Lan; Wu, Wenping

    2016-06-14

    The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

  8. Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

    Energy Technology Data Exchange (ETDEWEB)

    Schnorr, Kirk; Kramer, Randall

    2016-08-09

    The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

  9. Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

    2016-08-09

    The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

  10. Elucidating the formation of terra fuscas using Sr–Nd–Pb isotopes and rare earth elements

    International Nuclear Information System (INIS)

    Highlights: • Geochemical evidences on stabile phase confirm Bajocian marl as terra fusca parent material. • Precipitation/Dissolution of secondary carbonates controls geochemistry of labile phases. • This terra fusca sequence record at least four geological and environmental events. - Abstract: Carbonate weathering mantles, like terra fusca, are common in Europe but their formation and evolution is still badly understood. We propose to combine geological, mineralogical and pedological knowledge with trace element and isotope data of a weathering mantle as a novel approach to understand the evolution of terra fuscas. Sr–Nd–Pb isotopes and rare earth element (REE) contents were analyzed in a cambisol developing on a typical terra fusca on top of a condensed Bajocian limestone-marl succession from the eastern side of the Paris Basin. The isotope data, REE distribution patterns and mass balance calculations suggest that the cambisol mirrors the trace element enrichments present in this carbonate lithology, which are exceptionally high compared to global average carbonate. The deeper soil horizons are strongly enriched not only in REE (ΣREE: 2640 ppm) but also in redox-sensitive elements such as Fe (44 wt.%), V (1000 ppm), Cr (700 ppm), Zn (550 ppm), As (260 ppm), Co (45 ppm) and Cd (2.4 ppm). The trace element distribution patterns of the carbonate bedrock are similar to those of the soil suggesting their close genetic relationships. Sr–Nd–Pb isotope data allow to identify four principal components in the soil: a silicate-rich pool close to the surface, a leachable REE enriched pool at the bottom of the soil profile, the limestone on which the weathering profile developed and an anthropogenic, atmosphere-derived component detected in the soil leachates of the uppermost soil horizon. The leachable phases are mainly secondary carbonate-bearing REE phases such as bastnaesite ((X) Ca(CO3)2F) (for X: Ce, La and Nd). The isotope data and trace element

  11. Comparison of Cellulolytic Activities in Clostridium thermocellum and Three Thermophilic, Cellulolytic Anaerobes.

    Science.gov (United States)

    Reynolds, P H; Sissons, C H; Daniel, R M; Morgan, H W

    1986-01-01

    Avicelase, carboxymethyl cellulase (CMCase), and beta-glucosidase activities have been compared between Clostridium thermocellum and three extremely thermophilic, cellulolytic anaerobes, isolates TP8, TP11, and KT8. The three isolates were all small, gram-negative staining, oval-ended rods which occurred singly and, at exponential phase, in long chains. They were nonflagellated and no spores were visible. The KT8 and TP11 isolates caused clumping of the cellulose during growth. In all four organisms the CMCase activity paralleled cell growth; however, in C. thermocellum and TP8 the avicelase activity did not increase until early stationary phase. Total CMCase activity in C. thermocellum was significantly higher than in the three isolates; however, avicelase activities were much more comparable among the four organisms. C. thermocellum produced higher levels of ethanol, and all four organisms produced similar concentrations of acetate. The amounts of free and bound CMCase and avicelase activities were investigated. In C. thermocellum and TP8 most of the CMCase and avicelase activities were bound to the cellulose in the medium. In contrast, most of the CMCase activity in TP11 and KT8 was free in the culture supernatant; a significant percentage of avicelase activity was also free. The TP8 isolate was also grown on a defined medium with urea as sole nitrogen source and cellulose serving as the carbon source. Under these conditions the pattern of enzyme production was the same as that in the enriched medium, although the level of that production was considerably reduced. PMID:16346961

  12. BIOTECHNOLOGY OF TRICHODERMA-BASED FEED ADDITIVE WITH CELLULOLYTIC PROPERTIES

    Directory of Open Access Journals (Sweden)

    Koshchayev A. G.

    2013-11-01

    Full Text Available In the work, we have presented the information of elaboration of a manufacturing process of Mycocel feed additive with the cellulolytic activity for poul-try industry. Manufacturing process includes follow-ing steps: stock culture maintenance and storage of Trichoderma lignorum 81-17, growing fluid culture of microscopic fungus in sucrose yeast extract me-dium, feed additive with cellulolytic properties out-put and quality control, packaging, storage and disposal of waste. We have shown that the Mycocel is non-toxic feed additive for protozoa and warm-blooded animals (laboratory mice and quails. This study demonstrated total population livability in the experimental group with feed additive. Quail body-weight of experimental group was higher by 6% as compared to the control and feed consumption per 1 kg of live weight of bird was 3,58 kg, 7,5% lower than the control

  13. Responses of the tropical gorgonian coral Eunicea fusca to ocean acidification conditions

    Science.gov (United States)

    Gómez, C. E.; Paul, V. J.; Ritson-Williams, R.; Muehllehner, N.; Langdon, C.; Sánchez, J. A.

    2015-06-01

    Ocean acidification can have negative repercussions from the organism to ecosystem levels. Octocorals deposit high-magnesium calcite in their skeletons, and according to different models, they could be more susceptible to the depletion of carbonate ions than either calcite or aragonite-depositing organisms. This study investigated the response of the gorgonian coral Eunicea fusca to a range of CO2 concentrations from 285 to 4,568 ppm (pH range 8.1-7.1) over a 4-week period. Gorgonian growth and calcification were measured at each level of CO2 as linear extension rate and percent change in buoyant weight and calcein incorporation in individual sclerites, respectively. There was a significant negative relationship for calcification and CO2 concentration that was well explained by a linear model regression analysis for both buoyant weight and calcein staining. In general, growth and calcification did not stop in any of the concentrations of pCO2; however, some of the octocoral fragments experienced negative calcification at undersaturated levels of calcium carbonate (>4,500 ppm) suggesting possible dissolution effects. These results highlight the susceptibility of the gorgonian coral E. fusca to elevated levels of carbon dioxide but suggest that E. fusca could still survive well in mid-term ocean acidification conditions expected by the end of this century, which provides important information on the effects of ocean acidification on the dynamics of coral reef communities. Gorgonian corals can be expected to diversify and thrive in the Atlantic-Eastern Pacific; as scleractinian corals decline, it is likely to expect a shift in these reef communities from scleractinian coral dominated to octocoral/soft coral dominated under a "business as usual" scenario of CO2 emissions.

  14. Fermentation of cellodextrins by cellulolytic and noncellulolytic rumen bacteria.

    OpenAIRE

    Russell, J B

    1985-01-01

    Water-soluble cellodextrins were prepared from microcrystalline cellulose by using fuming hydrochloric acid and acetone precipitation. This cellodextrin preparation contained only trace amounts of glucose and cellobiose and was primarily composed of cellotetraose and cellopentaose. When various species of cellulolytic and noncellulolytic bacteria were cultured with cellodextrins, their growth rates and maximal optical densities were in most cases similar to those observed with cellobiose. Tim...

  15. Ecology of the African Maize Stalk Borer, Busseola fusca (Lepidoptera: Noctuidae with Special Reference to Insect-Plant Interactions

    Directory of Open Access Journals (Sweden)

    Paul-André Calatayud

    2014-07-01

    Full Text Available Busseola fusca (Lepidoptera: Noctuidae is an important pest of maize and sorghum in sub-Saharan Africa. One century after its first description by Fuller in 1901, inaccurate information based on earlier reports are still propagated on its distribution (e.g., absent from the lower altitudes in East Africa and host plant range (e.g., feeding on a large range of wild grass species. This review provides updated information on the biology, distribution and genetics of B. fusca with emphasis on insect-plant interactions. Related to this, new avenues of stem borer management are proposed.

  16. Karyological observations on Turbellaria Proseriata: karyometric analysis of Monocelis fusca, M. lineata (Monocelididae) and Parotoplana macrostyla (Otoplanidae)

    Science.gov (United States)

    Curini-Galletti, M.; Galleni, L.; Puccinelli, I.

    1984-03-01

    A karyometric analysis of the chromosome set of the marine turbellarians Monocelis fusca, M. lineata and Parotoplana macrostyla has been carried out. The karyotype of the two Monocelis species investigated (2n=6) is formed by three pairs of small and similarly sized chromosomes: In M. fusca, chromosome 1 is metacentric, chromosome 2 acrocentric and chromosome 3 is subtelocentric. M. lineata also presents one pair of metacentric chromosomes (chromosome 2), while chromosomes 1 and 3 are submetacentric. P. macrostyla (2n=12) reveals two pairs of large metacentric and four pairs of small chromosomes, three of which are metacentric, whereas the last is subtelocentric.

  17. Assessment of cellulolytic microorganisms in soils of Nevados Park, Colombia

    Directory of Open Access Journals (Sweden)

    Lizeth Manuela Avellaneda-Torres

    2014-12-01

    Full Text Available A systematized survey was conducted to find soil-borne microbes that degrade cellulose in soils from unique ecosystems, such as the Superpáramo, Páramo, and the High Andean Forest in the Nevados National Natural Park (NNNP, Colombia. These high mountain ecosystems represent extreme environments, such as high levels of solar radiation, low atmospheric pressure, and extreme daily changes in temperature. Cellulolytic activity of the microorganisms was evaluated using qualitative tests, such as growth in selective media followed by staining with congo red and iodine, and quantitative tests to determine the activity of endoglucanase, β-glucosidase, exoglucanase, and total cellulase. Microorganisms were identified using molecular markers, such as the 16S rRNA gene for bacteria and the internal transcribed spacer region (ITS of ribosomal DNA for fungi. Multivariate statistical analysis (MVA was used to select microorganisms with high cellulolytic capacity. A total of 108 microorganisms were isolated from the soils and, in general, the enzymatic activities of fungi were higher than those of bacteria. Our results also found that none of the organisms studied were able to degrade all the components of the cellulose and it is therefore suggested that a combination of bacteria and/or fungi with various enzymatic activities be used to obtain high total cellulolytic activity. This study gives an overview of the potential microorganism that could be used for cellulose degradation in various biotechnological applications and for sustainable agricultural waste treatment.

  18. Constitutive Expression of Thermobifida fusca Thermostable Acetylxylan Esterase Gene in Pichia pastoris

    OpenAIRE

    Yu-Chun Huang; Wei-Lin Chen; Cheng-Yu Chen; Gen-Hung Chen; Yu-Fen Chen; Chao-Hsun Yang; Kun-I Lin

    2010-01-01

    A gene encoding the thermostable acetylxylan esterase (AXE) in Thermobifida fusca NTU22 was amplified by PCR, sequenced and cloned into the Pichia pastoris X-33 host strain using the vector pGAPZαA, allowing constitutive expression and secretion of the protein. Recombinant expression resulted in high levels of extracellular AXE production, as high as 526 U/mL in the Hinton flask culture broth. The purified enzyme showed a single band at about 28 kDa by SDS-polyacrylamide gel electrophoresis a...

  19. IDENTIFICATION AND CHARACTERIZATION OF THERMOBIFIDA FUSCA GENES INVOLVED IN PLANT CELL WALL DEGRADATION.

    Energy Technology Data Exchange (ETDEWEB)

    David B. Wilson

    2006-01-23

    Micro-array experiments identified a number of Thermobifida fusca genes which were upregulated by growth on cellulose or plant biomass. Five of these genes were cloned, overexpressed in E. coli and the expressed proteins were purified and characterized. These were a xyloglucanase,a 1-3,beta glucanase, a family 18 hydrolase and twocellulose binding proteins that contained no catalytic domains. The catalyic domain of the family 74 endoxyloglucanase with a C-terminal, cellulose binding module was crystalized and its 3-dimensional structure was determined by X-ray crystallography.

  20. Compositions comprising a polypeptide having cellulolytic enhancing activity and a dioxy compound and uses thereof

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, Matthew; Xu, Feng; Quinlan, Jason

    2016-07-19

    The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a dioxy compound. The present invention also relates to methods of using the compositions.

  1. Compositions comprising a polypeptide having cellulolytic enhancing activity and a heterocyclic compound and uses thereof

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Feng; Sweeney, Matthew; Quinlan, Jason

    2016-08-02

    The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a heterocyclic compound. The present invention also relates to methods of using the compositions.

  2. Compositions comprising a polypeptide having cellulolytic enhancing activity and a bicycle compound and uses thereof

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Feng; Sweeney, Matthew; Quinlan, Jason

    2015-06-16

    The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a bicyclic compound. The present invention also relates to methods of using the compositions.

  3. Compositions comprising a polypeptide having cellulolytic enhancing activity and a quinone compound and uses thereof

    Energy Technology Data Exchange (ETDEWEB)

    Quinlan, Jason; Xu, Feng; Sweeney, Matthew

    2016-03-01

    The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a quinone compound. The present invention also relates to methods of using the compositions.

  4. Heterologous expression and biochemical characterization of glucose isomerase from Thermobifida fusca.

    Science.gov (United States)

    Deng, Hui; Chen, Sheng; Wu, Dan; Chen, Jian; Wu, Jing

    2014-06-01

    Glucose isomerase (GIase) catalyzes the isomerization of D-glucose to D-fructose. The GIase from Thermobifida fusca WSH03-11 was expressed in Escherichia coli BL21(DE3), and the purified enzyme took the form of a tetramer in solution and displayed a pI value of 5.05. The temperature optimum of GIase was 80 °C and its half life was about 2 h at 80 °C or 15 h at 70 °C. The pH optimum of GIase was 10 and the enzyme retained 95 % activity over the pH range of 5-10 after incubating at 4 °C for 24 h. Kinetic studies showed that the K m and K cat values of the enzyme are 197 mM and 1,688 min(-1), respectively. The maximum conversion yield of glucose (45 %, w/v) to fructose of the enzyme was 53 % at pH 7.5 and 70 °C. The present study provides the basis for the industrial application of recombinant T. fusca GIase in the production of high fructose syrup. PMID:24317483

  5. Degradation of konjac glucomannan by Thermobifida fusca thermostable β-mannanase from yeast transformant.

    Science.gov (United States)

    Chen, Cheng-Yu; Huang, Yu-Chun; Yang, Ting-Ya; Jian, Jhen-Yi; Chen, Wei-Lin; Yang, Chao-Hsun

    2016-01-01

    Native konjac glucomannan was used as the substrate for thermophilic actinomycetes, Thermobifida fusca BCRC19214, to produce β-mannanase. The β-mannanase was purified and five internal amino acid sequences were determined by LC-MS/MS. These sequences had high homology with the β-mannanase from T. fusca YX. The tfm gene which encoded the β-mannanase was cloned, sequenced and heterologous expressed in Yarrowia lipolytica P01 g expression system. Recombinant heterologous expression resulted in extracellular β-mannanase production at levels as high as 3.16 U/ml in the culture broth within 48 h cultivation. The recombinant β-mannanase from Y. lipolytica transformant had superior thermal property. The optimal temperature of the recombinant β-mannanase from Y. lipolytica transformant (pYLSC1-tfm) was 80°C. When native konjac glucomannan was incubated with the recombinant β-mannanase from Y. lipolytica transformant (pYLSC1-tfm) at 50°C, there was a fast decrease of viscosity happen during the initial phase of reaction. This viscosity reduction was accompanied by an increase of reducing sugars. The surface of konjac glucomannan film became smooth. After 24h of treatment, the DPw of native konjac glucomannan decreased from 6,435,139 to 3089. PMID:26476245

  6. Influence of Host-Plant Surface Chemicals on the Oviposition of the Cereal Stemborer Busseola Fusca.

    Science.gov (United States)

    Juma, Gerald; Clément, Gilles; Ahuya, Peter; Hassanali, Ahmed; Derridj, Sylvie; Gaertner, Cyrile; Linard, Romain; Le Ru, Bruno; Frérot, Brigitte; Calatayud, Paul-André

    2016-05-01

    The chemical composition of plant surfaces plays a role in selection of host plants by herbivorous insects. Once the insect reaches the plant, these cues determine host acceptance. Laboratory studies have shown that the stem borer Busseola fusca (Lepidoptera: Noctuidae), an important pest of sorghum and maize in sub-Saharan Africa, is able to differentiate between host and non-host plant species. However, no information is available on the cues used by this insect to seek and accept the host plant. Thus, the role of surface phytochemical stimuli on host selection and oviposition by B. fusca was studied in the laboratory using two host plants, sorghum, Sorghum bicolor, and maize, Zea mays, and one non-host plant, Napier grass, Pennisetum purpureum. The numbers of eggs and egg masses deposited on the three plant species were compared first under no-choice and choice conditions. In both cases, more eggs and egg masses were laid on maize and sorghum than on the non-host. Artificial surrogate stems treated with a water or chloroform surface extract of each plant were then compared with surrogate stems treated with, respectively, water or chloroform as controls, under similar conditions. Surrogate stems treated with plant water extracts did not show an increase in oviposition when compared to controls, indicating that the major compounds in these extracts, i.e., simple sugars and free amino acids, are not significantly responsible for the oviposition preference. By contrast, a chloroform extract of sorghum enhanced oviposition on the surrogate stems compared to the control, while those of maize and Napier grass showed no significant effects. Analysis of the chloroform extract of sorghum showed higher amounts of α-amyrin, ß-amyrin, and n-nonacosane compared to those of maize and Napier grass. A blend of the three chemicals significantly increased oviposition compared to the chloroform-treated control, indicating that these compounds are part of the surface chemical

  7. Culturable epibacteria of the marine sponge Ircinia fusca: Temporal variations and their possible role in the epibacterial defense of the host

    Digital Repository Service at National Institute of Oceanography (India)

    Thakur, N.L.; Anil, A; Muller, W.E.G.

    The influence of environmental changes on the epibacterial population of the marine sponge Ircinia fusca (Carter) was evaluated by using a bacterial culture-based approach. Sponge surface-associated bacteria were isolated, enumerated and cultured...

  8. Processivity, substrate binding, and mechanism of cellulose hydrolysis by Thermobifida fusca Cel9A.

    Science.gov (United States)

    Li, Yongchao; Irwin, Diana C; Wilson, David B

    2007-05-01

    Thermobifida fusca Cel9A-90 is a processive endoglucanase consisting of a family 9 catalytic domain (CD), a family 3c cellulose binding module (CBM3c), a fibronectin III-like domain, and a family 2 CBM. This enzyme has the highest activity of any individual T. fusca enzyme on crystalline substrates, particularly bacterial cellulose (BC). Mutations were introduced into the CD or the CBM3c of Cel9A-68 using site-directed mutagenesis. The mutant enzymes were expressed in Escherichia coli; purified; and tested for activity on four substrates, ligand binding, and processivity. The results show that H125 and Y206 play an important role in activity by forming a hydrogen bonding network with the catalytic base, D58; another important supporting residue, D55; and Glc(-1) O1. R378, a residue interacting with Glc(+1), plays an important role in processivity. Several enzymes with mutations in the subsites Glc(-2) to Glc(-4) had less than 15% activity on BC and markedly reduced processivity. Mutant enzymes with severalfold-higher activity on carboxymethyl cellulose (CMC) were found in the subsites from Glc(-2) to Glc(-4). The CBM3c mutant enzymes, Y520A, R557A/E559A, and R563A, had decreased activity on BC but had wild-type or improved processivity. Mutation of D513, a conserved residue at the end of the CBM, increased activity on crystalline cellulose. Previous work showed that deletion of the CBM3c abolished crystalline activity and processivity. This study shows that it is residues in the catalytic cleft that control processivity while the CBM3c is important for loose binding of the enzyme to the crystalline cellulose substrate. PMID:17369336

  9. An Efficient and Improved Methodology for the Screening of Industrially Valuable Xylano-Pectino-Cellulolytic Microbes

    Directory of Open Access Journals (Sweden)

    Avtar Singh

    2015-01-01

    Full Text Available Xylano-pectino-cellulolytic enzymes are valuable enzymes of the industrial sector. In our earlier study, we have reported a novel and cost effective methodology for the qualitative screening of cellulase-free xylano-pectinolytic microorganisms by replacing the commercial, highly expensive substrates with agricultural residues, but the microorganisms with xylanolytic, pectinolytic, cellulolytic, xylano-pectinolytic, xylano-cellulolytic, pectino-cellulolytic, and xylano-pectino-cellulolytic potential were obtained. The probability of getting the desired combination was low, so efforts were made to further improve this cost effective methodology for obtaining the high yield of the microbes capable of producing desired combination of enzymes. By inclusion of multiple enrichment steps in sequence, using only practically low cost substrates and without any nutrient media till primary screening stage, this improved novel protocol for screening gave only the desired microorganisms with xylano-pectino-cellulolytic activity. Using this rapid, efficient, cost effective, and improved methodology, microbes with required combination of enzymes can be obtained and the probability of getting the desired microorganisms is cent percent. This is the first report presenting the methodology for the isolation of xylano-pectino-cellulolytic positive microorganisms at low cost and consuming less time.

  10. An efficient and improved methodology for the screening of industrially valuable xylano-pectino-cellulolytic microbes.

    Science.gov (United States)

    Singh, Avtar; Kaur, Amanjot; Dua, Anita; Mahajan, Ritu

    2015-01-01

    Xylano-pectino-cellulolytic enzymes are valuable enzymes of the industrial sector. In our earlier study, we have reported a novel and cost effective methodology for the qualitative screening of cellulase-free xylano-pectinolytic microorganisms by replacing the commercial, highly expensive substrates with agricultural residues, but the microorganisms with xylanolytic, pectinolytic, cellulolytic, xylano-pectinolytic, xylano-cellulolytic, pectino-cellulolytic, and xylano-pectino-cellulolytic potential were obtained. The probability of getting the desired combination was low, so efforts were made to further improve this cost effective methodology for obtaining the high yield of the microbes capable of producing desired combination of enzymes. By inclusion of multiple enrichment steps in sequence, using only practically low cost substrates and without any nutrient media till primary screening stage, this improved novel protocol for screening gave only the desired microorganisms with xylano-pectino-cellulolytic activity. Using this rapid, efficient, cost effective, and improved methodology, microbes with required combination of enzymes can be obtained and the probability of getting the desired microorganisms is cent percent. This is the first report presenting the methodology for the isolation of xylano-pectino-cellulolytic positive microorganisms at low cost and consuming less time. PMID:25692034

  11. 暗棕羊海绵Ircinia fusca Carter 1880.化学成分的研究%Research on the Chemical Compositions of Ircinia Fusca Carter, 1880.

    Institute of Scientific and Technical Information of China (English)

    袁霞; 罗轩; 欧冰凝

    2012-01-01

      首次对暗棕羊海绵Ircinia fusca Carter 1880.化学成分进行研究,从该属海绵中分离得到4个单体化合物,经过波谱等手段鉴别为胸腺嘧啶、尿嘧啶、次黄嘌呤、黄嘌呤.%  In this paper the chemical compositions of Ircinia fusca Carter 1880. were researched for the first time. Four compounds were separated by the silica gel column, the structures of which were determined as thymine, uracil, hypoxanthine and xanthine by means of UV, IR, EI-MS, 1H and 13C NMR.

  12. Compositions for enhancing hydroysis of cellulosic material by cellulolytic enzyme compositions

    Energy Technology Data Exchange (ETDEWEB)

    Quinlan, Jason; Xu, Feng; Sweeney, Matthew; Johansen, Katja Salomon

    2014-09-30

    The present invention relates to compositions comprising a GH61 polypeptide having cellulolytic enhancing activity and an organic compound comprising a carboxylic acid moiety, a lactone moiety, a phenolic moiety, a flavonoid moiety, or a combination thereof, wherein the combination of the GH61 polypeptide having cellulolytic enhancing activity and the organic compound enhances hydrolysis of a cellulosic material by a cellulolytic enzyme compared to the GH61 polypeptide alone or the organic compound alone. The present invention also relates to methods of using the compositions.

  13. Determination of the cellulolytic activities of microorganisms isolated from poultry litter for sawdust degradation

    OpenAIRE

    Akpomie O.OF; Ubogun M.

    2013-01-01

    Cellulolytic activities of bacterial and fungal isolates obtained from poultry droppings were determined using the ability of each isolate to produce clear zones on Carboxyl Methyl Cellulose Agar plates. The bacterial isolates were Klebsiella, Streptococcus, Celulomonas, Escherichia coli and Micrococus species. The cellulolytic counts ranged from 5.02 x 104 + 3.42 to 7.20 x 109 + 6.12 cfu/g. The cellulolytic activities of the bacterial isolates ranged from 0.04 to 0.26 iu/m with Cellulomonas...

  14. The iturin and fengycin families of lipopeptides are key factors in antagonism of Bacillus subtilis toward Podosphaera fusca

    OpenAIRE

    Romero, Diego; de Vicente, Antonio; Rakotoaly, Rivo H.; Dufour, Samuel E.; Veening, Jan-Willem; Arrebola, Eva; Cazorla, Francisco M.; Kuipers, Oscar P; Paquot, Michel; Perez-Garcia, Alejandro; Stacey, Gary

    2007-01-01

    Podosphaera fusca is the main causal agent of cucurbit powdery mildew in Spain. Four Bacillus subtilis strains, UMAF6614, UMAF6619, UMAF6639, and UMAF8561, with proven ability to suppress the disease on melon in detached leaf and seedling assays, were subjected to further analyses to elucidate the mode of action involved in their biocontrol performance. Cell-free supernatants showed antifungal activities very close to those previously reported for vegetative cells. Identification of three lip...

  15. Phylogeography and population genetics of the maize stalk borer Busseola fusca (Lepidoptera, Noctuidae) in sub-Saharan Africa

    OpenAIRE

    Sezonlin, Michel; Dupas, Stéphane; Le Ru, Bruno; Le Gall, Philippe; Moyal, Pascal; Calatayud, Paul-André; Giffard, I; Faure, N; Silvain, Jean-François

    2006-01-01

    The population genetics and phylogeography of African phytophagous insects have received little attention. Some, such as the maize stalk borer Busseola fusca, display significant geographic differences in ecological preferences that may be congruent with patterns of molecular variation. To test this, we collected 307 individuals of this species from maize and cultivated sorghum at 52 localities in West, Central and East Africa during the growing season. For all collected individuals, we seque...

  16. NREL Explains the Higher Cellulolytic Activity of a Vital Microorganism

    Energy Technology Data Exchange (ETDEWEB)

    2016-06-01

    The discovery of a new mode of action by C. thermocellum to convert biomass to biofuels is significant because the bacterium is already recognized as one of the most effective in the biosphere. Researchers found that, in addition to using common cellulase degradation mechanisms attached to cells, C. thermocellum also uses a new category of cell-free scaffolded enzymes. The new discovery will influence the strategies used to improve the cellulolytic activity of biomass degrading microbes going forward. Better understanding of this bacterium could lead to cheaper production of ethanol and drop-in fuels. Also, this discovery demonstrates that nature's biomass conversion behaviors are not fully understood and remain as opportunities for future microbial/enzyme engineering efforts.

  17. SACCHARIFICATION OF CORNCOB USING CELLULOLYTIC BACTERIA FOR BIOETHANOL PRODUCTION

    Directory of Open Access Journals (Sweden)

    TITI CANDRA SUNARTI

    2010-08-01

    Full Text Available The use of cellulose degrading enzyme (cellulases for hydrolysis of lignocellulosic material is a part of bioethanol production process. In this experiment, delignified corncob, its cellulose fraction and alpha cellulose were used as substrates to produce fermentable sugar by using three local isolates of celluloytic bacteria (C5-1, C4-4, C11-1 and Cmix ; mixed cultures of three isolates, and Saccharomyces cereviseae to produce ethanol. The results showed that all isolates of cellulolytic bacteria can grow on cellulose fraction better than on delignified corncob, and alpha cellulose. The highest hydrolytic activity produced from cellulose fraction was by isolate C4-4, which liberated 3.50 g/l of total sugar. Ethanol can be produced by mixed culture of bacteria and yeast, but because of competitive growth, the fermentation only produced 0.39-0.47 g/l of ethanol.

  18. Characterization of cellulolytic activities of environmental bacterial consortia from an Argentinian native forest.

    Science.gov (United States)

    Romano, Nelson; Gioffré, Andrea; Sede, Silvana M; Campos, Eleonora; Cataldi, Angel; Talia, Paola

    2013-08-01

    Cellulolytic activities of three bacterial consortia derived from a forest soil sample from Chaco region, Argentina, were characterized. The phylogenetic analysis of consortia revealed two main highly supported groups including Achromobacter and Pseudomonas genera. All three consortia presented cellulolytic activity. The carboxymethylcellulase (CMCase) and total cellulase activities were studied both quantitatively and qualitatively and optimal enzymatic conditions were characterized and compared among the three consortia. Thermal and pH stability were analyzed. Based on its cellulolytic activity, one consortium was selected for further characterization by zymography. We detected a specific protein of 55 kDa with CMCase activity. In this study, we have shown that these consortia encode for cellulolytic enzymes. These enzymes could be useful for lignocellulosic biomass degradation into simple components and for different industrial applications. PMID:23471693

  19. Insight into Dominant Cellulolytic Bacteria from Two Biogas Digesters and Their Glycoside Hydrolase Genes

    OpenAIRE

    Yongjun Wei; Haokui Zhou; Jun Zhang; Lei Zhang; Alei Geng; Fanghua Liu; Guoping Zhao; Shengyue Wang; Zhihua Zhou; Xing Yan

    2015-01-01

    Diverse cellulolytic bacteria are essential for maintaining high lignocellulose degradation ability in biogas digesters. However, little was known about functional genes and gene clusters of dominant cellulolytic bacteria in biogas digesters. This is the foundation to understand lignocellulose degradation mechanisms of biogas digesters and apply these gene resource for optimizing biofuel production. A combination of metagenomic and 16S rRNA gene clone library methods was used to investigate t...

  20. Isolation and Identification of Cellulolytic Bacteria from the Gut of Holotrichia parallela Larvae (Coleoptera: Scarabaeidae)

    OpenAIRE

    Hongyu Zhang; Ping Sheng; Shengwei Huang

    2012-01-01

    In this study, 207 strains of aerobic and facultatively anaerobic cellulolytic bacteria were isolated from the gut of Holotrichia parallela larvae. These bacterial isolates were assigned to 21 genotypes by amplified ribosomal DNA restriction analysis (ARDRA). A partial 16S rDNA sequence analysis and standard biochemical and physiological tests were used for the assignment of the 21 representative isolates. Our results show that the cellulolytic bacterial community is dominated by the Proteoba...

  1. Cellulolytic Bacteria Associated with the Gut of Dendroctonus armandi Larvae (Coleoptera: Curculionidae: Scolytinae)

    OpenAIRE

    Xia Hu; Jiamin Yu; Chunyan Wang; Hui Chen

    2014-01-01

    The object of this study was to investigate the cellulolytic bacterial community in the intestine of the Chinese white pine beetle (Dendroctonus armandi) larvae. A total of 91 cellulolytic bacteria were isolated and assigned to 11 genotypes using amplified ribosomal DNA restriction analysis (ARDRA). Partial 16S rDNA sequence analysis and morphological tests were used to assign the 11 representative isolates. The results showed that the isolates belonged to α-Proteobacteria, γ-Proteobacteria a...

  2. Effect of Carbon and Nitrogen Sources on the Production of Reducing Sugars, Extra-cellular Protein and Cellulolytic Enzymes by Two Cellulolytic Bacterial Isolates

    OpenAIRE

    Kashem, M. A.; M.A. Manchur; M.S. Rahman; M.N. Anwar

    2004-01-01

    Two thermophilic cellulolytic bacterial isolates were tested to determine the effect of carbon and nitrogen sources on the production of extra-cellular proteins, reducing sugars and cellulolytic enzymes. Lactose was found to be the most potential carbon source for Avicelase (342.52 U mL-1) and ß-glucosidase (256.89 U mL-1) activity where as NH4Cl was found to be the potential nitrogen source for CMCase (144.68 U mL-1) activity.

  3. Constitutive Expression of Thermobifida fusca Thermostable Acetylxylan Esterase Gene in Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Yu-Chun Huang

    2010-12-01

    Full Text Available A gene encoding the thermostable acetylxylan esterase (AXE in Thermobifida fusca NTU22 was amplified by PCR, sequenced and cloned into the Pichia pastoris X-33 host strain using the vector pGAPZαA, allowing constitutive expression and secretion of the protein. Recombinant expression resulted in high levels of extracellular AXE production, as high as 526 U/mL in the Hinton flask culture broth. The purified enzyme showed a single band at about 28 kDa by SDS-polyacrylamide gel electrophoresis after being treated with endo-β-N-acetylglycosaminidase H; this agrees with the predicted size based on the nucleotide sequence. About 70% of the original activity remained after heat treatment at 60 °C for three hours. The optimal pH and temperature of the purified enzyme were 8.0 and 60 °C, respectively. The properties of the purified AXE from the P. pastoris transformant are similar to those of the AXE from an E. coli transformant.

  4. Biochemical and biophysical characterization of collagens of marine sponge, Ircinia fusca (Porifera: Demospongiae: Irciniidae).

    Science.gov (United States)

    Pallela, Ramjee; Bojja, Sreedhar; Janapala, Venkateswara Rao

    2011-07-01

    Collagens were isolated and partially characterized from the marine demosponge, Ircinia fusca from Gulf of Mannar (GoM), India, with an aim to develop potentially applicable collagens from unused and under-used resources. The yield of insoluble, salt soluble and acid soluble forms of collagens was 31.71 ± 1.59, 20.69 ± 1.03, and 17.38 ± 0.87 mg/g dry weight, respectively. Trichrome staining, Scanning & Transmission Electron microscopic (SEM & TEM) studies confirmed the presence of collagen in the isolated, terminally globular irciniid filaments. The partially purified (gel filtration chromatography), non-fibrillar collagens appeared as basement type collagenous sheets under light microscopy whereas the purified fibrillar collagens appeared as fibrils with a repeated band periodicity of 67 nm under Atomic Force Microscope (AFM). The non-fibrillar and fibrillar collagens were seen to have affinity for anti-collagen type IV and type I antibodies raised against human collagens, respectively. The macromolecules, i.e., total protein, carbohydrate and lipid contents within the tissues were also quantified. The present information on the three characteristic irciniid collagens (filamentous, fibrillar and non-fibrillar) could assist the future attempts to unravel the therapeutically important, safer collagens from marine sponges for their use in pharmaceutical and cosmeceutical industries. PMID:21501629

  5. Kinetic studies of Thermobifida fusca Cel9A active site mutant enzymes.

    Science.gov (United States)

    Zhou, Weilin; Irwin, Diana C; Escovar-Kousen, Jose; Wilson, David B

    2004-08-01

    Thermobifida fusca Cel9A-90, an unusual family 9 enzyme, is a processive endoglucanase containing a catalytic domain closely linked to a family 3c cellulose binding domain (Cel9A-68) followed by a fibronectin III-like domain and a family 2 cellulose binding domain. To study its catalytic mechanism, 12 mutant genes with changes in five conserved residues of Cel9A-68 were constructed, cloned, and expressed in Escherichia coli. The purified mutant enzymes were assayed for their activities on (carboxymethyl)cellulose, phosphoric acid-swollen cellulose, bacterial microcrystalline cellulose, and 2,4-dinitrophenyl beta-D-cellobioside. They were also tested for ligand binding, enzyme processivity, and thermostability. The results clearly show that E424 functions as the catalytic acid, D55 and D58 are both required for catalytic base activity, and Y206 plays an important role in binding, catalysis, and processivity, while Y318 plays an important role in binding of crystalline cellulose substrates and is required for processivity. Several amino acids located in a loop at the end of the catalytic cleft (T245-L251) were deleted from Cel9A-68, and this enzyme showed slightly improved filter paper activity and binding to BMCC but otherwise behaved like the wild-type enzyme. The FnIII-like domain was deleted from Cel9A-90, reducing BMCC activity to 43% of the wild type. PMID:15274620

  6. Insight into Dominant Cellulolytic Bacteria from Two Biogas Digesters and Their Glycoside Hydrolase Genes.

    Directory of Open Access Journals (Sweden)

    Yongjun Wei

    Full Text Available Diverse cellulolytic bacteria are essential for maintaining high lignocellulose degradation ability in biogas digesters. However, little was known about functional genes and gene clusters of dominant cellulolytic bacteria in biogas digesters. This is the foundation to understand lignocellulose degradation mechanisms of biogas digesters and apply these gene resource for optimizing biofuel production. A combination of metagenomic and 16S rRNA gene clone library methods was used to investigate the dominant cellulolytic bacteria and their glycoside hydrolase (GH genes in two biogas digesters. The 16S rRNA gene analysis revealed that the dominant cellulolytic bacteria were strains closely related to Clostridium straminisolvens and an uncultured cellulolytic bacterium designated BG-1. To recover GH genes from cellulolytic bacteria in general, and BG-1 in particular, a refined assembly approach developed in this study was used to assemble GH genes from metagenomic reads; 163 GH-containing contigs ≥ 1 kb in length were obtained. Six recovered GH5 genes that were expressed in E. coli demonstrated multiple lignocellulase activities and one had high mannanase activity (1255 U/mg. Eleven fosmid clones harboring the recovered GH-containing contigs were sequenced and assembled into 10 fosmid contigs. The composition of GH genes in the 163 assembled metagenomic contigs and 10 fosmid contigs indicated that diverse GHs and lignocellulose degradation mechanisms were present in the biogas digesters. In particular, a small portion of BG-1 genome information was recovered by PhyloPythiaS analysis. The lignocellulase gene clusters in BG-1 suggested that it might use a possible novel lignocellulose degradation mechanism to efficiently degrade lignocellulose. Dominant cellulolytic bacteria of biogas digester possess diverse GH genes, not only in sequences but also in their functions, which may be applied for production of biofuel in the future.

  7. Mycobiota variation in stored rice straw and its cellulolytic profile.

    Science.gov (United States)

    El-Metwally, Mohammad Magdy; Ghoneem, Khalid Mohammad; Saber, Wesam El-Din Ismail Ali

    2014-09-01

    Rice Straw (RS) one of most important agrowaste worldwide. Variation in mycobiota inhabiting long stored RS and its cellulolytic profile were studied. The highest number of fungi (23 species) was recovered from 1st storage period (1-3 year). Alternaria alternata, Aspergillus sp., Cladosporium herbarum, Fusarium incarnatum, Geotrichum candidum, Penicillium sp., Stemphylium lycopersici and Ulocladium atrum are the most frequent genera. Among 21 fungal species recovered in the 2nd period (3-5 year), Cladosporium herbarum, Fusarium incarnatum, Stemphylium lycopersici and Ulocladium atrum recorded 100% frequency, whereas Ulocladium atrum, Veticillium lecanii, Stemphylium lycopersici and Penicillium sp., were the most frequent species in the 3rd period (> 5 years). Regarding the pathogenic fungal isolates, Nigrospora oryzae was the most frequent with high intensity in all samples of the three storage periods, whereas Alternaria padwikii reached the highest frequency and intensity in the 1st period and absent the 2nd and 3rd ones. The isolated fungal species showed a high production of cellulases comparing to previous studies with positive and significant correlation between FPase from one side and CMCase (r = 0.634, p ≤ 0.05) and β-glucosidase (r = 0.775, p ≤ 0.05) from the other side. PMID:26031023

  8. Extracellular overexpression of recombinant Thermobifida fusca cutinase by alpha-hemolysin secretion system in E. coli BL21(DE3

    Directory of Open Access Journals (Sweden)

    Su Lingqia

    2012-01-01

    Full Text Available Abstract Background Extracellular expression of proteins has an absolute advantage in a large-scale industrial production. In our previous study, Thermobifida fusca cutinase, an enzyme mainly utilized in textile industry, was expressed via type II secretory system in Escherichia coli BL21(DE3, and it was found that parts of the expressed protein was accumulated in the periplasmic space. Due to the fact that alpha-hemolysin secretion system can export target proteins directly from cytoplasm across both cell membrane of E. coli to the culture medium, thus in the present study we investigated the expression of cutinase using this alpha-hemolysin secretion system. Results T. fusca cutinase was fused with the specific signal peptide of alpha-hemolysin scretion system and expressed in E. coli BL21(DE3. In addition, HlyB and HlyD, strain-specific translocation components of alpha-hemolysin secretion system, were coexpressed to facilitate the enzyme expression. The cultivation of this engineered cell showed that cutinase activity in the culture medium reached 334 U/ml, which is 2.5 times that from type II secretion pathway under the same culture condition. The recombinant cutinase was further purified. Biochemical characterization of purified enzyme, which had an α-hemolysin secretion pathway signal peptide attached, had substrate specificity, pH and temperature profile, as well as application capability in bioscouring similar to that of wild-type cutinase. Conclusions In the present study, T. fusca cutinase was successfully secreted to the culture media by α-hemolysin secretion system. This is the first report of cutinase being efficiently secreted by this pathway. Due to the limited cases of successful expression of industrial enzyme by E. coli α-hemolysin secretion system, our study further explored the utilization of this pathway in industrial enzymes.

  9. Study of artificial propagation technology of Megalonibea fusca%褐毛鲿全人工繁殖技术研究

    Institute of Scientific and Technical Information of China (English)

    陈朴贤; 曾志南

    2013-01-01

      为了掌握褐毛鲿(Megalonibea fusca)繁殖生物学特性并突破全人工繁殖技术,作者介绍了1998~2002年项目实施期间,对褐毛鲿的性成熟年龄、生殖季节、产卵水温、性腺发育与性周期、产卵类型与产卵量、室内产卵池催产、海上网箱催产、亲鱼产卵率、受精率、催产激素与剂量、全人工繁殖技术等所做的研究,讨论和总结了褐毛鲿亲鱼的强化培育,人工催产的方法与措施。%  In order to master reproductive biology of Megalonibea fusca, and break through its artificial propaga-tion technology, the paper introduced the researches on Megalonibea fusca during the project periods from 1998 to 2002, such as the research of sexual mature age, breeding seasons, spawning temperature, gonadic development and reproductive periods, spawning pattern and fecundity, induced spawning indoor pond, induced spawning in marine cage, spawning rate and fertilization rate of parent fish, hormones and dose, artificial propagation technology and so on. We discussed and summarized the methods and measures on intensive culture and induced spawning of parent fish.

  10. Isolation and Identification of Cellulolytic Bacteria from the Gut of Holotrichia parallela Larvae (Coleoptera: Scarabaeidae

    Directory of Open Access Journals (Sweden)

    Hongyu Zhang

    2012-02-01

    Full Text Available In this study, 207 strains of aerobic and facultatively anaerobic cellulolytic bacteria were isolated from the gut of Holotrichia parallela larvae. These bacterial isolates were assigned to 21 genotypes by amplified ribosomal DNA restriction analysis (ARDRA. A partial 16S rDNA sequence analysis and standard biochemical and physiological tests were used for the assignment of the 21 representative isolates. Our results show that the cellulolytic bacterial community is dominated by the Proteobacteria (70.05%, followed by the Actinobacteria (24.15%, the Firmicutes (4.35%, and the Bacteroidetes (1.45%. At the genus level, Gram-negative bacteria including Pseudomonas, Ochrobactrum, Rhizobium, Cellulosimicrobium, and Microbacterium were the predominant groups, but members of Bacillus, Dyadobacter, Siphonobacter, Paracoccus, Kaistia, Devosia, Labrys, Ensifer, Variovorax, Shinella, Citrobacter, and Stenotrophomonas were also found. Furthermore, our results suggest that a significant amount of bacterial diversity exists among the cellulolytic bacteria, and that Siphonobacter aquaeclarae, Cellulosimicrobium funkei, Paracoccus sulfuroxidans, Ochrobactrum cytisi, Ochrobactrum haematophilum, Kaistia adipata, Devosia riboflavina, Labrys neptuniae, Ensifer adhaerens, Shinella zoogloeoides, Citrobacter freundii, and Pseudomonas nitroreducens are reported to be cellulolytic for the first time in this study. Our results indicate that the scarab gut is an attractive source for the study of novel cellulolytic microorganisms and enzymes useful for cellulose degradation.

  11. Cellulolytic Bacteria Associated with the Gut of Dendroctonus armandi Larvae (Coleoptera: Curculionidae: Scolytinae

    Directory of Open Access Journals (Sweden)

    Xia Hu

    2014-03-01

    Full Text Available The object of this study was to investigate the cellulolytic bacterial community in the intestine of the Chinese white pine beetle (Dendroctonus armandi larvae. A total of 91 cellulolytic bacteria were isolated and assigned to 11 genotypes using amplified ribosomal DNA restriction analysis (ARDRA. Partial 16S rDNA sequence analysis and morphological tests were used to assign the 11 representative isolates. The results showed that the isolates belonged to α-Proteobacteria, γ-Proteobacteria and Firmicutes. Members of γ-Proteobacteria were the most frequently represented species and accounted for 73.6% of all the cellulolytic bacteria. The majority of cellulolytic bacteria in D. armandi larva gut were identified as Serratia and accounted for 49.5%, followed by Pseudomonas, which accounted for 22%. In addition, members of Bacillus, Brevundimonas, Paenibacillus, Pseudoxanthomonas, Methylobacterium and Sphingomonas were found in the D. armandi larva gut. Brevundimonas kwangchunensis, Brevundimonas vesicularis, Methylobacterium populi and Pseudoxanthomonas mexicana were reported to be cellulolytic for the first time in this study. Information generated from the present study might contribute towards understanding the relationship between bark beetle and its gut flora.

  12. Hydrodynamics and photosynthesis performance of Chlorella fusca (Chlorophyta) grown in a thin-layer cascade (TLC) system

    Czech Academy of Sciences Publication Activity Database

    Jerez, Celia G.; Navarro, E.; Rico, Rosa M.; Malpartida, I.; Masojídek, Jiří; Abdala, R.; Figueroa, Félix L.

    2014-01-01

    Roč. 22, č. 2 (2014), s. 111-122. ISSN 1864-7790 R&D Projects: GA MŠk ED2.1.00/03.0110 Grant ostatní: Government of Spain(ES) Project Ecolife CGL08-05407-C03-01; Junta de Andalucía(ES) RNM-295; Ministry of Economy and Competitiveness(ES) CTM2011-15659-E Institutional support: RVO:61388971 Keywords : Chlorella fusca * TLC * cultivation * photosynthesis Subject RIV: EE - Microbiology, Virology Impact factor: 1.258, year: 2014

  13. Overlapping and distinct roles of AKIN10 and FUSCA3 in ABA and sugar signaling during seed germination

    OpenAIRE

    Tsai, Allen Yi-Lun; Gazzarrini, Sonia

    2012-01-01

    The Arabidopsis B3-domain transcription factor FUSCA3 (FUS3) is a master regulator of seed maturation and also a central modulator of hormonal responses during late embryogenesis and germination. Recently, we have identified AKIN10, the Arabidopsis ortholog of Snf1 (Sucrose Non-Fermenting-1)–Related Kinase1 (SnRK1), as a FUS3-interacting protein. We demonstrated that AKIN10 physically interacts with and phosphorylates FUS3 at its N-terminal region, and genetically interacts with FUS3 to regul...

  14. Selective allylic hydroxylation of acyclic terpenoids by CYP154E1 from Thermobifida fusca YX

    Directory of Open Access Journals (Sweden)

    Anna M. Bogazkaya

    2014-06-01

    Full Text Available Allylic alcohols are valuable precursors in the synthesis of pharmaceutical intermediates, agrochemicals and natural products. Regioselective oxidation of parental alkenes is a challenging task for chemical catalysts and requires several steps including protection and deprotection. Many cytochrome P450 enzymes are known to catalyse selective allylic hydroxylation under mild conditions. Here, we describe CYP154E1 from Thermobifida fusca YX that enables this type of oxidation. Several acyclic terpenoids were tested as possible substrates for CYP154E1, and the regio- and chemoselectivity of their oxidation was investigated. Using a previously established bioinformatics approach we identified position 286 in the active site of CYP154E1 which is putatively involved in substrate binding and thereby might have an effect on enzyme selectivity. To tune regio- and chemoselectivity of the enzyme three mutants at position 286 were constructed and used for substrate oxidation. All formed products were analysed with GC–MS and identified using chemically synthesised authentic samples and known compounds as references. Best regioselectivity towards geraniol and nerol was observed with the wild type enzyme mainly leading to 8-hydroxy derivatives (8-hydroxygeraniol or 8-hydroxynerol with high selectivity (100% and 96% respectively. Highest selectivities during the oxidation of geranylacetone and nerylacetone were observed with the following variants: V286F led mainly to 7-hydroxygeranylacetone (60% of the total product and V286A produced predominantly 12-hydroxynerylacetone (75% of total product. Thus, CYP154E1 and its mutants expand the tool-box for allylic hydroxylation in synthetic chemistry.

  15. Cellulolytic Actinomycetes isolated from soil in Bukit Duabelas National Park, Jambi

    Directory of Open Access Journals (Sweden)

    ATIT KANTI

    2005-04-01

    Full Text Available The objective of study was to investigate the enzymatic activities of cellulolytic Actinomycetes. The soil sample was collected from Bukit Duabelas National Park, Jambi. Actinomycetes was isolated by Casein Agar Medium, and its cellulolytic capacity was determined by measuring the activity of CMC-ase. Two isolates of cellulolytic Actinomycetes belonged to genus Streptomyces were isolated. The CMC-ase activity was 7.7 unit and 13.4 unit for isolate I and isolate II respectively. The Km of isolate I and isolate II were 1.356x 10-3 and 1.595x 10-3 (% b/v respectively. Vmaks of isolate I and II was 1.658 x10-4 and 6.166x 10-4 µg glukosa/mL enzyme /minute, respectively.

  16. Relationship between soil cellulolytic activity and suppression of seedling blight of barley in arable soils

    DEFF Research Database (Denmark)

    Rasmussen, Peter Have; Knudsen, I.; Elmholt, S.;

    2002-01-01

    The objective was to investigate the relationship between soil suppression of seedling blight of barley caused by Fusarium culmorum (W.G. Smith) Sacc. and the soil cellulolytic activity of beta-glucosidase, cellobiohydrolase and endocellulase. Disease suppression was investigated in bioassays with...... test soils mixed with sand, and barley seeds inoculated with F. culmorum. After 19 days, disease severity was evaluated on the barley seedlings. Soil cellulolytic activities were measured using 4-methylumbelliferyl-labelled fluorogenic substrates, and were expressed as V-max values obtained by using...... content of total C and N. From the preliminary results obtained, it is proposed that the cellulolytic activity can be used as an enzymatic approach to study the microbial turnover of organic matter in soils and as indicator of seedling blight of barley caused by F. culmorum. (C) 2002 Elsevier Science B...

  17. Technique for preparation of anaerobic microbes: Rodshaped cellulolytic bacteria

    Directory of Open Access Journals (Sweden)

    Amlius Thalib

    2001-10-01

    Full Text Available Preparation of anaerobic-rod cellulolytic bacteria with coating technique has been conducted. Steps of the processes involved were cultivation, coating, evaporation, and drying. Coating agent used was Gum Arabic, and drying techniquesconducted were freeze drying and sun drying. pH of culture media was firstly optimized to obtain the maximal population ofbacteria. Both coated and uncoated preparates were subjected to drying. Morphological and Gram type identifications showed that uncoated preparate dried with freeze drying is not contaminated (ie. all bacteria are rod shape with Gram-negative type while the one dried with sun drying is not morphologically pure (ie. containing of both rod and coccus shapes with Gram negative and positive. The coated preparates dried by both freeze and sun drying, were not contaminated (ie. all are rods with Gram-negative. The coating and drying processes decreased viability of preparates significantly. However, the decreasing of viability of coated preparate are lower than uncoated preparate (ie. 89 vs. 97%. Total count of bacteria in sun-drying coated preparate are higher (P<0.05 than the uncoated preparate (ie. 3.38 x 1010 vs. 1.97 x 1010 colony/g DM. Activity of sun-drying coated preparate to digest elephant grass and rice straw was higher (P<0.01 than the sun-drying uncoated preparate with the in vitro DMD values were 42.7 vs. 35.5% for elephant grass substrate and 29.3 vs. 24.6% for rice straw substrate. Therefore, it is concluded that coating technique has a positive effects on the preparation of rumen bacteria.

  18. PGASO: A synthetic biology tool for engineering a cellulolytic yeast

    Directory of Open Access Journals (Sweden)

    Chang Jui-Jen

    2012-07-01

    Full Text Available Abstract Background To achieve an economical cellulosic ethanol production, a host that can do both cellulosic saccharification and ethanol fermentation is desirable. However, to engineer a non-cellulolytic yeast to be such a host requires synthetic biology techniques to transform multiple enzyme genes into its genome. Results A technique, named Promoter-based Gene Assembly and Simultaneous Overexpression (PGASO, that employs overlapping oligonucleotides for recombinatorial assembly of gene cassettes with individual promoters, was developed. PGASO was applied to engineer Kluyveromycesmarxianus KY3, which is a thermo- and toxin-tolerant yeast. We obtained a recombinant strain, called KR5, that is capable of simultaneously expressing exoglucanase and endoglucanase (both of Trichodermareesei, a beta-glucosidase (from a cow rumen fungus, a neomycin phosphotransferase, and a green fluorescent protein. High transformation efficiency and accuracy were achieved as ~63% of the transformants was confirmed to be correct. KR5 can utilize beta-glycan, cellobiose or CMC as the sole carbon source for growth and can directly convert cellobiose and beta-glycan to ethanol. Conclusions This study provides the first example of multi-gene assembly in a single step in a yeast species other than Saccharomyces cerevisiae. We successfully engineered a yeast host with a five-gene cassette assembly and the new host is capable of co-expressing three types of cellulase genes. Our study shows that PGASO is an efficient tool for simultaneous expression of multiple enzymes in the kefir yeast KY3 and that KY3 can serve as a host for developing synthetic biology tools.

  19. Utilization of simulated flue gas containing CO2, SO2, NO and ash for Chlorella fusca cultivation.

    Science.gov (United States)

    Duarte, Jessica Hartwig; Fanka, Letícia Schneider; Costa, Jorge Alberto Vieira

    2016-08-01

    Microalgae can use the CO2 from coal power plants in their metabolic pathways. However, these microorganisms must be able to tolerate other residues produced from burning coal. This study evaluated the wastes addition (CO2, SO2, NO and ash) present in the flue gas from a coal power plant on the growth parameters during culture, CO2 biofixation and on the biomass characterization of Chlorella fusca LEB 111. The SO2 and NO injection (until 400ppm) in cultivations did not markedly affect CO2 biofixation by microalga. The best CO2 biofixation efficiency was obtained with 10% CO2, 200ppm SO2 and NO and 40ppm ash (50.0±0.8%, w w(-1)), showing a specific growth rate of 0.18±0.01 d(-1). The C. fusca LEB 111 biomass composition was similar in all experiments with around 19.7% (w w(-1)) carbohydrates, 15.5% (w w(-1)) lipids and 50.2% (w w(-1)) proteins. PMID:27132223

  20. Effects of Water Miscible Organic Solvents on the Activity and Conformation of the Baeyer-Villiger Monooxygenases From Thermobifida fusca and Acinetobacter calcoaceticus : A Comparative Study

    NARCIS (Netherlands)

    Secundo, Francesco; Fiala, Stefano; Fraaije, Marco W.; de Gonzalo, Gonzalo; Meli, Massimiliano; Zambianchi, Francesca; Ottolina, Gianluca

    2011-01-01

    A broader exploitation of enzymes in organic synthesis can be achieved by increasing their tolerance toward organic solvents. In this study, the stability and activity of Baeyer-Villiger monooxygenases from Thermobifida fusca (PAMO) and Acinetobacter sp. (CHMO) in the presence of water miscible orga

  1. Metabolic engineering of a laboratory-evolved Thermobifida fusca muC strain for malic acid production on cellulose and minimal treated lignocellulosic biomass.

    Science.gov (United States)

    Deng, Yu; Mao, Yin; Zhang, Xiaojuan

    2016-01-01

    Malic acid is mainly used as an acidulant and taste enhancer in the beverage and food industry. Previously, a mutant strain Thermobifida fusca muC, obtained by adaptive evolution was found to accumulate malic acid on cellulose with low yield. In this study, the malic acid synthesis pathway in T. fusca muC was confirmed to be from phosphoenolpyruvate to oxaloacetate, followed by reduction of oxaloacetate to malate. To increase the yield of malic acid by the muC strain significantly, the carbon flux from pyruvate was redirected to oxaloacetate by expressing an exogenous pyruvate carboxylase (PCx) gene from Corynebacterium glutamicum ATCC 13032 in the chromosome of T. fusca muC-16. The yield of malic acid in the engineered strain muC-16 was increased by 47.9% compared to the parent strain muC. The muC-16 strain was then grown on ∼100 g/L cellulose and the highest titer of malic acid was 62.76 g/L by batch fermentation. T. fusca muC-16 strain converted milled corn stover to malic acid with the highest titer of 21.47 g/L with minimal treatment. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:14-20, 2016. PMID:26439318

  2. The impact of a parasitic nematode Thripinema fuscum (Tylenchida: Allantonematidae) on the feeding behavior and vector competence of Frankliniella fusca (Thysanoptera: Thripidae)

    Science.gov (United States)

    Frankliniella fusca (Hinds) (Thysanoptera: Thripidae) is the predominant thrips species found inhabiting and reproducing in peanut (Arachis hypogaea L.) and is one of at least seven thrips species reported to transmit Tomato spotted wilt virus (TSWV). The entomogenous nematode Thripinema fuscum Tipp...

  3. Evolution of Acetoclastic Methanogenesis in Methanosarcina via Horizontal Gene Transfer from Cellulolytic Clostridia▿ †

    OpenAIRE

    Fournier, Gregory P.; Gogarten, J. Peter

    2007-01-01

    Phylogenetic analysis confirmed that two genes required for acetoclastic methanogenesis, ackA and pta, were horizontally transferred to the ancestor of Methanosarcina from a derived cellulolytic organism in the class Clostridia. This event likely occurred within the last 475 million years, causing profound changes in planetary methane biogeochemistry.

  4. Determination of the cellulolytic activities of microorganisms isolated from poultry litter for sawdust degradation

    Directory of Open Access Journals (Sweden)

    Akpomie O.OF

    2013-03-01

    Full Text Available Cellulolytic activities of bacterial and fungal isolates obtained from poultry droppings were determined using the ability of each isolate to produce clear zones on Carboxyl Methyl Cellulose Agar plates. The bacterial isolates were Klebsiella, Streptococcus, Celulomonas, Escherichia coli and Micrococus species. The cellulolytic counts ranged from 5.02 x 104 + 3.42 to 7.20 x 109 + 6.12 cfu/g. The cellulolytic activities of the bacterial isolates ranged from 0.04 to 0.26 iu/m with Cellulomonas having the highest cellulose activity. The fungal isolates were Aspergillus niger, Mucor mucedo, Trichoderma sp. and Penicllium chrysogenum with cellulose activities of 0.24 + 0.021 0.19 + 0.031, 0.23 + 0.05 and 0.23 + 0.028iu/ml respectively. All the isolates were able to degrade the sawdust to varying extent. The percentage degradation was highest with Micrococcus sp. (78.20% and least with Trichoderma sp. (65.83%. The study shows that is a potential source of cellulolytic microorganisms which could be employed in the degradation of sawdust.

  5. Sample handling factors affecting the enumeration of lactobacilli and cellulolytic bacteria in equine feces

    Science.gov (United States)

    The objectives were to compare media types and evaluate the effects of fecal storage time and temperature on the enumeration of cellulolytic bacteria and lactobacilli from horses. Fecal samples were collected from horses (n = 3) and transported to the lab (CO2, 37 ºC, 0.5 h). The samples were assign...

  6. Cellulolytic and proteolytic ability of bacteria isolated from gastrointestinal tract and composting of a hippopotamus.

    Science.gov (United States)

    da Cruz Ramos, Geomárcia Feitosa; Ramos, Patricia Locosque; Passarini, Michel Rodrigo Zambrano; Vieira Silveira, Marghuel A; Okamoto, Débora Noma; de Oliveira, Lilian Caroline Gonçalves; Zezzo, Larissa Vieira; Marem, Alyne; Santos Rocha, Rafael Costa; da Cruz, João Batista; Juliano, Luiz; de Vasconcellos, Suzan Pantaroto

    2016-03-01

    The bioprospection for cellulase and protease producers is a promise strategy for the discovery of potential biocatalysts for use in hydrolysis of lignocellulosic materials as well as proteic residues. These enzymes can increment and turn viable the production of second generation ethanol from different and alternative sources. In this context, the goal of this study was the investigation of cellulolytic and proteolytic abilities of bacteria isolated from the gastrointestinal tract of a hippopotamus as well as from its composting process. It is important to highlight that hippopotamus gastrointestinal samples were a non-typical sources of efficient hydrolytic bacteria with potential for application in biotechnological industries, like biofuel production. Looking for this, a total of 159 bacteria were isolated, which were submitted to qualitative and quantitative enzymatic assays. Proteolytic analyzes were conducted through the evaluation of fluorescent probes. Qualitative assays for cellulolytic abilities revealed 70 positive hits. After quantitative analyzes, 44 % of these positive hits were selected, but five (5) strains showed cellulolytic activity up to 11,8 FPU/mL. Regarding to proteolytic activities, six (6) strains showed activity above 10 %, which overpassed results described in the literature. Molecular analyzes based on the identification of 16S rDNA, revealed that all the selected bacterial isolates were affiliated to Bacillus genus. In summary, these results strongly indicate that the isolated bacteria from a hippopotamus can be a potential source of interesting biocatalysts with cellulolytic and proteolytic activities, with relevance for industrial applications. PMID:26931430

  7. The occurrence and distribution of cellulolytic fungi and Fusarium in seven Montagu’s Harrier (Circus pygargus

    Directory of Open Access Journals (Sweden)

    Teresa Korniłłowicz-Kowalska

    2013-12-01

    Full Text Available A total of 45 species of cellulolytic fungi and ten Fusarium species were identified. Three genera (Chaetomium, Trichoderma, Fusarium represented 80% of the frequency of cellulolytic fungi. Of them, Chaetomium globosum, Trichoderma viride and T. koningii were some of the most frequent species. A high differentiation of the richness and frequency of species of cellulolytic fungi depending on the nest and its individual layers was observed. Reasons for the differences in the frequency and species composition of the fungi were discussed.

  8. Compositions comprising a polypeptide having cellulolytic enhancing activity and a nitrogen-containing compound and uses thereof

    Energy Technology Data Exchange (ETDEWEB)

    Quinlan, Jason; Xu, Feng; Sweeney, Matthew

    2016-05-31

    The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a nitrogen-containing compound. The present invention also relates to methods of using the compositions.

  9. Toxicity and antifeedant activity of essential oils from three aromatic plants grown in Colombia against Euprosterna elaeasa and Acharia fusca (Lepidoptera:Limacodidae)

    Institute of Scientific and Technical Information of China (English)

    Ricardo Hernández-Lambraño; Karina Caballero-Gallardo; Jesus Olivero-Verbel

    2014-01-01

    Objective:To determine the biological effects of essential oils (EOs) isolated from Cymbopogon nardus, Cymbopogon flexuosus and Cymbopogon martinii grown in Colombia against two Lepidoptera larvae, common pests in the oil palm. Methods:Specimens were captured in the field and the antifeedant activity and dermal contact lethality of EOs were measured against Acharia fusca and Euprosterna elaeasa (Lepidoptera:Limacodidae) at various concentrations 0.002-0.600 μL/cm2 and 0.002-8 μL/g, respectively. Results: All EOs exhibited strong antifeedant and toxicity activity toward Acharia fusca and Euprosterna elaeasa larvae. Cymbopogon martinii oil was the most active against both pest insect species, although all tested EOs were better than the synthetic repellent IR3535 on both insects. Conclusions:Colombian EOs have potential for integrated pest management programs in the oil palm industry.

  10. Toxicity and antifeedant activity of essential oils from three aromatic plants grown in Colombia against Euprosterna elaeasa and Acharia fusca(Lepidoptera:Limacodidae)

    Institute of Scientific and Technical Information of China (English)

    Ricardo; Hernández-Lambrao; Karina; Caballero-Gallardo; Jesus; Olivero-Verbel

    2014-01-01

    Objective:To determine the biological effects of essential oils(EOs) isolated from Cymbopogon iiardus,Cymbopogon Jlexuosus and Cvrnbopogon marlinii grown in Colombia against two Lepidoptera larvae,common pests in the oil palm.Methods:Specimens were captured in the field and the antifeedant activity and dermal contact lethality of EOs were measured against Acharia fusca and Euprosterna elaeasa(Lepidoptera:I.imacodidae) at various concentrations 0.002-0.600 μL/cm~3 and 0.002-8 μL/g,respectively.Results:All EOs exhibited strong antifeedant and toxicity activity toward Acharia fusca and Euprosterna elaeasa larvae.Cymbopogon marlinii oil was llie most active againsl both pest insect species,although all tested EOs were better than the synthetic;repellent IR535 on both insects.Conclusions:Colombian EOs have potential for integrated pest management programs in the oil palm industry.

  11. EJECTION OF THE WART CONTENT INCLUDING WHEEL-SHAPED OSSICLES FROM THE BODY WALL OF THE APODID SEA CUCUMBER POLYCHEIRA FUSCA (RUFESCENS) INDUCED BY MECHANICAL STIMULATION

    OpenAIRE

    Kubota, Tomoyuki; INADA, Kozi

    2003-01-01

    The apodid sea cucumber Polycheira fusca that was pushed hard on its body surface ejected the wart contents including the wheel-shaped ossicles from the body wall. The ejection always occurred quickly in a small circular region around the press point, indicating that pushing caused a nervous signal, which was diffusely conducted to the surrounding area and induced rupture of the warts and ejection of their contents. All ejected ossicles dispersed but were still attached to the wall by a branc...

  12. Deciphering the molecular mechanisms behind cellulase production in Trichoderma reesei, the hyper-cellulolytic filamentous fungus.

    Science.gov (United States)

    Shida, Yosuke; Furukawa, Takanori; Ogasawara, Wataru

    2016-09-01

    The filamentous fungus Trichoderma reesei is a potent cellulase producer and the best-studied cellulolytic fungus. A lot of investigations not only on glycoside hydrolases produced by T. reesei, but also on the machinery controlling gene expression of these enzyme have made this fungus a model organism for cellulolytic fungi. We have investigated the T. reesei strain including mutants developed in Japan in detail to understand the molecular mechanisms that control the cellulase gene expression, the biochemical and morphological aspects that could favor this phenotype, and have attempted to generate novel strains that may be appropriate for industrial use. Subsequently, we developed recombinant strains by combination of these insights and the heterologous-efficient saccharifing enzymes. Resulting enzyme preparations were highly effective for saccharification of various biomass. In this review, we present some of the salient findings from the recent biochemical, morphological, and molecular analyses of this remarkable cellulase hyper-producing fungus. PMID:27075508

  13. Biodiversity characterization of cellulolytic bacteria present on native Chaco soil by comparison of ribosomal RNA genes.

    Science.gov (United States)

    Talia, Paola; Sede, Silvana M; Campos, Eleonora; Rorig, Marcela; Principi, Dario; Tosto, Daniela; Hopp, H Esteban; Grasso, Daniel; Cataldi, Angel

    2012-04-01

    Sequence analysis of the 16S ribosomal RNA gene was used to study bacterial diversity of a pristine forest soil and of two cultures of the same soil enriched with cellulolytic bacteria. Our analysis revealed high bacterial diversity in the native soil sample, evidencing at least 10 phyla, in which Actinobacteria, Proteobacteria and Acidobacteria accounted for more than 76% of all sequences. In both enriched samples, members of Proteobacteria were the most frequently represented. The majority of bacterial genera in both enriched samples were identified as Brevundimonas and Caulobacter, but members of Devosia, Sphingomonas, Variovorax, Acidovorax, Pseudomonas, Xanthomonas, Stenotrophomonas, Achromobacter and Delftia were also found. In addition, it was possible to identify cellulolytic taxa such as Acidothermus, Micromonospora, Streptomyces, Paenibacillus and Pseudomonas, which indicates that this ecosystem could be an attractive source for study of novel enzymes for cellulose degradation. PMID:22202170

  14. Cloning, expression and characterization of glycoside hydrolases from the thermophilic cellulolytic anaerobic bacterium Caldicellulosiruptor kristjanssonii

    OpenAIRE

    Skalman, Lars Nygård

    2010-01-01

    Lignocellulosic biomass has great potential as a substrate for ethanol production as it is a renewable and rather abundant energy source. However, the rigid and complex structure of lignocellulose is a major bottleneck preventing the development of cost-effective production methods. By the use of thermostable cellulolytic enzymes, hydrolysis of cellulose and fermentation of glucose to ethanol could be performed at high temperatures and this would lower the production cost of ethanol significa...

  15. RESEARCH OF INFLUENCE OF GLYCEROL ON HYDROLYSIS AND FERMENTATION OF MEADOW GRASS BY CELLULOLYTIC ACTINOMYCETES

    OpenAIRE

    Sultanova, L.; Zorin, V.; Petukhova, N.; Sharaeva, A.; Mikhailova, T.; Fedorova, V.

    2011-01-01

    It has been shown that pre-treatment of meadow grass with saline water solutions containing 220 % of glycerol (temperature 120 oC, pressure 98 kPa, time 1 hour) and further washing of lignocelluloses substrate by water lead to significant increase of microorganisms growth, yield of reducing substances and KMC-cellulase activity of extracellular enzymes during the period of cellulolytic actinomycetes cultivation.

  16. Enrichment and characterization of an anaerobic cellulolytic microbial consortium SQD-1.1 from mangrove soil.

    Science.gov (United States)

    Gao, Zhao-Ming; Xu, Xun; Ruan, Ling-Wei

    2014-01-01

    Enrichment of microbial consortia provides an approach to simulate and investigate microbial communities in natural environments. In this study, a cellulolytic microbial consortium SQD-1.1 was enriched from mangrove soil of Qinglan port (Hainan, China) by 27 times continuous subcultivation under anaerobic static conditions. The consortium could completely degrade 0.2% (w/v) filter paper within 3 days and utilized it as the sole carbon source. PCR-denaturing gradient gel electrophoresis analysis revealed a stable microbial community structure in the incubation process of 10 days and in the procedure of subcultivation. Twenty-four operational taxonomic units belonging to seven phyla were obtained from the full-length 16S rRNA gene library. Five clones, closest related to the genera Alkaliflexus, Clostridium, Alistipes, Spirochaeta, and Trichococcus, were the predominant ones. Among them, M117, phylogeneticly showing high similarity (16S rRNA gene identity, 95.3%) with the cellulolytic anaerobic bacterium Clostridium straminisolvens CSK1(T), was the potential key cellulolytic bacterium. Using the plate cultivation method, 12 strains, including one potential new species and four potential new species of new genera, were isolated. The strain P2, corresponding to the most frequently detected clone (M05) in the 16S rRNA gene library, showed both CMCase and xylanase activity and may be another important cellulolytic bacterium. The findings of cellulase activity in cell pellet and cohesion and dockerin domains in metagenome data further suggested the potential of utilization of cellulosomes by the consortium to degrade cellulose. Consortium SQD-1.1 provides a candidate for investigating the mechanism of cellulose degradation under anoxic conditions in natural environments. PMID:23529681

  17. Paenibacillus curdlanolyticus Strain B-6 Xylanolytic-Cellulolytic Enzyme System That Degrades Insoluble Polysaccharides

    OpenAIRE

    Pason, Patthra; Kyu, Khin Lay; Ratanakhanokchai, Khanok

    2006-01-01

    A facultatively anaerobic bacterium, Paenibacillus curdlanolyticus B-6, isolated from an anaerobic digester produces an extracellular xylanolytic-cellulolytic enzyme system containing xylanase, β-xylosidase, arabinofuranosidase, acetyl esterase, mannanase, carboxymethyl cellulase (CMCase), avicelase, cellobiohydrolase, β-glucosidase, amylase, and chitinase when grown on xylan under aerobic conditions. During growth on xylan, the bacterial cells were found to adhere to xylan from the early exp...

  18. Cellulolytic ability of Penicillium strains isolated from soil of the Brazilian Atlantic forest

    OpenAIRE

    Cruz, R.; Lima, J. S.; Fonseca, J. C.; Ferreira, M. J. S.; Moreira, K. A.; Santos, C; de Souza-Motta, Cristina Maria

    2012-01-01

    Penicillium spp. are capable of degrading plant wastes by producing large amounts of enzymes such as cellulases. These form a complex capable of acting on cellulosic materials and producing sugars with industrial interest (e.g., ethanol production). Cellulases are also used for (a) pulp and paper industry (b) in the textile industry. The aim of this study was to evaluate the cellulolytic capability of 17 strains of Penicillium isolated from soil of the Brazilian Atlantic Forest...

  19. Studies of the Extracellular Glycocalyx of the Anaerobic Cellulolytic Bacterium Ruminococcus albus 7▿

    OpenAIRE

    Weimer, Paul J.; Price, Neil P. J.; Kroukamp, Otini; Joubert, Lydia-Marie; Wolfaardt, Gideon M.; Van Zyl, Willem H

    2006-01-01

    Anaerobic cellulolytic bacteria are thought to adhere to cellulose via several mechanisms, including production of a glycocalyx containing extracellular polymeric substances (EPS). As the compositions and structures of these glycocalyces have not been elucidated, variable-pressure scanning electron microscopy (VP-SEM) and chemical analysis were used to characterize the glycocalyx of the ruminal bacterium Ruminococcus albus strain 7. VP-SEM revealed that growth of this strain was accompanied b...

  20. Cellulolytic enzymes on lignocellulosic substrates in solid state fermentation by Aspergillus niger

    OpenAIRE

    Chandra, M. Subhosh; Viswanath, Buddolla; Reddy, B. Rajasekhar

    2007-01-01

    The production of cellulolytic enzymes by Aspergillus niger on lignocellulosic substrates groundnut fodder, wheat bran, rice bran and sawdust in solid state fermentation in a laboratory scale was compared. Czapek Dox liquid broth amended with cellulose (0.5%) was used to moisten lignocellulosic solid supports for cultivation of Aspergillus niger. The production of filter paperase, carboxymethyl cellulase and -glucosidase were monitored at daily intervals for 5 days. The peak production of the...

  1. Activity of Cellulolytic Enzymes Immobilized on Some Organic and Inorganic Matter of Soil

    OpenAIRE

    H. Shariatmadari; G. Emtiazi; A. A. Safari Sinejani

    2002-01-01

    Soil organic matter and clay minerals adsorb and immobilize extracellular enzymes of microorganisms and increase soil enzymes stability. This study aims to clarify the relative importance of soil organic matter and clay minerals on the cellulolytic activities of soils. Fluca prepared cellulase was immobilized on some agricultural residues and clay minerals, avicel and a sample of soil. Immobilized exoglucanase and endoglucanase were assayed at different times. Activities of the immobilized en...

  2. Engineering of a novel cellulose-adherent cellulolytic Saccharomyces cerevisiae for cellulosic biofuel production

    OpenAIRE

    Zhuo Liu; Shih-Hsin Ho; Kengo Sasaki; Riaan den Haan; Kentaro Inokuma; Chiaki Ogino; van Zyl, Willem H; Tomohisa Hasunuma; Akihiko Kondo

    2016-01-01

    Cellulosic biofuel is the subject of increasing attention. The main obstacle toward its economic feasibility is the recalcitrance of lignocellulose requiring large amount of enzyme to break. Several engineered yeast strains have been developed with cellulolytic activities to reduce the need for enzyme addition, but exhibiting limited effect. Here, we report the successful engineering of a cellulose-adherent Saccharomyces cerevisiae displaying four different synergistic cellulases on the cell ...

  3. Cellulolytic and proteolytic ability of bacteria isolated from gastrointestinal tract and composting of a hippopotamus

    OpenAIRE

    da Cruz Ramos, Geomárcia Feitosa; Ramos, Patricia Locosque; Passarini, Michel Rodrigo Zambrano; Vieira Silveira, Marghuel A.; Okamoto, Débora Noma; de Oliveira, Lilian Caroline Gonçalves; Zezzo, Larissa Vieira; Marem, Alyne; Santos Rocha, Rafael Costa; da Cruz, João Batista; Juliano, Luiz; de Vasconcellos, Suzan Pantaroto

    2016-01-01

    The bioprospection for cellulase and protease producers is a promise strategy for the discovery of potential biocatalysts for use in hydrolysis of lignocellulosic materials as well as proteic residues. These enzymes can increment and turn viable the production of second generation ethanol from different and alternative sources. In this context, the goal of this study was the investigation of cellulolytic and proteolytic abilities of bacteria isolated from the gastrointestinal tract of a hippo...

  4. Evaluation in Cellulolytic Activity of Stenotrophomonas sp. in Cellulose Nitrogen Free Mineral Medium

    International Nuclear Information System (INIS)

    Three bacterial strains were isolated from rice rhizospheric soil and their nitrogen fixing activity was determined in nitrogen free mineral medium and broth with glucose and cellulose as carbon sources and they produced ammonium concentration (above 3ppm) in G-NFFMM and (2-3ppm) in C-NFMM. Moreover, their cellulolytic activity was determined by DNS mothod and strain H3 having the cellulolytic activity was selected. Then, cellulose, carboxymethyl cellulose, baggasse, pea haulm, corn stem, rice straw were used as substrates and determined its reducing sugar concentration. After detection of the cellulolytic activity, the bacteria produced the highest concentration of reducing sugar on cellulose substrate at 12 day incubation period with the reducing sugar amount of 0.12mg/ml and 0.298mg/ml on CMC substrates. In the study of argicultral wastes as substrates, the selected strain, H3, produced in the reducing sugar concentration with 0.12, 0.116,0.103 and 0.098mg/ml respectively. The selected strain was identified by biochemical characterists and 16s ribosomal DNA analysis and it was Stenotrophomonas sp.

  5. Leopard Panthera pardus fusca Density in the Seasonally Dry, Subtropical Forest in the Bhabhar of Terai Arc, Nepal

    Directory of Open Access Journals (Sweden)

    Kanchan Thapa

    2014-01-01

    Full Text Available We estimated leopard (Panthera pardus fusca abundance and density in the Bhabhar physiographic region in Parsa Wildlife Reserve, Nepal. The camera trap grid, covering sampling area of 289 km2 with 88 locations, accumulated 1,342 trap nights in 64 days in the winter season of 2008-2009 and photographed 19 individual leopards. Using models incorporating heterogeneity, we estimated 28 (±SE 6.07 and 29.58 (±SE 10.44 leopards in Programs CAPTURE and MARK. Density estimates via 1/2 MMDM methods were 5.61 (±SE 1.30 and 5.93 (±SE 2.15 leopards per 100 km2 using abundance estimates from CAPTURE and MARK, respectively. Spatially explicit capture recapture (SECR models resulted in lower density estimates, 3.78 (±SE 0.85 and 3.48 (±SE 0.83 leopards per 100 km2, in likelihood based program DENSITY and Bayesian based program SPACECAP, respectively. The 1/2 MMDM methods have been known to provide much higher density estimates than SECR modelling techniques. However, our SECR models resulted in high leopard density comparable to areas considered better habitat in Nepal indicating a potentially dense population compared to other sites. We provide the first density estimates for leopards in the Bhabhar and a baseline for long term population monitoring of leopards in Parsa Wildlife Reserve and across the Terai Arc.

  6. Habitat selection and ecological speciation in Galápagos warbler finches (Certhidea olivacea and Certhidea fusca).

    Science.gov (United States)

    Tonnis, Brandon; Grant, Peter R; Grant, B Rosemary; Petren, Kenneth

    2005-04-22

    We investigated phylogeographic divergence among populations of Galápagos warble finches. Their broad distribution, lack of phenotypic differentiation and low levels of genetic divergence make warbler finches an appropriate model to study speciation in allopatry. A positive relationship between genetic and geographical distance is expected for island taxa. Warbler finches actually showed a negative isolation by distance relationship, causing us to reject the hypothesis of distance-limited dispersal. An alternative hypothesis, that dispersal is limited by habitat similarity, was supported. We found a positive correlation between genetic distances and differences in maximum elevation among islands, which is an indicator of ecological similarity. MtDNA sequence variation revealed monophyletic support for two distinct species. Certhidea olivacea have recently dispersed among larger central islands, while some Certhidea fusca have recently dispersed to small islands at opposite ends of the archipelago. We conclude that females have chosen to breed on islands with habitats similar to their natal environment. Habitat selection is implicated as an important component of speciation of warbler finches, which is the earliest known divergence of the adaptive radiation of Darwin's finches. These results suggest that small populations can harbour cryptic but biologically meaningful variation that may affect longer term evolutionary processes. PMID:15940826

  7. Orthophosphate influx and efflux rates of Chlorella fusca measured in a continuous turbidostat culture with 32P under various conditions

    International Nuclear Information System (INIS)

    The main objective of the experiments with Chlorella fusca strain 211-8b was to measure the unidirectional influx rates of phosphate into non-phosphate-starved algae under different steady-state conditions (light, temperature, 3-phosphoglycerate influence) or following the addition of several photosynthesis and phosphate transport inhibitors. For a continuous steady-state culture grown in the light (250C) the unidirectional influx rate measured with 32P is 260 times higher than the net uptake rate calculated from the mass balance using the data of this culture. In all experiments except the controls, the specific activity of the intracellular inorganic orthophosphate compartment oscillates around a constant mean value which never reaches the specific activity of the nutrient medium within the duration of the short-term experiments. The inhibitors strongly affect the characteristics of the oscillations. The unidirectional influx rates are constant. Oscillating flushing rates with unlabelled phosphate from a storage compartment have been postulated to explain the oscillations. Oscillating rates from the individual cells are apparently synchronized by an unknown mechanism. (orig./MG)

  8. Recombination of thermo-alkalistable, high xylooligosaccharides producing endo-xylanase from Thermobifida fusca and expression in Pichia pastoris.

    Science.gov (United States)

    Wang, Qian; Du, Wen; Weng, Xiao-Yan; Liu, Ming-Qi; Wang, Jia-Kun; Liu, Jian-Xin

    2015-02-01

    For xylooligosaccharide (XO) production, endo-xylanase from Thermobifida fusca was modified by error-prone PCR and DNA shuffling. The G4SM1 mutant (S62T, S144C, N198D, and A217V) showed the most improved hydrolytic activity and was two copies expressed in Pichia pastoris under the control of GAP promoter. The maximum xylanase activity in culture supernatants was 165 ± 5.5 U/ml, and the secreted protein concentration reached 493 mg/l in a 2-l baffled shake flask. After 6× His-tagged protein purification, the specific activity of G4SM1 was 2036 ± 45.8 U/mg, 2.12 times greater than that of wild-type enzyme. Additionally, G4SM1 was stable over a wide pH range from 5.0 to 9.0. Meanwhile, half-life of G4SM1 thermal inactivation at 70 °C increased 8.5-fold. Three-dimensional structures suggest that two amino acid substitutions, S62T and S144C, located at catalytic domain may be responsible for the enhanced activity and thermostability of xylanase. Xylobiose was the dominant end product of xylan hydrolysis by G4SM1. Due to its attractive biochemical properties, G4SM1 has potential value in commercial XO production. PMID:25384545

  9. Nitric oxide and heat shock protein 90 co-regulate temperature-induced bleaching in the soft coral Eunicea fusca

    Science.gov (United States)

    Ross, Cliff

    2014-06-01

    Coral bleaching represents a complex physiological process that is affected not only by environmental conditions but by the dynamic internal cellular biology of symbiotic dinoflagellates ( Symbiodinium spp.) and their cnidarian hosts. Recently, nitric oxide (NO) has emerged as a key molecule involved with the expulsion of Symbiodinium from host cnidarian cells. However, the site of production remains under debate, and the corresponding signaling pathways within and between host and endosymbiont remain elusive. In this study, using freshly isolated Symbiodinium from the soft coral Eunicea fusca, I demonstrate that thermally induced stress causes an upregulation in Symbiodinium heat shock protein 90 (Hsp90). In turn, Hsp90 shows a concomitant ability to enhance the activity of a constitutively expressed isoform of NO synthase. The resulting production of NO constitutes a signaling molecule capable of inducing Symbiodinium expulsion. Using nitric oxide synthase (NOS) and Hsp90 polyclonal antibodies, thermal stress-induced Hsp90 was shown to co-immunoprecipitate with a constitutive isoform of NOS. The specific blocking of Hsp90 activity, with the Hsp90 inhibitor geldanamycin, was capable of inhibiting NO production implicating the involvement of a coordinated regulatory system. These results have strong evolutionary implications for Hsp90-NOS chaperone complexes among biological kingdoms and provide evidence for a new functional role in symbiotic associations.

  10. Development of Detection Methods for Cellulolytic Activity of Auricularia auricula-judae

    OpenAIRE

    Jo, Woo-Sik; Bae, Soon-Hwa; Choi, Seung-Yong; Park, So-Deuk; Yoo, Young-Bok; Park, Seung-Chun

    2010-01-01

    To obtain basic information on the detection of cellulolytic activity in Auricularia auricula-judae, the influences of dye reagent, pH, and temperature were assessed. Chromogenic dye (congo red, phenol red, remazol brilliant blue, and trypan blue) was individually incorporated into a medium containing either carboxymethyl-cellulose, Avicel, or D-cellobiose as a polysaccharide carbon substrate. The other assessments utilized pHs ranging from 4.5 to 8.0 and temperatures from 15~35℃. Overall, wh...

  11. Enzymatic activity of the cellulolytic complex produced by trichoderma reesei. Enzymatic hydrolysis of cellulose

    International Nuclear Information System (INIS)

    The enzymatic activity characterization of the cellulolytic complex obtained from Trichoderma reese QM 9414 and the influence of the enzymatic hydrolysis conditions on the hydrolysis yield are studied. Pure cellulose and native or alkali pretreated biomass from Onopordum nervosum have been used as substrates. The values of pH, temperature, substrate concentration and enzyme-substrate ratio for the optimum activity of that complex, evaluated as glucose and reducing sugars productions, have been selected. Previous studies on enzymatic hydrolysis of O. nervosum have shown a remarkable effect of the alkaline pretreatments on the final hydrolysis yield. (author). 10 figs.; 10 refs

  12. Enzymatic activity of the cellulolytic complex produced by Trichoderma reesei. Enzymatic hydrolysis of cellulose

    International Nuclear Information System (INIS)

    The enzymatic activity characterization of the cellulolytic complex obtained from Trichoderma reesei QM 9414 and the influence of the enzymatic hydrolysis conditions on the hydrolysis yield are studied. Pure cellulose and native or alkali pretreated biomass Onopordum nervosum have been used as substrates. The values of pH, temperature, substrate concentration and enzyme-substrate ratio for the optimum activity of that complex, evaluated as glucose and reducing sugars production, have been selected. Previous studies on enzymatic hydrolysis of 0. nervosum have shown a remarkable effect of the alkaline pretreatments on the final hydrolysis yield. (Author) 10 refs

  13. Relationship between soil cellulolytic activity and suppression of seedling blight of barley in arable soils

    DEFF Research Database (Denmark)

    Rasmussen, Peter Have; Knudsen, I.; Elmholt, S.; Jensen, D. F.

    2002-01-01

    the Hanes-Wolf transformation of the Michaelis-Menten equation. Soil samples from 6 to 13 cm depth were collected in the early spring as undisturbed blocks from 10 arable soils with different physico-chemical properties and cultivation history. Significant correlations were found between soil...... content of total C and N. From the preliminary results obtained, it is proposed that the cellulolytic activity can be used as an enzymatic approach to study the microbial turnover of organic matter in soils and as indicator of seedling blight of barley caused by F. culmorum. (C) 2002 Elsevier Science B...

  14. Cloning of the Thermomonospora fusca Endoglucanase E2 gene in Streptomyces lividans: Affinity purification and functional domains of the cloned gene product

    Energy Technology Data Exchange (ETDEWEB)

    Ghangas, G.S.; Wilson, D.B. (Cornell Univ., Ithaca, NY (USA))

    1988-10-01

    Thermomonospora fusca YX grown in the presence of cellulose produces a number of {beta}-1-4-endoglucanases, some of which bind to microcrystalline cellulose. By using a multicopy plasmid, pIJ702, a gene coding for one of these enzymes (E2) was cloned into Streptomyces lividans and then mobilized into both Escherichia coli and Streptomyces albus. The gene was localized to a 1.6-kilobase PvuII-ClaI segment of the originally cloned 3.0-kilobase SstI fragment of Thermomonospora DNA. The culture supernatants of Streptomyces transformants contain a major endoglucanase that cross-reacts with antibody against Thermomonospora cellulase E2 and has the same molecular weight (43,000) as T. fusca E2. This protein binds quickly and tightly to Avicel. It also binds to filter paper but at a slower rate than to Avicel. Several large proteolytic degradation products of this enzyme generated in vivo lose the ability to bind to Avicel and have higher activity on carboxymethyl cellulose than the native enzyme. Other smaller products bind to Avicel but lack activity. A weak cellobiose-binding site not observed in the native enzyme was present in one of the degradation products. In E. coli, the cloned gene produced a cellulase that also binds tightly to Avicel but appeared to be slightly larger than T. fusca E2. The activity of intact E2 from all organisms can be inactivated by Hg{sup 2+} ions. Dithiothreitol protected against Hg{sup 2+} inactivation and reactivated both unbound and Avicel-bound Hg{sub 2+}-inhibited E2, but at different rates.

  15. mRNA secondary structure engineering of Thermobifida fusca endoglucanase (Cel6A) for enhanced expression in Escherichia coli.

    Science.gov (United States)

    Ali, Imran; Asghar, Rehana; Ahmed, Sajjad; Sajjad, Muhammad; Tariq, Muhammad; Waheed Akhtar, M

    2015-03-01

    The sequence and structure of mRNA plays an important role in solubility and expression of the translated protein. To divulge the role of mRNA secondary structure and its thermodynamics in the expression level of the recombinant endoglucanase in Escherichia coli, 5'-end of the mRNA was thermodynamically optimized. Molecular engineering was done by introducing two silent synonymous mutations at positions +5 (UCU with UCC) and +7 (UUC with UUU) of the 5'-end of mRNA to relieve hybridization with ribosomal binding site. Two variants of glycoside hydrolase family six endoglucanase, wild type (cel6A.wt) and mutant (cel6A.mut) from Thermobifida fusca were expressed and characterized in E. coli using T7 promoter-based expression vector; pET22b(+). Enhanced expression level of engineered construct (Cel6A.mut) with ∆G = -2.7 kcal mol(-1)was observed. It showed up to ~45 % higher expression as compared to the wild type construct (Cel6A.wt) having ∆G = -7.8 kcal mol(-1) and ~25 % expression to the total cell proteins. Heterologous protein was purified by heating the recombinant E. coli BL21 (DE3) CodonPlus at 60 °C. The optimum pH for enzyme activity was six and optimum temperature was 60 °C. Maximum activity was observed 4.5 Umg(-1) on CMC. Hydrolytic activity was also observed on insoluble substrates, i.e. RAC (2.8 Umg(-1)), alkali treated bagass (1.7 Umg(-1)), filter paper (1.2 Umg(-1)) and BMCC (0.3 Umg(-1)). Metal ions affect endoglucanase activity in different ways. Only Fe(2+) exhibited 20.8 % stimulatory effects on enzyme activity. Enzyme activity was profoundly inhibited by Hg2(+) (91.8 %). PMID:25617066

  16. Studies on cellulolytic bacteria isolated from a steer and a buffalo

    International Nuclear Information System (INIS)

    A simple method using medium enriched with Whatman No. 1 filter paper as the sole selective substrate proved to be very effective in the isolation of cellulolytic bacteria from the rumen of a steer and a buffalo. Both animals were fed a high fibre ration. Most of the cellulolytic bacteria isolated were identified as Bacteriodes succinogenes; Ruminococcus flaveflaciens was detected less frequently. However, no R. albus was isolated. The colonies were contaminated with Butyrivibrio sp. but not with Borrelia sp. The method described is effective, requires less time than the conventional cellulose agar method of isolation and is superior to the latter because pure colonies of B. succinogenes, which usually escape detection because of their failure to produce clear zones, can be detected. In clear zone experiments with cellulose (Whatman No. 1 filter paper) agar (1.3% wt/vol.) roll tubes, B. succinogenes and Butyrivibrio sp. were unable to produce clear zones, whereas mixed cultures were. However, R. flaveflaciens in its pure form was able to produce clearings which had centre colonies. (author)

  17. Flow cytometry community fingerprinting and amplicon sequencing for the assessment of landfill leachate cellulolytic bioaugmentation.

    Science.gov (United States)

    Kinet, R; Dzaomuho, P; Baert, J; Taminiau, B; Daube, G; Nezer, C; Brostaux, Y; Nguyen, F; Dumont, G; Thonart, P; Delvigne, F

    2016-08-01

    Flow cytometry (FCM) is a high throughput single cell technology that is actually becoming widely used for studying phenotypic and genotypic diversity among microbial communities. This technology is considered in this work for the assessment of a bioaugmentation treatment in order to enhance cellulolytic potential of landfill leachate. The experimental results reveal the relevant increase of leachate cellulolytic potential due to bioaugmentation. Cytometric monitoring of microbial dynamics along these assays is then realized. The flow FP package is used to establish microbial samples fingerprint from initial 2D cytometry histograms. This procedure allows highlighting microbial communities' variation along the assays. Cytometric and 16S rRNA gene sequencing fingerprinting methods are then compared. The two approaches give same evidence about microbial dynamics throughout digestion assay. There are however a lack of significant correlation between cytometric and amplicon sequencing fingerprint at genus or species level. Same phenotypical profiles of microbiota during assays matched to several 16S rRNA gene sequencing ones. Flow cytometry fingerprinting can thus be considered as a promising routine on-site method suitable for the detection of stability/variation/disturbance of complex microbial communities involved in bioprocesses. PMID:27160955

  18. In vitro Cellulose Rich Organic Material Degradation by Cellulolytic Streptomyces albospinus (MTCC 8768

    Directory of Open Access Journals (Sweden)

    Pinky Prasad

    2012-09-01

    Full Text Available Aims: Cellulosic biomass is the only foreseeable sustainable source of fuels and is also one of the dominating waste materials in nature resulting from human activities. Keeping in view the environmental problems like disposal of large volumes of cellulosic wastes and shortage of fossil fuel in the world, the main aim of the present investigation was to characterize and study the cellulolytic activity of Streptomyces albospinus (MTCC 8768, isolated from municipal wastes, on natural cellulosic substrates viz. straw powder, wood powder and finely grated vegetable peels.Methodology and Result: Stanier’s Basal broth with 100 mg of each of the substrates was inoculated separately with S. albospinus (MTCC No. 8768 and incubated at 37 °C for 8 days. The cellulosic substrates were re-weighed at an interval of 2 days and the difference between the initial weight and the final weight gave the amount of substratesdegraded by the isolate. It was observed that maximum degradation was observed in the grated vegetable peels (64 mg followed by straw powder (38 mg and wood powder (28 mg over a period of 8 days.Conclusion, significance and impact of study: By the selection of efficient cellulolytic microorganisms and cost-effective operational techniques, the production of useful end products from the biodegradation of the low cost enormous stock of cellulose in nature can be very beneficial.

  19. Cellulolytic enzymes, nucleic acids encoding them and methods for making and using them

    Science.gov (United States)

    Gray, Kevin A.; Zhao, Lishan; Cayouette, Michelle H.

    2012-01-24

    The invention provides polypeptides having any cellulolytic activity, e.g., a cellulase activity, a endoglucanase, a cellobiohydrolase, a beta-glucosidase, a xylanase, a mannanse, a .beta.-xylosidase, an arabinofuranosidase, and/or an oligomerase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In one aspect, the invention is directed to polypeptides having any cellulolytic activity, e.g., a cellulase activity, e.g., endoglucanase, cellobiohydrolase, beta-glucosidase, xylanase, mannanse, .beta.-xylosidase, arabinofuranosidase, and/or oligomerase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. In one aspect, the invention provides polypeptides having an oligomerase activity, e.g., enzymes that convert recalcitrant soluble oligomers to fermentable sugars in the saccharification of biomass. The polypeptides of the invention can be used in a variety of pharmaceutical, agricultural, food and feed processing and industrial contexts. The invention also provides compositions or products of manufacture comprising mixtures of enzymes comprising at least one enzyme of this invention.

  20. Biodegradation of Palm Kernel Cake by Cellulolytic and Hemicellulolytic Bacterial Cultures through Solid State Fermentation

    Directory of Open Access Journals (Sweden)

    Mohamed Idris Alshelmani

    2014-01-01

    Full Text Available Four cellulolytic and hemicellulolytic bacterial cultures were purchased from the Leibniz Institute DSMZ-German Collection of Microorganisms and Cell Culture (DSMZ and the American Type Culture Collection (ATCC. Two experiments were conducted; the objective of the first experiment was to determine the optimum time period required for solid state fermentation (SSF of palm kernel cake (PKC, whereas the objective of the second experiment was to investigate the effect of combinations of these cellulolytic and hemicellulolytic bacteria on the nutritive quality of the PKC. In the first experiment, the SSF was lasted for 12 days with inoculum size of 10% (v/w on different PKC to moisture ratios. In the second experiment, fifteen combinations were created among the four microbes with one untreated PKC as a control. The SSF lasted for 9 days, and the samples were autoclaved, dried, and analyzed for proximate analysis. Results showed that bacterial cultures produced high enzymes activities at the 4th day of SSF, whereas their abilities to produce enzymes tended to be decreased to reach zero at the 8th day of SSF. Findings in the second experiment showed that hemicellulose and cellulose was significantly P<0.05 decreased, whereas the amount of reducing sugars were significantly P<0.05 increased in the fermented PKC (FPKC compared with untreated PKC.

  1. Multiple horizontally acquired genes from fungal and prokaryotic donors encode cellulolytic enzymes in the bdelloid rotifer Adineta ricciae.

    Science.gov (United States)

    Szydlowski, L; Boschetti, C; Crisp, A; Barbosa, E G G; Tunnacliffe, A

    2015-07-25

    The bdelloid rotifer, Adineta ricciae, an anhydrobiotic microinvertebrate, exhibits a high rate of horizontal gene transfer (HGT), with as much as 10% of its transcriptome being of foreign origin. Approximately 80% of these foreign transcripts are involved in metabolic processes, and therefore bdelloids represent a useful model for assessing the contribution of HGT to biochemical diversity. To validate this concept, we focused on cellulose digestion, an unusual activity in animals, which is represented by at least 16 genes encoding cellulolytic enzymes in A. ricciae. These genes have been acquired from a variety of different donor organisms among the bacteria and fungi, demonstrating that bdelloids use diverse genetic resources to construct a novel biochemical pathway. A variable complement of the cellulolytic gene set was found in five other bdelloid species, indicating a dynamic process of gene acquisition, duplication and loss during bdelloid evolution. For example, in A. ricciae, gene duplications have led to the formation of three copies of a gene encoding a GH45 family glycoside hydrolase, at least one of which encodes a functional enzyme; all three of these gene copies are present in a close relative, Adineta vaga, but only one copy was found in each of four Rotaria species. Furthermore, analysis of expression levels of the cellulolytic genes suggests that a bacterial-origin cellobiase is upregulated upon desiccation. In summary, bdelloid rotifers have apparently developed cellulolytic functions by the acquisition and domestication of multiple foreign genes. PMID:25863176

  2. Characterization of a Thermobifida fusca beta-1,3-glucanase (Lam81A) with a potential role in plant biomass degradation.

    Science.gov (United States)

    McGrath, Colleen E; Wilson, David B

    2006-11-28

    Thermobifida fusca is a filamentous soil bacterium that plays a major role in the breakdown of plant biomass. In this paper, we report the cloning, expression, purification, and characterization of the T. fusca enzyme, Lam81A. The Carbohydrate Active Enzymes Database (http://afmb.cnrs-mrs.fr/CAZY/) indicates that Lam81A belongs to a relatively uncharacterized family of beta-1,3-glucanases, family GH-81 [Coutinho, P. M., and Henrissat, B. (1999) in Recent Advances in Carbohydrate Bioengineering (Gilbert, H. J., Davies, G., Henrissat, B., and Svensson, B., Eds.) pp 3-12, The Royal Society of Chemistry, Cambridge, U.K.]. Microarray analysis suggests that Lam81A plays a role in biomass degradation, where its natural substrate may be the plant cell wall polysaccharide, callose, which is a polymer of beta-1,3-linked glucose. Characterization of Lam81A has shown that the enzyme is specific for beta-1,3-linked glucose polysaccharides, is endohydrolytic, and utilizes an inverting mechanism for substrate hydrolysis. In addition, the enzyme has a broad pH optimum from 5.5 to 10, a temperature optimum of 50 degrees C, and demonstrates substrate inhibition, as well as showing a high basal level of expression. PMID:17115704

  3. Production of cellulolytic enzymes by Pleurotus species on lignocellulosic wastes using novel pretreatments.

    Science.gov (United States)

    Singh, M P; Pandey, A K; Vishwakarma, S K; Srivastava, A K; Pandey, V K; Singh, V K

    2014-01-01

    In the present investigation three species of Pleurotus i.e. P. sajor—caju (P1), P. florida (P2) and P. flabellatus (P3) along with two lignocellulosic substrates namely paddy straw and wheat straw were selected for evaluation of production of extracellular cellulolytic enzymes. During the cultivation of three species of Pleurotus under in vivo condition, the two lignocellulosic substrates were treated with plants extracts (aqueous extracts of ashoka leaves (A) and neem oil (B)), hot water (H) and chemicals (C).Among all treatments, neem oil treated substrates supported better enzyme production followed by aqueous extract of ashoka leaves, hot water and chemical treatment. Between the two substrates paddy straw supported better enzyme production than wheat straw. P. flabellatus showed maximum activity of exoglucanase, endoglucanase and β—glucosidase followed by P. florida and P. sajor—caju. PMID:25535714

  4. Isolation and characterization of Caldicellulosiruptor lactoaceticus sp. nov., an extremely thermophilic, cellulolytic, anaerobic bacterium

    DEFF Research Database (Denmark)

    Mladenovska, Zuzana; Mathrani, Indra M.; Ahring, Birgitte Kiær

    1995-01-01

    An anaerobic, extremely thermophilic, cellulolytic, non-spore-forming bacterium, strain 6A, was isolated from an alkaline hot spring in Hverageroi, Iceland. The bacterium was non-motile, rod-shaped (1.5-3.5 x 0.7 mu m) and occurred singly, in pairs or in chains and stained gram-negative. The growth...... temperature was between 50 and 78 degrees C with a temperature optimum near 68 degrees C. Growth occurred between pH 5.8 and 8.2 with an optimum mum near 7.0. The bacterium fermented microcrystalline cellulose (Avicel) and produced lactate, acetate and H-2 as the major fermentation products, and CO2...... and ethanol occurred as minor fermentation products. Only a restricted number of carbon sources (cellulose, xylan, starch, pectin, cellobiose, xylose, maltose and lactose) were used as substrates. During growth on Avicel, the bacterium produced free cellulases with carboxymethylcellulase and avicelase...

  5. Biological pre-treatment: Enhancing biogas production using the highly cellulolytic fungus Trichoderma viride.

    Science.gov (United States)

    Mutschlechner, Mira; Illmer, Paul; Wagner, Andreas Otto

    2015-09-01

    With regard to renewable sources of energy, bioconversion of lignocellulosic biomass has long been recognized as a desirable endeavor. However, the highly heterogeneous structure of lignocellulose restricts the exploitation of its promising potential in biogas plants. Hence, effective pre-treatment methods are decisive prerequisites to overcome these challenges in order to improve the utilization ratio of (ligno) cellulosic substrates during fermentation. In the present study, the application of Trichoderma viride in an aerobic upstream process prior to anaerobic digestion led up to a threefold increase in the yield of methane and total gas in a lab-scale investigation. Due to its highly efficient cellulolytic activities, T. viride seemed to be responsible for an improved nutrient availability that positively influenced the anaerobic microbiocenosis. Aerobic pre-treatment of organic matter with T. viride is therefore a promising solution to achieve higher methane yields and degradation performances without any additional energy demand, nor undesired by-product inhibition. PMID:26013693

  6. Engineering of a novel cellulose-adherent cellulolytic Saccharomyces cerevisiae for cellulosic biofuel production.

    Science.gov (United States)

    Liu, Zhuo; Ho, Shih-Hsin; Sasaki, Kengo; den Haan, Riaan; Inokuma, Kentaro; Ogino, Chiaki; van Zyl, Willem H; Hasunuma, Tomohisa; Kondo, Akihiko

    2016-01-01

    Cellulosic biofuel is the subject of increasing attention. The main obstacle toward its economic feasibility is the recalcitrance of lignocellulose requiring large amount of enzyme to break. Several engineered yeast strains have been developed with cellulolytic activities to reduce the need for enzyme addition, but exhibiting limited effect. Here, we report the successful engineering of a cellulose-adherent Saccharomyces cerevisiae displaying four different synergistic cellulases on the cell surface. The cellulase-displaying yeast strain exhibited clear cell-to-cellulose adhesion and a "tearing" cellulose degradation pattern; the adhesion ability correlated with enhanced surface area and roughness of the target cellulose fibers, resulting in higher hydrolysis efficiency. The engineered yeast directly produced ethanol from rice straw despite a more than 40% decrease in the required enzyme dosage for high-density fermentation. Thus, improved cell-to-cellulose interactions provided a novel strategy for increasing cellulose hydrolysis, suggesting a mechanism for promoting the feasibility of cellulosic biofuel production. PMID:27079382

  7. Quantifying Synergy, Thermostability, and Targeting of Cellulolytic Enzymes and Cellulosomes with Polymerization-Based Amplification.

    Science.gov (United States)

    Malinowska, Klara H; Rind, Thomas; Verdorfer, Tobias; Gaub, Hermann E; Nash, Michael A

    2015-07-21

    We present a polymerization-based assay for determining the potency of cellulolytic enzyme formulations on pretreated biomass substrates. Our system relies on monitoring the autofluorescence of cellulose and measuring the attenuation of this fluorescent signal as a hydrogel consisting of poly(ethylene glycol) (PEG) polymerizes on top of the cellulose in response to glucose produced during saccharification. The one-pot method we present is label-free, rapid, highly sensitive, and requires only a single pipetting step. Using model enzyme formulations derived from Trichoderma reesei, Trichoderma longibrachiatum, Talaromyces emersonii and recombinant bacterial minicellulosomes from Clostridium thermocellum, we demonstrate the ability to differentiate enzyme performance based on differences in thermostability, cellulose-binding domain targeting, and endo/exoglucanase synergy. On the basis of its ease of use, we expect this cellulase assay platform to be applicable to enzyme screening for improved bioconversion of lignocellulosic biomass. PMID:26114625

  8. Metabolic responses of novel cellulolytic and saccharolytic agricultural soil Bacteria to oxygen.

    Science.gov (United States)

    Schellenberger, Stefanie; Kolb, Steffen; Drake, Harold L

    2010-04-01

    Cellulose is the most abundant biopolymer in terrestrial ecosystems and is degraded by microbial communities in soils. However, relatively little is known about the diversity and function of soil prokaryotes that might participate in the overall degradation of this biopolymer. The active cellulolytic and saccharolytic Bacteria in an agricultural soil were evaluated by 16S rRNA (13)C-based stable isotope probing. Cellulose, cellobiose and glucose were mineralized under oxic conditions in soil slurries to carbon dioxide. Under anoxic conditions, these substrates were converted primarily to acetate, butyrate, carbon dioxide, hydrogen and traces of propionate and iso-butyrate; the production of these fermentation end-products was concomitant with the apparent reduction of iron(III). [(13)C]-cellulose was mainly degraded under oxic conditions by novel family-level taxa of the Bacteroidetes and Chloroflexi, and a known family-level taxon of Planctomycetes, whereas degradation under anoxic conditions was facilitated by the Kineosporiaceae (Actinobacteria) and cluster III Clostridiaceae and novel clusters within Bacteroidetes. Active aerobic sub-communities in oxic [(13)C]-cellobiose and [(13)C]-glucose treatments were dominated by Intrasporangiaceae and Micrococcaceae (Actinobacteria) whereas active cluster I Clostridiaceae (Firmicutes) were prevalent in anoxic treatments. A very large number (i.e. 28) of the detected taxa did not closely affiliate with known families, and active Archaea were not detected in any of the treatments. These collective findings suggest that: (i) a large uncultured diversity of soil Bacteria was involved in the utilization of cellulose and products of its hydrolysis, (ii) the active saccharolytic community differed phylogenetically from the active cellulolytic community, (iii) oxygen availability impacted differentially on the activity of taxa and (iv) different redox guilds (e.g. fermenters and iron reducers) compete or interact during

  9. Isolation of microbial native Stumps with cellulolytic activity of a compost process

    International Nuclear Information System (INIS)

    The isolation, selection adaptation and handling of native microorganisms coming from organic waste are an alternative to avoid the accumulation and the lack of the proper use of these undesirable materials. This organic waste is a source for obtaining microbial strains, which are potentially producers of Industrial enzymes and, at the same time, it works as substrate so that these organisms can transform it into compost or organic manure. In this work, 39 native strains of microorganisms with potential cellulolytic activity coming from the organic waste of the urban and rural sector, from the Compost Plant of Marinilla Antioquia) municipality, were isolated, evaluated and purified. The waste was previously selected and then submitted to an aerobic degradation or compost. The microbial strains were isolated in a selective medium with carboxymethyl cellulose (CMC), of the phases mesophile, termophile, cooling and maturation of the compost process. Eighty-two percent (82%)of the obtained colonies were identified, in principle as Bacillus, because of their morphology and their reaction to the Gram coloration. The fungi population was seen only during the cooling phase. Then, the potential cellulolytic activity was evaluated qualitatively in a solid medium with the Congo Red coloration, with which the Beta-endoglucanase activity was evaluated through the formation of clarified zones. Such staining was applied in two mediums with CMC with and without glucose It was observed that 33.3% of the isolated organisms produced the enzyme In both mediums; however, 25.6% of microorganisms did not show the production of this enzyme, and only 15.8% did not require the inducers to produce it

  10. Microbial Consortium with High Cellulolytic Activity (MCHCA for enhanced biogas production.

    Directory of Open Access Journals (Sweden)

    Krzysztof ePoszytek

    2016-03-01

    Full Text Available The use of lignocellulosic biomass as a substrate in agricultural biogas plants is very popular and yields good results. However, the efficiency of anaerobic digestion, and thus biogas production, is not always satisfactory due to the slow or incomplete degradation (hydrolysis of plant matter. To enhance the solubilization of the lignocellulosic biomass various physical, chemical and biological pretreatment methods are used.The aim of this study was to select and characterize cellulose-degrading bacteria, and to construct a microbial consortium, dedicated for degradation of maize silage and enhancing biogas production from this substrate.Over one hundred strains of cellulose-degrading bacteria were isolated from: sewage sludge, hydrolyzer from an agricultural biogas plant, cattle slurry and manure. After physiological characterization of the isolates, sixteen strains (representatives of Bacillus, Providencia and Ochrobactrum genera were chosen for the construction of a Microbial Consortium with High Cellulolytic Activity, called MCHCA. The selected strains had a high endoglucanase activity (exceeding 0.21 IU/mL CMCase activity and a wide range of tolerance to various physical and chemical conditions. Lab-scale simulation of biogas production using the selected strains for degradation of maize silage was carried out in a two-bioreactor system, similar to those used in agricultural biogas plants.The obtained results showed that the constructed MCHCA consortium is capable of efficient hydrolysis of maize silage, and increases biogas production by even 38%, depending on the inoculum used for methane fermentation. The results in this work indicate that the mesophilic Microbial Consortium with High Cellulolytic Activity has a great potential for application on industrial scale in agricultural biogas plants.

  11. Effect of micromineral and phenylpropionic acid on performances of coccus and rod-shaped cellulolytic bacteria degrading fibre of forage

    Directory of Open Access Journals (Sweden)

    Amlius Thalib

    2000-06-01

    Full Text Available Performances of coccus and rod-shaped cellulolytic bacteria as inoculum for fermentation of fibrous substrate treated with growth or stimulator factors have been conducted by in vitro. The bacteria were firstly separated and purified based on their morphological shape and followed by identification of their gram type. The treatments as follow : control, Cu (1,0 ppm, Zn (6,0 ppm, Se (0,02 ppm, Fe (16 ppm, Co (0,02 ppm, Mn (4,0 ppm, Mo (0,002 ppm, and phenylpropionic acid (PPA (30 ppm. These factors were added into fermentation media individually (F.P/S and as mixture (Mix F.P/S. Substrates used were cellulose and rice straw. Measurements were bacterial digestion of drymatter (DMD, bacterial count, volatile fatty acids (VFA and NH3-N contents. Gram test showed that inoculum cellulolytic cocci and rods are gram-positive and gram-negative consecutively. The results of treatments showed that Cu, Zn, Co, Mo and PPA improve digestibility of cellulose and rice straw substrates by cellulolytic cocci significantly (p<0.05, and beside Mn, these factors increased the total count of cellulolytic cocci in fermentation medium significantly (p<0.05. The growth or stimulator factors increasing digestibility values of the substrates by cellulolytic rods significantly (p<0.05 were Cu, Zn, Se, Fe, Co, Mn and Mo (except Mn for rice straw substrate. Only 4 elements of the growth and stimulator factors increasing the total count of cellulolytic rods during fermentation of cellulose and rice straw substrates significantly (p<0.05 that is Zn, Co, Mn and Mo. Digestibility of cellulose by cocci is higher than by rods (34.65% vs 29.87%, however, the digestibility of rice straw by both bacteria did not show difference. Digestibility of both cellulose and rice straw substrates was improved by cocci and rods combination and improved further when treated with Mix F.P/S. Parameters of fermentation media ecosystem measured (i.e. total count of bacteria, VFA and NH3-N were

  12. CO2 Biofixation by the Cyanobacterium Spirulina sp. LEB 18 and the Green Alga Chlorella fusca LEB 111 Grown Using Gas Effluents and Solid Residues of Thermoelectric Origin.

    Science.gov (United States)

    da Silva Vaz, Bruna; Costa, Jorge Alberto Vieira; de Morais, Michele Greque

    2016-01-01

    The concentration of carbon dioxide (CO2) in the atmosphere has increased from 280 to 400 ppm in the last 10 years, and the coal-fired power plants are responsible for approximately 22 % of these emissions. The burning of fossil fuel also produces a great amount of solid waste that causes serious industrial and environmental problems. The biological processes become interesting alternative in combating pollution and developing new products. The objective of this study was to evaluate the CO2 biofixation potential of microalgae that were grown using gaseous effluents and solid residues of thermoelectric origin. The microalgae Chlorella fusca LEB 111 presented higher rate of CO2 biofixation (42.8 %) (p coal combustion, using the minerals present in this residue as the source of the essential metals required for their growth and the CO2 derived from the combustion gas as their carbon source. PMID:26453033

  13. Temporal variations in microbial biomass C and cellulolytic enzyme activity in arable soils: effects of organic matter input

    DEFF Research Database (Denmark)

    Debosz, K.; Rasmussen, Peter Have; Pedersen, A. R.

    1999-01-01

    Temporal variations in soil microbial biomass C concentration and in activity of extracellular enzymes of the cellulolytic complex were investigated in a field experiment after eight years of cultivation with either low organic matter input (low-OM) or high organic matter input (high-OM). The...... biomass C concentration and activity of extracellular enzymes of the cellulolytic complex were observed. The temporal pattern was generally similar in the low-OM and high-OM cultivation systems. Temporal variations may have been driven by environmental factors (e.g., temperature and moisture) and crop...... growth, i.e. by factors common to both systems but not differences in organic matter input. Pronounced and constant increases in beta-glucosidase activity (40%) and endocellulase activity (30%) in high-OM were detected across all sampling periods. The increases in microbial biomass C concentration and...

  14. Temporal variations in microbial biomass C and cellulolytic enzyme activity in arable soils: effects of organic matter input

    DEFF Research Database (Denmark)

    Debosz, K.; Rasmussen, Peter Have; Pedersen, A. R.

    1999-01-01

    Temporal variations in soil microbial biomass C concentration and in activity of extracellular enzymes of the cellulolytic complex were investigated in a field experiment after eight years of cultivation with either low organic matter input (low-OM) or high organic matter input (high-OM). The...... cultivation systems differed in whether their source of fertiliser was mainly mineral or organic, in whether a winter cover crop was grown, and whether straw was mulched or removed. Sampling occurred at approximately monthly intervals, over a period of two years. Distinct temporal variations in microbial...... biomass C concentration and activity of extracellular enzymes of the cellulolytic complex were observed. The temporal pattern was generally similar in the low-OM and high-OM cultivation systems. Temporal variations may have been driven by environmental factors (e.g., temperature and moisture) and crop...

  15. Evolution of High Cellulolytic Activity in Symbiotic Streptomyces through Selection of Expanded Gene Content and Coordinated Gene Expression

    Science.gov (United States)

    McDonald, Bradon R.; Takasuka, Taichi E.; Wendt-Pienkowski, Evelyn; Doering, Drew T.; Raffa, Kenneth F.; Fox, Brian G.; Currie, Cameron R.

    2016-01-01

    The evolution of cellulose degradation was a defining event in the history of life. Without efficient decomposition and recycling, dead plant biomass would quickly accumulate and become inaccessible to terrestrial food webs and the global carbon cycle. On land, the primary drivers of plant biomass deconstruction are fungi and bacteria in the soil or associated with herbivorous eukaryotes. While the ecological importance of plant-decomposing microbes is well established, little is known about the distribution or evolution of cellulolytic activity in any bacterial genus. Here we show that in Streptomyces, a genus of Actinobacteria abundant in soil and symbiotic niches, the ability to rapidly degrade cellulose is largely restricted to two clades of host-associated strains and is not a conserved characteristic of the Streptomyces genus or host-associated strains. Our comparative genomics identify that while plant biomass degrading genes (CAZy) are widespread in Streptomyces, key enzyme families are enriched in highly cellulolytic strains. Transcriptomic analyses demonstrate that cellulolytic strains express a suite of multi-domain CAZy enzymes that are coregulated by the CebR transcriptional regulator. Using targeted gene deletions, we verify the importance of a highly expressed cellulase (GH6 family cellobiohydrolase) and the CebR transcriptional repressor to the cellulolytic phenotype. Evolutionary analyses identify complex genomic modifications that drive plant biomass deconstruction in Streptomyces, including acquisition and selective retention of CAZy genes and transcriptional regulators. Our results suggest that host-associated niches have selected some symbiotic Streptomyces for increased cellulose degrading activity and that symbiotic bacteria are a rich biochemical and enzymatic resource for biotechnology. PMID:27276034

  16. Evolution of High Cellulolytic Activity in Symbiotic Streptomyces through Selection of Expanded Gene Content and Coordinated Gene Expression.

    Science.gov (United States)

    Book, Adam J; Lewin, Gina R; McDonald, Bradon R; Takasuka, Taichi E; Wendt-Pienkowski, Evelyn; Doering, Drew T; Suh, Steven; Raffa, Kenneth F; Fox, Brian G; Currie, Cameron R

    2016-06-01

    The evolution of cellulose degradation was a defining event in the history of life. Without efficient decomposition and recycling, dead plant biomass would quickly accumulate and become inaccessible to terrestrial food webs and the global carbon cycle. On land, the primary drivers of plant biomass deconstruction are fungi and bacteria in the soil or associated with herbivorous eukaryotes. While the ecological importance of plant-decomposing microbes is well established, little is known about the distribution or evolution of cellulolytic activity in any bacterial genus. Here we show that in Streptomyces, a genus of Actinobacteria abundant in soil and symbiotic niches, the ability to rapidly degrade cellulose is largely restricted to two clades of host-associated strains and is not a conserved characteristic of the Streptomyces genus or host-associated strains. Our comparative genomics identify that while plant biomass degrading genes (CAZy) are widespread in Streptomyces, key enzyme families are enriched in highly cellulolytic strains. Transcriptomic analyses demonstrate that cellulolytic strains express a suite of multi-domain CAZy enzymes that are coregulated by the CebR transcriptional regulator. Using targeted gene deletions, we verify the importance of a highly expressed cellulase (GH6 family cellobiohydrolase) and the CebR transcriptional repressor to the cellulolytic phenotype. Evolutionary analyses identify complex genomic modifications that drive plant biomass deconstruction in Streptomyces, including acquisition and selective retention of CAZy genes and transcriptional regulators. Our results suggest that host-associated niches have selected some symbiotic Streptomyces for increased cellulose degrading activity and that symbiotic bacteria are a rich biochemical and enzymatic resource for biotechnology. PMID:27276034

  17. Selection and molecular characterization of cellulolytic-xylanolytic fungi from surface soil-biomass mixtures from Black Belt sites.

    Science.gov (United States)

    Okeke, Benedict C; Hall, Rosine W; Nanjundaswamy, Ananda; Thomson, M Sue; Deravi, Yasaman; Sawyer, Leah; Prescott, Andrew

    2015-06-01

    Plant biomass is an abundant renewable natural resource that can be transformed into chemical feedstocks. Enzymes used in saccharification of lignocellulosic biomass are a major part of biofuel production costs. A cocktail of cellulolytic and xylanolytic enzymes are required for optimal saccharification of biomass. Accordingly, thirty-two fungal pure cultures were obtained from surface soil-biomass mixtures collected from Black Belt sites in Alabama by culturing on lignocellulosic biomass medium. The fungal strains were screened for the coproduction of cellulolytic and xylanolytic enzymes. Strains that displayed promising levels of cellulolytic and xylanolytic enzymes were characterized by molecular analysis of DNA sequences from the large subunit and internal transcribed spacer (ITS) of their ribosomal RNA gene. Nucleotide sequence analysis revealed that two most promising isolates FS22A and FS5A were most similar to Penicillium janthinellum and Trichoderma virens. Production dynamics of cellulolytic and xylanolytic enzymes from these two strains were explored in submerged fermentation. Volumetric productivity after 120 h incubation was 121.08 units/L/h and 348 units/L/h for the filter paper cellulase and xylanase of strain FS22A, and 90.83 units/L/h and 359 units/L/h, respectively for strain FS5A. Assays with 10 times dilution of enzymes revealed that the activities were much higher than that observed in the crude culture supernatant. Additionally, both FS22A and FS5A also produced amylase in lignocellulose medium. The enzyme profiles of these strains and their activities suggest potential applications in cost effective biomass conversion and biodegradation. PMID:25817459

  18. In Vitro Inhibition of Cellulolytic Enzymes of Fusarium Oxysporum by Trichoderma spp and Pseudomonas Fluorescens on Arachis Hypogaea L

    Directory of Open Access Journals (Sweden)

    P. Rajeswari

    2015-03-01

    Full Text Available In an attempt to develop biocontrol system for management of Fusarium wilt in groundnut, Trichoderma viride, Trichoderma harzianum,and Pseudomonas fluorescens were evaluated for their antagonistic activity against Fusarium oxysporum in vitro. .Fusarium wilt diseasescaused by the fungus Fusarium oxysporum lead to significant yield losses of crops. Experiments were conducted on the effect of culture filtratesof T.viride (1%, T. harzianum (1.5%, and P. fluorescens (2% on the in vitro inhibition of cellulolytic enzymes of Fusarium oxysporum. Theactivity of 1,4 endoglucanases, 1,4exoglucanase Cellobiase produced by Fusariumoxysporum was higher, when compared to control.Maximum inhibition of above Cellulolytic enzymes (1, 4 endoglucanases, 1,4exoglucanase, Cellobiase was shown by T. viride treatment wasfollowed by T. harzianum and P. fluorescens. Of all the treatments, T. viride treatment showed higher rate of inhibition of Cellulolytic enzymesof Fusarium oxysporum followed by that of T. harzianum and P. fluorescens.This present study indicates that culture filtrate of T.viride(1%is the best biocontrol agent in the inhibition of Fusarium oxysporum causing Fusarium wilt of Arachis hypogaea .L

  19. [Construction of Producers of Cellulolytic and Pectinolytic Enzymes Based on the Fungus Penicillium verruculosum].

    Science.gov (United States)

    Bushina, E V; Rubtsova, E A; Rozhkova, A M; Sinitsyna, O A; Koshelev, A V; Matys, V Yu; Nemashkalov, V A; Sinitsyn, A P

    2015-01-01

    Based on the fungus Penicillium verruculosum, we created strains with a complex of extracellular enzymes that contains both cellulolytic enzymes of the fungus and heterologous pectin lyase A from P. canescens and endo- 1,4-α-polygalacturonase from Aspergillus niger. The endopolygalacturonase and pectin lyase activities of enzyme preparations obtained from culture media of the producer strains reached 46-53 U/mg of protein and 1.3-2.3 U/mg of protein, respectively. The optimal temperature and pH values for recombinant pectin lyase and endopolygalacturonase corresponded to those described in the literature for these enzymes. The content of heterologous endopolygalacturonase and pectin lyase in the studied enzyme preparations was 4-5% and 23% of the total protein content, respectively. The yield of reducing sugars upon the hydrolysis of sugar beet and apple processing wastes with the most efficient preparation was 41 and 71 g/L, respectively, which corresponded to a polysaccharide conversion of 49% and 65%. Glucose was the main product of the hydrolysis of sugar beet and apple processing wastes. PMID:26353405

  20. Cellulosic Ethanol Production by Recombinant Cellulolytic Bacteria Harbouring pdc and adh II Genes of Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    P. Sobana Piriya

    2012-01-01

    Full Text Available The ethanol fermenting genes such as pyruvate decarboxylase (pdc and alcohol dehydrogenase II (adh II were cloned from Zymomonas mobilis and transformed into three different cellulolytic bacteria, namely Enterobacter cloacae JV, Proteus mirabilis JV and Erwinia chrysanthemi and their cellulosic ethanol production capability was studied. Recombinant E. cloacae JV was found to produce 4.5% and 3.5% (v/v ethanol, respectively, when CMC and 4% NaOH pretreated bagasse were used as substrates, whereas recombinant P. mirabilis and E. chrysanthemi with the same substrates could only produce 4%, 3.5%, 1%, and 1.5 % of ethanol, respectively. The recombinant E. cloacae strain produced twofold higher percentage of ethanol than the wild type. The recombinant E. cloacae strain could be improved further by increasing its ethanol tolerance capability through media optimization and also by combining multigene cellulase expression for enhancing ethanol production from various types of lignocellulosic biomass so that it can be used for industrial level ethanol production.

  1. Streptomyces abietis sp. nov., a cellulolytic bacterium isolated from soil of a pine forest.

    Science.gov (United States)

    Fujii, Katsuhiko; Satomi, Masataka; Fukui, Youhei; Matsunobu, Shun; Morifuku, Youji; Enokida, Yuya

    2013-12-01

    Cellulolytic bacteria A191(T), A192 and A193 isolated from the soil of Sakhalin fir forest in Hokkaido, Japan were studied phenotypically, genotypically and phylogenetically. Analysis of their 16S rRNA gene and gyrB sequences and DNA base composition suggested that these isolates were conspecific and members of the genus Streptomyces. However, levels of 16S rRNA gene and gyrB sequence similarity between the isolates and the type strains of their closest relatives in the genus Streptomyces were no higher than 97.9 and 95.0 %, respectively, implying that these isolates were distinctive. Moreover, the results of DNA-DNA hybridization experiments and physiological characterization clearly differentiated these isolates from their closest neighbours. It is therefore concluded that these isolates represent a novel species of the genus Streptomyces, for which the name Streptomyces abietis is proposed. The type strain is A191(T) ( = NBRC 109094(T) = DSM 42080(T)). PMID:23990653

  2. Engineering of a novel cellulose-adherent cellulolytic Saccharomyces cerevisiae for cellulosic biofuel production

    Science.gov (United States)

    Liu, Zhuo; Ho, Shih-Hsin; Sasaki, Kengo; den Haan, Riaan; Inokuma, Kentaro; Ogino, Chiaki; van Zyl, Willem H.; Hasunuma, Tomohisa; Kondo, Akihiko

    2016-01-01

    Cellulosic biofuel is the subject of increasing attention. The main obstacle toward its economic feasibility is the recalcitrance of lignocellulose requiring large amount of enzyme to break. Several engineered yeast strains have been developed with cellulolytic activities to reduce the need for enzyme addition, but exhibiting limited effect. Here, we report the successful engineering of a cellulose-adherent Saccharomyces cerevisiae displaying four different synergistic cellulases on the cell surface. The cellulase-displaying yeast strain exhibited clear cell-to-cellulose adhesion and a “tearing” cellulose degradation pattern; the adhesion ability correlated with enhanced surface area and roughness of the target cellulose fibers, resulting in higher hydrolysis efficiency. The engineered yeast directly produced ethanol from rice straw despite a more than 40% decrease in the required enzyme dosage for high-density fermentation. Thus, improved cell-to-cellulose interactions provided a novel strategy for increasing cellulose hydrolysis, suggesting a mechanism for promoting the feasibility of cellulosic biofuel production. PMID:27079382

  3. Vertical zonation and seed germination indices of chromium resistant cellulolytic and nitrogen fixing bacteria from a chronically metal exposed land area

    International Nuclear Information System (INIS)

    Twenty eight cellulolytic and 25 nitrogen fixing bacteria were isolated from 20, 40 and 60 cm depths of the chromium contaminated land area. The cellulolytic as well as nitrogen fixing microbial communities in soil profiles were dominated by genus Bacillus. More diverse nitrogen fixing bacterial isolates belonging to different genera Paenibacillus, Corynebacterium and Pseudomonas were observed as compared to cellulolytic bacterial community. Majority of the cellulolytic bacteria were found inhabitants of 20 cm soil layer while 40 cm depth was the preferred zone for the nitrogen fixing bacteria. Screening of the bacterial isolates for chromium resistance showed that isolates designated as ASK15 and ASK16 were able to resist up to 1800 mg/l of chromium while the nitrogen fixing isolates which offered a maximum resistant level up to 1650 mg/l of chromium were ASNt10 and ASNS13. Nitrogen fixing isolates enhanced seed germination by 33% and expressed efficient nitrogenase activity up to 0.80 (C/sub 2/H/sub 2/ nmol/ml/hr). Growth promoting assay proved ASNt10 a potential isolate which produced 90 meu g/ml of indoleacetic acid (IAA). Though cellulolytic isolates did not affect seed germination, a significant influence on root length similar to that of ASNt10 and ASNS13 with nearly 5-fold increase in comparison with uninoculated control was observed. The isolates ASK15, ASK16 were identified as Bacillus cereus while ASNt10 and ASNS13 as Paenibacillus barcinonensis and Bacillus megaterium, respectively. (author)

  4. Microbial Consortium with High Cellulolytic Activity (MCHCA) for Enhanced Biogas Production

    Science.gov (United States)

    Poszytek, Krzysztof; Ciezkowska, Martyna; Sklodowska, Aleksandra; Drewniak, Lukasz

    2016-01-01

    The use of lignocellulosic biomass as a substrate in agricultural biogas plants is very popular and yields good results. However, the efficiency of anaerobic digestion, and thus biogas production, is not always satisfactory due to the slow or incomplete degradation (hydrolysis) of plant matter. To enhance the solubilization of the lignocellulosic biomass various physical, chemical and biological pretreatment methods are used. The aim of this study was to select and characterize cellulose-degrading bacteria, and to construct a microbial consortium, dedicated for degradation of maize silage and enhancing biogas production from this substrate. Over 100 strains of cellulose-degrading bacteria were isolated from: sewage sludge, hydrolyzer from an agricultural biogas plant, cattle slurry and manure. After physiological characterization of the isolates, 16 strains (representatives of Bacillus, Providencia, and Ochrobactrum genera) were chosen for the construction of a Microbial Consortium with High Cellulolytic Activity, called MCHCA. The selected strains had a high endoglucanase activity (exceeding 0.21 IU/mL CMCase activity) and a wide range of tolerance to various physical and chemical conditions. Lab-scale simulation of biogas production using the selected strains for degradation of maize silage was carried out in a two-bioreactor system, similar to those used in agricultural biogas plants. The obtained results showed that the constructed MCHCA consortium is capable of efficient hydrolysis of maize silage, and increases biogas production by even 38%, depending on the inoculum used for methane fermentation. The results in this work indicate that the mesophilic MCHCA has a great potential for application on industrial scale in agricultural biogas plants. PMID:27014244

  5. The complete genome sequence of Fibrobacter succinogenes S85 reveals a cellulolytic and metabolic specialist.

    Directory of Open Access Journals (Sweden)

    Garret Suen

    Full Text Available Fibrobacter succinogenes is an important member of the rumen microbial community that converts plant biomass into nutrients usable by its host. This bacterium, which is also one of only two cultivated species in its phylum, is an efficient and prolific degrader of cellulose. Specifically, it has a particularly high activity against crystalline cellulose that requires close physical contact with this substrate. However, unlike other known cellulolytic microbes, it does not degrade cellulose using a cellulosome or by producing high extracellular titers of cellulase enzymes. To better understand the biology of F. succinogenes, we sequenced the genome of the type strain S85 to completion. A total of 3,085 open reading frames were predicted from its 3.84 Mbp genome. Analysis of sequences predicted to encode for carbohydrate-degrading enzymes revealed an unusually high number of genes that were classified into 49 different families of glycoside hydrolases, carbohydrate binding modules (CBMs, carbohydrate esterases, and polysaccharide lyases. Of the 31 identified cellulases, none contain CBMs in families 1, 2, and 3, typically associated with crystalline cellulose degradation. Polysaccharide hydrolysis and utilization assays showed that F. succinogenes was able to hydrolyze a number of polysaccharides, but could only utilize the hydrolytic products of cellulose. This suggests that F. succinogenes uses its array of hemicellulose-degrading enzymes to remove hemicelluloses to gain access to cellulose. This is reflected in its genome, as F. succinogenes lacks many of the genes necessary to transport and metabolize the hydrolytic products of non-cellulose polysaccharides. The F. succinogenes genome reveals a bacterium that specializes in cellulose as its sole energy source, and provides insight into a novel strategy for cellulose degradation.

  6. Studies of the extracellular glycocalyx of the anaerobic cellulolytic bacterium Ruminococcus albus 7.

    Science.gov (United States)

    Weimer, Paul J; Price, Neil P J; Kroukamp, Otini; Joubert, Lydia-Marie; Wolfaardt, Gideon M; Van Zyl, Willem H

    2006-12-01

    Anaerobic cellulolytic bacteria are thought to adhere to cellulose via several mechanisms, including production of a glycocalyx containing extracellular polymeric substances (EPS). As the compositions and structures of these glycocalyces have not been elucidated, variable-pressure scanning electron microscopy (VP-SEM) and chemical analysis were used to characterize the glycocalyx of the ruminal bacterium Ruminococcus albus strain 7. VP-SEM revealed that growth of this strain was accompanied by the formation of thin cellular extensions that allowed the bacterium to adhere to cellulose, followed by formation of a ramifying network that interconnected individual cells to one another and to the unraveling cellulose microfibrils. Extraction of 48-h-old whole-culture pellets (bacterial cells plus glycocalyx [G] plus residual cellulose [C]) with 0.1 N NaOH released carbohydrate and protein in a ratio of 1:5. Boiling of the cellulose fermentation residue in a neutral detergent solution removed almost all of the adherent cells and protein while retaining a residual network of adhering noncellular material. Trifluoroacetic acid hydrolysis of this residue (G plus C) released primarily glucose, along with substantial amounts of xylose and mannose, but only traces of galactose, the most abundant sugar in most characterized bacterial exopolysaccharides. Linkage analysis and characterization by nuclear magnetic resonance suggested that most of the glucosyl units were not present as partially degraded cellulose. Calculations suggested that the energy demand for synthesis of the nonprotein fraction of EPS by this organism represents only a small fraction (<4%) of the anabolic ATP expenditure of the bacterium. PMID:17028224

  7. The embryonic leaf identity gene FUSCA3 regulates vegetative phase transitions by negatively modulating ethylene-regulated gene expression in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Lumba Shelley

    2012-02-01

    Full Text Available Abstract Background The embryonic temporal regulator FUSCA3 (FUS3 plays major roles in the establishment of embryonic leaf identity and the regulation of developmental timing. Loss-of-function mutations of this B3 domain transcription factor result in replacement of cotyledons with leaves and precocious germination, whereas constitutive misexpression causes the conversion of leaves into cotyledon-like organs and delays vegetative and reproductive phase transitions. Results Herein we show that activation of FUS3 after germination dampens the expression of genes involved in the biosynthesis and response to the plant hormone ethylene, whereas a loss-of-function fus3 mutant shows many phenotypes consistent with increased ethylene signaling. This FUS3-dependent regulation of ethylene signaling also impinges on timing functions outside embryogenesis. Loss of FUS3 function results in accelerated vegetative phase change, and this is again partially dependent on functional ethylene signaling. This alteration in vegetative phase transition is dependent on both embryonic and vegetative FUS3 function, suggesting that this important transcriptional regulator controls both embryonic and vegetative developmental timing. Conclusion The results of this study indicate that the embryonic regulator FUS3 not only controls the embryonic-to-vegetative phase transition through hormonal (ABA/GA regulation but also functions postembryonically to delay vegetative phase transitions by negatively modulating ethylene-regulated gene expression.

  8. A 24.7-kDa copper-containing oxidase, secreted by Thermobifida fusca, significantly increasing the xylanase/cellulase-catalyzed hydrolysis of sugarcane bagasse.

    Science.gov (United States)

    Chen, Cheng-Yu; Hsieh, Zhi-Shen; Cheepudom, Jatuporn; Yang, Chao-Hsun; Meng, Menghsiao

    2013-10-01

    Thermobifida fusca is a moderately thermophilic soil bacterium belonging to Actinobacteria. It has been known for its capability to degrade plant cell wall polymers except lignin and pectin. To know whether it can produce enzymes to facilitate lignin degradation, the extracellular proteins bound to sugarcane bagasse were harvested and identified by liquid chromatography tandem mass spectrometry. Among the identified proteins, a putative copper-containing polyphenol oxidase of 241 amino acids, encoded by the locus Tfu_1114, was thought to presumably play a role in lignin degradation. This protein (Tfu1114) was thus expressed in E. coli and characterized. Similarly to common laccases, Tfu1114 is able to catalyze the oxidation reaction of phenolic and nonphenolic lignin related compounds such as 2,6-dimethoxyphenol and veratryl alcohol. More interestingly, it can significantly enhance the enzymatic hydrolysis of bagasse by xylanase and cellulase. Tfu1114 is stable against heat, with a half-life of 4.7 h at 90 °C, and organic solvents. It is sensitive to ethylenediaminetetraacetic acid and reducing agents but resistant to sodium azide, a potent inhibitor of laccases. Atomic absorption spectroscopy indicated that the ratio of copper to the protein monomer is 1, instead of 4, a feature of classical laccases. All these data suggest that Tfu1114 is a novel oxidase with laccase-like activity, potentially useful in biotechnology application. PMID:23377789

  9. Exploration of the key functional proteins from an efficient cellulolytic microbial consortium using dilution-to-extinction approach.

    Science.gov (United States)

    Zhang, Qinghua; Li, Hanguang; Zhu, Xiangdong; Lai, Fenju; Zhai, Zhijun; Wang, Yuanxiu

    2016-05-01

    In the present study, the cellulose binding proteins (CBPs) secreted by a putative cellulolytic microbial consortium were isolated and purified by affinity digestion. The purified CBPs were subsequently separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). Using mass spectrometric analyses, eight CBPs were identified and annotated to be similar to known proteins secreted by Clostridium clariflavum DSM 19732 and Paenibacillus sp. W-61. In addition, in combination with dilution-to-extinction approach and zymogram analysis technique, CBPs 6 (97kDa) and 12 (52kDa) were confirmed to be the key functional proteins that influence cellulolytic activities. Moreover, structural domain analyses and enzymatic activity detection indicated that CBPs 6 and 12 contained glycoside hydrolase families (GH) 9 and 48 catalytic modules, which both revealed endoglucandase and xylanase activities. It was suggested that the coexistence of GH9 and GH48 catalytic domains present in these two proteins could synergistically promote the efficient degradation of cellulose. PMID:27155425

  10. RICHNESS, CELLULOLYTIC ACTIVITY, AND FUNGICIDE SUSCEPTIBILITY OF FUNGI FROM A BIRD BIOLOGICAL COLLECTION

    Directory of Open Access Journals (Sweden)

    Henry Arenas-Castro

    2015-11-01

    Full Text Available ABSTRACTBiological collections in natural history museums serve important purposes to the scientific community and the general public, however, their value and utility might be diminished by biodeterioration. We studied a biological collection that represents more than sixty years of avifauna sampling of Colombia, the country with the highest bird diversity. An initial inspection of the collection showed that the general appearance of some specimens was compromised by mold-like growth on their surfaces. We aimed at (i identifying the taxonomic affiliation of these fungi, (ii evaluating their cellulolytic activity, and (iii probing chemical agents that could be utilized to control their growth. The most common fungi genera were Aspergillus, Penicillium, Chaetomium, and Trichophyton, most of which can degrade cellulose. Zinc chloride and salicylic acid showed to be effective fungicides. Based on this, we propose some actions to control the fungi-pest in this biological collection of birds.RESUMENLas colecciones biológicas en los museos de historia natural juegan un papel importante tanto para la comunidad científica como para el público en general. Sin embargo, su valor y utilidad pueden verse afectados por la biodeterioración de sus ejemplares. Se estudio una colección biológica de aves que representa más de sesenta años de esfuerzo de muestreo de la avifauna del país más rico en aves. Una inspección inicial mostró que la apariencia general de algunos de los especímenes de la colección se encontraba afectada por hongos. Los objetivos de este estudio fueron (i identificar la afiliación taxonómica de los hongos, (ii determinar la actividad celulolítica y (iii probar agentes químicos que puedan ser utilizados para controlar su desarrollo. Los géneros de hongos más comunes fueron Aspergillus, Penicillium, Chaetomium y Trichophyton, de los cuales la mayoría presentan la capacidad de degradar celulosa. Adicionalmente, el cloruro de

  11. Utilization of mixed cellulolytic microbes from termite extract, elephant faecal solution and buffalo ruminal fluid to increase in vitro digestibility of King Grass

    Directory of Open Access Journals (Sweden)

    Agung Prabowo

    2007-06-01

    Full Text Available Cellulose is a compound of plant cell walls which is difficult to be degraded because it composed of glucose monomers linked by β-(1.4-bound. It will be hydrolysed by cellulase enzyme secreted by cellulolytic microbes. The effective digestion of cellulose needs high activity of cellulase enzyme. This research aims to increase in vitro king grass digestibility utilizing mixed cellulolytic microbes of termite extract, elephant faecal solution, and buffalo ruminal fluid. Twelve syringes contained gas test media were randomly divided into four treatments based on sources of microbe (SM, namely: S (SM: cattle ruminal fluid [S], RGK (SM: mixed cellulolytic microbes of termite extract, elephant faecal solution, and buffalo ruminal fluid [RGK], with composition 1 : 1 : 1, S-RGK (SM: S + RGK, with composition 1:1, and TM (without given treatment microbe. Digestibility was measured using gas test method. Average of gas production treatment of S-RGK (70.2 + 0.6 ml was higher and significantly different (P<0.01 compared to treatment of S (60.3 + 0.8 ml, RGK (40.8 + 2.3 ml, and TM (13.3 + 2.0 ml. Utilization of mixed cellulolytic microbes of termite extract, elephant faecal solution, and buffalo ruminal fluid (RGK that combined with microbes of cattle ruminal fluid (S could increase in vitro digestibility of king grass.

  12. Microbiota Dynamics Associated with Environmental Conditions and Potential Roles of Cellulolytic Communities in Traditional Chinese Cereal Starter Solid-State Fermentation.

    Science.gov (United States)

    Li, Pan; Liang, Hebin; Lin, Wei-Tie; Feng, Feng; Luo, Lixin

    2015-08-01

    Traditional Chinese solid-state fermented cereal starters contain highly complex microbial communities and enzymes. Very little is known, however, about the microbial dynamics related to environmental conditions, and cellulolytic communities have never been proposed to exist during cereal starter fermentation. In this study, we performed Illumina MiSeq sequencing combined with PCR-denaturing gradient gel electrophoresis to investigate microbiota, coupled with clone library construction to trace cellulolytic communities in both fermentation stages. A succession of microbial assemblages was observed during the fermentation of starters. Lactobacillales and Saccharomycetales dominated the initial stages, with a continuous decline in relative abundance. However, thermotolerant and drought-resistant Bacillales, Eurotiales, and Mucorales were considerably accelerated during the heating stages, and these organisms dominated until the end of fermentation. Enterobacteriales were consistently ubiquitous throughout the process. For the cellulolytic communities, only the genera Sanguibacter, Beutenbergia, Agrobacterium, and Erwinia dominated the initial fermentation stages. In contrast, stages at high incubation temperature induced the appearance and dominance of Bacillus, Aspergillus, and Mucor. The enzymatic dynamics of amylase and glucoamylase also showed a similar trend, with the activities clearly increased in the first 7 days and subsequently decreased until the end of fermentation. Furthermore, β-glucosidase activity continuously and significantly increased during the fermentation process. Evidently, cellulolytic potential can adapt to environmental conditions by changes in the community structure during the fermentation of starters. PMID:26002897

  13. Nutritional Value And Yield of Kallar Grass (Leptochloa Fusca Linn) Hay and Its Effect on Reproductive Performance of Awassi Ewes Using Progesterone Radioimmunoassay

    International Nuclear Information System (INIS)

    Nutritional value of Kallar grass (Leptochloa fusca Linn) hay (whole plant), a salt-tolerant plant, was estimated by determinning its composition (ash, crude protein CP, crude fibre CF, ether extract EE, neutral-detergent fiber NDF, acid-detergent fiber ADF, acid-detergent lignin ADL); and the in vitro organic matter digestibility (IVOMD), metabolizable energy (ME), net energy of lactation (NEL) and gross energy (GE). Moreover, dry matter, energy and protein yields per hectar were also estimated. The effects of feeding Kallar grass hay to pregnant Awassi ewes on reproductive performance, serum progesterone changes using radioimmunoassay, and on birth and weaning weights of lambs born were also determined. Experimental ewes received daily 300 g of Kallar grass hay in addition to lentil straw and concentrates to cover their nutritional requirements. The results indicated that the nutritive components of Kallar grass were (g kg-1 dry matter): ash 96, CP 93, CF 290, EE 21, NDF 755, ADF 416 and ADL 94. IVOMD was 49.3%, and energy values (MJ kg-1 dry matter) were: GE 26.88, ME 6.41 and NEL 3.02. Dry matter and crude protein yields of Kallar grass hay were 7875 and 732 kg ha-1, respectively, and the energy produced (MJ ha-1) was: GE 211680, ME 50479 and NEL 23783. Kallar grass had no effects on the reproductive performance of pregnant Awassi ewes duration, of pregnancy (150.1 ± 2.2 days), progesterone patterns, birth (4.7±1.0 kg) or on weaning weights (22.7 ± ≤ 5.5 kg) of lambs.

  14. Structural insights into cellulolytic and chitinolytic enzymes revealing crucial residues of insect β-N-acetyl-D-hexosaminidase.

    Directory of Open Access Journals (Sweden)

    Tian Liu

    Full Text Available The chemical similarity of cellulose and chitin supports the idea that their corresponding hydrolytic enzymes would bind β-1,4-linked glucose residues in a similar manner. A structural and mutational analysis was performed for the plant cellulolytic enzyme BGlu1 from Oryza sativa and the insect chitinolytic enzyme OfHex1 from Ostrinia furnacalis. Although BGlu1 shows little amino-acid sequence or topological similarity with OfHex1, three residues (Trp(490, Glu(328, Val(327 in OfHex1, and Trp(358, Tyr(131 and Ile(179 in BGlu1 were identified as being conserved in the +1 sugar binding site. OfHex1 Glu(328 together with Trp(490 was confirmed to be necessary for substrate binding. The mutant E328A exhibited a 8-fold increment in K(m for (GlcNAc(2 and a 42-fold increment in K(i for TMG-chitotriomycin. A crystal structure of E328A in complex with TMG-chitotriomycin was resolved at 2.5 Å, revealing the obvious conformational changes of the catalytic residues (Glu(368 and Asp(367 and the absence of the hydrogen bond between E328A and the C3-OH of the +1 sugar. V327G exhibited the same activity as the wild-type, but acquired the ability to efficiently hydrolyse β-1,2-linked GlcNAc in contrast to the wild-type. Thus, Glu(328 and Val(327 were identified as important for substrate-binding and as glycosidic-bond determinants. A structure-based sequence alignment confirmed the spatial conservation of these three residues in most plant cellulolytic, insect and bacterial chitinolytic enzymes.

  15. Engineering cellulase mixtures by varying the mole fraction of Thermomonospora fusca E[sub 5] and E[sub 3], Trichoderma reesei CBHI, and Caldocellum saccharolyticum [beta]-glucosidase

    Energy Technology Data Exchange (ETDEWEB)

    Walker, L.P.; Belair, C.D.; Wilson, D.B.; Irwin, D.C. (Cornell Univ., Ithaca, NY (United States))

    1993-11-05

    In this study, different mole fractions of pure Thermomonospora fusca E[sub 5] and E[sub 3], plus Trichoderma reesei CBHI were studied for reducing sugar production at 2 h, degree of synergism, and cellulose binding. In addition, the effects of introducing the Caldocellum saccharolyticum [Beta]-glucosidase into this cellulase system were investigated. The cellulases used were purified to homogeneity. Avicel PH 102 was the substrate. Reactions were run at 50 C for 2 h using total cellulase concentrations of 8.3 or 12.2 [mu]M. A bimixture of T. fusca E[sub 3] and T. reesei CBHI was very effective in hydrolyzing microcrystalline cellulose. The addition of endoglucanase E[sub 5] to the mixture only increased conversion to 9.8%. However, when both E[sub 5] and [Beta]-glucosidase were added, conversion increased to 14%. It was also observed that increasing total cellulase concentration beyond 8.3 [mu]M did little to increase percent conversion of cellulose into glucose. The results of the binding studies indicate no competition for binding sites between the endo- and exocellulases.

  16. Effect of Feeding Palm Oil By-Products Based Diets on Total Bacteria, Cellulolytic Bacteria and Methanogenic Archaea in the Rumen of Goats

    OpenAIRE

    Abubakr, Abdelrahim; Alimon, Abdul Razak; Yaakub, Halimatun; Abdullah, Norhani; Ivan, Michael

    2014-01-01

    Rumen microorganisms are responsible for digestion and utilization of dietary feeds by host ruminants. Unconventional feed resources could be used as alternatives in tropical areas where feed resources are insufficient in terms of quality and quantity. The objective of the present experiment was to evaluate the effect of diets based on palm oil (PO), decanter cake (DC) or palm kernel cake (PKC) on rumen total bacteria, selected cellulolytic bacteria, and methanogenic archaea. Four diets: cont...

  17. Exploring thermophilic cellulolytic enzyme production potential of Aspergillus fumigatus by the solid-state fermentation of wheat straw.

    Science.gov (United States)

    Mehboob, Nazia; Asad, M Javaid; Asgher, M; Gulfraz, M; Mukhtar, Tariq; Mahmood, Raja Tahir

    2014-04-01

    Cellulases can be used for biofuel production to decrease the fuel crises in the world. Microorganisms cultured on lignocellulosic wastes can be used for the production of cellulolytic enzymes at large scale. In the current study, cellulolytic enzyme production potential of Aspergillus fumigatus was explored and optimized by employing various cultural and nutritional parameters. Maximum endoglucanase production was observed after 72 h at 55 °C, pH 5.5, and 70 % moisture level. Addition of 0.3 % of fructose, peptone, and Tween-80 further enhanced the production of endoglucanase. Maximum purification was achieved with 40 % ammonium sulfate, and it was purified 2.63-fold by gel filtration chromatography. Endoglucanase has 55 °C optimum temperature, 4.8 optimum pH, 3.97 mM K m, and 8.53 μM/mL/min V max. Maximum exoglucanase production was observed at 55 °C after 72 h, at pH 5.5, and 70 % moisture level. Further addition of 0.3 % of each of fructose, peptone, and Tween-80 enhances the secretion of endoglucanase. It was purified 3.30-fold in the presence of 40 % ammonium sulfate followed by gel filtration chromatography. Its optimum temperature was 55 °C, optimum pH was 4.8, 4.34 mM K m, and 7.29 μM/mL/min V max. In the case of β-glucosidase, maximum activity was observed after 72 h at 55 °C, pH 5.5, and 70 % moisture level. The presence of 0.3 % of fructose, peptone, and Tween-80 in media has beneficial impact on β-glucosidase production. A 4.36-fold purification was achieved by 40 % ammonium sulfate precipitation and gel filtration chromatography. Optimum temperature of β-glucosidase was 55 °C, optimum pH was 4.8, K m was 4.92 mM, and V max 6.75 μM/mL/min. It was also observed that fructose is better than glucose, and peptone is better than urea for the growth of A. fumigatus. The K m and V max values indicated that endoglucanase, exoglucanase, and β-glucosidase have good affinity for their substrates. PMID:24562980

  18. A novel promising Trichoderma harzianum strain for the production of a cellulolytic complex using sugarcane bagasse in natura.

    Science.gov (United States)

    Benoliel, Bruno; Torres, Fernando Araripe Gonçalves; de Moraes, Lidia Maria Pepe

    2013-01-01

    Brazil is a major producer of agro-industrial residues, such as sugarcane bagasse, which could be used as raw material for microbial production of cellulases as an important strategy for the development of sustainable processes of second generation ethanol production. For this purpose, this work aimed at screening for glycosyl hydrolase activities of fungal strains isolated from the Brazilian Cerrado. Among 13 isolates, a Trichoderma harzianum strain (L04) was identified as a promising candidate for cellulase production when cultured on in natura sugarcane bagasse. Strain L04 revealed a well-balanced cellulolytic complex, presenting fast kinetic production of endoglucanases, exoglucanases and β-glucosidases, achieving 4,022, U.L(-1) (72 h), 1,228 U.L(-1) (120 h) and 1,968 U.L(-1) (48 h) as the highest activities, respectively. About 60% glucose yields were obtained from sugarcane bagasse after 18 hours hydrolysis. This new strain represents a potential candidate for on-site enzyme production using sugarcane bagasse as carbon source. PMID:24349958

  19. Cellulolytic potential of a novel strain of Paenibacillus sp. isolated from the armored catfish Parotocinclus maculicauda gut

    Directory of Open Access Journals (Sweden)

    André L. M. de Castro

    2011-12-01

    Full Text Available A cellulolytic bacterial strain, designated P118, isolated from the gut of the tropical fish Parotocinclus maculicauda was identified as belonging to the genus Paenibacillus based on phenotypic and chemotaxonomic characteristics and the 16S rRNA gene sequence. The novel strain was Gram-positive, spore-forming and rod-shaped. Catalase but not oxidase was produced. Carboxymethylcellulose was hydrolyzed but starch or gelatin was not. Acetoin production was negative whereas nitrate reduction and urease production were positive. Many carbohydrates served as carbon sources for growth. MK-7 was the predominant isoprenoid quinone. Anteiso-C15:0 (38.73% and C16:0 (20.85% were the dominant cellular fatty acids. Strain P118 was closely related to Paenibacillus amylolyticus NRRL NRS-290, P. pabuli HSCC 492, P. tundrae Ab10b, P. xylanexedens B22a, and P. tylopili MK2 with 98.3-98.8% 16S rRNA gene sequence similarity. The results presented here suggest that strain P118 represents a novel species of the genus Paenibacillus and it is a potential strain for further studies concerning its role in the production of industrially important products from cellulosic biomass.

  20. Dominant ectosymbiotic bacteria of cellulolytic protists in the termite gut also have the potential to digest lignocellulose.

    Science.gov (United States)

    Yuki, Masahiro; Kuwahara, Hirokazu; Shintani, Masaki; Izawa, Kazuki; Sato, Tomoyuki; Starns, David; Hongoh, Yuichi; Ohkuma, Moriya

    2015-12-01

    Wood-feeding lower termites harbour symbiotic gut protists that support the termite nutritionally by degrading recalcitrant lignocellulose. These protists themselves host specific endo- and ectosymbiotic bacteria, functions of which remain largely unknown. Here, we present draft genomes of a dominant, uncultured ectosymbiont belonging to the order Bacteroidales, 'Candidatus Symbiothrix dinenymphae', which colonizes the cell surface of the cellulolytic gut protists Dinenympha spp. We analysed four single-cell genomes of Ca. S. dinenymphae, the highest genome completeness was estimated to be 81.6-82.3% with a predicted genome size of 4.28-4.31 Mb. The genome retains genes encoding large parts of the amino acid, cofactor and nucleotide biosynthetic pathways. In addition, the genome contains genes encoding various glycoside hydrolases such as endoglucanases and hemicellulases. The genome indicates that Ca. S. dinenymphae ferments lignocellulose-derived monosaccharides to acetate, a major carbon and energy source of the host termite. We suggest that the ectosymbiont digests lignocellulose and provides nutrients to the host termites, and hypothesize that the hydrolytic activity might also function as a pretreatment for the host protist to effectively decompose the crystalline cellulose components. PMID:26079531

  1. ISOLATION AND PHYSICO-CHEMICAL CHARACTERIZATION OF EXTRACELLULAR LIGNO-CELLULOLYTIC ENZYMES OF PLEUROTUS PULMONARIUS IN SUBMERGED FERMENTATION

    Directory of Open Access Journals (Sweden)

    Nirmalendu Das

    2015-07-01

    Full Text Available Pleurotus pulmonarius, a member of oyster mushroom can produced lignocellulosic enzymes laccase, peroxidise and cellulase in liquid potato-dextrose medium in submerged stationary condition. The lignocellulolytic activities were assayed using the extracellular culture filtrate which was partially purified using 0- 80% ammonium sulphate saturation. Different physico-chemical studies were performed using the partially purified culture filtrate. The fungus produced more laccase and peroxidase than the cellulase. The optimum laccase production was found on 17th day whereas cellulase & peroxidase productions were found on 9th& 10th day, respectively. Km of laccase is 4.1mM against guaiacol and 1.25 mM against o-dianisidine whereas Km of peroxidase was 0.72mM and cellulase was 0.06 mM. Optimum pH of laccase was 6.0 but for peroxidase and cellulase it was 7.0. The temperature optima of cellulase (50?C was more than laccase (40?C and peroxidase (30?C. All the lignocellulosic enzymes showed a wide range of temperature and pH stabilities. Laccase and peroxidase were fully inhibited by NaCl but it was not so effective against cellulase. P. pulmonarius showed higher ligninolytic (Laccase and peroxidase activity than cellulolytic (cellulase activity. The lignocellulosic enzymes isolated from submerged fermentation of P. pulmonarius might be industrially significant as they showed a wide range of temperature and pH stabilities.

  2. Development of a real-time PCR assay for monitoring anaerobic fungal and cellulolytic bacterial populations within the rumen.

    Science.gov (United States)

    Denman, Stuart E; McSweeney, Christopher S

    2006-12-01

    Traditional methods for enumerating and identifying microbial populations within the rumen can be time consuming and cumbersome. Methods that involve culturing and microscopy can also be inconclusive, particularly when studying anaerobic rumen fungi. A real-time PCR SYBR Green assay, using PCR primers to target total rumen fungi and the cellulolytic bacteria Ruminococcus flavefaciens and Fibrobacter succinogenes, is described, including design and validation. The DNA and crude protein contents with respect to the fungal biomass of both polycentric and monocentric fungal isolates were investigated across the fungal growth stages to aid in standard curve generation. The primer sets used were found to be target specific with no detectable cross-reactivity. Subsequently, the real-time PCR assay was employed in a study to detect these populations within cattle rumen. The anaerobic fungal target was observed to increase 3.6-fold from 0 to 12 h after feeding. The results also indicated a 5.4-fold increase in F. succinogenes target between 0 and 12 h after feeding, whereas R. flavefaciens was observed to maintain more or less consistent levels. This is the first report of a real-time PCR assay to estimate the rumen anaerobic fungal population. PMID:17117998

  3. Caldicellulosiruptor obsidiansis sp. nov., an anaerobic, extremely thermophilic, cellulolytic bacterium isolated from Obsidian Pool, Yellowstone National Park

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton-Brehm, Scott [ORNL; Elkins, James G [ORNL; Phelps, Tommy Joe [ORNL; Keller, Martin [ORNL; Carroll, Sue L [ORNL; Allman, Steve L [ORNL; Podar, Mircea [ORNL; Mosher, Jennifer J [ORNL; Vishnivetskaya, Tatiana A [ORNL

    2010-01-01

    A novel, obligately anaerobic, extremely thermophilic, cellulolytic bacterium, designated OB47T, was isolated from Obsidian Pool, Yellowstone National Park, WY, USA. The isolate was a non-motile, non-spore forming, Gram-positive rod approximately 2 m long by 0.2 m wide and grew at temperatures between 55-85oC with the optimum at 78oC. The pH range for growth was 6.0-8.0 with values of near 7.0 being optimal. Growth on cellobiose produced the fastest specific growth rates at 0.75 hr-1. The organism also displayed fermentative growth on glucose, maltose, arabinose, fructose, starch, lactose, mannose, sucrose, galactose, xylose, arabinogalactan, Avicel, xylan, filter paper, processed cardboard, pectin, dilute acid-pretreated switchgrass and Populus. OB47T was unable to grow on mannitol, fucose, lignin, Gelrite, acetate, glycerol, ribose, sorbital, carboxymethylcellulose and casein. Yeast extract stimulated growth and thiosulfate, sulfate, nitrate, and sulfur were not reduced. Fermentation end products were mainly acetate, H2, and CO2 although lactate and ethanol were produced in 5 l batch fermentations. The G+C content of the DNA was 35 mol% and sequence analysis of the small subunit ribosomal RNA gene placed OB47T within the genus Caldicellulosiruptor. Based on its phylogenetic and phenotypic properties, the isolate is proposed to be designated Caldicellulosiruptor obsidiansis sp. nov. and OB47T is the type stain (ATCC = ____, JCM = ____).

  4. Complete genome of the cellulolytic thermophile Acidothermus cellulolyticus 11B provides insights into its ecophysiological and evolutionary adaptations

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Gary [Los Alamos National Laboratory; Detter, Chris [Los Alamos National Laboratory; Bruce, David [Los Alamos National Laboratory; Challacome, Jean F [Los Alamos National Laboratory; Brettin, Thomas S [Los Alamos National Laboratory; Barabote, Ravi D [UC DAVIS; Leu, David [UC DAVIS; Normand, Philippe [CNRS, UNIV LYON; Necsula, Anamaria [CNRS, UNIV LYON; Daubin, Vincent [CNRS, UNIV LYON; Medigue, Claudine [CNRS/GENOSCOPE; Adney, William S [NREL; Xu, Xin C [UC DAVIS; Lapidus, Alla [DOE JOINT GENOME INST.; Pujic, Pierre [CNRS, UNIV LYON; Richardson, Paul [DOE JOINT GENOME INST; Berry, Alison M [UC DAVIS

    2008-01-01

    We present here the complete 2.4 MB genome of the actinobacterial thermophile, Acidothermus cellulolyticus lIB, that surprisingly reveals thermophilic amino acid usage in only the cytosolic subproteome rather than its whole proteome. Thermophilic amino acid usage in the partial proteome implies a recent, ongoing evolution of the A. cellulolyticus genome since its divergence about 200-250 million years ago from its closest phylogenetic neighbor Frankia, a mesophilic plant symbiont. Differential amino acid usage in the predicted subproteomes of A. cellulolyticus likely reflects a stepwise evolutionary process of modern thermophiles in general. An unusual occurrence of higher G+C in the non-coding DNA than in the transcribed genome reinforces a late evolution from a higher G+C common ancestor. Comparative analyses of the A. cellulolyticus genome with those of Frankia and other closely-related actinobacteria revealed that A. cellulolyticus genes exhibit reciprocal purine preferences at the first and third codon positions, perhaps reflecting a subtle preference for the dinucleotide AG in its mRNAs, a possible adaptation to a thermophilic environment. Other interesting features in the genome of this cellulolytic, hot-springs dwelling prokaryote reveal streamlining for adaptation to its specialized ecological niche. These include a low occurrence of pseudogenes or mobile genetic elements, a flagellar gene complement previously unknown in this organism, and presence of laterally-acquired genomic islands of likely ecophysiological value. New glycoside hydrolases relevant for lignocellulosic biomass deconstruction were identified in the genome, indicating a diverse biomass-degrading enzyme repertoire several-fold greater than previously characterized, and significantly elevating the industrial value of this organism.

  5. Complete genome of the cellulolytic thermophile Acidothermus cellulolyticus 11B provides insights into its ecophysiological and evolutionary adaptations

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Gary [Los Alamos National Laboratory; Detter, John C [Los Alamos National Laboratory; Bruce, David C [Los Alamos National Laboratory; Challacombe, Jean F [Los Alamos National Laboratory; Brettin, Thomas S [Los Alamos National Laboratory; Necsulea, Anamaria [UNIV LYON; Daubin, Vincent [UNIV LYON; Medigue, Claudine [GENOSCOPE; Adney, William S [NREL; Xu, Xin C [UC DAVIS; Lapidus, Alla [JGI; Pujic, Pierre [UNIV LYON; Berry, Alison M [UC DAVIS; Barabote, Ravi D [UC DAVIS; Leu, David [UC DAVIS; Normand, Phillipe [UNIV LYON

    2009-01-01

    We present here the complete 2.4 MB genome of the actinobacterial thermophile, Acidothermus cellulolyticus 11B, that surprisingly reveals thermophilic amino acid usage in only the cytosolic subproteome rather than its whole proteome. Thermophilic amino acid usage in the partial proteome implies a recent, ongoing evolution of the A. cellulolyticus genome since its divergence about 200-250 million years ago from its closest phylogenetic neighbor Frankia, a mesophilic plant symbiont. Differential amino acid usage in the predicted subproteomes of A. cellulolyticus likely reflects a stepwise evolutionary process of modern thermophiles in general. An unusual occurrence of higher G+C in the non-coding DNA than in the transcribed genome reinforces a late evolution from a higher G+C common ancestor. Comparative analyses of the A. cellulolyticus genome with those of Frankia and other closely-related actinobacteria revealed that A. cellulolyticus genes exhibit reciprocal purine preferences at the first and third codon positions, perhaps reflecting a subtle preference for the dinucleotide AG in its mRNAs, a possible adaptation to a thermophilic environment. Other interesting features in the genome of this cellulolytic, hot-springs dwelling prokaryote reveal streamlining for adaptation to its specialized ecological niche. These include a low occurrence of pseudo genes or mobile genetic elements, a flagellar gene complement previously unknown in this organism, and presence of laterally-acquired genomic islands of likely ecophysiological value. New glycoside hydrolases relevant for lignocellulosic biomass deconstruction were identified in the genome, indicating a diverse biomass-degrading enzyme repertoire several-fold greater than previously characterized, and significantly elevating the industrial value of this organism.

  6. Fermentative Conversion of Cellulose to Acetic Acid and Cellulolytic Enzyme Production by a Bacterial Mixed Culture Obtained from Sewage Sludge †

    OpenAIRE

    Khan, A. W.; Wall, Duncan; L. Van Den Berg

    1981-01-01

    A simple procedure that uses a cellulose-enriched culture started from sewage sludge was developed for producing cellulolytic enzymes and converting cellulose to acetic acid rather than CH4 and CO2. In this procedure, the culture which converts cellulose to CH4 and CO2 was mixed with a synthetic medium and cellulose and heated to 80°C for 15 min before incubation. The end products formed were acetic acid, propionic acid, CO2, and traces of ethanol and H2. Supernatants from 6- to 10-day-old cu...

  7. Enzymatic activity of the cellulolytic complex produced by Trichoderma reesei. Enzymatic hydrolysis of cellulose; Actividad enzimatica del complejo celulolitico producido por Trichoderma reesei. Hidrolisis enzimatica de la celulosa

    Energy Technology Data Exchange (ETDEWEB)

    Alfonsel, M.; Negro, M. J.; Saez, R.; Martin, C.

    1986-07-01

    The enzymatic activity characterization of the cellulolytic complex obtained from Trichoderma reesei QM 9414 and the influence of the enzymatic hydrolysis conditions on the hydrolysis yield are studied. Pure cellulose and native or alkali pretreated biomass Onopordum nervosum have been used as substrates. The values of pH, temperature, substrate concentration and enzyme-substrate ratio for the optimum activity of that complex, evaluated as glucose and reducing sugars production, have been selected. Previous studies on enzymatic hydrolysis of 0. nervosum have shown a remarkable effect of the alkaline pretreatments on the final hydrolysis yield. (Author) 10 refs.

  8. A semi-continuous culture system for production of cellulolytic and xylanolytic enzymes by the anaerobic fungus Piromyces sp. strain E2

    Energy Technology Data Exchange (ETDEWEB)

    Teunissen, M.J.; Baerends, R.J.S.; Knelissen, R.A.G.; Camp, H.J.M. op den; Vogels, G.D. (Katholieke Univ., Nijmegen (Netherlands). Dept. of Microbiology)

    1992-10-01

    A system was developed for the semi-continous cultivation of an anaerobic fungus, Piromyces sp. strain E2 (isolated from an Indian elephant), on Avicel (microcrystalline cellulose). The fungus was grown in a semi-continuous culture system: Solids and fungal biomass was retained by means of a simple filter construction whereas the culture fluid was removed continuously. The production of fermentation products (acetate, ethanol, formate, lactate, hydrogen or methane), cellulolytic and xylanolytic enzymes, and protein by the fungus in monoculture or co-culture with Methanobacterium formicicum during growth on Avicel was monitored up to 45 days. These productions stabilized after an adaptation period of 24 and 30 days in the semi-continuous co-culture and monoculture, respectively. After this period the average ([+-]SD) avicelase, [beta]-glucosidase, endoglucanase, and xylanase production in the semicontinuous monoculture were 27[+-]6, 140[+-]16, 1057[+-]120 and 5012[+-]583 IUxl[sup -1]xday[sup -1], respectively. Co-culture with the methanogen caused a shift in fermentation products to more acetate, and less ethanol and lactate. Furthermore, the production of all cellulolytic enzymes increased (40%) and xylanolytic enzyme production decreased (35%). (orig.).

  9. Production and assay of cellulolytic enzyme activity of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya abbatoir, Indonesia

    Directory of Open Access Journals (Sweden)

    W. P. Lokapirnasari

    2015-03-01

    Full Text Available Aim: This study aims to produce and assay cellulolytic enzyme activity (endo-(1,4-β-D-glucanase, exo-(1,4-β-Dglucanase, and β-glucosidase, at optimum temperature and optimum pH of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya Abbatoir, Indonesia. Materials and Methods: To produce enzyme from a single colony of E. cloacae WPL 214, 98 × 1010 CFU/ml of isolates was put into 20 ml of liquid medium and incubated in a shaker incubator for 16 h at 35°C in accordance with growth time and optimum temperature of E. cloacae WPL 214. Further on, culture was centrifuged at 6000 rpm at 4°C for 15 min. Pellet was discarded while supernatant containing cellulose enzyme activity was withdrawn to assay endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase, and β-glucosidase. Results: Cellulase enzyme of E. cloacae WPL 214 isolates had endoglucanase activity of 0.09 U/ml, exoglucanase of 0.13 U/ml, and cellobiase of 0.10 U/ml at optimum temperature 35°C and optimum pH 5. Conclusion: E. cloacae WPL 214 isolated from bovine rumen fluid waste produced cellulose enzyme with activity as cellulolytic enzyme of endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase and β-glucosidase.

  10. Interação com os pais e o uso do espaço por um infante de Alouatta fusca (Geoffroy Saint-Hilaire, 1812 em cativeiro Interaction with parents and use of space by an infant of Alouatta fusca (Geoffroy Saint Hilaire, 1812 in captivity

    Directory of Open Access Journals (Sweden)

    Fernanda Keley Silva Pereira Navarro

    2012-09-01

    significant departure (P < 0.05 compared to the puppy's maternal contact with increasing age and greater independence. The most used during the first 3 months of captivity was the pergola. In December, a period of higher rainfall, the chick ventral increased interactions with the mother, and stayed longer in the barrel. Information obtained here will contribute to a better understanding in relation to infants of Alouatta fusca, their social interactions and use of space that can be used to improve the ex-situ management of animals, creating better conditions for the stay of those in captivity, using appropriate structures that mimic the natural environment, to ensure the welfare of apes and thus the survival of the species.

  11. The genome sequences of Cellulomonas fimi and "Cellvibrio gilvus" reveal the cellulolytic strategies of two facultative anaerobes, transfer of "Cellvibrio gilvus" to the genus Cellulomonas, and proposal of Cellulomonas gilvus sp. nov.

    Directory of Open Access Journals (Sweden)

    Melissa R Christopherson

    Full Text Available Actinobacteria in the genus Cellulomonas are the only known and reported cellulolytic facultative anaerobes. To better understand the cellulolytic strategy employed by these bacteria, we sequenced the genome of the Cellulomonas fimi ATCC 484(T. For comparative purposes, we also sequenced the genome of the aerobic cellulolytic "Cellvibrio gilvus" ATCC 13127(T. An initial analysis of these genomes using phylogenetic and whole-genome comparison revealed that "Cellvibrio gilvus" belongs to the genus Cellulomonas. We thus propose to assign "Cellvibrio gilvus" to the genus Cellulomonas. A comparative genomics analysis between these two Cellulomonas genome sequences and the recently completed genome for Cellulomonas flavigena ATCC 482(T showed that these cellulomonads do not encode cellulosomes but appear to degrade cellulose by secreting multi-domain glycoside hydrolases. Despite the minimal number of carbohydrate-active enzymes encoded by these genomes, as compared to other known cellulolytic organisms, these bacteria were found to be proficient at degrading and utilizing a diverse set of carbohydrates, including crystalline cellulose. Moreover, they also encode for proteins required for the fermentation of hexose and xylose sugars into products such as ethanol. Finally, we found relatively few significant differences between the predicted carbohydrate-active enzymes encoded by these Cellulomonas genomes, in contrast to previous studies reporting differences in physiological approaches for carbohydrate degradation. Our sequencing and analysis of these genomes sheds light onto the mechanism through which these facultative anaerobes degrade cellulose, suggesting that the sequenced cellulomonads use secreted, multidomain enzymes to degrade cellulose in a way that is distinct from known anaerobic cellulolytic strategies.

  12. Investigations on potato pulp as a dietary fiber source. The influence of pectolytic and cellulolytic enzymes. Untersuchungen an Kartoffelpuelpe als Ballaststoffquelle. Zum Einfluss von pektolytischen und cellulolytischen Enzymen

    Energy Technology Data Exchange (ETDEWEB)

    Dongowski, G. (Deutsches Inst. fuer Ernaehrungsforschung Potsdam-Rehbruecke, Bergholz-Rehbruecke (Germany))

    1993-05-01

    The influence of treatment with pectolytic and cellulolytic enzyme preparations was investigated with reference to the separation of water and the composition of potato pulp. In contrast to pectinesterase, pectate lyase or cellulase it was found an intensive action on the pulp after incubation with Pectinex Ultra SP-L or pectinase/cellulase combinations. The content of pectin, starch and protein as well as the water binding capacity are varied in dependence of the used enzyme preparations. The occurring changes in the supermolecular structure of the potato pulp tissue are investigated by scanning electron microscopy. The grown biological structure is partly or extensive destroyed especially after action of pectinases and cellulases. The content of starch in the potato pulp preparations remains relatively high even after intensive treatment with cell wall degrading enzymes. (orig.)

  13. Effects of Neutral Detergent Soluble Fiber and Sucrose Supplementation on Ruminal Fermentation, Microbial Synthesis, and Populations of Ruminal Cellulolytic Bacteria Using the Rumen Simulation Technique (RUSITEC)

    Institute of Scientific and Technical Information of China (English)

    ZHAO Xiang-hui; LIU Chan-juan; LI Chao-yun; YAO Jun-hu

    2013-01-01

    We evaluated the effects of neutral detergent soluble fiber (NDSF) and sucrose supplementation on ruminal fermentation, microbial synthesis, and populations of ruminal cellulolytic bacteria using the rumen simulation technique (RUSITEC). The experiment had a 2×2 factorial design with two dosages of sucrose, low (ca. 0.26 g d-1, low-sucrose) and high (ca. 1.01 g d-1, high-sucrose), and two dosages of supplied NDSF, low (1.95 g d-1, low-NDSF) and high (2.70 g d-1, high-NDSF). Interactions between NDSF and sucrose were detected for xylanase activity from solid fraction and apparent disappearance of neutral detergent fiber (NDF) and hemicellulose, with the lowest values observed for high-NDSF and high-sucrose treatment. Supplemental NDSF appeared to increase the molar proportion of acetate and reduce that of butyrate;however, the effects of supplemental sucrose on VFA profiles depended upon NDSF amount. There was a NDSF×sucrose interaction for the production of methane. High-NDSF fermenters had lower ammonia-N production, greater daily N flow of solid-associated microbial pellets and total microorganisms, and greater microbial synthesis efficiency compared with low-NDSF fermenters. Supplementation with NDSF resulted in an increase in 16S rDNA copies of Ruminococcus flavefaciens and a reduction in copies of Ruminococcus albus. Supplementation with sucrose tended to increase the 16S rDNA copies of R. albus from liquid fraction, but did not affect daily total microbial N flow and cellulolytic bacterium populations from solid fraction. These data indicate that the effects of the interaction between NDSF and sugars on ruminal fermentation and fiber digestion should be taken into account in diet formulation. Ruminal fermentation and metabolism of sugars warrant further investigation.

  14. Kallotenue papyrolyticum gen. nov., sp. nov., a cellulolytic and filamentous thermophile that represents a novel lineage (Kallotenuales ord. nov., Kallotenuaceae fam. nov.) within the class Chloroflexia

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Jesse; Gieler, Brandon; Heisler, Devon; Palisoc, Maryknoll; Williams, Amanda; Dohnalkova, Alice; Ming, Hong; Yu, Tian T.; Dodsworth, Jeremy A.; Li, Wen J.; Hedlund, Brian P.

    2013-08-15

    Several closely-related, thermophilic, and cellulolytic bacterial strains, designated JKG1T, JKG2, JKG3, JKG4, and JKG5, were isolated from a cellulolytic enrichment (corn stover) incubated in the water column of Great Boiling Spring, NV. Strain JKG1T had cells of a diameter of 0.7 - 0.9 μm and length of ~2.0 μm that formed non-branched multicellular filaments reaching >300 μm. Spores were not formed and dense liquid cultures were red. The temperature range for growth was 45-65 °C, with an optimum of 55 °C. The pH range for growth was 5.6-9.0, with an optimum of 7.5. JKG1T grew as an aerobic heterotroph, utilizing glucose, sucrose, xylose, arabinose, cellobiose, carboxymethylcellulose, filter paper, microcrystalline cellulose, xylan, starch, casamino acids, tryptone, peptone, yeast extract, acetate, citrate, lactate, pyruvate, and glycerol as sole carbon sources, and was not observed to photosynthesize. The cells stained Gram-negative. Phylogenetic analysis using 16S rRNA gene sequences placed the new isolates in the class Chloroflexia, but distant from other cultivated members, with the highest sequence identity of 82.5% to Roseiflexus castenholzii. The major quinone was menaquinone-9; no ubiquinones were detected. The major cellular fatty acids (>5%) were C18:0, anteiso-C17:0, iso-C18:0, and iso-C17:0. C16:0, iso-C16:0, and C17:0. The peptidoglycan amino acids were alanine, ornithine, glutamic acid, serine, and asparagine. Whole-cell sugars included mannose, rhamnose, glucose, galactose, ribose, arabinose, and xylose. Morphological, phylogenetic, and chemotaxonomic results suggest that JKG1T is representative of a new lineage within the class Chloroflexia, which we propose to designate Kallotenue papyrolyticum gen. nov., sp. nov., Kallotenuaceae fam. nov., Kallotenuales ord. nov.

  15. Activity-based protein profiling of secreted cellulolytic enzyme activity dynamics in Trichoderma reesei QM6a, NG14, and RUT-C30

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Lindsey N.; Culley, David E.; Hofstad, Beth A.; Chauvigne-Hines, Lacie M.; Zink, Erika M.; Purvine, Samuel O.; Smith, Richard D.; Callister, Stephen J.; Magnuson, Jon M.; Wright, Aaron T.

    2013-12-01

    Development of alternative, non-petroleum based sources of bioenergy that can be applied in the short-term find great promise in the use of highly abundant and renewable lignocellulosic plant biomass.1 This material obtained from different feedstocks, such as forest litter or agricultural residues, can yield liquid fuels and other chemical products through biorefinery processes.2 Biofuels are obtained from lignocellulosic materials by chemical pretreatment of the biomass, followed by enzymatic decomposition of cellulosic and hemicellulosic compounds into soluble sugars that are converted to desired chemical products via microbial metabolism and fermentation.3, 4 To release soluble sugars from polymeric cellulose multiple enzymes are required, including endoglucanase, exoglucanase, and β-glucosidase.5, 6 However, the enzymatic hydrolysis of cellulose into soluble sugars remains a significant limiting factor to the efficient and economically viable utilization of lignocellulosic biomass for transport fuels.7, 8 The primary industrial source of cellulose and hemicellulases is the mesophilic soft-rot fungus Trichoderma reesei,9 having widespread applications in food, feed, textile, pulp, and paper industries.10 The genome encodes 200 glycoside hydrolases, including 10 cellulolytic and 16 hemicellulolytic enzymes.11 The hypercellulolytic catabolite derepressed strain RUT-C30 was obtained through a three-step UV and chemical mutagenesis of the original T. reesei strain QM6a,12, 13 in which strains M7 and NG14 were intermediate, having higher cellulolytic activity than the parent strain but less activity and higher catabolite repression than RUT-C30.14 Numerous methods have been employed to optimize the secreted enzyme cocktail of T. reesei including cultivation conditions, operational parameters, and mutagenesis.3 However, creating an optimal and economical enzyme mixture for production-scale biofuels synthesis may take thousands of experiments to identify.

  16. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    Directory of Open Access Journals (Sweden)

    Yan-Ling Liang

    2014-01-01

    Full Text Available From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36.36% of all the 22 strains. Three isolates among the 22 strains showed higher carboxymethyl cellulase (CMCase activity, and isolate ME27-1 exhibited the highest CMCase activity in liquid culture. The strain ME27-1 was identified as Paenibacillus terrae on the basis of 16S rRNA gene sequence analysis as well as physiological and biochemical properties. The optimum pH and temperature for CMCase activity produced by the strain ME27-1 were 5.5 and 50°C, respectively, and the enzyme was stable at a wide pH range of 5.0–9.5. A 12-fold improvement in the CMCase activity (2.08 U/mL of ME27-1 was obtained under optimal conditions for CMCase production. Thus, this study provided further information about the diversity of cellulose-degrading bacteria in the subtropical region of China and found P. terrae ME27-1 to be highly cellulolytic.

  17. Cellulolytic potential of probiotic Bacillus Subtilis AMS6 isolated from traditional fermented soybean (Churpi): An in-vitro study with regards to application as an animal feed additive.

    Science.gov (United States)

    Manhar, Ajay K; Bashir, Yasir; Saikia, Devabrata; Nath, Dhrubajyoti; Gupta, Kuldeep; Konwar, Bolin K; Kumar, Rahul; Namsa, Nima D; Mandal, Manabendra

    2016-01-01

    The aim of the present study is to evaluate the probiotic attributes of Bacillus subtilis AMS6 isolated from fermented soybean (Churpi). This isolate exhibited tolerance to low pH (pH 2.0) and bile salt (0.3%), capability to autoaggregate and coaggregate. AMS6 also showed highest antibacterial activity against the pathogenic indicator strain Salmonella enterica typhimurium (MTCC 1252) and susceptibility towards different antibiotics tested. The isolate was effective in inhibiting the adherence of food borne pathogens to Caco-2 epithelial cell lines, and was also found to be non-hemolytic which further strengthen the candidature of the isolate as a potential probiotic. Further studies revealed B. subtilis AMS6 showed cellulolytic activity (0.54±0.05 filter paper units mL(-1)) at 37°C. The isolate was found to hydrolyze carboxymethyl cellulose, filter paper and maize (Zea mays) straw. The maize straw digestion was confirmed by scanning electron microscopy studies. The isolate was able to degrade filter paper within 96h of incubation. A full length cellulase gene of AMS6 was amplified using degenerate primers consisting of 1499 nucleotides. The ORF encoded for a protein of 499 amino acids residues with a predicted molecular mass of 55.04kDa. The amino acids sequence consisted of a glycosyl hydrolase family 5 domain at N-terminal; Glycosyl hydrolase catalytic core and a CBM-3 cellulose binding domain at its C terminal. The study suggests potential probiotic B. subtilis AMS6 as a promising candidate envisaging its application as an animal feed additive for enhanced fiber digestion and gut health of animal. PMID:27242144

  18. Synergistic Effect of Simple Sugars and Carboxymethyl Cellulose on the Production of a Cellulolytic Cocktail from Bacillus sp. AR03 and Enzyme Activity Characterization.

    Science.gov (United States)

    Manfredi, Adriana P; Pisa, José H; Valdeón, Daniel H; Perotti, Nora I; Martínez, María A

    2016-04-01

    A cellulase-producing bacterium isolated from pulp and paper feedstock, Bacillus sp. AR03, was evaluated by means of a factorial design showing that peptone and carbohydrates were the main variables affecting enzyme production. Simple sugars, individually and combined with carboxymethyl cellulose (CMC), were further examined for their influence on cellulase production by strain AR03. Most of the mono and disaccharides assayed presented a synergistic effect with CMC. As a result, a peptone-based broth supplemented with 10 g/L sucrose and 10 g/L CMC maximized enzyme production after 96 h of cultivation. This medium was used to produce endoglucanases in a 1-L stirred tank reactor in batch mode at 30 °C, which reduced the fermentation period to 48 h and reaching 3.12 ± 0.02 IU/mL of enzyme activity. Bacillus sp. AR03 endoglucanases showed an optimum temperature of 60 °C and a pH of 6.0 with a wide range of pH stability. Furthermore, presence of 10 mM Mn(2+) and 5 mM Co(2+) produced an increase of enzyme activity (246.7 and 183.7 %, respectively), and remarkable tolerance to NaCl, Tween 80, and EDTA was also observed. According to our results, the properties of the cellulolytic cocktail from Bacillus sp. AR03 offer promising features in view of potential biorefinery applications. PMID:26797928

  19. Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, David B.

    2008-04-02

    This grant provided the basic funding that enabled me to carry out a detailed characterization of the proteins used by the aerobic soil bacterium, Thermobifida fusca, to degrade cellulose and to study the mechanisms used by T. fusca to regulate cellulase synthesis. This work resulted in 53 publications and led to the decision by The DOE Joint Genome Institute to sequence the T. fusca genome. T. fusca is now recognized as one of the best studied cellulolytic microorganisms and our work led to the discovery of a novel class of cellulases, processive endoglucanases, which are found in many cellulolytic bacteria including both aerobes and anaerobes. In addition, we were able to determine the mechanism by which Cel9A caused processive hydrolysis of cellulose. This research also helped to explain why many cellulolytic microorganisms produce two different exocellulases, as we showed that these enzymes have different specificities, with one attacking the reducing end of a cellulose chain and the other attacking the nonreducing end. Our work also provided additional evidence for the importance of a cellulose binding domain (carbohydrate binding module) [CBM] in the hydrolysis of crystalline cellulose.

  20. 纤维素分解酶处理玉米秸秆对肉牛生产性能和经济效益的影响%Effects of corn stover fermented by cellulolytic enzyme on production performance and economic benefit in beef cattle

    Institute of Scientific and Technical Information of China (English)

    高月平; 张贵花; 王聪; 刘强; 白元生; 师周戈; 刘晓妮

    2013-01-01

    研究玉米秸秆经纤维素分解酶(纤维素酶和木聚糖酶)处理后的化学成分变化以及对肉牛生产性能和经济效益的影响.选用12月龄左右的西门塔尔牛36头,对照组饲喂基础日粮(混合精料十玉米秸秆,精粗比45∶55),试验组分别以0.5%、1.0%和1.5%的纤维素分解酶处理玉米秸秆替代基础饲粮中的玉米秸秆进行为期70 d的试验.结果表明:采用纤维素分解酶处理玉米秸秆后化学成分发生变化,粗蛋白质含量增加显著,中性洗涤纤维和酸性洗涤纤维降低显著,1.5%的纤维素分解酶处理组中性洗涤纤维和酸性洗涤纤维显著低于1.0%的纤维素分解酶处理组.1.0%、1.5%的纤维素分解酶处理组西门塔尔牛干物质采食量、平均日增重和经济效益提高显著(P<0.05).适宜的纤维素分解酶添加水平为1.0%.%The objective was to evaluate the effects of corn stover fermented by cellulolytic enzyme on nutrition of corn stover,production performance of beef cattles and economic benefit.Thirty-six Simmenta beef cattles (12-month-old) were randomly divided into 4 groups.The control group was fed the basal diet (mixed concentrate and corn stover,concentrate to roughage as 45 to 55).Treatments lasted for 70 days were fed corn stover fermented by cellulolytic enzyme at 0.5%,1.0% and 1.5 %,respectively.The results showed that chemical composition of corn stover changed with the addition of cellulolytic enzymes.The crude protein content increased significantly,neutral detergent fiber and acid detergent fiber decreased significantly.neutral detergent fiber and acid detergent fiber of 1.5 % cellulolytic enzyme treatment were significantly lower than that of 1% cellulolytic enzyme treatment.The dry matter intake,average daily gain and economic benefit of 1.0%,1.5% cellulolytic enzyme treatment increased significantly (P<0.05).The cellulolytic enzyme addition level as 1% was good.

  1. Use of remazol blue dyed avicel for the determination of cellulolytic activity in basidiomycetes Uso de Avicel colorida com Remazol Blue para determinação da atividade celulolítica em Basidiomycetos

    Directory of Open Access Journals (Sweden)

    Marcos José Correia

    1998-10-01

    Full Text Available A modified method for direct determination of cellulolytic activity using Avicel colored with Remazol Brilliant Blue R (RBBR in Agar test tubes is discussed. Refinements were introduced in a simple method for quantitation of cellulase activity, based on the release of dye from Avicel-RBBR medium by the enzymatic hydrolysis. Modifications in Avicel-dye preparation were enhanced and a spectrophotometer for direct OD measurement in agar test tubes used. The use of a spectrophotometer improved the precision of the collected data, since absorbance measurements could be done at the maximum wavelenght for RBBR (595 nm.Neste trabalho, é discutido um método modificado para determinação da atividade celulolítica em fungos utilizando Avicel colorida com Remazol Brilliant Blue R (RBBR, diretamente em tubos com ágar, a partir de refinamentos introduzidos em uma metodologia simples e baseada na liberação deste corante pela ação hidrolítica em Avicel colorida com o RBBR. Foram feitas modificações no preparo da Avicel colorida, bem como um espectrofotômetro para medição direta da absorbância nos tubos com ágar foi usado. O uso de espectrofotômetro aumentou a precisão dos dados coletados, pois permitiu leituras de absorbância no comprimento de onda máximo para RBBR (595 nm.

  2. Optimization of productions of cellulolytic enzymes by Aspergillus niger using residue of mango a substrate Otimização da produção de enzimas celulolíticas obtidas de Aspergillus niger utilizando o resíduo da manga como substrato

    OpenAIRE

    Tamires Carvalho dos Santos; Ingrid Souza Cavalcanti; Renata Cristina Ferreira Bonomo; Nivio Batista Santana; Marcelo Franco

    2011-01-01

    The present paper analyses the effects of water activity (0.88, 0.94 and 0.97) and of fermentation time (24, 48, 72, 96 and 120 hours) on the kinetic activity of enzymes cellulolytic, produced during the solid state fermentation of waste from the improvement of mango, with the aid of fungus species Aspergillus niger. Solid state fermentation was carried out at 35°C inside a bacteriological incubator. The statistical results indicated that the best activity for enzyme CMCase was 7.26U g-1 ...

  3. IMPACTS OF BIOFILM FORMATION ON CELLULOSE FERMENTATION

    Energy Technology Data Exchange (ETDEWEB)

    Leschine, Susan

    2009-10-31

    This project addressed four major areas of investigation: i) characterization of formation of Cellulomonas uda biofilms on cellulose; ii) characterization of Clostridium phytofermentans biofilm development; colonization of cellulose and its regulation; iii) characterization of Thermobifida fusca biofilm development; colonization of cellulose and its regulation; and iii) description of the architecture of mature C. uda, C. phytofermentans, and T. fusca biofilms. This research is aimed at advancing understanding of biofilm formation and other complex processes involved in the degradation of the abundant cellulosic biomass, and the biology of the microbes involved. Information obtained from these studies is invaluable in the development of practical applications, such as the single-step bioconversion of cellulose-containing residues to fuels and other bioproducts. Our results have clearly shown that cellulose-decomposing microbes rapidly colonize cellulose and form complex structures typical of biofilms. Furthermore, our observations suggest that, as cells multiply on nutritive surfaces during biofilms formation, dramatic cell morphological changes occur. We speculated that morphological changes, which involve a transition from rod-shaped cells to more rounded forms, might be more apparent in a filamentous microbe. In order to test this hypothesis, we included in our research a study of biofilm formation by T. fusca, a thermophilic cellulolytic actinomycete commonly found in compost. The cellulase system of T. fusca has been extensively detailed through the work of David Wilson and colleagues at Cornell, and also, genome sequence of a T. fusca strain has been determine by the DOE Joint Genome Institute. Thus, T. fusca is an excellent subject for studies of biofilm development and its potential impacts on cellulose degradation. We also completed a study of the chitinase system of C. uda. This work provided essential background information for understanding how C. uda

  4. Sugarcane bagasse hydrolysis using yeast cellulolytic enzymes.

    Science.gov (United States)

    Souza, Angelica Cristina de; Carvalho, Fernanda Paula; Silva e Batista, Cristina Ferreira; Schwan, Rosane Freitas; Dias, Disney Ribeiro

    2013-10-28

    Ethanol fuel production from lignocellulosic biomass is emerging as one of the most important technologies for sustainable development. To use this biomass, it is necessary to circumvent the physical and chemical barriers presented by the cohesive combination of the main biomass components, which hinders the hydrolysis of cellulose and hemicellulose into fermentable sugars. This study evaluated the hydrolytic capacity of enzymes produced by yeasts, isolated from the soils of the Brazilian Cerrado biome (savannah) and the Amazon region, on sugarcane bagasse pre-treated with H2SO4. Among the 103 and 214 yeast isolates from the Minas Gerais Cerrado and the Amazon regions, 18 (17.47%) and 11 (5.14%) isolates, respectively, were cellulase-producing. Cryptococcus laurentii was prevalent and produced significant β- glucosidase levels, which were higher than the endo- and exoglucanase activities. In natura sugarcane bagasse was pre-treated with 2% H2SO4 for 30 min at 150oC. Subsequently, the obtained fibrous residue was subjected to hydrolysis using the Cryptococcus laurentii yeast enzyme extract for 72 h. This enzyme extract promoted the conversion of approximately 32% of the cellulose, of which 2.4% was glucose, after the enzymatic hydrolysis reaction, suggesting that C. laurentii is a good β-glucosidase producer. The results presented in this study highlight the importance of isolating microbial strains that produce enzymes of biotechnological interest, given their extensive application in biofuel production. PMID:23851270

  5. Structure/function relationships in cellulolytic enzymes

    Institute of Scientific and Technical Information of China (English)

    Marc Claeyssens

    2004-01-01

    @@ Cellulose and hemicellulose (mostly xylan), together with lignin, are the major polymeric constituents of plant cell walls and from the largest reservoir of fixed carbon in nature. The enzymatic hydrolysis of polymeric substances by extracellular enzymes, such as cellulases, hemicellulases and laccases, is preferred to chemical depolymerisation to avoid the production of toxic by-products and waste that are expensive to treat. The monosaccharides released through enzymatic hydrolysis can subsequently be microbially converted to commercial commodities, such as bio-ethanol (fuel extender) or microbial protein as feed supplements. The individual depolymerisering enzymes used, such as cellulases,xylanases and laccases, also have industrial application in (i) biobleaching in the paper and pulp industry, (ii) improvement of animal feed (poultry and ruminants) digestibility in feed industries, and (iii) dough rheology and bread volume in the baking process, and beer viscosity and filtration velocity during brewing. The cloning of the genes, coding for several xylan degrading enzymes, and their expression in Baker' s yeast (Saccharomyces cerevisiae) and filamentous fungi (Aspergillus species)opened the possibility to study the pure enzymes, without contaminating activity.Trichoderma reesei produces several of these enzymes and detailed information on their specificity,synergies and structure/activity relationships is known. An overview will be presented.

  6. Genomics of aerobic cellulose utilization systems in actinobacteria.

    Directory of Open Access Journals (Sweden)

    Iain Anderson

    Full Text Available Cellulose degrading enzymes have important functions in the biotechnology industry, including the production of biofuels from lignocellulosic biomass. Anaerobes including Clostridium species organize cellulases and other glycosyl hydrolases into large complexes known as cellulosomes. In contrast, aerobic actinobacteria utilize systems comprised of independently acting enzymes, often with carbohydrate binding domains. Numerous actinobacterial genomes have become available through the Genomic Encyclopedia of Bacteria and Archaea (GEBA project. We identified putative cellulose-degrading enzymes belonging to families GH5, GH6, GH8, GH9, GH12, GH48, and GH51 in the genomes of eleven members of the actinobacteria. The eleven organisms were tested in several assays for cellulose degradation, and eight of the organisms showed evidence of cellulase activity. The three with the highest cellulase activity were Actinosynnema mirum, Cellulomonas flavigena, and Xylanimonas cellulosilytica. Cellobiose is known to induce cellulolytic enzymes in the model organism Thermobifida fusca, but only Nocardiopsis dassonvillei showed higher cellulolytic activity in the presence of cellobiose. In T. fusca, cellulases and a putative cellobiose ABC transporter are regulated by the transcriptional regulator CelR. Nine organisms appear to use the CelR site or a closely related binding site to regulate an ABC transporter. In some, CelR also regulates cellulases, while cellulases are controlled by different regulatory sites in three organisms. Mining of genome data for cellulose degradative enzymes followed by experimental verification successfully identified several actinobacteria species which were not previously known to degrade cellulose as cellulolytic organisms.

  7. 单宁和聚乙二醇对绵羊和山羊瘤胃纤维降解菌数量的影响%Effects of Tannin and Polyethylene Glycol on Ruminal Cellulolytic Bacteria Quantity in Sheep and Goats

    Institute of Scientific and Technical Information of China (English)

    李大彪; 张梅梅; 于永强; 李红磊; 塔娜; 邢媛媛; 王卫云

    2015-01-01

    本文旨在研究饲粮中添加不同水平的单宁和高单宁饲粮条件下添加聚乙二醇( PEG )对绵羊和山羊瘤胃纤维降解菌数量的影响。试验选用1.5岁、体重约45 kg、安装永久性瘤胃瘘管的绵羊和绒山羊各4只,采用自身对照试验设计,分4期进行。第1期饲喂基础饲粮(Ⅰ组),第2期在基础饲粮中添加2%的单宁(Ⅱ组),第3期在基础饲粮中添加6%的单宁(Ⅲ组),第4期在基础饲粮中添加6%单宁+12% PEG(Ⅳ组)。每期试验30 d,其中预试期12 d,正试期18 d。每个正试期第1天,采集绵羊和山羊瘤胃内容物,测定瘤胃液pH、氨态氮( NH3-N)和菌体蛋白( MCP)浓度;运用实时定量PCR技术对固相、液相及全食糜中所附着的白色瘤胃球菌、黄色瘤胃球菌、产琥珀酸拟杆菌进行定量检测。结果表明:1)与Ⅰ组相比,添加6%单宁显著降低了山羊瘤胃液NH3-N浓度和绵羊瘤胃液MCP浓度( P<0.05)。添加6%单宁+12% PEG后,这2个指标恢复至与Ⅰ组相当的水平。2)与Ⅰ组相比,添加6%单宁显著降低了绵羊和山羊瘤胃固相、绵羊瘤胃液相白色瘤胃球菌数量( P<0.05);添加2%和6%单宁显著降低了绵羊和山羊固相黄色瘤胃球菌数量( P<0.05),添加6%单宁显著降低了绵羊和山羊瘤胃液相黄色瘤胃球菌数量( P<0.05);添加6%单宁显著降低了绵羊和山羊瘤胃固相、绵羊全食糜产琥珀酸拟杆菌数量( P<0.05)。添加6%单宁+12% PEG后,绵羊和山羊瘤胃这3株纤维降解菌数量恢复至Ⅰ组水平或高于Ⅰ组。由此可见,饲粮单宁添加量达到6%时降低了瘤胃液NH3-N的浓度,影响MCP的合成,抑制瘤胃固相纤维降解菌的增殖;添加PEG可以削弱单宁对瘤胃纤维降解菌生长的负面影响,促进瘤胃发酵。%This paper studied the effects of different dietary tannin levels and high tannin diets supplemented with polyethylene glycol ( PEG) on ruminal cellulolytic bacteria quantity in sheep and

  8. Cellulase variants

    Energy Technology Data Exchange (ETDEWEB)

    Blazej, Robert; Toriello, Nicholas; Emrich, Charles; Cohen, Richard N.; Koppel, Nitzan

    2015-07-14

    This invention provides novel variant cellulolytic enzymes having improved activity and/or stability. In certain embodiments the variant cellulotyic enzymes comprise a glycoside hydrolase with or comprising a substitution at one or more positions corresponding to one or more of residues F64, A226, and/or E246 in Thermobifida fusca Cel9A enzyme. In certain embodiments the glycoside hydrolase is a variant of a family 9 glycoside hydrolase. In certain embodiments the glycoside hydrolase is a variant of a theme B family 9 glycoside hydrolase.

  9. Screening and characterization of indigenous cellulolytic and xylanolytic bacteria

    International Nuclear Information System (INIS)

    Ninety-six bacterial isolates were isolated from the soil samples collected from MADA Rice Experimental Plot, Kedah. Many of the isolates were Gram-positive bacteria suggesting this type of bacteria makes up the majority of the culturable populations residing in the plots investigated. These isolates were studied for their abilities to hydrolyse carboxymethyl cellulose (CMC) and xylan. Ability to hydrolyse CMC was observed in 61.5% of the isolates. Whilst 62.5% of the isolates exhibiting the ability to hydrolyse xylan. Active isolates were further confirmed by the presence of the respective gene(s) via molecular approaches. These isolates were later screened by restriction fragment length polymorphism (RFLP), and sequencing of representative 16S rDNAs. Majority of identified isolates were members of common soil microbe such as members of the genera Bacillus. (Author)

  10. Isolation of Cellulolytic Bacteria and Characterization of the Enzyme

    Directory of Open Access Journals (Sweden)

    Nisa Rachmania

    2009-04-01

    Full Text Available Four of cellulolitic bacteria isolates had beencharacterized. The determination of cellulase activity was conducted at the highest production time, using crudeenzymes with the modification of Miller methods (1959 on pure cellulose substrates such as CMC (Carboxymethylcellulose, Avicel and Filter paper Whatman No. 1 as well as agriculture waste such as rice straw, corn cob and bananapeel. Cellulase from C4-4, C5-1, C5-3 and C11-1 showed optimum activity at pH 5, 70°C, pH 3.5, 90°C, pH 5, 80°Cand pH 8, 70°C, respectively. Avicel is a appropriate substrate for C4-4 cellulase whereas CMC for the other three.C11-1 cellulase has the highest cellulase enzyme activity on rice straw substrate whereas C4-4 cellulase on banana peelsubstrates. C5-1 and C5-3 cellulase have relatively low cellulase activities in degrading substrates of agriculture waste.However, isolates of C5-1 and C5-3 have high cellulase activities on banana peel substrates.

  11. Isolation of Cellulolytic Bacteria and Characterization of the Enzyme

    OpenAIRE

    Nisa Rachmania; Titi Candra Sunarti; Besty Maranatha; Wahyu Widosari; Anja Meryandini; Hasrul Satria

    2009-01-01

    Four of cellulolitic bacteria isolates had beencharacterized. The determination of cellulase activity was conducted at the highest production time, using crudeenzymes with the modification of Miller methods (1959) on pure cellulose substrates such as CMC (Carboxymethylcellulose), Avicel and Filter paper Whatman No. 1 as well as agriculture waste such as rice straw, corn cob and bananapeel. Cellulase from C4-4, C5-1, C5-3 and C11-1 showed optimum activity at pH 5, 70°C, pH 3.5, 90°C, pH 5, 80°...

  12. Utilization of individual cellodextrins by three predominant ruminal cellulolytic bacteria.

    OpenAIRE

    Shi, Y; Weimer, P.J.

    1996-01-01

    Growth of the ruminal bacteria Fibrobacter succinogenes S85, Ruminococcus flavefaciens FD-1, and R. albus 7 followed Monod kinetics with respect to concentrations of individual pure cellodextrins (cellobiose, cellotriose, cellotetraose, cellopentaose, and cellohexaose). Under the conditions tested, R. flavefaciens FD-1 possesses the greatest capacity to compete for low concentrations of these cellodextrins.

  13. FERROFLUIDS INFLUENCE ON DEHYDROGENASES ACTIVITY IN CELLULOLYTIC FUNGUS CHAETOMIUM GLOBOSUM

    Directory of Open Access Journals (Sweden)

    Alexandru Manoliu

    2003-08-01

    Different results were noticed for different ferrofluids concentrations: 20, 40, 60, 80 and 100 μl/L. Inhibitory or stimulatory ferrofluids effect was obtained depending on the nature of the investigated enzyme.

  14. FERROFLUIDS INFLUENCE ON DEHYDROGENASES ACTIVITY IN CELLULOLYTIC FUNGUS CHAETOMIUM GLOBOSUM

    OpenAIRE

    Alexandru Manoliu; Lacramioara Oprica; Zenovia Olteanu; Dorina Creanga

    2003-01-01

    he activity of dehy drogenases was studied after ferrofluids supply ing in the culture medium of Chaetomium globosum. Spectral measurements were carried out after 7 and, respectively , 11 day s of growth. Different results were noticed for different ferrofluids concentrations: 20, 40, 60, 80 and 100 μl/L. Inhibitory or stimulatory ferrofluids effect was obtained depending on the nature of the investigated enzyme.

  15. Cellulolytic bacteria in human gut and irritable bowel syndrome

    Czech Academy of Sciences Publication Activity Database

    Kopečný, Jan; Šimůnek, Jiří

    2002-01-01

    Roč. 71, - (2002), s. 421-427. ISSN 0001-7213 R&D Projects: GA AV ČR KSK5020115; GA ČR GA525/02/0402; GA AV ČR KSK5052113 Keywords : anaerobic bacteria * colon * fibrolytic Subject RIV: ED - Physiology Impact factor: 0.370, year: 2002

  16. FACTORS AFFECTING ACTIVITY OF CELLULOLYTIC MICROBES IN THE RUMEN

    Science.gov (United States)

    Ruminant diets that contain high levels of readily fermentable carbohydrates often display reduced fiber digestibility. However, separating direct from indirect effects has proven difficult. Laboratory culture studies have revealed that the most widely studied ruminal fibrolytic bacteria cannot use...

  17. Linking hydrolysis performance to Trichoderma reesei cellulolytic enzyme profile.

    Science.gov (United States)

    Lehmann, Linda; Rønnest, Nanna P; Jørgensen, Christian I; Olsson, Lisbeth; Stocks, Stuart M; Jørgensen, Henrik S; Hobley, Timothy

    2016-05-01

    Trichoderma reesei expresses a large number of enzymes involved in lignocellulose hydrolysis and the mechanism of how these enzymes work together is too complex to study by traditional methods, for example, by spiking with single enzymes and monitoring hydrolysis performance. In this study, a multivariate approach, partial least squares regression, was used to see whether it could help explain the correlation between enzyme profile and hydrolysis performance. Diverse enzyme mixtures were produced by T. reesei Rut-C30 by exploiting various fermentation conditions and used for hydrolysis of washed pretreated corn stover as a measure of enzyme performance. In addition, the enzyme mixtures were analyzed by liquid chromatography-tandem mass spectrometry to identify and quantify the different proteins. A multivariate model was applied for the prediction of enzyme performance based on the combination of different proteins present in an enzyme mixture. The multivariate model was used for identification of candidate proteins that are correlated to enzyme performance on pretreated corn stover. A very large variation in hydrolysis performance was observed and this was clearly caused by the difference in fermentation conditions. Besides β-glucosidase, the multivariate model identified several xylanases, Cip1 and Cip2, as relevant proteins to study further. Biotechnol. Bioeng. 2016;113: 1001-1010. © 2015 Wiley Periodicals, Inc. PMID:26524197

  18. 饲粮物理有效中性洗涤纤维水平对8~10月龄奶牛瘤胃发酵参数和纤维降解菌的影响%Effects of Dietary Physically Effective Neutral Detergent Fiber Level on Rumen Fermentation Parameters and Cellulolytic Bacteria of 8 to 10-Month-Old Heifers

    Institute of Scientific and Technical Information of China (English)

    陈青; 王洪荣; 葛汝方; 崔慧慧; 王梦芝; 喻礼怀; 林淼

    2015-01-01

    The objective of this experiment was to evaluate effects of dietary physically effective neutral deter⁃gent fiber ( peNDF) level on rumen fermentation parameters and cellulolytic bacteria of 8 to 10⁃month⁃old heif⁃ers. Twenty⁃four Chinese Holstein heifers with similar month of age and body weight were randomly divided into 4 groups. Heifers were offered one of four diets, which were chemically identical but included different peNDF levels [22.73%, 23.92%, 25.85% and 28.39%] through cutting the roughage of Chinese wildrye into different lengths. The pre⁃test lasted for 10 days, and the test lasted for 60 days. The results showed as fol⁃lows:1) the intakes of dry matter, neutral detergent fiber and acid detergent fiber of heifers were not signifi⁃cantly affected by peNDF level (P>0.05). 2) Rumen fluid pH increased with the increasing peNDF level, 22.73% group was significantly lower than the other 3 groups ( P0.05) , however, with the in⁃creasing of peNDF level, propionate content decreased, and 22. 73% group was significantly higher than 23.92% group (P<0.01) and 28.39% group (P<0.05); the ratio of acetate to propionate of 23.92% group was significantly higher than that of 22.73% group ( P<0.01) and 25.85% group( P<0.05);ammonia⁃N con⁃centration of 25.85% group was significantly higher than that of the other 3 groups ( P<0.01 or P<0.01) . 3) Using 22.73% group as control, the relative content of Fibrobacter succinogene of the other 3 groups was in⁃creased with increasing peNDF level, and that of 28. 39% group was the highest, but was still significantly lower than that of 22.73% group ( P<0.01);with the increasing of peNDF level, the relative content of Rumi⁃nococcus flave faciensk, Ruminococcus Albus and Prevotella rumicola increased initially and then decreased, and the highest contents all appeared in 25.85% group, which were significantly higher than those of the other 3 groups ( P<0.05 or P<0.01) . It is concluded that properly

  19. Effects of the ant Formica fusca on the transmission of microsporidia infecting gypsy moth larvae

    OpenAIRE

    Goertz, Dörte; Hoch, Gernot

    2013-01-01

    Transmission plays an integral part in the intimate relationship between a host insect and its pathogen that can be altered by abiotic or biotic factors. The latter include other pathogens, parasitoids, or predators. Ants are important species in food webs that act on various levels in a community structure. Their social behavior allows them to prey on and transport larger prey, or they can dismember the prey where it was found. Thereby they can also influence the horizontal transmission of a...

  20. Unusual nocturnal feeding by Brown Rock-chat Cercomela fusca (Passeriformes: Muscicapidae in Bikaner, Rajasthan, India

    Directory of Open Access Journals (Sweden)

    P. Singh

    2009-04-01

    Full Text Available Brown Rock-chat is a diurnal insectivorous bird commonly associated with human habitations. I report here nocturnal foraging of the species in and around Bikaner in Rajasthan. The birds showed a marked bimodal activity during their nocturnal foraging which peaked in early morning and late evening hours. Bright sodium-vapour lights that attracted a horde of insects during monsoons offered ideal foraging opportunities for the birds. This behavior is explained here as an adaptation to maximize their food intake during the period when the birds breed and their nutritional requirements are naturally high.

  1. Are you my mother? Kin recognition in the ant Formica fusca

    DEFF Research Database (Denmark)

    El-Showk, S; van Zweden, J S; d'Ettorre, P;

    2010-01-01

    In social insects, workers trade personal reproduction for indirect fitness returns from helping their mother rear collateral kin. Colony membership is generally used as a proxy for kin discrimination, but the question remains whether recognition allows workers to discriminate between kin and non...

  2. Cuticular chemistry of males and females in the ant Formica fusca

    DEFF Research Database (Denmark)

    Chernenko, Anton; Holman, Luke; Helanterä, Heikki;

    2012-01-01

    between genetic relatedness and chemical diversity within colonies. We demonstrated that female and male sexuals do not have unique sex-specific compounds, but that there are quantitative chemical differences between the sexes. Out of the 51 cuticular hydrocarbon compounds identified, 10 showed a...... significant quantitative difference between males and females. We also showed that both males and females have a significant colony-specific component in their profiles. Finally, we found a negative correlation between within-colony relatedness and within-colony chemical diversity of branched, but not linear......Communication between organisms involves visual, auditory, and olfactory pathways. In solitary insects, chemical recognition cues are influenced mainly by selection regimes related to species recognition and sexual selection. In social insects, chemical recognition cues have an additional role in...

  3. Temporal variation in macroinvertebrates associated with intertidal sponge Ircinia fusca (Carter 1880) from Ratnagiri, West coast, India.

    Digital Repository Service at National Institute of Oceanography (India)

    Sivadas, S.K.; Redij, A.G.S.; Sagare, P.; Thakur, N.L.; Ingole, B.S.

    taxa in the sponges of south eastern United State22 and northeast Brazil3. Therefore, it can be concluded that most sponge species are dominated by single taxa. High abundance of macrofauna during March was due to the recruitment of Ophiactis savignyi... the southeastern United States, Invertebr. Biol., 129 (2) (2010) 105–120. 23 Thorson, G., Some factors influencing the recruitment and establishment of marine benthic communities, Netherland J. Sea Res., 3 (1966) 267-293. 24 Turon, X., Codina, M., Tarjuelo, I...

  4. Synergistic effect of UV radiation and nutrient limitation on Chlorella fusca (Chlorophyta) cultures grown in outdoor cylindrical photobioreactors

    Czech Academy of Sciences Publication Activity Database

    Malpartida, I.; Jerez, C.G.; Morales, M.M.; Nascimento, E.; Freire, I.; Ezequiel, J.; Rico, R.M.; Peralta, E.; Malapascua, J.R.; Florez, Y.; Masojídek, Jiří; Abdala, R.; Figueroa, F.L.; Navarro, E.

    2014-01-01

    Roč. 22, č. 2 (2014), s. 141-158. ISSN 1864-7790 Grant ostatní: Univ. Málaga, Ministry of Economy and Competitiveness of Spanish Government(ES) Acción Complementaria CTM2011-15659-E; Spanish Ministry of Economy and Competitiveness of Spanish Government(ES) BFU2010-22053 Institutional support: RVO:61388971 Keywords : bio-optics * radiation * Chlorella * chlorophyll Subject RIV: EE - Microbiology, Virology Impact factor: 1.258, year: 2014

  5. Hyper secretion of Thermobifida fusca β-glucosidase via a Tat-dependent signal peptide using Streptomyces lividans

    OpenAIRE

    Miyazaki, Takaya; Noda, Shuhei; Tanaka, Tsutomu; Kondo, Akihiko

    2013-01-01

    Background Protein production as secretory-form is a powerful tool in industrial enzyme production due to the simple purification procedure. Streptomyces lividans is a versatile host for secretory production of useful proteins. In order to expand the amount of secreted protein, signal peptide sequences, which encourage protein secretion from inside cell to extracellular environment, are one of the most significant factors. In this study, we focused on Streptomyces lividans as a host strain to...

  6. Quantitative analysis of cellulose degradation and growth of cellulolytic bacteria in the rumen

    Science.gov (United States)

    Ruminant animals digest cellulose via a symbiotic relationship with ruminal microorganisms. Because feedstuffs only remain in the rumen for a short time, the rate of cellulose digestion must be very rapid. This speed is facilitated by rumination, a process that returns food to the mouth to be re-...

  7. Improved cellulolytic efficacy in Penicilium decumbens via heterologous expression of Hypocrea jecorina endoglucanase II

    Directory of Open Access Journals (Sweden)

    Qin Yuqi

    2013-01-01

    Full Text Available Hypocrea jecorina endoglucanase II (Hjegl2 was heterologously expressed in Penicillium decumbens (yielding strain Pd::Hjegl2. After induction in cellulose containing media, strain Pd::Hjeg2 displayed increased carboxymethylcellulase activity (CMCase, 5.77 IU/ml, representing a 21% increase and cellulose degradation determined with a filter paper assay (FPA, 0.40 IU/ml, 67% increase, as compared to the parent strain. In media supplemented with glucose (2%, Pd::Hjegl2, displayed 51.2-fold and 3-fold higher CMCase and FPA activities, respectively, as compared to the parent strain. No changes in the expression levels of the four main native cellulase genes of P. decumbens (Pdegl1, Pdegl2, Pdcbh1, and Pdcbh2 were noted between the transformant and wild-type strains. These data support the idea that Hjegl2 cleaves both internal and terminal glycosidic residues, in a relatively random and processive manner. In situ polyacrylamide gelactivity staining of extracts derived from wild-type and Pd::Hjegl2 revealed two additional active fractions in the latter strain; one with a molecular mass ~50-65 KDa and another ~80-116 kDa.

  8. Incorporation of Fungal Cellulases in Bacterial Minicellulosomes Yields Viable, Synergistically Acting Cellulolytic Complexes▿

    OpenAIRE

    2007-01-01

    Artificial designer minicellulosomes comprise a chimeric scaffoldin that displays an optional cellulose-binding module (CBM) and bacterial cohesins from divergent species which bind strongly to enzymes engineered to bear complementary dockerins. Incorporation of cellulosomal cellulases from Clostridium cellulolyticum into minicellulosomes leads to artificial complexes with enhanced activity on crystalline cellulose, due to enzyme proximity and substrate targeting induced by the scaffoldin-bor...

  9. Cellulolytic activity of some cellulose-decomposing fungi in salinized soils

    Directory of Open Access Journals (Sweden)

    R. A. Badran

    2014-08-01

    Full Text Available Maximum evolution of CO2 was marked in control soil inoculated by tested fungi but its rate decreased with the increasing salinity. The period of 10 days was most suitable for cellulose degradation by A. niger and P. chrysoecnum and 15 days by A. flavus and C. globosum in control soil. High salinity levels affected greatly the cellulolylic activities of tesled fungi. Carbon content of saline soils increased white the nitrogen content decreased.

  10. Exploring and integrating cellulolytic systems of insects to advance biofuel technology

    Institute of Scientific and Technical Information of China (English)

    Jian-Zhong Sun; Michael E. Scharf

    2010-01-01

    @@ In line with the requirements for sustainable economics and clean environments, cellulose-based biofuels have recently received tremendous attention both in industry and academic communities worldwide.Alternative and renewable fuels derived from lignocellulosic biomass of-fer the potential to reduce our dependence on fossil fuels and mitigate global climate change.

  11. Genomic analysis of the hydrocarbon-producing, cellulolytic, endophytic fungus Ascocoryne sarcoides.

    Directory of Open Access Journals (Sweden)

    Tara A Gianoulis

    Full Text Available The microbial conversion of solid cellulosic biomass to liquid biofuels may provide a renewable energy source for transportation fuels. Endophytes represent a promising group of organisms, as they are a mostly untapped reservoir of metabolic diversity. They are often able to degrade cellulose, and they can produce an extraordinary diversity of metabolites. The filamentous fungal endophyte Ascocoryne sarcoides was shown to produce potential-biofuel metabolites when grown on a cellulose-based medium; however, the genetic pathways needed for this production are unknown and the lack of genetic tools makes traditional reverse genetics difficult. We present the genomic characterization of A. sarcoides and use transcriptomic and metabolomic data to describe the genes involved in cellulose degradation and to provide hypotheses for the biofuel production pathways. In total, almost 80 biosynthetic clusters were identified, including several previously found only in plants. Additionally, many transcriptionally active regions outside of genes showed condition-specific expression, offering more evidence for the role of long non-coding RNA in gene regulation. This is one of the highest quality fungal genomes and, to our knowledge, the only thoroughly annotated and transcriptionally profiled fungal endophyte genome currently available. The analyses and datasets contribute to the study of cellulose degradation and biofuel production and provide the genomic foundation for the study of a model endophyte system.

  12. Linking Hydrolysis Performance to Trichoderma reesei Cellulolytic Enzyme Profile

    DEFF Research Database (Denmark)

    Lehmann, Linda Olkjær; Petersen, Nanna; I. Jørgensen, Christian;

    2016-01-01

    Trichoderma reesei expresses a large number of enzymes involved in lignocellulose hydrolysis and the mechanism of how these enzymes work together is too complex to study by traditional methods, e.g. by spiking with single enzymes and monitoring hydrolysis performance. In this study a multivariate...

  13. Do new cellulolytic enzyme preparations affect the industrial strategies for high solids lignocellulosic ethanol production?

    DEFF Research Database (Denmark)

    Cannella, David; Jørgensen, Henning

    2014-01-01

    Production of ethanol from lignocellulosic materials has a promising market potential, but the process is still only at pilot/demonstration scale due to the technical and economical difficulties of the process. Operating the process at very high solids concentrations (above 20% dry matter—DM) has...

  14. Functional diversity of family 3 β-glucosidases from thermophilic cellulolytic fungus Humicola insolens Y1.

    Science.gov (United States)

    Xia, Wei; Bai, Yingguo; Cui, Ying; Xu, Xinxin; Qian, Lichun; Shi, Pengjun; Zhang, Wei; Luo, Huiying; Zhan, Xiuan; Yao, Bin

    2016-01-01

    The fungus Humicola insolens is one of the most powerful decomposers of crystalline cellulose. However, studies on the β-glucosidases from this fungus remain insufficient, especially on glycosyl hydrolase family 3 enzymes. In the present study, we analyzed the functional diversity of three distant family 3 β-glucosidases from Humicola insolens strain Y1, which belonged to different evolutionary clades, by heterogeneous expression in Pichia pastoris strain GS115. The recombinant enzymes shared similar enzymatic properties including thermophilic and neutral optima (50-60 °C and pH 5.5-6.0) and high glucose tolerance, but differed in substrate specificities and kinetics. HiBgl3B was solely active towards aryl β-glucosides while HiBgl3A and HiBgl3C showed broad substrate specificities including both disaccharides and aryl β-glucosides. Of the three enzymes, HiBgl3C exhibited the highest specific activity (158.8 U/mg on pNPG and 56.4 U/mg on cellobiose) and catalytic efficiency and had the capacity to promote cellulose degradation. Substitutions of three key residues Ile48, Ile278 and Thr484 of HiBgl3B to the corresponding residues of HiBgl3A conferred the enzyme activity towards sophorose, and vice versa. This study reveals the functional diversity of GH3 β-glucosidases as well as the key residues in recognizing +1 subsite of different substrates. PMID:27271847

  15. Heterologous Expression and Extracellular Secretion of Cellulolytic Enzymes by Zymomonas mobilis▿

    OpenAIRE

    Linger, Jeffrey G.; Adney, William S; Darzins, Al

    2010-01-01

    Development of the strategy known as consolidated bioprocessing (CBP) involves the use of a single microorganism to convert pretreated lignocellulosic biomass to ethanol through the simultaneous production of saccharolytic enzymes and fermentation of the liberated monomeric sugars. In this report, the initial steps toward achieving this goal in the fermentation host Zymomonas mobilis were investigated by expressing heterologous cellulases and subsequently examining the potential to secrete th...

  16. Diarrhea-associated pathogens, lactobacilli and cellulolytic bacteria in equine feces: responses to antibiotic challenge

    Science.gov (United States)

    Antibiotics are important to equine medicine, but antibiotic-associated diarrhea (AAD) can lead to poor performance and even mortality. AAD is attributed to disruption of the hindgut microbiota, which permits proliferation of pathogenic microbes. The goal of this study was to evaluate the effects o...

  17. Study of cellulolytic enzyme immobilization on copolymers of N-vinylformamide.

    Science.gov (United States)

    Tąta, Agnieszka; Sokołowska, Katarzyna; Świder, Joanna; Konieczna-Molenda, Anna; Proniewicz, Edyta; Witek, Ewa

    2015-10-01

    This study was focused on finding of effective carriers suitable for the immobilization of cellulase. Copolymers of N-vinylformamide (NFV) and divinylbenzene (DVB) were synthesized by free radical crosslinking polymerization in inverse suspension. Methyl silicone oil was used as the continuous phase. Three polymeric carriers based on P(NVF-co-DVB) with varying degrees of crosslinking and spherical particles with different grain sizes were obtained. The formamide groups in these carriers were hydrolyzed to amino groups, yielding three P(VAm-co-DVB) polymers with vinylamine units. Enzyme, cellulase (Novozym® 476), was immobilized onto carriers with vinylamine (through glutaraldehyde) and vinylformamide groups (without glutaraldehyde). The efficiency of the enzyme immobilization was determined based on the enzymatic activity of the enzyme during the catalytic reaction relative to that of the native enzyme. All tested carriers were found to be effective carriers for the immobilization of cellulase. However, the catalytic activity of cellulase immobilized on the P(VAM-co-DVB0.27)/2000/350 carrier was higher than that for the native enzyme. In addition, two molecular spectroscopy methods, Fourier-transform absorption infrared spectroscopy (FT-IR) and Fourier-transform Raman spectroscopy (FT-Raman), were used to analyze the carriers. These studies provided complete information regarding the structure of the studied copolymers. PMID:25978017

  18. Isolation of Cellulose-Degrading Bacteria and Determination of Their Cellulolytic Potential

    Directory of Open Access Journals (Sweden)

    Pratima Gupta

    2012-01-01

    Full Text Available Eight isolates of cellulose-degrading bacteria (CDB were isolated from four different invertebrates (termite, snail, caterpillar, and bookworm by enriching the basal culture medium with filter paper as substrate for cellulose degradation. To indicate the cellulase activity of the organisms, diameter of clear zone around the colony and hydrolytic value on cellulose Congo Red agar media were measured. CDB 8 and CDB 10 exhibited the maximum zone of clearance around the colony with diameter of 45 and 50 mm and with the hydrolytic value of 9 and 9.8, respectively. The enzyme assays for two enzymes, filter paper cellulase (FPC, and cellulase (endoglucanase, were examined by methods recommended by the International Union of Pure and Applied Chemistry (IUPAC. The extracellular cellulase activities ranged from 0.012 to 0.196 IU/mL for FPC and 0.162 to 0.400 IU/mL for endoglucanase assay. All the cultures were also further tested for their capacity to degrade filter paper by gravimetric method. The maximum filter paper degradation percentage was estimated to be 65.7 for CDB 8. Selected bacterial isolates CDB 2, 7, 8, and 10 were co-cultured with Saccharomyces cerevisiae for simultaneous saccharification and fermentation. Ethanol production was positively tested after five days of incubation with acidified potassium dichromate.

  19. [Role of intramolecular bonds in stability of certain enzymes of the cellulolytic complex].

    Science.gov (United States)

    Sirdova, T M; Tsiperovikh, O S

    1976-01-01

    Stability of C1- and C2-cellulases, CX-exo- and CX-endoglucanases and beta-glucosidase of Aspergillus awamori was studied as affected by monoatomic aliphatic alcohols --methanol, ethanol, propanol and isopropanol; bi- and triatomic alcohols - ethylene glycol and glycerol, urea as well as detergents of dodecyl sulphate and sodium nonilate. The mentioned enzymes are established to manifest the highest activity in 40-60% glycerol. It is also shown that their stability is changed differently under the effect of other alcohols, urea and detergents. The latter testifies to the fact that the studied enzymes are nonidentical, in particular, they differ between themselves by a ratio of intramolecular forces which stabilize their macrostructure. PMID:1258159

  20. Diversity of Cellulolytic Microbes and the Biodegradation of Municipal Solid Waste by a Potential Strain

    Directory of Open Access Journals (Sweden)

    S. P. Gautam

    2012-01-01

    Full Text Available Municipal solid waste contains high amounts of cellulose, which is an ideal organic waste for the growth of most of microorganism as well as composting by potential microbes. In the present study, Congo red test was performed for screening of microorganism, and, after selecting a potential strains, it was further used for biodegradation of organic municipal solid waste. Forty nine out of the 250 different microbes tested (165 belong to fungi and 85 to bacteria produced cellulase enzyme and among these Trichoderma viride was found to be a potential strain in the secondary screening. During the biodegradation of organic waste, after 60 days, the average weight losses were 20.10% in the plates and 33.35% in the piles. There was an increase in pH until 20 days. pH however, stabilized after 30 days in the piles. Temperature also stabilized as the composting process progressed in the piles. The high temperature continued until 30 days of decomposition, after which the temperature dropped to 40°C and below during the maturation. Good quality compost was obtained in 60 days.

  1. Production of ethanol from lepthochloa fusca L. (kallar grass) and panicum maximum using cellulases from trichoderma SSP and cultures of saccharomyces carlsbergensis

    International Nuclear Information System (INIS)

    Saline sodic soils have been used for production of biomass using salt tolerant grass, kallar grass followed by lesser tolerant plants, namely, sasbania aculeata or Panicum maximum or to provide biomass throughout the year for it utilization for microbial conversion. These substrates have been utilized to produce single cell protein and cellases or hemicellulases. The enzyme titer obtained after growth of cellulomonas biazotea on kallar grass could saccharify wheat straw ad bagasse for subsequent conversion to ethanol but kallar grass itself was saccharified to lesser extent, however, enzyme titres from different fungi could saccherify the biomass produced on saline lands to monomeric sugars. In these studies, the enzyme titre from Trichoderma spp. were used for saccharification purpose. (author)

  2. A novel promising Trichoderma harzianum strain for the production of a cellulolytic complex using sugarcane bagasse in natura

    OpenAIRE

    Benoliel, Bruno; Torres, Fernando Araripe Gonçalves; de Moraes, Lidia Maria Pepe

    2013-01-01

    Brazil is a major producer of agro-industrial residues, such as sugarcane bagasse, which could be used as raw material for microbial production of cellulases as an important strategy for the development of sustainable processes of second generation ethanol production. For this purpose, this work aimed at screening for glycosyl hydrolase activities of fungal strains isolated from the Brazilian Cerrado. Among 13 isolates, a Trichoderma harzianum strain (L04) was identified as a promising candid...

  3. Effect of extracellular pH on growth and proton motive force of Bacteroides succinogenes, a cellulolytic ruminal bacterium.

    OpenAIRE

    Russell, J B

    1987-01-01

    The utilization of cellulose or cellobiose by Bacteroides succinogenes S85 was severely inhibited at pH values of less than 5.7. Since low pH inhibited the utilization of both cellobiose and cellulose, changes in cellulase activity could not explain the effect. At an extracellular pH of 6.9, the pH gradient (delta pH) across the cell membrane was only 0.07 U. As extracellular pH declined from 6.9 to 5.7, intracellular pH decreased to a smaller extent than extracellular pH and delta pH increas...

  4. The effect of gamma radiation on the cellulolytic, pectinolytic and amylolytic enzyme activity of some ''garri'' fermenting microorganisms

    International Nuclear Information System (INIS)

    In this study, three fungi and a bacterium involved in the fermentation of ''garri'' were investigated for their cellulase, pectinase amylase activity when exposed to different doses of gamma radiation. The fungi are Trichoderma viride, Rhizopus oryzae and Aspergillus niger and the bacterium is Lactobecillus, plantarum. Enzyme activity, growth and acidity were monitored after five days of incubation. T. viride and R. Oryzae showed best cellulase activity at a dose of 100 krads and A. niger showed best cellulase activity at 50 krads. All the three fungi showed their best pectinase activity at 50 krads dose. The amylolytic potential of all three fungi was increased at doses 50 krads. Dosages of 50 krads also increased the three enzyme activities of the L. plantarum but increases were not as marked as those of the fungi. Gamma irradiation increased the acide producing potential of A. niger. The growth potential of T. viride was also increased by irradiation. (author). 10 refs, 6 figs, 1 tab

  5. Suberin Regulates the Production of Cellulolytic Enzymes in Streptomyces scabiei, the Causal Agent of Potato Common Scab.

    Science.gov (United States)

    Padilla-Reynaud, Rebeca; Simao-Beaunoir, Anne-Marie; Lerat, Sylvain; Bernards, Mark A; Beaulieu, Carole

    2015-01-01

    Suberin, a major constituent of the potato periderm, is known to promote the production of thaxtomins, the key virulence factors of the common scab-causing agent Streptomyces scabiei. In the present study, we speculated that suberin affected the production of glycosyl hydrolases, such as cellulases, by S. scabiei, and demonstrated that suberin promoted glycosyl hydrolase activity when added to cellulose-, xylan-, or lichenin-containing media. Furthermore, secretome analyses revealed that the addition of suberin to a cellulose-containing medium increased the production of glycosyl hydrolases. For example, the production of 13 out of the 14 cellulases produced by S. scabiei in cellulose-containing medium was stimulated by the presence of suberin. In most cases, the transcription of the corresponding cellulase-encoding genes was also markedly increased when the bacterium was grown in the presence of suberin and cellulose. The level of a subtilase-like protease inhibitor was markedly decreased by the presence of suberin. We proposed a model for the onset of S. scabiei virulence mechanisms by both cellulose and suberin, the main degradation product of cellulose that acts as an inducer of thaxtomin biosynthetic genes, and suberin promoting the biosynthesis of secondary metabolites including thaxtomins. PMID:26330095

  6. Temperature and substrate chemistry as major drivers of interregional variability of leaf microbial decomposition and cellulolytic activity in headwater streams.

    Science.gov (United States)

    Fenoy, Encarnación; Casas, J Jesús; Díaz-López, Manuel; Rubio, Juan; Guil-Guerrero, J Luís; Moyano-López, Francisco J

    2016-11-01

    Abiotic factors, substrate chemistry and decomposers community composition are primary drivers of leaf litter decomposition. In soil, much of the variation in litter decomposition is explained by climate and substrate chemistry, but with a significant contribution of the specialisation of decomposer communities to degrade specific substrates (home-field advantage, HFA). In streams, however, HFA effects on litter decomposition have not been explicitly tested. We evaluated responses of microbial decomposition and β-glucosidase activity to abiotic factors, substrate and decomposer assemblages, using a reciprocal litter transplant experiment: 'ecosystem type' (mountain vs lowland streams) × 'litter chemistry' (alder vs reed). Temperature, pH and ionic concentration were higher in lowland streams. Decomposition for both species was faster in lowland streams. Decomposition of reed was more accelerated in lowland compared with mountain streams than that of alder, suggesting higher temperature sensitivity of decomposition in reed. Q10 (5°C-15°C) values of β-glucosidase activity were over 2. The alkaline pH and high ionic concentration of lowland streams depleted enzyme activity. We found similar relationships of decomposition or enzyme activity with abiotic factors for both species, suggesting limited support to the HFA hypothesis. Overall, our results suggest a prime role of temperature interacting with substrate chemistry on litter decomposition. PMID:27515735

  7. Extracellular cellulolytic enzyme system of Aspergillus japonicus: Pt. 2. Purification and characterization of an inducible extracellular. beta. -glucosidase

    Energy Technology Data Exchange (ETDEWEB)

    Sanyal, Arunik; Kundu, R.K.; Dube, S.; Dube, D.K.

    1988-02-01

    A high molecular weight ..beta..-glucosidase (mol. wt. > 240 000 daltons) was isolated from the culture filtrate of Aspergillus japonicus and was finally purified to 86-fold by alcohol precipitation, gel filtration and ion exchange chromatography on Whatman DE-52. An apparently homogeneous form of the enzyme appeared in the polyacrylamide gel electrophoresis. It is capable of utilizing cellobiose, salicin, o-nitrophenyl-..beta..-D-glucoside (ONPG), methyl-..beta..-D-glucoside and amygdalin effectively as substrates but not arbutin, esculin hydrate and phloridzin. No metal ion is required for its catalytic activity. Hg/sup ++/ and p-chloromercuricbenzoate (PCMB) are strong inhibitors for the enzyme. Nojirimycin and glucono-delta-lactone are two competitive inhibitors of the same enzyme, and nojirimycin is the more potent of the two.

  8. In Vitro Inhibition of Cellulolytic Enzymes of Fusarium Oxysporum by Trichoderma spp and Pseudomonas Fluorescens on Arachis Hypogaea L

    OpenAIRE

    P.Rajeswari

    2015-01-01

    In an attempt to develop biocontrol system for management of Fusarium wilt in groundnut, Trichoderma viride, Trichoderma harzianum,and Pseudomonas fluorescens were evaluated for their antagonistic activity against Fusarium oxysporum in vitro. .Fusarium wilt diseasescaused by the fungus Fusarium oxysporum lead to significant yield losses of crops. Experiments were conducted on the effect of culture filtratesof T.viride (1%), T. harzianum (1.5%), and P. fluorescens (2%) on the in vitro inhibiti...

  9. Identification of novel glycosyl hydrolases with cellulolytic activity against crystalline cellulose from metagenomic libraries constructed from bacterial enrichment cultures

    OpenAIRE

    Mori, Toshio; Kamei, Ichiro; Hirai, Hirofumi; Kondo, Ryuichiro

    2014-01-01

    To obtain cellulases that are capable of degrading crystalline cellulose and cedar wood, metagenomic libraries were constructed from raw soil sample which was covered to pile of cedar wood sawdust or from its enrichment cultures. The efficiency of screening of metagenomic library was improved more than 3 times by repeating enrichment cultivation using crystalline cellulose as a carbon source, compared with the library constructed from raw soil. Four cellulase genes were obtained from the meta...

  10. Genomic, proteomic, and biochemical analyses of oleaginous Mucor circinelloides: evaluating its capability in utilizing cellulolytic substrates for lipid production.

    Directory of Open Access Journals (Sweden)

    Hui Wei

    Full Text Available Lipid production by oleaginous microorganisms is a promising route to produce raw material for the production of biodiesel. However, most of these organisms must be grown on sugars and agro-industrial wastes because they cannot directly utilize lignocellulosic substrates. We report the first comprehensive investigation of Mucor circinelloides, one of a few oleaginous fungi for which genome sequences are available, for its potential to assimilate cellulose and produce lipids. Our genomic analysis revealed the existence of genes encoding 13 endoglucanases (7 of them secretory, 3 β-D-glucosidases (2 of them secretory and 243 other glycoside hydrolase (GH proteins, but not genes for exoglucanases such as cellobiohydrolases (CBH that are required for breakdown of cellulose to cellobiose. Analysis of the major PAGE gel bands of secretome proteins confirmed expression of two secretory endoglucanases and one β-D-glucosidase, along with a set of accessory cell wall-degrading enzymes and 11 proteins of unknown function. We found that M. circinelloides can grow on CMC (carboxymethyl cellulose and cellobiose, confirming the enzymatic activities of endoglucanases and β-D-glucosidases, respectively. The data suggested that M. circinelloides could be made usable as a consolidated bioprocessing (CBP strain by introducing a CBH (e.g. CBHI into the microorganism. This proposal was validated by our demonstration that M. circinelloides growing on Avicel supplemented with CBHI produced about 33% of the lipid that was generated in glucose medium. Furthermore, fatty acid methyl ester (FAME analysis showed that when growing on pre-saccharified Avicel substrates, it produced a higher proportion of C14 fatty acids, which has an interesting implication in that shorter fatty acid chains have characteristics that are ideal for use in jet fuel. This substrate-specific shift in FAME profile warrants further investigation.

  11. Regulation of the cellulolytic system in Trichoderma reesei by sophorose: induction of cellulase and repression of beta-glucosidase.

    OpenAIRE

    Sternberg, D; Mandels, G. R.

    1980-01-01

    Sophorose has two regulatory roles in the production of cellulase enzymes in Trichoderma reesei: beta-glucosidase repression and cellulase induction. Sophorose also is hydrolyzed by the mycelial-associated beta-glucosidase. Repression of beta-glucosidase reduces sophorose hydrolysis and thus may increase cellulase induction.

  12. 白蚁肠道共生体的纤维素代谢体系%The termite intestinal symbiont cellulolytic system

    Institute of Scientific and Technical Information of China (English)

    曾文慧; 刘瑞娴; 钟俊鸿

    2010-01-01

    白蚁是大陆生态系统中木质纤维素降解的生力军,其肠道共生系统纤维素酶对纤维素的消化起到了关键的作用.本文概述了白蚁自身及其肠道共生微生物的纤维素水解系统的特点、相互关系以及相互作用的研究进展.

  13. Characterization of the cellulolytic secretome of Trichoderma harzianum during growth on sugarcane bagasse and analysis of the activity boosting effects of swollenin.

    Science.gov (United States)

    A L Rocha, Vanessa; N Maeda, Roberto; Pereira, Nei; F Kern, Marcelo; Elias, Luisa; Simister, Rachael; Steele-King, Clare; Gómez, Leonardo D; McQueen-Mason, Simon J

    2016-03-01

    This study demonstrates the production of an active enzyme cocktail produced by growing Trichoderma harzianum on sugarcane bagasse. The component enzymes were identified by LCMS-MS. Glycosyl hydrolases were the most abundant class of proteins, representing 67% of total secreted protein. Other carbohydrate active enzymes involved in cell wall deconstruction included lytic polysaccharide mono-oxygenases (AA9), carbohydrate-binding modules, carbohydrate esterases and swollenin, all present at levels of 1%. In total, proteases and lipases represented 5 and 1% of the total secretome, respectively, with the rest of the secretome being made up of proteins of unknown or putative function. This enzyme cocktail was efficient in catalysing the hydrolysis of sugarcane bagasse cellulolignin to fermentable sugars for potential use in ethanol production. Apart from mapping the secretome of T. harzianum, which is a very important tool to understand the catalytic performance of enzyme cocktails, the gene coding for T. harzianum swollenin was expressed in Aspergillus niger. This novel aspect in this work, allowed increasing the swollenin concentration by 95 fold. This is the first report about the heterologous expression of swollenin from T. harzianum, and the findings are of interest in enriching enzyme cocktail with this important accessory protein which takes part in the cellulose amorphogenesis. Despite lacking detectable glycoside activity, the addition of swollenin of T. harzianum increased by two-fold the hydrolysis efficiency of a commercial cellulase cocktail. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:327-336, 2016. PMID:26697775

  14. COMPARED ANALYSIS OF CATALASE AND PEROXIDASE ACTIVITY IN CELLULOLYTIC FUNGUS TRICHODERMA REESEI GROWN ON MEDIUM WITH DIFFERENT CONCENTRATIONS OF GRINDED WHEAT AND BARLEY STRAWS

    Directory of Open Access Journals (Sweden)

    Mihaela Cristica

    2010-09-01

    Full Text Available The purpose of this study was to assess the evolution of catalase and peroxidase activity in Trichoderma reesei grown on medium containing grinded wheat and barley straws. Carbon source of cultivation medium - glucose was replaced by various concentrations of grinded wheat and barley straws, finally resulting three experimental variants as follows: V1 = 20 g/l, V2 = 30 g/l, V3 = 40 g/l. ĂŽn addition to these variants a control sample was added in which composition remainded unchanged. The catalase activity was determined by spectrophotometric Sinha method (Artenie et al., 2008 while peroxidase activity was assesed using the o-dianisidine method (Cojocaru, 2009. Enzymatic determinations were carried out at 7 and 14 days from inoculation, in both fungus mycelium and culture liquid. The enzymatic assay showed significant differences between determinations intervals and work variants. Enzyme activity is influenced by the age of fungus and by the different nature of the substrate used.

  15. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    OpenAIRE

    Yan-Ling Liang; Zheng Zhang; Min Wu; Yuan Wu; Jia-Xun Feng

    2014-01-01

    From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36...

  16. Persistance of a surrogate for a genetically engineered cellulolytic microorganism and effects on aquatic community and ecosystem properties: Mesocosm and stream comparisons

    International Nuclear Information System (INIS)

    The accidental or deliberate release of genetically engineered microorganisms (GEMs) into the environment raises concerns related to their potential to alter natural processes and biological communities. Research was conducted to determine the persistance of an introduced surrogate for a GEM in lotic habitats, to test the responses to the introduced bacterial, and to evaluate the utility of flowing water mesocosms as tools for assessing the fates and effects of bacteria introduced into streams. Cellulolomonas cellulose-degrading bacteria were selcted as the GEM surrogate because cellulose superdegrader bacteria are being genetically engineered and are of interest to the food and paper industries and in the conversion of biomass to fuels. Cellulomonas densities were determined using fluorescent antibodies, and declined from postinoculation maxima faster in sediments than in Chlorophyta growths and leaf packs. Cellulomonas persisted in leaf packs at densities much greater than background. Cellulomonas had no statistically significant effects on primary productivity, community respiration, photosynthesis/respiration ratios, assimilation ratios, bacterial productivity, and rates of leaf litter decomposition. Cellulase concentrations were positively correlated with Cellulolomonas densities ≥7x108 cells/g dry mass in fresh leaf litter for 2 d following exposure. Mesocosms were good tools for studying bacterial population dynamics in leaf litter and physiological aspects of litter degradation. 45 refs., 8 figs., 5 tabs

  17. Differential cellulolytic activity of native-form and C-terminal tagged-form cellulase derived from coptotermes formosanus and expressed in E. coli

    Science.gov (United States)

    The endogenous cellulase gene (CfEG3a) of Coptotermes formosanus, an economically important pest termite, was cloned and overexpressed in both native form (nCfEG) and C-terminal His-tagged form (tCfEG) in E.coli. Both forms of recombinant cellulases showed hydrolytic activity on cellulosic substrate...

  18. COMPARED ANALYSIS OF CATALASE AND PEROXIDASE ACTIVITY IN CELLULOLYTIC FUNGUS TRICHODERMA REESEI GROWN ON MEDIUM WITH DIFFERENT CONCENTRATIONS OF GRINDED WHEAT AND BARLEY STRAWS

    OpenAIRE

    Elena Ciornea; Tamara Barbaneagra; Alexandru Manoliu; Mihaela Cristica

    2010-01-01

    The purpose of this study was to assess the evolution of catalase and peroxidase activity in Trichoderma reesei grown on medium containing grinded wheat and barley straws. Carbon source of cultivation medium - glucose was replaced by various concentrations of grinded wheat and barley straws, finally resulting three experimental variants as follows: V1 = 20 g/l, V2 = 30 g/l, V3 = 40 g/l. ĂŽn addition to these variants a control sample was added in which composition remainded unchanged. The cat...

  19. 7 CFR 361.6 - Noxious weed seeds.

    Science.gov (United States)

    2010-01-01

    ... pallide-fusca (Schumacher) Stapf & Hubbard Solanum tampicense Dunal (wetland nightshade) Solanum torvum Swartz Solanum viarum Dunal Sparganium erectum L. Spermacoce alata (Aublet) de Candolle Striga...

  20. Draft Genome Sequence of Acinetobacter sp. Strain BMW17, a Cellulolytic and Plant Growth-Promoting Bacterium Isolated from the Rhizospheric Region of Phragmites karka of Chilika Lake, India.

    Science.gov (United States)

    Mishra, Samir R; Ray, Lopamudra; Panda, Ananta Narayan; Sahu, Neha; Xess, Sonal S; Jadhao, Sudhir; Suar, Mrutyunjay; Adhya, Tapan Kumar; Rastogi, Gurdeep; Pattnaik, Ajit Kumar; Raina, Vishakha

    2016-01-01

    We report the 3.16 Mb draft genome of Acinetobacter sp. strain BMW17, a Gram-negative bacterium in the class of Gammaproteobacteria, isolated from the rhizospheric region of Phragmites karka, an invasive weed in Chilika Lake, Odisha, India. The strain BMW17(T) is capable of degrading cellulose and is also an efficient plant growth promoter that can be useful for various phytoremedial and commercial applications. PMID:27365343

  1. Production of cellulolytic enzymes by Aspergillus fumigatus ABK9 in wheat bran-rice straw mixed substrate and use of cocktail enzymes for deinking of waste office paper pulp.

    Science.gov (United States)

    Das, Arpan; Paul, Tanmay; Halder, Suman K; Jana, Arijit; Maity, Chiranjit; Das Mohapatra, Pradeep K; Pati, Bikas R; Mondal, Keshab C

    2013-01-01

    Response surface methodology was employed to optimize mixed substrate solid state fermentation for the production of cellulases and xylanase by Aspergillus fumigatus ABK9. Among 11 different parameters, fermentation time (86-88 h), medium pH (6.1-6.2), substrate amount (10.0-10.5 g) and substrate ratio (wheat bran:rice straw) (1.1) had significantly influences on enzyme production. Under these conditions endoglucanase, β-glucosidase, FPase (filter paper degrading activity) and xylanase activities of 826.2, 255.16, 102.5 and 1130.4 U/g, respectively were obtained. The enzyme cocktail extracted (solid to water ratio of 1:10) from the ferments increased brightness of waste office paper pulp by 82.8% ISO, Ink(D) value by 82.1%, removed chromophores (2.53 OD; A(237)nm) and hydrophobic compounds (1.15 OD; A(465)nm) and also decreased the kappa number to 13.5 from 16.8. PMID:23196251

  2. Draft Genome Sequence of Acinetobacter sp. Strain BMW17, a Cellulolytic and Plant Growth-Promoting Bacterium Isolated from the Rhizospheric Region of Phragmites karka of Chilika Lake, India

    Science.gov (United States)

    Mishra, Samir R.; Ray, Lopamudra; Panda, Ananta Narayan; Sahu, Neha; Xess, Sonal S.; Jadhao, Sudhir; Suar, Mrutyunjay; Adhya, Tapan Kumar; Rastogi, Gurdeep; Pattnaik, Ajit Kumar

    2016-01-01

    We report the 3.16 Mb draft genome of Acinetobacter sp. strain BMW17, a Gram-negative bacterium in the class of Gammaproteobacteria, isolated from the rhizospheric region of Phragmites karka, an invasive weed in Chilika Lake, Odisha, India. The strain BMW17T is capable of degrading cellulose and is also an efficient plant growth promoter that can be useful for various phytoremedial and commercial applications. PMID:27365343

  3. 7 CFR 360.200 - Designation of noxious weeds.

    Science.gov (United States)

    2010-01-01

    ... (giant salvinia) Solanum tampicense Dunal (wetland nightshade) Sparganium erectum Linnaeus (exotic bur... ragwort) Setaria pallide-fusca (Schumacher) Stapf & Hubbard (cattail grass) Solanum torvum Swartz (turkeyberry) Solanum viarum Dunal (tropical soda apple) Spermacoce alata (Aublet) de Candolle...

  4. Florae Malseianae Precursores XXV. Notes on Malaysian and some S.E. Asian Cyperaceae VIII

    NARCIS (Netherlands)

    Kern, J.H.

    1960-01-01

    1. Fimbristylis savannicola Kern, spec. nov. — Sect. Fuscae Ohwi. — Fig. 1. Herba perennis, rhizomate lignoso brevissimo vaginis brunneis parce dissolutis circumdato. Culmi caespitosi, erecti, graciles sed firmuli, compressi, sulcati, dense puncticulati, glabri laevesque vel praesertim basin versus

  5. Enzymatic hydrolysis of PTT polymers and oligomers

    OpenAIRE

    Eberl, A.; Heumann, Sonja; Kotek, R.; Kaufmann, F; Mitscher, S.; Paulo, Artur Cavaco; Gübitz, Georg M.

    2008-01-01

    Oligomers and polymers (film, fabrics) of the linear aromatic polyester poly(trimethylene terephthalate) (PTT) were treated with polyesterases from Thermomyces lanuginosus, Penicillium citrinum, Thermobifida fusca and Fusarium solani pisi. The cutinase from T. fusca was found to release the highest amounts of hydrolysis products from PTT materials and was able to open and hydrolyse a cyclic PTT dimer according to RP-HPLC–UV detection. In contrast, the lipase from T. lanuginosus also showed ac...

  6. Evaluating Models of Cellulose Degradation by Fibrobacter succinogenes S85

    OpenAIRE

    Burnet, Meagan C.; Dohnalkova, Alice C.; Neumann, Anthony P.; Lipton, Mary S.; Smith, Richard D.; Suen, Garret; Callister, Stephen J.

    2015-01-01

    Fibrobacter succinogenes S85 is an anaerobic non-cellulosome utilizing cellulolytic bacterium originally isolated from the cow rumen microbial community. Efforts to elucidate its cellulolytic machinery have resulted in the proposal of numerous models which involve cell-surface attachment via a combination of cellulose-binding fibro-slime proteins and pili, the production of cellulolytic vesicles, and the entry of cellulose fibers into the periplasmic space. Here, we used a combination of RNA-...

  7. Cellulose- and Xylan-Degrading Thermophilic Anaerobic Bacteria from Biocompost ▿ †

    OpenAIRE

    Sizova, M. V.; Izquierdo, J. A.; Panikov, N. S.; Lynd, L. R.

    2011-01-01

    Nine thermophilic cellulolytic clostridial isolates and four other noncellulolytic bacterial isolates were isolated from self-heated biocompost via preliminary enrichment culture on microcrystalline cellulose. All cellulolytic isolates grew vigorously on cellulose, with the formation of either ethanol and acetate or acetate and formate as principal fermentation products as well as lactate and glycerol as minor products. In addition, two out of nine cellulolytic strains were able to utilize xy...

  8. Enzymatic hydrolysis of lignocelluloses: Identification of novel cellulase genes from filamentous fungi

    DEFF Research Database (Denmark)

    Kolasa, Marta; Ahring, Birgitte Kiær; Lübeck, Peter Stephensen;

    2010-01-01

    bonds. Cellulose can be degraded to simple sugar components by means of enzymatic hydrolysis. However, due to its complex, crystalline structure it is difficult to break it down and the cooperative action of a variety of cellulolytic enzymes is necessary. Fungi are known to have potential in production...... of a variety of cellulolytic enzymes. The aim of this work is to discover new thermostable and robust cellulolytic enzymes for improved enzymatic hydrolysis of biomass. For this purpose two screening methods are applied in different fungal strains with high cellulolytic activities: an expression...

  9. Enzymatic Hydrolysis of Lignocelluloses

    DEFF Research Database (Denmark)

    Kolasa, Marta; Ahring, Birgitte Kiær; Lübeck, Peter Stephensen;

    2010-01-01

    bonds. Cellulose can be degraded to simple sugar components by means of enzymatic hydrolysis. However, due to its complex, crystalline structure it is difficult to break it down and the cooperative action of a variety of cellulolytic enzymes is necessary. Fungi are known to have potential in production...... of a variety of cellulolytic enzymes. The aim of this work is to discover new thermostable and robust cellulolytic enzymes for improved enzymatic hydrolysis of biomass. For this purpose two screening methods are applied in different fungal strains with high cellulolytic activities: an expression...

  10. Diseño de oligonucléotidos para el estudio de genes celulolíticos y solventogénicos en cepas colombianas de Clostridium sp. (CLOSTRIDIACEAE Oligonucleotide Probe Design for the Study of Cellulolytic and Solventogenic Genes in Colombian Clostridiumsp. strains (Clostridiaceae

    Directory of Open Access Journals (Sweden)

    Suárez Moreno Zulma Rocío

    2007-12-01

    Full Text Available El objetivo de este estudio fue analizar las rutas metabólicas para la producción de solventes y degradación de celulosa en cepas colombianas promisorias del género Clostridium. Para ello se diseñaron sondas de hibridación que sirvieran para posteriores estudios de mejoramiento genético de las cepas. Se construyó la base de datos denominada MULTICLOST en Microsoft Access® con las secuencias de 485 genes involucrados en las rutas metabólicas arriba mencionadas, provenientes de 45 especies bacterianas y 10 especies fúngicas. Los genes fueron agrupados de acuerdo al tipo de enzima y a los dominios catalíticos o de unión a sustrato en el caso de las celulasas. Cada grupo se sometió a alineamiento múltiple en ClustalW 1.83 y con base en los resultados se crearon subgrupos de similitud mayor al 50%. Se localizaron secuencias conservadas de longitud mayor a 19 nucleótidos en GeneDoc 2.6.002 y sus valores termodinámicos fueron estimados con GeneRunner v3.05, mientras que la sensibilidad y especificidad fue verificada por búsquedas en GenBank usando BLASTN 2.2.8. En total se obtuvieron 94 secuencias conservadas con las siguientes características: longitud promedio de 24 nucleótidos, Tm promedio de 65,8 ºC y contenido de (G+C entre 14,3 y 60,0%. Se determinó que ninguna de las sondas diseñadas forma estructuras secundarias estables con Tm superior a 36,1 ºC. De acuerdo a sus características y valores termodinámicos, todas las sondas podrían ser utilizadas en la construcción de un microarreglo o en reacciones de PCR para la identificación de regiones relevantes en el mejoramiento del proceso por ingeniería metabólica.The goal of the present study was to analyze the metabolic pathways involved in solvent production and cellulose consumption by promising Colombian native strains of the genus Clostridium. Therefore a set of oligonucleotide probes was designed, with the aim of analyzing potential targets for genetic improvement of the Colombian strains. The database named MULTICLOST was created in Microsoft Access® using the sequences from 485 genes involved in solventogenesis, 1,3propanodiol production and cellulolysis from 45 bacterial and 10 fungal species. The genes were grouped according to their respective enzyme function and to the catalytic domain or the substrate binding domain in the case of cellulases. ClustalW 1.83 was used for multiple alignment of every group. Subgroups of sequences with more than 50% identity among themselves were created. Conserved sequences longer than 19 nucleotides were identified using GeneDoc 2.6.002 and their thermodynamic values were calculated with GeneRunner v3.05, while their sensitivity and specificity were verified by searching in GenBank with BLASTN 2.2.8. Ninetyfour conserved sequences were obtained with an average 24nucleotide length, 65.8ºC average Tm and a (G+C content between 14.3% and 60.0%. None of these probes forms stable secondary structures at temperatures higher than 36.1ºC. According to the former results, all of the probes could be used in an oligonucleotide microarray or in PCR reactions for the identification of metabolic targets for improvement of the industrial process.

  11. DISEÑO DE OLIGONUCLEÓTIDOS PARA EL ESTUDIO DE GENES CELULOLÍTICOS Y SOLVENTOGÉNICOS EN CEPAS COLOMBIANAS DE Clostridiumsp. (CLOSTRIDIACEAE Oligonucleotide Probe Design for the Study of Cellulolytic and Solventogenic Genes in Colombian Clostridiumsp. strains (Clostridiaceae

    Directory of Open Access Journals (Sweden)

    JOSÉ DAVID MONTOYA SOLANO

    Full Text Available El objetivo de este estudio fue analizar las rutas metabólicas para la producción de solventes y degradación de celulosa en cepas colombianas promisorias del género Clostridium. Para ello se diseñaron sondas de hibridación que sirvieran para posteriores estudios de mejoramiento genético de las cepas. Se construyó la base de datos denominada MULTICLOST en Microsoft Access® con las secuencias de 485 genes involucrados en las rutas metabólicas arriba mencionadas, provenientes de 45 especies bacterianas y 10 especies fúngicas. Los genes fueron agrupados de acuerdo al tipo de enzima y a los dominios catalíticos o de unión a sustrato en el caso de las celulasas. Cada grupo se sometió a alineamiento múltiple en ClustalW 1.83 y con base en los resultados se crearon subgrupos de similitud mayor al 50%. Se localizaron secuencias conservadas de longitud mayor a 19 nucleótidos en GeneDoc 2.6.002 y sus valores termodinámicos fueron estimados con GeneRunner v3.05, mientras que la sensibilidad y especificidad fue verificada por búsquedas en GenBank usando BLASTN 2.2.8. En total se obtuvieron 94 secuencias conservadas con las siguientes características: longitud promedio de 24 nucleótidos, Tm promedio de 65,8 ºC y contenido de (G+C entre 14,3 y 60,0%. Se determinó que ninguna de las sondas diseñadas forma estructuras secundarias estables con Tm superior a 36,1 ºC. De acuerdo a sus características y valores termodinámicos, todas las sondas podrían ser utilizadas en la construcción de un microarreglo o en reacciones de PCR para la identificación de regiones relevantes en el mejoramiento del proceso por ingeniería metabólica.The goal of the present study was to analyze the metabolic pathways involved in solvent production and cellulose consumption by promising Colombian native strains of the genus Clostridium. Therefore a set of oligonucleotide probes was designed, with the aim of analyzing potential targets for genetic improvement of the Colombian strains. The database named MULTICLOST was created in Microsoft Access® using the sequences from 485 genes involved in solventogenesis, 1,3propanodiol production and cellulolysis from 45 bacterial and 10 fungal species. The genes were grouped according to their respective enzyme function and to the catalytic domain or the substrate binding domain in the case of cellulases. ClustalW 1.83 was used for multiple alignment of every group. Subgroups of sequences with more than 50% identity among themselves were created. Conserved sequences longer than 19 nucleotides were identified using GeneDoc 2.6.002 and their thermodynamic values were calculated with GeneRunner v3.05, while their sensitivity and specificity were verified by searching in GenBank with BLASTN 2.2.8. Ninetyfour conserved sequences were obtained with an average 24nucleotide length, 65.8ºC average Tm and a (G+C content between 14.3% and 60.0%. None of these probes forms stable secondary structures at temperatures higher than 36.1ºC. According to the former results, all of the probes could be used in an oligonucleotide microarray or in PCR reactions for the identification of metabolic targets for improvement of the industrial process.

  12. Weed suppressive rice for drill-seeded systems of the Southern USA: Research strategies and limitations

    Science.gov (United States)

    Effective, affordable weed control is a challenge to sustainable rice production in the U.S. Research efforts in Arkansas have identified several rice lines that can suppress economically important C4 grass weeds such as Echinochloa crus-galli and Leptochloa fusca ssp. fascicularis. Earlier findin...

  13. Acid epimerization of 20-keto pregnane glycosides is determined by 2D-NMR spectroscopy

    OpenAIRE

    García, Víctor P.

    2011-01-01

    Carbohydrates influence many essential biological events such as apoptosis, differentiation, tumor metastasis, cancer, neurobiology, immunology, development, host-pathogen interactions, diabetes, signal transduction, protein folding, and many other contexts. We now report on the structure determination of pregnane glycosides isolated from the aerial parts of Ceropegia fusca Bolle (Asclepiadaceae). The observation of cicatrizant, vulnerary and cytostatic activities in some humans and animals o...

  14. Developments in rice allelopathy: Searching for the balance between allelopathic activity, agronomic viability and commercial acceptability

    Science.gov (United States)

    Sustainable weed control is an ongoing challenge in rice production. Indica rice lines that suppress troublesome C4 grass weeds such as Echinochloa crus-galli and Leptochloa fusca ssp. fascicularis have been evaluated extensively in Arkansas. Earlier findings suggested that suppression likely incl...

  15. New xenophytes from Gran Canaria (Canary Islands, Spain), with emphasis on naturalized and (potentially) invasive species

    OpenAIRE

    Verloove, F

    2013-01-01

    Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides), Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta,...

  16. Phylogenetic relationships among Brazilian howler monkeys, genus Alouatta (Platyrrhini, Atelidae, based on g1-globin pseudogene sequences

    Directory of Open Access Journals (Sweden)

    Carla Maria Meireles

    1999-09-01

    Full Text Available The genus Alouatta (howler monkeys is the most widely distributed of New World primates, and has been arranged in three species groups: the Central American Alouatta palliata group and the South American Alouatta seniculus and Alouatta caraya groups. While the latter is monotypic, the A. seniculus group encompasses at least three species (A. seniculus, A. belzebul and A. fusca. In the present study, approximately 600 base pairs of the g1-globin pseudogene were sequenced in the four Brazilian species (A. seniculus, A. belzebul, A. fusca and A. caraya. Maximum parsimony and maximum likelihood methods yielded phylogenetic trees with the same arrangement: {A. caraya [A. seniculus (A. fusca, A. belzebul]}. The most parsimonious tree had bootstrap values greater than 82% for all groupings, and strength of grouping values of at least 2, supporting the sister clade of A. fusca and A. belzebul. The study also confirmed the presence of a 150-base pair Alu insertion element and a 1.8-kb deletion in the g1-globin pseudogene in A. fusca, features found previously in the remaining three species. The cladistic classification based on molecular data agrees with those of morphological studies, with the monospecific A. caraya group being clearly differentiated from the A. seniculus group.Os guaribas, do gênero Alouatta, que são os primatas do Novo Mundo com maior distribuição geográfica, têm sido colocados em três grupos de espécies: o grupo Alouatta palliata da América central, e os grupos sulamericanos Alouatta seniculus e Alouatta caraya. Este último é monotípico, mas o grupo A. seniculus inclui pelo menos três espécies (A. seniculus, A. belzebul e A. fusca. Neste estudo, foram seqüenciados aproximadamente 600 pares de base do pseudogene globina g1 nas quatro espécies brasileiras (A. seniculus, A. belzebul, A. fusca e A. caraya. Os métodos de máxima parcimônia e máxima verossimilhança produziram árvores filogenéticas com o mesmo arranjo

  17. Novel glycoside hydrolases from thermophilic fungi

    DEFF Research Database (Denmark)

    2012-01-01

    The present invention relates to isolated polypeptides having cellulolytic activity or hemicellulolytic activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of produ...

  18. Identification of thermostable beta-xylosidase activities produced by Aspergillus brasiliensis and Aspergillus niger

    DEFF Research Database (Denmark)

    Pedersen, Mads; Lauritzen, H.K.; Frisvad, Jens Christian; Meyer, Anne S.

    2007-01-01

    Twenty Aspergillus strains were evaluated for production of extracellular cellulolytic and xylanolytic activities. Aspergillus brasiliensis, A. niger and A. japonicus produced the highest xylanase activities with the A. brasiliensis and A. niger strains producing thermostable beta-xylosidases. The...

  19. Identification of thermostable β-xylosidase activities produced by Aspergillus brasiliensis and Aspergillus niger

    DEFF Research Database (Denmark)

    Pedersen, Mads; Lauritzen, Henrik Klitgaard; Frisvad, Jens Christian; Meyer, Anne Boye Strunge

    2007-01-01

    Twenty Aspergillus strains were evaluated for production of extracellular cellulolytic and xylanolytic activities. Aspergillus brasiliensis, A. niger and A. japonicus produced the highest xylanase activities with the A. brasiliensis and A. niger strains producing thermostable beta-xylosidases. The...

  20. Common and Distant Structural Characteristics of Feruloyl Esterase Families from Aspergillus oryzae

    DEFF Research Database (Denmark)

    Udatha, D. B. R. K. Gupta; Mapelli, Valeria; Panagiotou, Gianni;

    2012-01-01

    Background: Feruloyl esterases (FAEs) are important biomass degrading accessory enzymes due to their capability of cleaving the ester links between hemicellulose and pectin to aromatic compounds of lignin, thus enhancing the accessibility of plant tissues to cellulolytic and hemicellulolytic enzy...

  1. Draft Genome Sequence of Paenibacillus pini JCM 16418T, Isolated from the Rhizosphere of Pine Tree

    OpenAIRE

    Yuki, Masahiro; Oshima, Kenshiro; Suda, Wataru; Oshida, Yumi; Kitamura, Keiko; Iida, Toshiya; Hattori, Masahira; Ohkuma, Moriya

    2014-01-01

    Paenibacillus pini strain JCM 16418T is a cellulolytic bacterium isolated from the rhizosphere of pine trees. Here, we report the draft genome sequence of this strain. This genome information will be useful for studies of rhizosphere bacteria.

  2. Isolation of Paenibacillus sp. and Variovorax sp. strains from decaying woods and characterization of their potential for cellulose deconstruction

    OpenAIRE

    Ghio, Silvina; Lorenzo, Gonzalo Sabarís Di; Lia, Verónica; Talia, Paola; Cataldi, Angel; Grasso, Daniel; Campos, Eleonora

    2012-01-01

    Prospection of cellulose-degrading bacteria in natural environments allows the identification of novel cellulases and hemicellulases that could be useful in second-generation bioethanol production. In this work, cellulolytic bacteria were isolated from decaying native forest soils by enrichment on cellulose as sole carbon source. There was a predominance of Gram positive isolates that belonged to the phyla Proteobacteria and Firmicutes. Many primary isolates with cellulolytic activity were no...

  3. Isolation and Characterization of Cellulose-decomposing Bacteria Inhabiting Sawdust and Coffee Residue Composts

    OpenAIRE

    Eida, Mohamed Fathallh; Nagaoka, Toshinori; Wasaki, Jun; Kouno, Kenji

    2012-01-01

    Clarifying the identity and enzymatic activities of microorganisms associated with the decomposition of organic materials is expected to contribute to the evaluation and improvement of composting processes. In this study, we examined the cellulolytic and hemicellulolytic abilities of bacteria isolated from sawdust compost (SDC) and coffee residue compost (CRC). Cellulolytic bacteria were isolated using Dubos mineral salt agar containing azurine cross-linked (AZCL) HE-cellulose. Bacterial iden...

  4. Cellulose and hemicellulose decomposition by forest soil bacteria proceeds by the action of structurally variable enzymatic systems

    OpenAIRE

    Rubén López-Mondéjar; Daniela Zühlke; Dörte Becher; Katharina Riedel; Petr Baldrian

    2016-01-01

    Evidence shows that bacteria contribute actively to the decomposition of cellulose and hemicellulose in forest soil; however, their role in this process is still unclear. Here we performed the screening and identification of bacteria showing potential cellulolytic activity from litter and organic soil of a temperate oak forest. The genomes of three cellulolytic isolates previously described as abundant in this ecosystem were sequenced and their proteomes were characterized during the growth o...

  5. Cellulase activity mapping of Trichoderma reesei cultivated in sugar mixtures under fed-batch conditions

    OpenAIRE

    Jourdier, Etienne; Cohen, Céline; Poughon, Laurent; Larroche, Christian; Monot, Frédéric; Ben Chaabane, Fadhel

    2013-01-01

    Background: On-site cellulase production using locally available lignocellulosic biomass (LCB) is essential for cost-effective production of 2nd-generation biofuels. Cellulolytic enzymes (cellulases and hemicellulases) must be produced in fed-batch mode in order to obtain high productivity and yield. To date, the impact of the sugar composition of LCB hydrolysates on cellulolytic enzyme secretion has not been thoroughly investigated in industrial conditions. Results: The effect of sugar mixtu...

  6. Dicty_cDB: Contig-U10058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1068_2184( CP001068 |pid:none) Ralstonia pickettii 12J chromos... 101 4e-44 AM942759_1191( AM942759 |pid:none) Proteus mirabili...2 6e-50 CP000088_70( CP000088 |pid:none) Thermobifida fusca YX, complete g... 131 6e-50 BT052074_1( BT052074..._109( AM494966 |pid:none) Leishmania braziliensis chromoso... 89 9e-35 AE000516_4030( AE000516 |pid:none) Mycob...e... 82 1e-24 AM743169_2962( AM743169 |pid:none) Stenotrophomonas maltophilia K2... 87 2e-24 CP001002_48( CP...:none) Burkholderia multivorans ATCC 17... 77 4e-24 CP000088_358( CP000088 |pid:none) Thermobifida fusca YX,

  7. Wellington Quaternary palynology

    International Nuclear Information System (INIS)

    Pollen samples from a profile at Taita indicate a grassland environment prior to and immediately after the deposition of the Aokautere Ash (Kawakawa Tephra) approximately 21,000 years B.P. This grassland gradually gave way to a Nothofagus menziesii montane forest followed by an abrupt change to a N. ''Fusca'' group dominant forest which continues to the top of the section. The top few centimetres of the profile may have been deposited in post-European time. The abrupt change in the species of beech represents an unconformity of unknown duration. Pollen samples from a number of profiles at Mangaroa (Wallaceville Swamp) indicate a change from a cool environment (Gramineae plus Phyllocladus) through successive phases of Nothofagus menziesii, Podocarpus species, Dacrydium cupressinum to Nothofagus ''fusca'' group close to the present day. These results are presented in an historical context based on notes left by Dr W.F. Harris, supplemented with additional data by the junior author

  8. New Report on Two Species of the Genus Nipponomysis (Crustacea: Mysida: Mysidae from Korean Waters

    Directory of Open Access Journals (Sweden)

    Kim, Mijin

    2015-01-01

    Full Text Available Two species of mysid, Nipponomysis fusca (Ii, 1936 and N. tenuiculus (Ii, 1940, are newly recorded in Korean fauna. These two species were collected using a light or a bait trap from all coasts of the Korean peninsula. The genus Nipponomysis can be distinguished from allied genus by the following morphological characteristics: third to eighth thoracic endopods with carpopropodus divided into five to six subsegments compared to three subsegments, and anterior four pairs of pleopod in female subequal in length and fifth pair elongated. Nipponomysis fusca is characterized by its acute rostral plate and armature of telson, and N. tenuiculus differs from other species by the number of spine in ventral statocyst region and the shape of the fourth pleopod in male. Herein, we present detailed descriptions of two species from Korean waters with illustrations of morphology. In addition, an identification key to the Korean species of the genus is provided.

  9. Enzymatic hydrolysis of PTT polymers and oligomers.

    Science.gov (United States)

    Eberl, A; Heumann, S; Kotek, R; Kaufmann, F; Mitsche, S; Cavaco-Paulo, A; Gübitz, G M

    2008-05-20

    Oligomers and polymers (film, fabrics) of the linear aromatic polyester poly(trimethylene terephthalate) (PTT) were treated with polyesterases from Thermomyces lanuginosus, Penicillium citrinum, Thermobifida fusca and Fusarium solani pisi. The cutinase from T. fusca was found to release the highest amounts of hydrolysis products from PTT materials and was able to open and hydrolyse a cyclic PTT dimer according to RP-HPLC-UV detection. In contrast, the lipase from T. lanuginosus also showed activity on the PTT fibres and on bis(3-hydroxypropyl) terephthalate (BHPT) but was not able to hydrolyse the polymer film, mono(3-hydroxypropyl) terephthalate (MHPT) nor the cyclic dimer of PTT. As control enzymes inhibited with mercury chloride were used. Surface hydrophilicity changes were investigated with contact angle measurements and the degree of crystallinity changes were determined with DSC. PMID:18405994

  10. Fungal Bioconversion of Lignocellulosic Residues; Opportunities & Perspectives

    Directory of Open Access Journals (Sweden)

    Mehdi Dashtban, Heidi Schraft, Wensheng Qin

    2009-01-01

    Full Text Available The development of alternative energy technology is critically important because of the rising prices of crude oil, security issues regarding the oil supply, and environmental issues such as global warming and air pollution. Bioconversion of biomass has significant advantages over other alternative energy strategies because biomass is the most abundant and also the most renewable biomaterial on our planet. Bioconversion of lignocellulosic residues is initiated primarily by microorganisms such as fungi and bacteria which are capable of degrading lignocellulolytic materials. Fungi such as Trichoderma reesei and Aspergillus niger produce large amounts of extracellular cellulolytic enzymes, whereas bacterial and a few anaerobic fungal strains mostly produce cellulolytic enzymes in a complex called cellulosome, which is associated with the cell wall. In filamentous fungi, cellulolytic enzymes including endoglucanases, cellobiohydrolases (exoglucanases and β-glucosidases work efficiently on cellulolytic residues in a synergistic manner. In addition to cellulolytic/hemicellulolytic activities, higher fungi such as basidiomycetes (e.g. Phanerochaete chrysosporium have unique oxidative systems which together with ligninolytic enzymes are responsible for lignocellulose degradation. This review gives an overview of different fungal lignocellulolytic enzymatic systems including extracellular and cellulosome-associated in aerobic and anaerobic fungi, respectively. In addition, oxidative lignocellulose-degradation mechanisms of higher fungi are discussed. Moreover, this paper reviews the current status of the technology for bioconversion of biomass by fungi, with focus on mutagenesis, co-culturing and heterologous gene expression attempts to improve fungal lignocellulolytic activities to create robust fungal strains.

  11. Fungal bioconversion of lignocellulosic residues; opportunities & perspectives.

    Science.gov (United States)

    Dashtban, Mehdi; Schraft, Heidi; Qin, Wensheng

    2009-01-01

    The development of alternative energy technology is critically important because of the rising prices of crude oil, security issues regarding the oil supply, and environmental issues such as global warming and air pollution. Bioconversion of biomass has significant advantages over other alternative energy strategies because biomass is the most abundant and also the most renewable biomaterial on our planet. Bioconversion of lignocellulosic residues is initiated primarily by microorganisms such as fungi and bacteria which are capable of degrading lignocellulolytic materials. Fungi such as Trichoderma reesei and Aspergillus niger produce large amounts of extracellular cellulolytic enzymes, whereas bacterial and a few anaerobic fungal strains mostly produce cellulolytic enzymes in a complex called cellulosome, which is associated with the cell wall. In filamentous fungi, cellulolytic enzymes including endoglucanases, cellobiohydrolases (exoglucanases) and beta-glucosidases work efficiently on cellulolytic residues in a synergistic manner. In addition to cellulolytic/hemicellulolytic activities, higher fungi such as basidiomycetes (e.g. Phanerochaete chrysosporium) have unique oxidative systems which together with ligninolytic enzymes are responsible for lignocellulose degradation. This review gives an overview of different fungal lignocellulolytic enzymatic systems including extracellular and cellulosome-associated in aerobic and anaerobic fungi, respectively. In addition, oxidative lignocellulose-degradation mechanisms of higher fungi are discussed. Moreover, this paper reviews the current status of the technology for bioconversion of biomass by fungi, with focus on mutagenesis, co-culturing and heterologous gene expression attempts to improve fungal lignocellulolytic activities to create robust fungal strains. PMID:19774110

  12. Evaluation of biological control agents for managing cucurbit powdery mildew on greenhouse-grown melon

    OpenAIRE

    Torés Montosa, Juan Antonio

    2007-01-01

    An evaluation was made of the ability of two mycoparasite-based products AQ10® (Ampelomyces quisqualis) and Mycotal® (Lecanicillium lecanii), as well as three strains of Bacillus subtilis, to manage powdery mildew disease, caused by Podosphaera fusca on melon seedlings maintained under different regimes of relative humidity and on plants grown under greenhouse conditions in Spain. In every case fungal and bacterial biocontrol agents (BCAs) performed better under conditions of high relative hu...

  13. Is parasite pressure a driver of chemical cue diversity in ants?

    OpenAIRE

    Martin, Stephen J.; Helanterä, Heikki; Drijfhout, Falko P.

    2010-01-01

    Parasites and pathogens are possibly key evolutionary forces driving recognition systems. However, empirical evidence remains sparse. The ubiquitous pioneering ant Formica fusca is exploited by numerous socially parasitic ant species. We compared the chemical cue diversity, egg and nest mate recognition abilities in two Finnish and two UK populations where parasite pressure is high or absent, respectively. Finnish populations had excellent egg and nest mate discrimination abilities, which wer...

  14. Foraminifera from the Chilka Lake on the east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, K.K.; Jayalakshmy, K.V.; Venugopal, P.; Gopalakrishnan, T.C.; Rajagopal, M.D.

    . Nair, Scientist-in-charge, Regional Centre, Cochin, for encouragement and facilities. Thanks are also due to Dr. K. Ravindranathan Pillai for going through the manuscript and offering valuable ad- vice. Financial support for this study..., Trochammina and Ammo- nia occur in more than 60% of the sta- tions, while the remaining two, miliolids and Elphidium cover less than 30% of the area. Among the brackish species encoun- tered in the lake sediments, eight species {Miliammina fusca...

  15. Revision of the genus Tibraca Stål (Heteroptera, Pentatomidae, Pentatominae

    Directory of Open Access Journals (Sweden)

    José Antonio Marin Fernandes

    1998-12-01

    Full Text Available The genus Tibraca Stål, 1860 is revised, and some taxonomic changes are introduced. The following species are considered to belong in this genus: Tibraca limbaliventris Stål, 1860, T. similima Barber, 1941, and T. exigua sp.n. (from Argentina. Three other species, formerly placed in Tibraca, are considered respectively: T. obscurata Bergroth, 1914, incertae sedis; Mecocephala fusca (Haglund, 1868, comb.n.; Ogmocoris hypomelas (Burmeister, 1835. The genus Ogmocoris Mayr, 1864 is reinstated.

  16. The antagonistic strain Bacillus subtilis UMAF6639 also confers protection to melon plants against cucurbit powdery mildew by activation of jasmonate- and salicylic acid-dependent defence responses

    OpenAIRE

    Garcia-Gutierrez, Laura; Zeriouh, Houda; Romero, Diego; Cubero, Jaime; de Vicente, Antonio; Përez-García, Alejandro

    2013-01-01

    Biological control of plant diseases has gained acceptance in recent years. Bacillus subtilis UMAF6639 is an antagonistic strain specifically selected for the efficient control of the cucurbit powdery mildew fungus Podosphaera fusca, which is a major threat to cucurbits worldwide. The antagonistic activity relies on the production of the antifungal compounds iturin and fengycin. In a previous study, we found that UMAF6639 was able to induce systemic resistance (ISR) in melon and provide addit...

  17. Estimating the impacts of climate change on interactions between different lepidopteran stemborer species / Eric Siaw Ntiri

    OpenAIRE

    Ntiri, Eric Siaw

    2015-01-01

    The production of cereals, especially maize, which is a staple food in sub-Saharan Africa, is challenged by pests and diseases. In addition, climate change will exacerbate the magnitude of these challenges and agriculture in general. Lepidopteran stemborers are major pests of cereal crops in sub-Saharan Africa. Two indigenous noctuids, Busseola fusca and Sesamia calamistis and one exotic crambid, Chilo partellus, occur as single and mixed-species communities infesting cereal cr...

  18. Interplay of the H‑Bond Donor−Acceptor Role of the Distal Residues in Hydroxyl Ligand Stabilization of Thermobif ida f usca Truncated Hemoglobin

    OpenAIRE

    Droghetti, Enrica; Fittipaldi, Maria; Bonamore, Alessandra; Baiocco, Paola; Feis, Alessandro; Boffi, Alberto; Smulevich, Giulietta; Nicoletti, Francesco P; Bustamante, Juan Carlos; Howes, Barry D.; Estrin, Dario A.

    2014-01-01

    The unique architecture of the active site of Thermobifida fusca truncated hemoglobin (Tf-trHb) and other globins belonging to the same family has stimulated extensive studies aimed at understanding the interplay between iron-bound ligands and distal amino acids. The behavior of the heme-bound hydroxyl, in particular, has generated much interest in view of the relationships between the spin-state equilibrium of the ferric iron atom and hydrogen-bonding capabilities (as either acceptor or dono...

  19. ASPECTS CONCERNING THE ENZYMATIC ACTIVITY IN SEVERAL THERMOACTINOMYCETE STRAINS

    Directory of Open Access Journals (Sweden)

    Simona Dunca

    2003-08-01

    Full Text Available In the thermoactinomycete strains subjected to examination the values of their recorded enzymatic activities (i.e. α-amy lase, protease, exo-β-1,4 – glucanase, endo -β-1,4 – glucanase and β-glucosidase were lower in the stationary cultures as compared to the stirred ones. The strain Thermomonospora fusca BB255 was found to be highly cellulase- producing and at the same time able to synthesize α-amy lases and proteases.

  20. Kızılırmak Vadisinde Kuşları Etkileyen Olumsuz Faktörler

    OpenAIRE

    İLİKER, Ayşegül; ALBAYRAK, İrfan; TABUR, Mehmet Ali

    2015-01-01

    Totally, 263 bird species were observed in the Kızılırmak valley between 2010-2012 years. Among them were 93 residents, 82 summer migrants, 51 winter migrants and 37 transit migrants. When evaluated in IUCN criteria, Egyptian vulture (Neophron percnopterus), saker falcon (Falco cherrug) and velvet scoter (Melanitta fusca) are endengared (EN), marbled teal (Marmaronette angustirostris), great bustard (Otis tarda) and aquatic warbler (Acrocephalus paludicola) are vulnareble (VU) and ferruginous...

  1. Phylogenetic relationships among Brazilian howler monkeys, genus Alouatta (Platyrrhini, Atelidae), based on g1-globin pseudogene sequences

    OpenAIRE

    Carla Maria Meireles; John Czelusniak; STEPHEN F. FERRARI; Maria Paula Cruz Schneider; Morris Goodman

    1999-01-01

    The genus Alouatta (howler monkeys) is the most widely distributed of New World primates, and has been arranged in three species groups: the Central American Alouatta palliata group and the South American Alouatta seniculus and Alouatta caraya groups. While the latter is monotypic, the A. seniculus group encompasses at least three species (A. seniculus, A. belzebul and A. fusca). In the present study, approximately 600 base pairs of the g1-globin pseudogene were sequenced in the four Brazilia...

  2. Karyological study of three Monocelis-species, and description of a new species from the Mediterranean, Monocelis longistyla sp.n. (Monocelididae, Plathelminthes)

    OpenAIRE

    Martens, P.M.; Curini-Galletti, M.C.

    1987-01-01

    Monocelis longistyla sp.n. from littoral sandy habitats of the Mediterranean is described. The karyotypes of Monocelis fusca, M. lineata and M. longistyla sp.n. were analysed. A basic karyotype for the genus Monocelis is postulated and its probable evolution from the basic karyotype of the family Monocelididae and within the genus is discussed. The karyotype of M. longistyla seems to have evolved from the basic Monocelis karyotype by pericentric inversions. However from the analysis of the ka...

  3. Optimizing cellulase mixtures for maximum rate and extent of hydrolysis. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Walker, L.P.; Wilson, D.B. [Cornell Univ., Ithaca, NY (United States)

    1997-03-01

    Pure Thomomonospora fusca and Trichoderma reesei cellulases and their mixtures were studied to determine the optimal set of cellulases for biomass hydrolysis. The objective was to reduce the cost of cellulase in order to help lower the overall processing cost of the enzymatic conversion of biomass cellulose to sugars, which can then be fermented into fuels and other energy-intensive chemicals. No cellulase mixture was obtained that was much better than the best commercially available preparations. However, the study has greatly increased knowledge of T. fusca cellulases, synergism, and cellulose binding, and provide evidence that future work will produce cellulases with higher activity in degrading crystalline cellulose. T. fusca cellulases may have good industrial potential because: (1) they are compatible with industrial processes that operate at elevated temperatures; (2) they retain 90% of their activity under neutral or basic conditions, which provides a great deal of flexibility in reactor design and operation; and (3) tools are now available to change specific amino acid residues in their catalytic domains and to assess how these changes influence catalysis. 74 refs.

  4. Dominant inheritance of field-evolved resistance to Bt corn in Busseolafusca.

    Directory of Open Access Journals (Sweden)

    Pascal Campagne

    Full Text Available Transgenic crops expressing Bacillus thuringiensis (Bt toxins have been adopted worldwide, notably in developing countries. In spite of their success in controlling target pests while allowing a substantial reduction of insecticide use, the sustainable control of these pest populations is threatened by the evolution of resistance. The implementation of the "high dose/refuge" strategy for managing insect resistance in transgenic crops aims at delaying the evolution of resistance to Bt crops in pest populations by promoting survival of susceptible insects. However, a crucial condition for the "high dose/refuge" strategy to be efficient is that the inheritance of resistance should be functionally recessive. Busseolafusca developed high levels of resistance to the Bt toxin Cry 1Ab expressed in Bt corn in South Africa. To test whether the inheritance of B. fusca resistance to the Bt toxin could be considered recessive we performed controlled crosses with this pest and evaluated its survival on Bt and non-Bt corn. Results show that resistance of B. fusca to Bt corn is dominant, which refutes the hypothesis of recessive inheritance. Survival on Bt corn was not lower than on non-Bt corn for both resistant larvae and the F1 progeny from resistant × susceptible parents. Hence, resistance management strategies of B. fusca to Bt corn must address non-recessive resistance.

  5. Implication of salt marsh foraminiferal assemblages in Suncheon Bay, South Korea

    Science.gov (United States)

    Jeong, Da Un; Lee, Yeon Gyu; Kang, Sora; Kim, Shin; Lee, Jung Sick

    2016-03-01

    Analyses of the compositions of benthic foraminifera and sediment, observations of tidal level and salinity, and a geographic survey of the tidal salt marsh in Suncheon Bay were conducted to examine the vertical distribution of foraminifera and evaluate their potential use for sea level studies. The salt marsh is composed mainly of fine-grained silty clay sediment and its salinity is below approximately 11 psu. The tidal current flows in the southwest-tonortheast direction with an average velocity of 26.57 cm/s. A total of 33 species of foraminifera (17 agglutinated and 16 calcareoushyaline) belonging to 24 genera was identified. The species diversity (1.1 on average) was relatively low. Dominant species were Ammonia beccarii, Miliammina fusca, Haplophragmoides wilberti, and Jadammina macrescens. Calcareous foraminifera (29.5%) were dominantly represented by the Ammonia beccarii assemblage, which characterized the region between mean tide level and mean low high water (MLHW). Agglutinated species (70.5%) were represented mostly by Miliammina fusca, Miliammina fusca-Haplophragmoides wilberti, and Haplophragmoides wilberti assemblages, which characterized the MLHW-mean high water (MHW), MHW-mean highest high water (MHHW), and MHHW-Approx. highest high water tide levels, respectively. In particular, the Haplophragmoides wilberti assemblage is believed to represent the highest elevation zone of foraminifera in the salt marshes of Suncheon Bay and is considered to be a reliable indicator of sea level as a result of its narrow vertical range.

  6. MICROBIAL FERMENTATION OF ABUNDANT BIOPOLYMERS: CELLULOSE AND CHITIN

    Energy Technology Data Exchange (ETDEWEB)

    Leschine, Susan

    2009-10-31

    Our research has dealt with seven major areas of investigation: i) characterization of cellulolytic members of microbial consortia, with special attention recently given to Clostridium phytofermentans, a bacterium that decomposes cellulose and produces uncommonly large amounts of ethanol, ii) investigations of the chitinase system of Cellulomonas uda; including the purification and characterization of ChiA, the major component of this enzyme system, iii) molecular cloning, sequence and structural analysis of the gene that encodes ChiA in C. uda, iv) biofilm formation by C. uda on nutritive surfaces, v) investigations of the effects of humic substances on cellulose degradation by anaerobic cellulolytic microbes, vi) studies of nitrogen metabolism in cellulolytic anaerobes, and vii) understanding the molecular architecture of the multicomplex cellulase-xylanase system of Clostridium papyrosolvens. Also, progress toward completing the research of more recent projects is briefly summarized. Major accomplishments include: 1. Characterization of Clostridium phytofermentans, a cellulose-fermenting, ethanol-producing bacterium from forest soil. The characterization of a new cellulolytic species isolated from a cellulose-decomposing microbial consortium from forest soil was completed. This bacterium is remarkable for the high concentrations of ethanol produced during cellulose fermentation, typically more than twice the concentration produced by other species of cellulolytic clostridia. 2. Examination of the use of chitin as a source of carbon and nitrogen by cellulolytic microbes. We discovered that many cellulolytic anaerobes and facultative aerobes are able to use chitin as a source of both carbon and nitrogen. This major discovery expands our understanding of the biology of cellulose-fermenting bacteria and may lead to new applications for these microbes. 3. Comparative studies of the cellulase and chitinase systems of Cellulomonas uda. Results of these studies indicate

  7. The mutagenic action of UV-light irradiation on aspergillus terreus in relation to antibacterial activity

    International Nuclear Information System (INIS)

    Four strains of cellulolytic fungi (i.e Penicillium oxalicum, Aspergillus niger, Aspergillus terreus and Trichoderma longibrachiatum) were tested for the production of cellulolytic enzymes and antibiotic action. these fungi were cultured on Czapek Dox's media with different cellulosic substrates. A. terreus. exhibited the highest cellulolytic activity and the highest level of anti-bacterial activity against Staphylococcus aureus. and Escherichia Coli, Ultraviolet light as a mutagenic treatment for A.terreus was investigated. Two treated isolates U.30.12 and U.60.10 were obtained after the treatment at dose 30 and 60 min., respectively with a higher antibiotic activity in comparison with the wild isolate. A compound of fifteen carbon atom of terrecylic acid was isolated from ethyl acetate extract using spectroscopic analysis

  8. Cellulase production by halophytic fungi. Pt. 1. Screening experiments and salt relations

    Energy Technology Data Exchange (ETDEWEB)

    Sallam, L.A.R.; EL-Refai, A.M.H.; El-Sayed, S.M.

    1988-01-01

    The potentiality of 3 local halophytic fungi, isolated from the salt marshes at Burg El-Arab area in the Western Mediterranean Coast of Egypt, to produce cellulose-hydrolysing enzymes has been studied under static culture conditions using 4 different media charged with avicel as a sole carbon source. Ulocladium chartarum was selected as the most potent for cellulase production. This fungus has not been proviously reported to possess cellulolytic activities. Dispensing the basal medium 2 mm depth and incubation of U. chartarum for 3 weeks were the most favourable conditions for best cellulolytic activities. The production of cellulolytic enzymes was markedly affected by the salt supplied and its concentration. Best CMCase and FPase activities (0.289 and 0.043 unit/ml respectively) were noticed on using 60 g Na/sub 2/SO/sub 4//l.

  9. MICROBIAL FERMENTATION OF ABUNDANT BIOPOLYMERS: CELLULOSE AND CHITIN

    Energy Technology Data Exchange (ETDEWEB)

    Leschine, Susan

    2009-10-31

    Our research has dealt with seven major areas of investigation: i) characterization of cellulolytic members of microbial consortia, with special attention recently given to Clostridium phytofermentans, a bacterium that decomposes cellulose and produces uncommonly large amounts of ethanol, ii) investigations of the chitinase system of Cellulomonas uda; including the purification and characterization of ChiA, the major component of this enzyme system, iii) molecular cloning, sequence and structural analysis of the gene that encodes ChiA in C. uda, iv) biofilm formation by C. uda on nutritive surfaces, v) investigations of the effects of humic substances on cellulose degradation by anaerobic cellulolytic microbes, vi) studies of nitrogen metabolism in cellulolytic anaerobes, and vii) understanding the molecular architecture of the multicomplex cellulase-xylanase system of Clostridium papyrosolvens. Also, progress toward completing the research of more recent projects is briefly summarized. Major accomplishments include: 1. Characterization of Clostridium phytofermentans, a cellulose-fermenting, ethanol-producing bacterium from forest soil. The characterization of a new cellulolytic species isolated from a cellulose-decomposing microbial consortium from forest soil was completed. This bacterium is remarkable for the high concentrations of ethanol produced during cellulose fermentation, typically more than twice the concentration produced by other species of cellulolytic clostridia. 2. Examination of the use of chitin as a source of carbon and nitrogen by cellulolytic microbes. We discovered that many cellulolytic anaerobes and facultative aerobes are able to use chitin as a source of both carbon and nitrogen. This major discovery expands our understanding of the biology of cellulose-fermenting bacteria and may lead to new applications for these microbes. 3. Comparative studies of the cellulase and chitinase systems of Cellulomonas uda. Results of these studies indicate

  10. Cultivable microflora and endo mycorrhizas obtained in litter forest (Paramo Guerrero - Finca Puente de Tierra) Zipaquira, Colombia

    International Nuclear Information System (INIS)

    The count of cultivable microorganisms (bacteria and fungi), cellulolytic microorganisms and endo mycorrhizas present in litter forest (property Puente de Tierra) in the Guerrero's moor, Colombia was made. The most frequently isolated microorganisms belonged to the staphylococcus, bacillus, pseudomonas, micrococcus, penicillium and rhodotorulagenus and cladosporium sp., which is a cellulolytic microorganism, was isolated in carboxymethyl cellulose agar. In addition eight morphotypes of endomycorrhizas were found, species of glomus and acaulospora predominated among them. This study contributes with the knowledge of the cultivable microorganisms of litter that have been little explored in moor ecosystems

  11. Effect of cellulase producing fungi on plant residues degradation used as organic fertilizer

    International Nuclear Information System (INIS)

    Series of laboratory and field experiments were conducted at Soil microbiology Unit and Farm of soil and Water research department, Nuclear Research Center, Atomic Energy Authority, Egypt. Laboratory experiments revealed that between nine fungal strain, A. niger was the most potent cellulolytic fungus able to degrade many cellulosic sources (CP, CMC, and FP). Study the effect of cellulolytic fungi on degradation of plant residues used as organic fertilizer in addition to nitrogen fixing bacteria (symbiotically) on lupine growth, yield and nutrients uptake (Field experiment) had been carried out. This objective aims to recycling different plant residues in soil which is consistent with (sustainable development) and utilization of these organic residues as a single carbon source for cellulolytic fungi.Application of 15N- tracer technique gave us the chance and opportunity to quantify the exact amounts of N derived from the different sources of nitrogen available to lupine plant under the effect of cellulolytic fungi on different plant residues.The obtained results could be summarized as following:I.Laboratory Technique Selection of the most potent cellulolytic fungi 1-Nine fungal strains of Aspergillus niger; Penicillium oxalicum; Trichoderma longibranchiatum; Aspergillus terreus; Aspergillus flavus; Alterrnaria sp.; Trichderma harzianum ; Rhizopus sp. and Syncephalastrum sp. obtained from different sources and tested for their cellulolytic activity. 2-Aspergillus niger and Pencillium oxalicum exhibited the highest cellulase productivity followed by Trichoderma longibranchiatum and Aspergillus terreus.3- fungal mixtures of the most potent four genera Aspergillus niger; Penicillium oxalicum; Trichoderma longibranchiatum and Aspergillus terreus found to have a lower cellulolytic activities for all substrates compared with single inoculation with A. niger.4-Highest FPase activities were exhibited by A. niger when filter paper (FP) used as a carbon source.5-A. niger is

  12. Karakterisasi Tepung Kasava Yang Dimodifikasi Dengan Bakteri Selulolitik Sebagai Bahan Baku Produk Mie Dan Biskuit

    OpenAIRE

    Sembiring, Simon Petrus

    2011-01-01

    The research was conducted to dertermine the characterization of modified starch cassava with cellulolytic bacteria as the raw materials of noodles and biscuits products. The study was conducted using single-factor randomized block design that is the number of cellulolytic bacteria (J) with 5 degree (J1:0 ml, J2:10 ml, J3:20 ml, J4:30 ml, J5:40 ml) and for the ratio of wheat with flour cassava flour(100:0, 90:10, 80:20, 70:30, 60:40). Product was parameters for the flour were the chemical pro...

  13. Continuous Cellulosic Bioethanol Fermentation by Cyclic Fed-Batch Cocultivation

    OpenAIRE

    Jiang, He-Long; He, Qiang; He, Zhili; Hemme, Christopher L.; Wu, Liyou; Zhou, Jizhong

    2013-01-01

    Cocultivation of cellulolytic and saccharolytic microbial populations is a promising strategy to improve bioethanol production from the fermentation of recalcitrant cellulosic materials. Earlier studies have demonstrated the effectiveness of cocultivation in enhancing ethanolic fermentation of cellulose in batch fermentation. To further enhance process efficiency, a semicontinuous cyclic fed-batch fermentor configuration was evaluated for its potential in enhancing the efficiency of cellulose...

  14. Mycoflora in the intestine of Eisenia andrei (Oligochaeta, Lumbricidae) and in vermiculture substrates

    Czech Academy of Sciences Publication Activity Database

    Nováková, Alena; Pižl, Václav

    2003-01-01

    Roč. 55, 1/2 (2003), s. 83-102. ISSN 1211-0981 R&D Projects: GA AV ČR IAA6066001 Institutional research plan: CEZ:AV0Z6066911 Keywords : cattle manure * saprotrophic and cellulolytic microfungi * earthworms Subject RIV: EH - Ecology, Behaviour

  15. The fate of lignin during hydrothermal pretreatment

    OpenAIRE

    Trajano, Heather L.; Engle, Nancy L.; Foston, Marcus; Ragauskas, Arthur J.; Tschaplinski, Timothy J; Wyman, Charles E

    2013-01-01

    Abstract Background Effective enzymatic hydrolysis of lignocellulosic biomass benefits from lignin removal, relocation, and/or modification during hydrothermal pretreatment. Phase transition, depolymerization/repolymerization, and solubility effects may all influence these lignin changes. To better understand how lignin is altered, Populus trichocarpa x P. deltoides wood samples and cellulolytic enzyme lignin (CEL) isolated from P. trichocarpa x P. de...

  16. Evaluation of minimal Trichoderma reesei cellulase mixtures on differently pretreated barley straw substrates

    DEFF Research Database (Denmark)

    Rosgaard, Lisa; Pedersen, Sven; Langston, Jim;

    2007-01-01

    The commercial cellulase product Celluclast 1.5, derived from Trichoderma reesei (Novozymes A/S, Bagsv ae rd, Denmark), is widely employed for hydrolysis of lignocellulosic biomass feedstocks. This enzyme preparation contains a broad spectrum of cellulolytic enzyme activities, most notably...

  17. Evaluation of Minimal Trichoderma reesei Cellulase Mixtures on Differently Pretreated Barley Straw Substrate

    DEFF Research Database (Denmark)

    Rosgaard, Lisa; Pedersen, Sven; Langston, J;

    2007-01-01

    The commercial cellulase product Celluclast 1.5, derived from Trichoderma reesei (Novozymes A/S, Bagsv ae rd, Denmark), is widely employed for hydrolysis of lignocellulosic biomass feedstocks. This enzyme preparation contains a broad spectrum of cellulolytic enzyme activities, most notably...

  18. Enzymic hydrolysis of chlorella cells

    Energy Technology Data Exchange (ETDEWEB)

    Khraptsova, G.I.; Tsaplina, I.A.; Burdenko, L.G.; Khoreva, S.L.; Loginova, L.G.

    1981-01-01

    Treatment of C. ellipsoidea, C. pyrenoidosa, and C. vulgaris with cellulolytic enzymes (from Aspergillus terreus) and pectofoetidin p10x (from A. foetidus) resulted in the degradation and lysis of the algae cells. The cells were more sensitive to cellulase than to pectinase. The combination of both enzymes produced a synergistic effect on cell lysis.

  19. Isolation of Paenibacillus sp. and Variovorax sp. strains from decaying woods and characterization of their potential for cellulose deconstruction.

    Science.gov (United States)

    Ghio, Silvina; Lorenzo, Gonzalo Sabarís Di; Lia, Verónica; Talia, Paola; Cataldi, Angel; Grasso, Daniel; Campos, Eleonora

    2012-01-01

    Prospection of cellulose-degrading bacteria in natural environments allows the identification of novel cellulases and hemicellulases that could be useful in second-generation bioethanol production. In this work, cellulolytic bacteria were isolated from decaying native forest soils by enrichment on cellulose as sole carbon source. There was a predominance of Gram positive isolates that belonged to the phyla Proteobacteria and Firmicutes. Many primary isolates with cellulolytic activity were not pure cultures. From these consortia, isolation of pure constituents was attempted in order to test the hypothesis whether microbial consortia are needed for full degradation of complex substrates. Two isolates, CB1-2-A-5 and VG-4-A-2, were obtained as the pure constituents of CB1-2 and VG-4 consortia, respectively. Based on 16S RNA sequence, they could be classified as Variovorax paradoxus and Paenibacillus alvei. Noteworthy, only VG-4 consortium showed measurable xylan degrading capacity and signs of filter paper degradation. However, no xylan or filter paper degrading capacities were observed for the pure cultures isolated from it, suggesting that other members of this consortium were necessary for these hydrolyzing activities. Our results indicated that Paenibacillus sp. and Variovorax sp. as well as VG-4 consortium, might be a useful source of hydrolytic enzymes. Moreover, although Variovorax sp. had been previously identified in metagenomic studies of cellulolytic communities, this is the first report on the isolation and characterization of this microorganism as a cellulolytic genus. PMID:23301200

  20. Biohydrogen Production by the Thermophilic Bacterium Caldicellulosiruptor saccharolyticus: Current Status and Perspectives

    NARCIS (Netherlands)

    Bielen, A.A.M.; Verhaart, M.R.A.; Oost, van der J.; Kengen, S.W.M.

    2013-01-01

    Caldicellulosiruptor saccharolyticus is one of the most thermophilic cellulolytic organisms known to date. This Gram-positive anaerobic bacterium ferments a broad spectrum of mono-, di- and polysaccharides to mainly acetate, CO2 and hydrogen. With hydrogen yields approaching the theoretical limit fo

  1. Correlation between the abundance of cellulolitic fungi and selected soil properties

    Directory of Open Access Journals (Sweden)

    Teresa Korniłłowicz-Kowalska

    2014-08-01

    Full Text Available The study conducted has revealed the general abundance of cellulolytic fungi in the soil is significantly correlated only with the phosphors content. The correlation with specific soil properties was found in the case of the genera Humicola, Penicillium, Fusarium and Chrysosporium of the 10 genera of these fungi isolated most often.

  2. Screening for cellulose and hemicellulose degrading enzymes from the fungal genus Ulocladium

    DEFF Research Database (Denmark)

    Pedersen, Mads; Hollensted, Morten; Lange, L.;

    2009-01-01

    The fungal genus Ulocladium consists mostly of saprotrophic species and can readily be isolated from dead vegetation, rotten wood. paper, textiles and other cellulose containing materials. Thus, they must produce cellulolytic and hemicellulolytic enzymes. In this study fifty Ulocladium strains from...... results suggest that species identity as well as isolation source must be considered when screening microorganisms for enzymes....

  3. Genome Sequence of Citrobacter sp. CtB7.12, Isolated from the Gut of the Desert Subterranean Termite Heterotermes aureus

    Science.gov (United States)

    Fontes-Perez, Héctor; Olvera-García, Myrna; Chávez-Martínez, America; Rodriguez-Almeida, Felipe A.; Arzola-Alvarez, Claudio A.

    2015-01-01

    The draft genome of Citrobacter sp. CtB7.12, isolated from termite gut, is presented here. This organism has been reported as a cellulolytic bacterium, which is biotechnologically important because it can be used as a gene donor for the ethanol and biofuel industries. PMID:26543121

  4. Cloning of a GH5 endoglucanase from genus Penicillium and its binding to different lignins

    DEFF Research Database (Denmark)

    Krogh, Kristian Bertel Rømer; Kastberg, H.; Jørgensen, C. I.;

    2009-01-01

    -productive binding of cellulolytic enzymes to lignin is an important obstacle to overcome for commercial biomass to ethanol production. Therefore, the adsorption on residual lignin produced from various biomass samples was investigated. Both Substrate and pretreatment conditions resulted in different adsorptions of...... Cel5C to the residual lignin....

  5. Xylanase XYN IV from Trichoderma reesei showing exo- and endo-xylanase activity

    Science.gov (United States)

    A novel xylanase from Trichoderma reesei Rut C30, named XYN IV, was purified from the cellulolytic system of the fungus. The enzyme was discovered on its ability to attack aldotetraohexenuronic acid (HexA-2Xyl-4Xyl-4Xyl, HexA3Xyl3), releasing the reducing-end xylose residue. XYN IV exhibited catalyt...

  6. Biodegradation of Aliphatic-aromatic Coplyester under Thermophilic Conditions

    Directory of Open Access Journals (Sweden)

    Elsayed B. Belal

    2013-11-01

    Full Text Available The biodegradation of poly (tetramethylene adipate-co-tetramethylene terephthalate (BTA-copolyester as synthetic polyester was investigated under thermophilic conditions. Two efficient BTA degrading actinomycetes were isolated from compost at thermophilic phase. These strains were identified as Thermobifida fusca and Thermobispora bispora. The degradation rate for BTA films within 7 days was 17.12 and 16.96 mg/week.cm2 by T. fusca and T. bispora, respectively. The optimum BTA40:60 degradation conditions are obtained as pH7 and 55°C. The both strains exhibited a wider substrate spectrum as they are able to degrade synthetic polyesters (BTA40:60, PCL-S MaterBi ZF03U/A and natural polymers (poly-&beta-hydroxybutyric acid (PHB and carboxymethyl cellulose. It was shown that the extracellular hydrolyases activity from the both strains was induced in the presence of BTA-copolyester, while the presence of additional carbon sources such as glucose or a complex medium suppressed enzyme formation. Tributyrin as triglycerides was degraded by the both crude concentrated BTA-hydrolases. In contrast the enzyme was not capable to depolymerize the natural polymers PHB and carboxymethyl cellulose, although the organism itself degraded both types of polymers. The obtained results showed that the degradation rate with T. fusca BTA40:60-hydrolase was 3.67 mg/day.cm2 and was 3.5 mg/day.cm2 with T. bispora BTA40:60-hydrolase. The pH optimum for BTA-hydrolases was 7 with 20 and 100 mM phosphate buffer and it was 6 with 150 mM citrate buffer. Finally, it could be concluded that actinomycetes and their hydrolases play an outstanding role in recycling of biodegradable plastics under thermophilic phase during composting process.

  7. Alpha-L-Arabinofuranosidases: The potential applications in biotechnology

    Digital Repository Service at National Institute of Oceanography (India)

    Numan, M.Th.; Bhosle, N.B.

    and nitrogen sources used were dried skins of grape pomace and casein peptone, respectively [57]. 11 Thermomonospora fusca BD25 showed highest �D�D -L-AFase activity (0.136 U/mg protein) when grown in a medium containing 0.6% (w/v) oat spelt xylan and 0... part of aromas [42]. They are not volatile and directly accessible to the olfactory mucosa [12,127,132]. A major portion of these monoterpenols in grapes musts, wines, other alcoholic beverages (brandy, bitters, etc.), and fruit juices (apple...

  8. Dicty_cDB: Contig-U06665-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0879 |pid:none) Petrotoga mobilis SJ95, complet... 32 7.9 CP000075_643( CP000075 |pid:none) Pseudomonas syri...8_431( AE016818 |pid:none) Ashbya gossypii (= Eremothecium ... 40 0.049 AE016825_3819( AE016825 |pid:none) Chromob...24( BA000030 |pid:none) Streptomyces avermitilis MA-468... 33 6.1 CP001157_2913( CP001157 |pid:none) Azotoba..._2658( CP000088 |pid:none) Thermobifida fusca YX, complete... 32 7.9 CP000444_3446( CP000444 |pid:none) Shew...............................................done Score E Sequences producing significant alignments: (bits)

  9. The rice GERMINATION DEFECTIVE 1, encoding a B3 domain transcriptional repressor, regulates seed germination and seedling development by integrating GA and carbohydrate metabolism

    OpenAIRE

    Guo, Xiaoli; Hou, Xiaomei; FANG, JUN; Wei, Piwei; Xu, Bo; Chen, Mingluan; Feng, Yuqi; Chu, Chengcai

    2013-01-01

    It has been shown that seed development is regulated by a network of transcription factors in Arabidopsis including LEC1 (LEAFY COTYLEDON1), L1L (LEC1-like) and the B3 domain factors LEC2, FUS3 (FUSCA3) and ABI3 (ABA-INSENSITIVE3); however, molecular and genetic regulation of seed development in cereals is poorly understood. To understand seed development and seed germination in cereals, a large-scale screen was performed using our T–DNA mutant population, and a mutant germination-defective1 ...

  10. Cloning, Expression and Biochemical Characterization of Endomannanases from Thermobifida Species Isolated from Different Niches.

    Directory of Open Access Journals (Sweden)

    Ákos Tóth

    Full Text Available Thermobifidas are thermotolerant, compost inhabiting actinomycetes which have complex polysaccharide hydrolyzing enzyme systems. The best characterized enzymes of these hydrolases are cellulases from T. fusca, while other important enzymes especially hemicellulases are not deeply explored. To fill this gap we cloned and investigated endomannanases from those reference strains of the Thermobifida genus, which have published data on other hydrolases (T. fusca TM51, T. alba CECT3323, T. cellulosilytica TB100T and T. halotolerans YIM90462T. Our phylogenetic analyses of 16S rDNA and endomannanase sequences revealed that T. alba CECT3323 is miss-classified; it belongs to the T. fusca species. The cloned and investigated endomannanases belong to the family of glycosyl hydrolases 5 (GH5, their size is around 50 kDa and they are modular enzymes. Their catalytic domains are extended by a C-terminal carbohydrate binding module (CBM of type 2 with a 23-25 residues long interdomain linker region consisting of Pro, Thr and Glu/Asp rich repetitive tetrapeptide motifs. Their polypeptide chains exhibit high homology, interdomain sequence, which don't show homology to each other, but all of them are built up from 3-6 times repeated tetrapeptide motifs (PTDP-Tc, TEEP-Tf, DPGT-Th. All of the heterologously expressed Man5A enzymes exhibited activity only on mannan. The pH optima of Man5A enzymes from T. halotolerans, T. cellulosilytica and T. fusca are slightly different (7.0, 7.5 and 8.0, respectively while their temperature optima span within the range of 70-75°C. The three endomannanases exhibited very similar kinetic performances on LBG-mannan substrate: 0.9-1.7mM of KM and 80-120 1/sec of turnover number. We detected great variability in heat stability at 70°C, which was influenced by the presence of Ca2+. The investigated endomannanases might be important subjects for studying the structure/function relation behind the heat stability and for industrial

  11. Novos táxons de Lamiinae (Coleoptera, Cerambycidae da América do Sul

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2012-06-01

    Full Text Available Novos táxons descritos: Acanthoderini, Nesozineus osorioensis sp. nov., do Brasil (Rio Grande do Sul; Calliini, Drycothaea clara sp. nov., do Brasil (Rondônia e Drycothaea hovorei sp. nov., do Equador (Napo; Forsteriini, Itacolomi gen. nov., espécie-tipo I. letiziae sp. nov., do Brasil (Minas Gerais; Yapyguara gen. nov., espécie-tipo Y. fusca sp. nov., da Bolívia (Santa Cruz; Xenofreini, Xenofrea zischkai sp. nov., do Equador (Napo e da Bolívia (Santa Cruz.

  12. Basic chromosome numbers and polyploid levels in some South African and Australian grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    J. J. Spies

    1991-12-01

    Full Text Available Chromosome numbers of 46 specimens of grasses, involving 24 taxa from South Africa and Australia, have been determined during the present study. For the first time chromosome numbers are given for Eragrostis sarmentosa (Thunb. Trin. (n = 20. Panicum aequinerve Nees (n = 18,  Digitaria argyrograpta (Nees Stapf (n = 9 and D. maitlandii Stapf & C.E. Hubb. (n = 9. Additional polyploid levels are described for Diplachne fusca (L. Beauv. ex Roem. & Schult. (n = 10 and Digitaria diagonalis (Nees Stapf var.  diagonalis (n = 9.B-chromosomes were observed in several different specimens. The presence of B-chromosomes often results in abnormal chromosomal behaviour during meiosis.

  13. Use of Solid Waste from Thermoelectric Plants for the Cultivation of Microalgae

    Directory of Open Access Journals (Sweden)

    Bruna da Silva Vaz

    2016-01-01

    Full Text Available ABSTRACT The aim of this study was to analyze the influence of solid waste on the cultivation of the microalgae Spirulina sp. LEB 18 and Chlorella fusca LEB 111 with 0, 40, 80 and 120 ppm of mineral coal ash. The addition of the ash did not inhibit the cultivation of microalgae at the tested concentrations, showing that it could be used for the cultivation of these microalgae due to the minerals present in the ash, which might substitute the nutrients needed for their growth.

  14. Is parasite pressure a driver of chemical cue diversity in ants?

    Science.gov (United States)

    Martin, Stephen J; Helanterä, Heikki; Drijfhout, Falko P

    2011-02-22

    Parasites and pathogens are possibly key evolutionary forces driving recognition systems. However, empirical evidence remains sparse. The ubiquitous pioneering ant Formica fusca is exploited by numerous socially parasitic ant species. We compared the chemical cue diversity, egg and nest mate recognition abilities in two Finnish and two UK populations where parasite pressure is high or absent, respectively. Finnish populations had excellent egg and nest mate discrimination abilities, which were lost in the UK populations. The loss of discrimination behaviour correlates with a loss in key recognition compounds (C(25)-dimethylalkanes). This was not owing to genetic drift or different ecotypes since neutral gene diversity was the same in both countries. Furthermore, it is known that the cuticular hydrocarbon profiles of non-host ant species remain stable between Finland and the UK. The most parsimonious explanation for the striking difference in the cue diversity (number of C(25)-dimethylalkanes isomers) between the UK and Finland populations is the large differences in parasite pressure experienced by F. fusca in the two countries. These results have strong parallels with bird (cuckoo) studies and support the hypothesis that parasites are driving recognition cue diversity. PMID:20610426

  15. A dual enzyme system composed of a polyester hydrolase and a carboxylesterase enhances the biocatalytic degradation of polyethylene terephthalate films.

    Science.gov (United States)

    Barth, Markus; Honak, Annett; Oeser, Thorsten; Wei, Ren; Belisário-Ferrari, Matheus R; Then, Johannes; Schmidt, Juliane; Zimmermann, Wolfgang

    2016-08-01

    TfCut2 from Thermobifida fusca KW3 and the metagenome-derived LC-cutinase are bacterial polyester hydrolases capable of efficiently degrading polyethylene terephthalate (PET) films. Since the enzymatic PET hydrolysis is inhibited by the degradation intermediate mono-(2-hydroxyethyl) terephthalate (MHET), a dual enzyme system consisting of a polyester hydrolase and the immobilized carboxylesterase TfCa from Thermobifida fusca KW3 was employed for the hydrolysis of PET films at 60°C. HPLC analysis of the reaction products obtained after 24 h of hydrolysis showed an increased amount of soluble products with a lower proportion of MHET in the presence of the immobilized TfCa. The results indicated a continuous hydrolysis of the inhibitory MHET by the immobilized TfCa and demonstrated its advantage as a second biocatalyst in combination with a polyester hydrolase for an efficient degradation oft PET films. The dual enzyme system with LC-cutinase produced a 2.4-fold higher amount of degradation products compared to TfCut2 after a reaction time of 24 h confirming the superior activity of his polyester hydrolase against PET films. PMID:27214855

  16. On the Amazonian species of the genus Scytodes Latreille (Arachnida, Araneae, Scytodidae

    Directory of Open Access Journals (Sweden)

    Cristina A. Rheims

    2004-09-01

    Full Text Available Eight species of Scytodes Latreille, 1804 are newly described: Scytodes iara sp. nov. and S. caure sp. nov. from Amazonas; S. mapinguari sp. nov. from Amazonas and Roraima; S. curupira sp. nov. from Amazonas and Rondônia; S. saci sp. nov. from Roraima; and S. jurupari sp. nov., S. tinkuan sp. nov. and S. caipora sp. nov. from Acre. In addition, the female of S. altamira Rheims & Brescovit, 2000 is described and new records are presented for S. auricula Rheims & Brescovit, 2000, S. fusca Walckenaer, 1837, S. longipes Lucas, 1844, S. martiusi Brescovit & Höfer, 1999, S. piroca Rheims & Brescovit, 2000, S. romitii Caporiacco, 1947 and S. vieirae Rheims & Brescovit, 2000.Oito novas espécies de Scytodes Latreille, 1804 são descritas: Scytodes iara sp. nov. e S. caure sp. nov. do Amazonas; S. mapinguari sp. nov. do Amazonas e de Roraima; S. curupira sp. nov. do Amazonas e de Rondônia; S. saci sp. nov. de Roraima; e S. jurupari sp. nov., S. tinkuan sp. nov. e S. caipora sp. nov. do Acre. A fêmea de S. altamira Rheims & Brescovit, 2000 é descrita e novos registros são apresentados para S. auricula Rheims & Brescovit, 2000, S. fusca Walckenaer, 1837, S. longipes Lucas, 1844, S. martiusi Brescovit & Höfer, 1999, S. piroca Rheims & Brescovit, 2000, S. romitii Caporiacco, 1947 e S. vieirae Rheims & Brescovit, 2000.

  17. The antagonistic strain Bacillus subtilis UMAF6639 also confers protection to melon plants against cucurbit powdery mildew by activation of jasmonate- and salicylic acid-dependent defence responses.

    Science.gov (United States)

    García-Gutiérrez, Laura; Zeriouh, Houda; Romero, Diego; Cubero, Jaime; de Vicente, Antonio; Pérez-García, Alejandro

    2013-05-01

    Biological control of plant diseases has gained acceptance in recent years. Bacillus subtilis UMAF6639 is an antagonistic strain specifically selected for the efficient control of the cucurbit powdery mildew fungus Podosphaera fusca, which is a major threat to cucurbits worldwide. The antagonistic activity relies on the production of the antifungal compounds iturin and fengycin. In a previous study, we found that UMAF6639 was able to induce systemic resistance (ISR) in melon and provide additional protection against powdery mildew. In the present work, we further investigated in detail this second mechanism of biocontrol by UMAF6639. First, we examined the signalling pathways elicited by UMAF6639 in melon plants, as well as the defence mechanisms activated in response to P. fusca. Second, we analysed the role of the lipopeptides produced by UMAF6639 as potential determinants for ISR activation. Our results demonstrated that UMAF6639 confers protection against cucurbit powdery mildew by activation of jasmonate- and salicylic acid-dependent defence responses, which include the production of reactive oxygen species and cell wall reinforcement. We also showed that surfactin lipopeptide is a major determinant for stimulation of the immune response. These results reinforce the biotechnological potential of UMAF6639 as a biological control agent. PMID:23302493

  18. NUTRITIONAL EVALUATION OF VARIOUS FEEDSTUFFS FOR LIVESTOCK PRODUCTION USING IN VITRO GAS METHOD

    Directory of Open Access Journals (Sweden)

    S. A. KHANUM, T. YAQOOB1, S. SADAF1, M. HUSSAIN, M. A. JABBAR1, H. N. HUSSAIN, R. KAUSAR AND S. REHMAN1

    2007-07-01

    Full Text Available A study was undertaken to evaluate the nutritional quality of some conventional and non-conventional feed resources by using in vitro gas method. Samples of various feedstuffs were analyzed chemically, as well as by in vitro gas method. The feedstuffs having different digestibilities showed significant (P<0.05 differences in the rate and amount of gas production, metabolizable energy (ME and digestibility of organic matter. Predicted metabolizable energy values were very low in feedstuffs having high fiber and low protein contents. These feedstuffs included various grasses, crop residues and wheal straw. Lowest ME value of 4.7 MJ/kg of dry matter (DM was found in wheat straw. Many of the roughages (Sorghum vulgare, Kochia indica, Leptochloa fusca studied were found to be deficient in fermentable carbohydrates, resulting in low organic matter digestibility. Concentrate feed stuffs like cotton seed meal, sunflower meal, cotton seed cakes, rice polish, rapeseed meal and Zea mays (maize grains had higher ME values (9.27 – 12.44 MJ/kg DM. The difference of ME of various feedstuffs reflects different contents of fermentable carbohydrates and available nitrogen in cereals and protein supplements. Among the non-conventional feedstuffs, Acacia ampliceps, Acacia nilotica, Sesbania aculeata, Leptochloa fusca and Prosopis juliflora were found potential fodders. Extensive use of in vitro gas method proved its potential as a tool to evaluate various ruminant feeds for energy component.

  19. [Chewing-lice (Phtihiraptera: Amblycera, Ischnocera) occurring on birds in the Konya zoo].

    Science.gov (United States)

    Dik, Bilal; Uslu, Uğur

    2009-01-01

    In this study, 25 birds belonging to 15 different species at the zoo in Konya were inspected for the presence of chewing-lice. Three Long-legged Buzzards (Buteo rufinus), one Imperial Eagle (Aquila heliaca) and one Marsh Harrier (Circus aeruginosus) were found to be infested by chewing-lice. Two hundred and eleven chewing-lice specimens were collected from the birds and seven species were identified. They were mounted on slides separately in Faure forte medium or Canada balsam after clearing in 10% KOH. Morphologic characteristics of the chewing-lice were examined and measured under the light microscope. Laemobothrion maximum (Scopoli, 1763), Craspedorrhynchus platystomus (Burmeister, 1838) and Degeeriella fulva (Giebel, 1874) were detected on Long-legged buzzards; Craspedorrhynchus fraterculus (Eichler & Zlotorzycka, 1975), Degeeriella aquilarum (Eichler, 1943) and Colpocephalum impressum (Rudow, 1866) on the Imperial Eagle; and Degeeriella fusca (Denny, 1842), on the Mars Harrier. C. fraterculus, D. aquilarum, C. impressum and D. fusca were found for the first time on these raptors in Turkey and information about these species were given in this paper. PMID:19367546

  20. The phylogeny of howler monkeys (Alouatta, Platyrrhini): reconstruction by multicolor cross-species chromosome painting.

    Science.gov (United States)

    de Oliveira, Edivaldo H C; Neusser, Michaela; Figueiredo, Wilsea B; Nagamachi, Cleusa; Pieczarka, Julio Cesar; Sbalqueiro, Ives J; Wienberg, Johannes; Müller, Stefan

    2002-01-01

    We performed multidirectional chromosome painting in a comparative cytogenetic study of the three howler monkey species Alouatta fusca, A. caraya and A. seniculus macconnelli (Atelinae, Platyrrhini) in order to reconstruct phylogenetic relationships within this genus. Comparative genome maps between these species were established by multicolor fluorescence in-situ hybridization (FISH) employing human, Saguinus oedipus and Lagothrix lagothricha chromosome-specific probes. The three species included in this study and previously analyzed howler monkey species were subjected to a phylogenetic analysis on the basis of a data matrix comprised of 98 discrete molecular cytogenetic characters. The results revealed that howler monkeys represent the genus with the most extensive karyotype diversity within Platyrrhini so far analyzed with high levels of intraspecific chromosomal variability. Two different multiple sex chromosome systems were identified. The phylogenetic analysis indicated that Alouatta is a monophyletic clade which can be derived from a proposed ancestral Atelinae karyotype of 2n = 62 chromosomes by a chromosome fusion, a fission, a Y-autosomal translocation and a pericentric inversion. Following these suggestions, the genus Alouatta can be divided into two distinct species groups: the first includes A. caraya and A. belzebul, the second A. s. macconnelli, A. sara, A. s. arctoidea and A. fusca. PMID:12575795

  1. PENAPISAN KHAMIR SELULOLITIK CRYPTOCOCCUS SP. YANG DIISOLASI DARI TANAH KEBUN BIOLOGI WAMENA, JAYA WIJAYA, PROPINSI PAPUA

    Directory of Open Access Journals (Sweden)

    Atit Kanti

    2007-06-01

    Full Text Available Cryptococcus sp. was isolated from Kebun Biologi Wamena, Papua. The isolate was able to grow in media with carboxymethyl cellulose as a sole carbon source implying that isolate produced 1-3 ? endo-glucanase. To study the effect of glucose and osmotic pressure, 0.1 % glucose and 0.1 % NaCl were amended into the medium containing CMC. Glucose significantly affected cellulolytic activity and biomass synthesis. At the beginning of cell cultivation glucose augmentation appear to slightly inhibit enzyme activity. Sodium chloride also significantly affected cellulolytic activity. Profile of pH varied dependent on cultivation media. Maximum growth of biomass was achieved after glucose addition, indicating that glucose stimulated cell growth.

  2. Thermophilic, lignocellulolytic bacteria for ethanol production: current state and perspectives

    DEFF Research Database (Denmark)

    Chang, Tinghong; Yao, Shuo

    2011-01-01

    Lignocellulosic biomass contains a variety of carbohydrates, and their conversion into ethanol by fermentation requires an efficient microbial platform to achieve high yield, productivity, and final titer of ethanol. In recent years, growing attention has been devoted to the development of...... cellulolytic and saccharolytic thermophilic bacteria for lignocellulosic ethanol production because of their unique properties. First of all, thermophilic bacteria possess unique cellulolytic and hemicellulolytic systems and are considered as potential sources of highly active and thermostable enzymes for...... efficient biomass hydrolysis. Secondly, thermophilic bacteria ferment a broad range of carbohydrates into ethanol, and some of them display potential for ethanologenic fermentation at high yield. Thirdly, the establishment of the genetic tools for thermophilic bacteria has allowed metabolic engineering, in...

  3. High-Yield Endoglucanase Production by Trichoderma harzianum IOC-3844 Cultivated in Pretreated Sugarcane Mill Byproduct.

    Science.gov (United States)

    de Castro, Aline Machado; Ferreira, Marcela Costa; da Cruz, Juliana Cunha; Pedro, Kelly Cristina Nascimento Rodrigues; Carvalho, Daniele Fernandes; Leite, Selma Gomes Ferreira; Pereira, Nei

    2010-01-01

    The low-cost production of cellulolytic complexes presenting high action at mild conditions and well-balanced cellulase activities is one of the major bottlenecks for the economical viability of the production of cellulosic ethanol. In the present paper, the filamentous fungus Trichoderma harzianum IOC-3844 was used for the production of cellulases from a pretreated sugarcane bagasse (namely, cellulignin), by submerged fermentation. This fungal strain produced high contents of endoglucanase activity (6,358 U·L(-1)) after 72 hours of process, and further relevant β-glucosidase and FPase activities (742 and 445 U·L(-1), resp.). The crude enzyme extract demonstrated appropriate characteristics for its application in cellulose hydrolysis, such as high thermal stability at up to 50°C, accessory xylanase activity, and absence of proteolytic activity towards azocasein. This strain showed, therefore, potential for the production of complete cellulolytic complexes aiming at the saccharification of lignocellulosic materials. PMID:21048871

  4. Third Generation Biofuels via Direct Cellulose Fermentation

    Directory of Open Access Journals (Sweden)

    David B. Levin

    2008-07-01

    Full Text Available Consolidated bioprocessing (CBP is a system in which cellulase production, substrate hydrolysis, and fermentation are accomplished in a single process step by cellulolytic microorganisms. CBP offers the potential for lower biofuel production costs due to simpler feedstock processing, lower energy inputs, and higher conversion efficiencies than separate hydrolysis and fermentation processes, and is an economically attractive near-term goal for “third generation” biofuel production. In this review article, production of third generation biofuels from cellulosic feedstocks will be addressed in respect to the metabolism of cellulolytic bacteria and the development of strategies to increase biofuel yields through metabolic engineering.

  5. High-Yield Endoglucanase Production by Trichoderma harzianum IOC-3844 Cultivated in Pretreated Sugarcane Mill Byproduct

    Directory of Open Access Journals (Sweden)

    Aline Machado de Castro

    2010-01-01

    Full Text Available The low-cost production of cellulolytic complexes presenting high action at mild conditions and well-balanced cellulase activities is one of the major bottlenecks for the economical viability of the production of cellulosic ethanol. In the present paper, the filamentous fungus Trichoderma harzianum IOC-3844 was used for the production of cellulases from a pretreated sugarcane bagasse (namely, cellulignin, by submerged fermentation. This fungal strain produced high contents of endoglucanase activity (6,358 U·L−1 after 72 hours of process, and further relevant β-glucosidase and FPase activities (742 and 445 U·L−1, resp.. The crude enzyme extract demonstrated appropriate characteristics for its application in cellulose hydrolysis, such as high thermal stability at up to 50∘C, accessory xylanase activity, and absence of proteolytic activity towards azocasein. This strain showed, therefore, potential for the production of complete cellulolytic complexes aiming at the saccharification of lignocellulosic materials.

  6. Degradation of cellulosic biomass and its subsequent utilization for the production of chemical feedstocks. Final report, February 1, 1978-January 31, 1979

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-01-01

    This is a coordinated program to effect the microbiological degradation of cellulosic biomasses and will focus on the use of anaerobic microorganisms which possess cellulolytic enzyme. The studies will attempt to increase the enzyme levels through genetics, mutation and strain selection. In addition, the direct conversion from cellulosic biomasses to liquid fuel (ethanol) and/or soluble sugars by the cellulolytic, anaerobic organism is also within the scope of this program. Process and engineering scale-up, along with economic analyses, will be performed throughout the course of the program. The second area of our major effort is devoted to the production of chemical feedstocks. In particular, three fermentations have been identified for exploration. These are: acrylic acid, acetone/butanol and acetic acid. The main efforts in these fermentations will address means for the reduction of the cost of manufacturing for these large volume chemicals.

  7. Selection and a 3-Year Field Trial of Sorangium cellulosum KYC 3262 Against Anthracnose in Hot Pepper

    OpenAIRE

    Yun, Sung-Chul

    2014-01-01

    KYC 3262 was selected as a biocontrol agent against anthracnose on hot pepper from 813 extracts of myxobacterial isolates. Dual culture with Colletotrichum acutatum and 813 myxobacterial extracts was conducted, and 19 extracts were selected that inhibited germination and mycelial growth of C. acutatum. All selections were Sorangium cellulosum, which are cellulolytic myxobacteria from soil. With the infection bioassay on detached fruits in airtight containers, KYC 3262, KYC 3512, KYC 3279, and...

  8. Effect of phytochemical and coconut oil supplementation on rumen ecology and methane production in ruminants

    International Nuclear Information System (INIS)

    Four, native beef cattle were used to determine the effect of phytochemical and coconut oil on rumen ecology and ruminal methane gas. The animals were housed in individual pens and fed with rice straw and concentrate containing 7% coconut oil (CCO) or supplemented with 100g mangosteen peel powder (MSP, Garcinia Mangostana), 100g soap berry tree fruit (SBF, Sapindus rarak) or with no supplement (NS). Feeding regimes lasted for 3 weeks and sampling of feeds, rumen fluid and gas measurements were done during the last 3 days. Animals received SBF had lowest (P 0.75), however, CCO supplemented group had highest (P 0.75. The OM and NDF digestibility were found lowest (P 4 : BW, L/kg) was significantly highest (P 4:BW): %NDF digestibility), it was found that MSP supplemented group had lowest value but were not significantly different when compared with control and SBF supplemented groups. These results were similar with methane gas production per % NDF digestibility. Quantification of the three predominant cellulolytic bacteria by using real time PCR technique are shown. It was found that CCO supplementation influenced on three species (P < 0.05) and resulted in lower (P < 0.05) total cellulolytic bacterial population. These results reflected on lower OM and NDF digestibility. However, MSP supplemented group had greatest in cellulolytic bacteria population. Supplementation had resulted in variable population of cellulolytic bacteria (P < 0.05), which corresponded with Ngamsaeng et al., who reported that MSP supplementation increased (P < 0.05) bacterial population and total count of bacteria and was highest at 150 g/hd/d. Quantification of Methanogenes population was found that SBF and CCO supplementation could decrease the population, particularly, SBF supplementation had resulted in lowest value (P < 0.05). Based on this study, use of phytochemicals showed potential effect on rumen manipulation especially supplementation with 100 g of mangosteen peel powder

  9. Effects of Condensed Tannins on Endoglucanase Activity and Filter Paper Digestion by Fibrobacter succinogenes S85 †

    OpenAIRE

    Bae, Hee Dong; McAllister, Tim A; Yanke, Jay; Cheng, K.-J.; Muir, A. D.

    1993-01-01

    The effect of condensed tannins from birdsfoot trefoil (Lotus corniculatus L.) on the cellulolytic rumen bacterium Fibrobacter succinogenes S85 was examined. Condensed tannins inhibited endoglucanase activity in the extracellular culture fluid, at concentrations as low as 25 μg ml-1. In contrast, cell-associated endoglucanase activity increased in concentrations of condensed tannins between 100 and 300 μg ml-1. Inhibition of endoglucanase activity in both the extracellular and the cell-associ...

  10. DECENTRALIZED THERMOPHILIC BIOHYDROGEN: A MORE EFFICIENT AND COST EFFECTIVE PROCESS

    OpenAIRE

    Sani, Rajesh K.; Rajesh V. Shende; Sudhir Kumar; Aditya Bhalla

    2011-01-01

    Nonfood lignocellulosic biomass is an ideal substrate for biohydrogen production. By avoiding pretreatment steps (acid, alkali, or enzymatic), there is potential to make the process economical. Utilization of regional untreated lignocellulosic biomass by cellulolytic and fermentative thermophiles in a consolidated mode using a single reactor is one of the ways to achieve economical and sustainable biohydrogen production. Employing these potential microorganisms along with decentralized biohyd...

  11. Effect of soluble carbohydrates on digestion of cellulose by pure cultures of rumen bacteria.

    OpenAIRE

    Hiltner, P; Dehority, B. A.

    1983-01-01

    The rate of cellulose digestion in the presence of either glucose or cellobiose was studied for the three predominant species of cellulolytic rumen bacteria: Ruminococcus albus, Ruminococcus flavefaciens, and Bacteroides succinogenes. When a soluble carbohydrate was added to cellulose broth, the lag phase of cellulose digestion was shortened. Presumably, this was due to greater numbers of bacteria, because increasing the size of the inoculum had a similar effect. Cellulose digestion occurred ...

  12. Thermochemical pre- and biological co-treatments to improve hydrolysis and methane production from poultry litter

    OpenAIRE

    Costa, J. C.; Barbosa, S. G.; Alves, M.M.; Sousa, D.Z.

    2012-01-01

    The biochemical methane potential (BMP) of raw poultry litter waste was assessed in batch assays. Biological co-treatment with Clostridium cellulolyticum, Caldicellulosiruptor saccharolyticum and Clostridium thermocellum as bioaugmentation strains, and thermochemical pre-treatments with lime and sodium hydroxide performed at different temperatures and pressures were applied as strategies to improve the BMP by favouring the hydrolysis of the cellulolytic material in the waste. Anaerobic digest...

  13. TECHNOLOGY OF CORN BREAD

    OpenAIRE

    Koryachkina, S.; Matveeva, T.; Kuznecova, E.; Cherepnina, L.

    2012-01-01

    The possibility of making bread from a cracked grains with triticale rich kefir starter without baking yeast cake. Experiments were carried out using varieties of triticale breeding Moscow Nemchinovsky 56, the most satisfying requirements for grain in bread making. To improve the quality of the finished product was carried out soaking the grain in the extract of coriander with cellulolytic enzyme preparation of celloviridine G20h under conditions optimal for the action of the enzyme complex o...

  14. Influence of Forage Phenolics on Ruminal Fibrolytic Bacteria and In Vitro Fiber Degradation

    OpenAIRE

    Varel, Vincent H.; Jung, Hans-Joachim G.

    1986-01-01

    In vitro cultures of ruminal microorganisms were used to determine the effect of cinnamic acid and vanillin on the digestibility of cellulose and xylan. Cinnamic acid and vanillin depressed in vitro dry matter disappearance of cellulose 14 and 49%, respectively, when rumen fluid was the inoculum. The number of viable Bacteroides succinogenes cells, the predominant cellulolytic organism, was threefold higher for fermentations which contained vanillin than for control fermentations. When xylan ...

  15. Hidden cellulases in termites: revision of an old hypothesis

    OpenAIRE

    Tokuda, Gaku; Watanabe, Hirofumi

    2007-01-01

    The intestinal flagellates of termites produce cellulases that contribute to cellulose digestion of their host termites. However, 75% of all termite species do not harbour the cellulolytic flagellates; the endogenous cellulase secreted from the midgut tissue has been considered a sole source of cellulases in these termites. Using the xylophagous flagellate-free termites Nasutitermes takasagoensis and Nasutitermes walkeri, we successfully solubilized cellulases present in the hindgut pellets. ...

  16. Thermochemical pre- and biological co-treatments to improve hydrolysis and methane production from poultry wastes

    OpenAIRE

    Costa, J.C.; Barbosa, S. G.; Alves, M. M.; Sousa, D.Z.

    2011-01-01

    Poultry industry wastes, namely feathers and poultry litter, are an interesting source of substrate for biogas production. The aim of this work was to assess the biomethane potential of raw poultry wastes, as well as the possibility of enhancing this potential by favouring the hydrolysis of cellulolytic and proteinaceous material in the wastes by using bioaugmentation and thermochemical pre-treatments. Biomethane production from poultry litter and chicken feathers was assessed in batch ass...

  17. ISOLASI DAN KARAKTERISASI BAKTERI PENDEGRADASI LIGNOSELULOSA ASAL RUMEN SAPI

    OpenAIRE

    Isdaryanti, Isdaryanti

    2015-01-01

    Research An ???Isolation and Characterization Of Lignocellulose Degrading Bacteria From Cattle Rumen??? research has been done. This research aims to obtain isolation of bacteria from cattle rumen which has potency to degraded cellulose and lignin, and also characterize isolation that showing cellulolytic and lignolytic activity. The isolation of bacteria from cattle rumen was undertaken using Nutrient Agar (NA) medium and the counting of the total of the growing bacteria used SPC method. Scr...

  18. Exploring laccase-like multicopper oxidase genes from the ascomycete Trichoderma reesei: a functional, phylogenetic and evolutionary study

    OpenAIRE

    Levasseur Anthony; Saloheimo Markku; Navarro David; Andberg Martina; Pontarotti Pierre; Kruus Kristiina; Record Eric

    2010-01-01

    Abstract Background The diversity and function of ligninolytic genes in soil-inhabiting ascomycetes has not yet been elucidated, despite their possible role in plant litter decay processes. Among ascomycetes, Trichoderma reesei is a model organism of cellulose and hemicellulose degradation, used for its unique secretion ability especially for cellulase production. T. reesei has only been reported as a cellulolytic and hemicellulolytic organism although genome annotation revealed 6 laccase-lik...

  19. Bacteriocin-resistant mutants of Erwinia chrysanthemi: possible involvement of iron acquisition in phytopathogenicity.

    OpenAIRE

    Expert, D; A. Toussaint

    1985-01-01

    A series of bacteriocin-resistant mutants of Erwinia chrysanthemi 3937JRH were unable to elicit soft-rot symptoms on saintpaulia plants. The loss of pathogenicity was correlated with the disappearance of one to three outer membrane polypeptides (molecular weights, about 80,000 to 90,000) whose production in wild-type strains was greatly enhanced under iron-limited growth conditions. The mutants did not exhibit altered extracellular pectinolytic or cellulolytic activities.

  20. Optimisation of Cellulase Production by Penicillium funiculosum in a Stirred Tank Bioreactor Using Multivariate Response Surface Analysis

    OpenAIRE

    Marcelle Lins de Albuquerque de Carvalho; Daniele Fernandes Carvalho; Edelvio de Barros Gomes; Roberto Nobuyuki Maeda; Lidia Maria Melo Santa Anna; Aline Machado de Castro; Nei Pereira

    2014-01-01

    Increasing interest in the production of second-generation ethanol necessitates the low-cost production of enzymes from the cellulolytic complex (endoglucanases, exoglucanases, and β-glucosidases), which act synergistically in cellulose breakdown. The present work aimed to optimise a bioprocess to produce these biocatalysts from the fungus Penicillium funiculosum ATCC11797. A statistical full factorial design (FFD) was employed to determine the optimal conditions for cellulase production. The...

  1. Effort of Increasing Production of Livestock Feed out of Cassava Waste by Identifying the more Suitable Cellulotic Degrading Fungi

    Directory of Open Access Journals (Sweden)

    Yani Suryani

    2012-09-01

    Full Text Available In the bioethanol production process, as much as 90% of waste was produced. The availability of waste production is very important since waste can be processed to become livestock feed. The solid bioethanol waste contains cyanide (HCN 5.8177 mg/kg, water 95,21%, ash 0,39%, protein 8,16%, crude fiber 5,45%, crude fat 2.06%, and carbohydrates 83,94%. Processing bioethanol solid waste into livestock feed can be done by utilizing the existing fungi on bioethanol solid waste. Crude fiber (cellulose and carbohydrates are a source of cellulolytic fungi. Cellulolytic fungi can degrade the role of organic materials contained in bioethanol solid waste, so that it can be made as a source of highly nutritious livestock feed. This study aims to determine the types of cellulolytic fungal isolates contained in bioethanol solid waste which is potentially processed to become livestock woof. Descriptive analysis was employed as a method of the study. Furthermore, Potato Dextrose Agar (PDA was used as a medium for culturing and isolating the fungus. Dilution series and pour plate method were employed to isolate the fungus. And, Moist Chamber method was employed to identify it. In addition, Carboxy Methyl Cellulose (CMC was used as medium to identify cellulolytic fungi. The process was carried out up to the level of genus based on macroscopic and microscopic characterization. 10 fungal isolates from the genus of Aspergillus sp 1, Aspergillus sp 2, Aspergillus sp 3, Aspergillus niger, Cladosporium sp, Mucor sp, Penicillium sp 1, Penicillium sp 2, Rhizopus sp and Trichoderma viride were yielded in this study. The results of examining cellulose enzyme activity revealed that 9 of 10 isolates of the fungus were capable of degrading cellulose. Isolates yielding the largest cellulose enzyme were Trichoderma viride, Penicillium sp 1, Cladosporium sp and Aspergillus niger.

  2. The fate of lignin during hydrothermal pretreatment

    OpenAIRE

    Heather L. Trajano; Engle, Nancy L; Foston, Marcus; Ragauskas, Arthur J; Tschaplinski, Timothy J; Wyman, Charles E

    2013-01-01

    Background Effective enzymatic hydrolysis of lignocellulosic biomass benefits from lignin removal, relocation, and/or modification during hydrothermal pretreatment. Phase transition, depolymerization/repolymerization, and solubility effects may all influence these lignin changes. To better understand how lignin is altered, Populus trichocarpa x P. deltoides wood samples and cellulolytic enzyme lignin (CEL) isolated from P. trichocarpa x P. deltoides were subjected to batch and flowthrough pre...

  3. PRODUCTION OF BIOETHANOL FROM AGRICULTURAL WASTE

    OpenAIRE

    W. Braide; I. A. Kanu; S.U. Oranusi; S. A. Adeleye

    2016-01-01

    This study investigates the potential of ethanol production from agro wastes. Agro waste from sugarcane Saccharum officinarum (sugarcane baggasse, sugarcane bark) and maize plant Zea mays (corncob, corn stalk, corn husk) was subjected to a pretreatment process using acid hydrolysis was applied to remove lignin which acts as physical barrier to cellulolytic enzymes. Ethanolic fermentation was done using Saccharomyces cerevisiae for 5days and the ethanol yield, specific gravity, pH and total re...

  4. High-Yield Endoglucanase Production by Trichoderma harzianum IOC-3844 Cultivated in Pretreated Sugarcane Mill Byproduct

    OpenAIRE

    Aline Machado de Castro; Marcela Costa Ferreira; Juliana Cunha da Cruz; Kelly Cristina Nascimento Rodrigues Pedro; Daniele Fernandes Carvalho; Selma Gomes Ferreira Leite; Nei Pereira

    2010-01-01

    The low-cost production of cellulolytic complexes presenting high action at mild conditions and well-balanced cellulase activities is one of the major bottlenecks for the economical viability of the production of cellulosic ethanol. In the present paper, the filamentous fungus Trichoderma harzianum IOC-3844 was used for the production of cellulases from a pretreated sugarcane bagasse (namely, cellulignin), by submerged fermentation. This fungal strain produced high contents of endoglucanase a...

  5. Overcoming restriction as a barrier to DNA transformation in Caldicellulosiruptor species results in efficient marker replacement

    OpenAIRE

    Chung, Daehwan; Farkas, Joel; Westpheling, Janet

    2013-01-01

    Background Thermophilic microorganisms have special advantages for the conversion of plant biomass to fuels and chemicals. Members of the genus Caldicellulosiruptor are the most thermophilic cellulolytic bacteria known. They have the ability to grow on a variety of non-pretreated biomass substrates at or near ~80°C and hold promise for converting biomass to bioproducts in a single step. As for all such relatively uncharacterized organisms with desirable traits, the ability to genetically mani...

  6. Requirement of the Type II Secretion System for Utilization of Cellulosic Substrates by Cellvibrio japonicus▿ † ‡

    OpenAIRE

    Gardner, Jeffrey G.; Keating, David H.

    2010-01-01

    Cellulosic biofuels represent a powerful alternative to petroleum but are currently limited by the inefficiencies of the conversion process. While Gram-positive and fungal organisms have been widely explored as sources of cellulases and hemicellulases for biomass degradation, Gram-negative organisms have received less experimental attention. We investigated the ability of Cellvibrio japonicus, a recently sequenced Gram-negative cellulolytic bacterium, to degrade bioenergy-related feedstocks. ...

  7. Cellulase, Clostridia, and Ethanol†

    OpenAIRE

    Demain, Arnold L.; Newcomb, Michael; Wu, J. H. David

    2005-01-01

    Biomass conversion to ethanol as a liquid fuel by the thermophilic and anaerobic clostridia offers a potential partial solution to the problem of the world's dependence on petroleum for energy. Coculture of a cellulolytic strain and a saccharolytic strain of Clostridium on agricultural resources, as well as on urban and industrial cellulosic wastes, is a promising approach to an alternate energy source from an economic viewpoint. This review discusses the need for such a process, the cellulas...

  8. Complete Genome Sequence of Herbinix luporum SD1D, a New Cellulose-Degrading Bacterium Isolated from a Thermophilic Biogas Reactor

    Science.gov (United States)

    Koeck, Daniela E.; Maus, Irena; Wibberg, Daniel; Winkler, Anika; Zverlov, Vladimir V.; Liebl, Wolfgang; Pühler, Alfred; Schwarz, Wolfgang H.

    2016-01-01

    A novel cellulolytic bacterial strain was isolated from an industrial-scale biogas plant. The 16S rRNA gene sequence of the strain SD1D showed 96.4% similarity to Herbinix hemicellulosilytica T3/55T, indicating a novel species within the genus Herbinix (family Lachnospiraceae). Here, the complete genome sequence of Herbinix luporum SD1D is reported. PMID:27445379

  9. PROTOZOÁRIOS RUMINAIS DE NOVILHOS DE CORTE CRIADOS EM PASTAGEM TROPICAL DURANTE O PERÍODO SECO

    OpenAIRE

    Kellerson Luiz da Silva; Eduardo Robson Duarte; Claudio Eduardo Silva Freitas; Flávia Oliveira Abrão; Luciana Castro Geraseev

    2014-01-01

    Protozoa of the rumen can represent 40% of total nitrogen and 60% of the final product of fermentation and it has cellulolytic activity. This study aimed to quantify and identify the ruminal protozoa populations from steers, raised exclusively on pastures during the dry season in the north of Minas Gerais, Brazil. Samples of ruminal fluid of 36 Nellore steers were collected directly from the rumen immediately after slaughter, during the early, middle or end of the dry season. For protozoa con...

  10. Fermentation of wort from a starch-containing raw material prepared using cellulases

    Energy Technology Data Exchange (ETDEWEB)

    Marinchenko, V.A.; Nosik, S.V.; Tiunova, N.A.

    1980-01-01

    Wort was prepared from powdered barley by treatment with cellulase from Geotrichum candidum or the enzyme preparation cellocandin G3X. After fermentation the alcohol concentration increased and the amount of nonmetabolized starch significantly decreased. The use of cellulolytic enzymes in the production of beer not only reduces the requirements for amylolytic enzymes but also increases the EtOh yield by 2.0-3.5%.

  11. Kinetic transcriptome analysis reveals an essentially intact induction system in a cellulase hyper-producer Trichoderma reesei strain

    OpenAIRE

    Poggi-Parodi, Dante; Bidard, Frédérique; Pirayre, Aurélie; Portnoy, Thomas; Blugeon, Corinne; Seiboth, Bernhard; Kubicek, Christian P.; Le Crom, Stéphane; Margeot, Antoine

    2014-01-01

    Background The filamentous fungus Trichoderma reesei is the main industrial cellulolytic enzyme producer. Several strains have been developed in the past using random mutagenesis, and despite impressive performance enhancements, the pressure for low-cost cellulases has stimulated continuous research in the field. In this context, comparative study of the lower and higher producer strains obtained through random mutagenesis using systems biology tools (genome and transcriptome sequencing) can ...

  12. Production of Alkaline Cellulase by Fungi Isolated from an Undisturbed Rain Forest of Peru

    OpenAIRE

    Karin Vega; Gretty K. Villena; Sarmiento, Victor H.; Yvette Ludeña; Nadia Vera; Marcel Gutiérrez-Correa

    2012-01-01

    Alkaline cellulase producing fungi were isolated from soils of an undisturbed rain forest of Peru. The soil dilution plate method was used for the enumeration and isolation of fast growing cellulolytic fungi on an enriched selective medium. Eleven out of 50 different morphological colonies were finally selected by using the plate clearing assay with CMC as substrate at different pH values. All 11 strains produced cellulases in liquid culture with activities at alkaline pH values without an ap...

  13. Lignocellulose-based bioproducts

    CERN Document Server

    Karimi, Keikhosro

    2015-01-01

    This volume provides the technical information required for the production of biofuels and chemicals from lignocellulosic biomass. It starts with a brief overview of the importance, applications, and production processes of different lignocellulosic products. Further chapters review the perspectives of waste-based biofuels and biochemicals; the pretreatment of lignocellulosic biomass for biofuel production; cellulolytic enzyme systems for the hydrolysis of lignocelluloses; and basic and applied aspects of the production of bioethanol, biogas, biohydrogen, and biobutanol from lignocelluloses.

  14. Biohydrogen Production by the Thermophilic Bacterium Caldicellulosiruptor saccharolyticus: Current Status and Perspectives

    OpenAIRE

    Kengen, Servé W. M.; Verhaart, Marcel R. A.; John van der Oost; Abraham A. M. Bielen

    2013-01-01

    Caldicellulosiruptor saccharolyticus is one of the most thermophilic cellulolytic organisms known to date. This Gram-positive anaerobic bacterium ferments a broad spectrum of mono-, di- and polysaccharides to mainly acetate, CO2 and hydrogen. With hydrogen yields approaching the theoretical limit for dark fermentation of 4 mol hydrogen per mol hexose, this organism has proven itself to be an excellent candidate for biological hydrogen production. This review provides an overview of the resear...

  15. Production and characterization of an enzyme complex from a new strain of Clostridium thermocellum with emphasis on its xylanase activity Produção e caracterização de um complexo enzimático de uma nova linhagem de Clostridium thermocellum com enfase em sua atividade de xilanase

    OpenAIRE

    Werner Bessa Vieira; Leonora Rios de Souza Moreira; Amadeu Monteiro Neto; Edivaldo Ximenes Ferreira Filho

    2007-01-01

    A new bacterial strain (ISO II) was isolated from manure cow and identified as phylogenetically close to the thermophilic cellulolytic bacterium Clostridium thermocellum. The new strain produced extracellular xylanase, pectinase, mannanase and cellulase activities when grown in liquid culture medium containing banana stem as carbon source. The enzyme production profile after growth on banana stem showed that xylanase and cellulase activities were detected in different incubation periods. An e...

  16. Elucidation of the recognition mechanisms for hemicellulose and pectin in Clostridium cellulovorans using intracellular quantitative proteome analysis

    OpenAIRE

    Aburaya, Shunsuke; Esaka, Kohei; Morisaka, Hironobu; Kuroda, Kouichi; Ueda, Mitsuyoshi

    2015-01-01

    Clostridium cellulovorans is an anaerobic, cellulolytic bacterium, capable of effectively degrading and metabolizing various types of substrates, including cellulose, hemicellulose (xylan and galactomannan), and pectin. Among Clostridia, this ability to degrade and metabolize a wide range of hemicellulose and pectin substrates is a unique feature; however, the mechanisms are currently unknown. To clarify the mechanisms of hemicelluloses and pectin recognition and metabolism, we carried out a ...

  17. Utilization of Enzymatically Hydrolyzed Wood Hemicelluloses by Microorganisms for Production of Liquid Fuels

    OpenAIRE

    Saddler, John N.; Yu, Ernest K. C.; Mes-Hartree, Mary; Levitin, Norm; Brownell, Harold H.

    1983-01-01

    Hemicellulose-derived sugars were obtained from a variety of pretreated wood substrates such as water-soluble fractions from steam-exploded aspen, solvent-extracted aspen, and commercial xylan. These fractions were enzymatically hydrolyzed by commercial enzyme preparations and by the culture filtrates of eight highly cellulolytic fungi. The sugars released were assayed by high-pressure liquid chromatography. Over 30% of the hemicellulose fractions, at a 10% substrate concentration, could be h...

  18. Synergism in Degradation and Utilization of Intact Forage Cellulose, Hemicellulose, and Pectin by Three Pure Cultures of Ruminal Bacteria †

    OpenAIRE

    Osborne, J. M.; Dehority, B. A.

    1989-01-01

    Pure cultures of ruminal bacteria characterized as using only a single forage polysaccharide (Fibrobacter succinogenes A3c, cellulolytic; Bacteroides ruminicola H2b, hemicellulolytic; Lachnospira multiparus D15d, pectinolytic) were inoculated separately and in all possible combinations into fermentation tubes containing orchard grass as the sole substrate. Fermentations were run to completion, and then cultures were analyzed for digestion of cellulose plus degradation and utilization of hemic...

  19. Aspects of the life history strategies of the Teredinidae

    OpenAIRE

    Shipway, John Reuben

    2013-01-01

    The Teredinidae are a major economic pest of wooden coastal structures, causing billions of Dollars worth of damage per annum. To fully understand the threat posed by teredinids it is necessary to examine their biology at a number of different levels. These include: the anatomical adaptations which facilitate their wood-boring and wood- feeding life-style; the mechanism of cellulose digestion, which is aided by cellulolytic symbionts retained in bacteriocytes on the teredinid gill; the early ...

  20. Bacteriocin-resistant mutants of Erwinia chrysanthemi: possible involvement of iron acquisition in phytopathogenicity.

    Science.gov (United States)

    Expert, D; Toussaint, A

    1985-07-01

    A series of bacteriocin-resistant mutants of Erwinia chrysanthemi 3937JRH were unable to elicit soft-rot symptoms on saintpaulia plants. The loss of pathogenicity was correlated with the disappearance of one to three outer membrane polypeptides (molecular weights, about 80,000 to 90,000) whose production in wild-type strains was greatly enhanced under iron-limited growth conditions. The mutants did not exhibit altered extracellular pectinolytic or cellulolytic activities. PMID:4008442

  1. Innovative enzymes for bioethanol production from lignocellulosic materials

    OpenAIRE

    Marcolongo, Loredana

    2015-01-01

    The general aim of this work was to add new knowledge on novel hemicellulolytic enzymes involved in the hydrolysis of lignocellulosic materials, considered as a key process for the bioethanol production. Therefore, it is not only focused on (hemi)cellulolytic enzymes from mesophilic fungi and bacteria but also on newly isolated and characterized xylanase and β-xylosidase from the thermophilic bacteria Geobacillus thermodenitrificans A333 and Anoxybacillus sp. 3M, respectively. The cove...

  2. Utilisation of Cellulose Waste for the Production a Chemical Intermediate of Economic Interest

    OpenAIRE

    Rojas-Cuellar, Tania Raquel

    2015-01-01

    economic interest, by Tania R. Rojas-Cuellar, submitted to The University of Manchester for the degree of Doctor of Philosophy, 2014.Currently biomass is considered to be one of the main options to substitute the fossil fuels. Nevertheless, bioenergy is not the only alternative use for organic waste materials. In recent years, the utilisation of cellulolytic waste from industries, such as the paper industry and agriculture (in fields and in processing plants), is considered to be a good sourc...

  3. Impact of the supramolecular structure of cellulose on the efficiency of enzymatic hydrolysis

    OpenAIRE

    Peciulyte, Ausra; Karlström, Katarina; Larsson, Per Tomas; Olsson, Lisbeth

    2015-01-01

    Background The efficiency of enzymatic hydrolysis is reduced by the structural properties of cellulose. Although efforts have been made to explain the mechanism of enzymatic hydrolysis of cellulose by considering the interaction of cellulolytic enzymes with cellulose or the changes in the structure of cellulose during enzymatic hydrolysis, the process of cellulose hydrolysis is not yet fully understood. We have analysed the characteristics of the complex supramolecular structure of cellulose ...

  4. Study of enzymatic hydrolysis of pretreated biomass at increased solids loading

    OpenAIRE

    Michael Ioelovich; Ely Morag

    2012-01-01

    The effect of biomass loading from 50 to 200 g/L on enzymatic hydrolysis was studied using switchgrass samples pretreated by dilute acid and hypochlorite-alkaline methods. It was confirmed that an increase of initial loading of the pretreated biomass leads to a decrease of enzymatic digestibility, probably due to difficulty of mass transfer of cellulolytic enzymes in the high-viscous substrate slurry and also because of an inhibiting effect of the formed sugars. An additional sharp problem co...

  5. Exo-endo cellulase fusion protein

    Science.gov (United States)

    Bower, Benjamin S.; Larenas, Edmund A.; Mitchinson, Colin

    2012-01-17

    The present invention relates to a heterologous exo-endo cellulase fusion construct, which encodes a fusion protein having cellulolytic activity comprising a catalytic domain derived from a fungal exo-cellobiohydrolase and a catalytic domain derived from an endoglucanase. The invention also relates to vectors and fungal host cells comprising the heterologous exo-endo cellulase fusion construct as well as methods for producing a cellulase fusion protein and enzymatic cellulase compositions.

  6. The bacterial population adherent to plant particles in the rumen of reindeer fed lichen, timothy hay or silage

    Directory of Open Access Journals (Sweden)

    Monica Alterskjær Olsen

    1998-02-01

    Full Text Available Male reindeer (Rangifer tarandus tarandus calves taken from a natural winter pasture were given ad lib. access to lichen (n = 3, timothy silage (n = 3 and hay (n = 3 for 7 weeks. Median numbers of viable anaerobic bacteria adherent to the plant particles (cells/g wet weight of rumen solids, growing on a habitat simulating medium (M8V, were significantly higher (P = 0.05 in the rumen of reindeer fed lichen (26.5 x 109- 53.0 x 109 and hay (4.0 x 109- 40.5 x 109, compared to reindeer fed silage (1.15 x 109 - 3.25 x 109. Anaerobic bacterial strains (n = 551 from the plant particles obtained from the rumen of the nine reindeer examined, were isolated using an acid swollen cellulose medium (M8SC and tested for their ability to hydrolyse carboxymethyl cellulose (CMC. The proportion of CMC hydrolysing adherent bacteria isolated from M8SC was significantly higher in reindeer fed hay (21.5% compared ro animals fed lichen (5.3% and silage (2.7% (P = 0.05. The CMC hydrolysing bacterial srrains (n=42 isolated from reindeer fed hay where characterised as non-cellulolytic Butyrivibrio fibrisolvens (9.5%, cellulolytic B. fibrisolvens (50.0%, Clostridium sp. (2.4% and unknowns (38.1%, while CMC hydrolysing strains (n=11 isolated from animals fed lichen and strains (n=4 isolated from animals fed silage where all characterised as B. fibrisolvens. None of the bacterial strains isolated from the rumen solids of reindeer fed lichen or silage were found to be cellulolytic. This study suggests that both lichen and timothy silage have a negative influence, compared to hay, on the numbers of cellulolytic bacteria adherent to the plant particles in the rumen of reindeer.

  7. Synergistic and Dose-Controlled Regulation of Cellulase Gene Expression in Penicillium oxalicum.

    Science.gov (United States)

    Li, Zhonghai; Yao, Guangshan; Wu, Ruimei; Gao, Liwei; Kan, Qinbiao; Liu, Meng; Yang, Piao; Liu, Guodong; Qin, Yuqi; Song, Xin; Zhong, Yaohua; Fang, Xu; Qu, Yinbo

    2015-09-01

    Filamentous fungus Penicillium oxalicum produces diverse lignocellulolytic enzymes, which are regulated by the combinations of many transcription factors. Here, a single-gene disruptant library for 470 transcription factors was constructed and systematically screened for cellulase production. Twenty transcription factors (including ClrB, CreA, XlnR, Ace1, AmyR, and 15 unknown proteins) were identified to play putative roles in the activation or repression of cellulase synthesis. Most of these regulators have not been characterized in any fungi before. We identified the ClrB, CreA, XlnR, and AmyR transcription factors as critical dose-dependent regulators of cellulase expression, the core regulons of which were identified by analyzing several transcriptomes and/or secretomes. Synergistic and additive modes of combinatorial control of each cellulase gene by these regulatory factors were achieved, and cellulase expression was fine-tuned in a proper and controlled manner. With one of these targets, the expression of the major intracellular β-glucosidase Bgl2 was found to be dependent on ClrB. The Bgl2-deficient background resulted in a substantial gene activation by ClrB and proved to be closely correlated with the relief of repression mediated by CreA and AmyR during cellulase induction. Our results also signify that probing the synergistic and dose-controlled regulation mechanisms of cellulolytic regulators and using it for reconstruction of expression regulation network (RERN) may be a promising strategy for cellulolytic fungi to develop enzyme hyper-producers. Based on our data, ClrB was identified as focal point for the synergistic activation regulation of cellulase expression by integrating cellulolytic regulators and their target genes, which refined our understanding of transcriptional-regulatory network as a "seesaw model" in which the coordinated regulation of cellulolytic genes is established by counteracting activators and repressors. PMID:26360497

  8. fSpatial and temporal dynamics of cellulose degradation and biofilm formation by Caldicellulosiruptor obsidiansis and Clostridium thermocellum

    OpenAIRE

    Wang, Zhi-Wu; Lee, Seung-Hwan; Elkins, James G; Morrell-Falvey, Jennifer L.

    2011-01-01

    Cellulose degradation is one of the major bottlenecks of a consolidated bioprocess that employs cellulolytic bacterial cells as catalysts to produce biofuels from cellulosic biomass. In this study, we investigated the spatial and temporal dynamics of cellulose degradation by Caldicellulosiruptfor obsidiansis, which does not produce cellulosomes, and Clostridium thermocellum, which does produce cellulosomes. Results showed that the degradation of either regenerated or natural cellulose was syn...

  9. Complete Genome Sequence of Herbinix luporum SD1D, a New Cellulose-Degrading Bacterium Isolated from a Thermophilic Biogas Reactor.

    Science.gov (United States)

    Koeck, Daniela E; Maus, Irena; Wibberg, Daniel; Winkler, Anika; Zverlov, Vladimir V; Liebl, Wolfgang; Pühler, Alfred; Schwarz, Wolfgang H; Schlüter, Andreas

    2016-01-01

    A novel cellulolytic bacterial strain was isolated from an industrial-scale biogas plant. The 16S rRNA gene sequence of the strain SD1D showed 96.4% similarity to Herbinix hemicellulosilytica T3/55(T), indicating a novel species within the genus Herbinix (family Lachnospiraceae). Here, the complete genome sequence of Herbinix luporum SD1D is reported. PMID:27445379

  10. A study of over-production and enhanced secretion of enzymes. Quarterly report 2

    Energy Technology Data Exchange (ETDEWEB)

    Dashek, W.V.

    1993-04-08

    This project is concerned with the over-production of ligno-cellulolytic enzymes which are relevant to the paper-pulp industry and agricultural community. Since ligno-cellulosics are components of wood, the project involves the forest, a renewable energy resource. Attention is focused on the following: over-production of polyphenol oxidase; establishment of the route of polyphenol oxidase secretion; regulation of polyphenol oxidase secretion; purification of extracellular oxidase.

  11. Mechanism by which cellulose triggers cellobiohydrolase I gene expression in Trichoderma reesei.

    OpenAIRE

    el-Gogary, S; Leite, A; Crivellaro, O; Eveleigh, D E; el-Dorry, H

    1989-01-01

    The expression of cellobiohydrolase I mRNA from Trichoderma reesei, measured by Northern blot hybridization, is controlled by the nature of carbon sources used in the culture medium. Cellulose and the soluble disaccharide sophorose, but not glycerol or glucose, act as inducers. Cellobiohydrolase I mRNA was undetectable when antibodies to the major members of the cellulolytic system were present in the culture medium prior to the addition of cellulose. These antibodies had no repressive effect...

  12. Synergy in Trichoderma Reesei cellulases

    OpenAIRE

    Jepsen Kudal, Eva Rose; Ejaz, Rooshanie Nadia; Poniewierska, Julia Alicja

    2016-01-01

    Synergy has been observed between the various cellulolytic enzymes of the fungus Trichoderma Reesei. Termed cellulases, these enzymes come together to form a potent cocktail of biomass degrading enzymes. The biofuel industry has seen a recent surge partly due to the advances in attaining a more applicable understanding of the mechanisms of synergy that occur when said enzymes are used to degrade biomass into fermentable sugar. To that end, this review summarizes the various theories postulati...

  13. Production of a high-efficiency cellulase complex via β-glucosidase engineering in Penicillium oxalicum

    OpenAIRE

    Yao, Guangshan; Wu, Ruimei; Kan, Qinbiao; Gao, Liwei; Liu, Meng; Yang, Piao; Du, Jian; Li, Zhonghai; Qu, Yinbo

    2016-01-01

    Background Trichoderma reesei is a widely used model cellulolytic fungus, supplying a highly effective cellulase production system. Recently, the biofuel industry discovered filamentous fungi from the Penicillium genus as a promising alternative to T. reesei. Results In our study, we present a systematic over-expression analysis of nine β-glucosidase encoding genes in the wild-type strain 114-2 of Penicillium oxalicum. We found that the over-expression of BGL1, BGL4, or BGL5 significantly enh...

  14. Cellulose and hemicellulose decomposition by forest soil bacteria proceeds by the action of structurally variable enzymatic systems

    Science.gov (United States)

    López-Mondéjar, Rubén; Zühlke, Daniela; Becher, Dörte; Riedel, Katharina; Baldrian, Petr

    2016-01-01

    Evidence shows that bacteria contribute actively to the decomposition of cellulose and hemicellulose in forest soil; however, their role in this process is still unclear. Here we performed the screening and identification of bacteria showing potential cellulolytic activity from litter and organic soil of a temperate oak forest. The genomes of three cellulolytic isolates previously described as abundant in this ecosystem were sequenced and their proteomes were characterized during the growth on plant biomass and on microcrystalline cellulose. Pedobacter and Mucilaginibacter showed complex enzymatic systems containing highly diverse carbohydrate-active enzymes for the degradation of cellulose and hemicellulose, which were functionally redundant for endoglucanases, β-glucosidases, endoxylanases, β-xylosidases, mannosidases and carbohydrate-binding modules. Luteibacter did not express any glycosyl hydrolases traditionally recognized as cellulases. Instead, cellulose decomposition was likely performed by an expressed GH23 family protein containing a cellulose-binding domain. Interestingly, the presence of plant lignocellulose as well as crystalline cellulose both trigger the production of a wide set of hydrolytic proteins including cellulases, hemicellulases and other glycosyl hydrolases. Our findings highlight the extensive and unexplored structural diversity of enzymatic systems in cellulolytic soil bacteria and indicate the roles of multiple abundant bacterial taxa in the decomposition of cellulose and other plant polysaccharides. PMID:27125755

  15. Cellulose and hemicellulose decomposition by forest soil bacteria proceeds by the action of structurally variable enzymatic systems.

    Science.gov (United States)

    López-Mondéjar, Rubén; Zühlke, Daniela; Becher, Dörte; Riedel, Katharina; Baldrian, Petr

    2016-01-01

    Evidence shows that bacteria contribute actively to the decomposition of cellulose and hemicellulose in forest soil; however, their role in this process is still unclear. Here we performed the screening and identification of bacteria showing potential cellulolytic activity from litter and organic soil of a temperate oak forest. The genomes of three cellulolytic isolates previously described as abundant in this ecosystem were sequenced and their proteomes were characterized during the growth on plant biomass and on microcrystalline cellulose. Pedobacter and Mucilaginibacter showed complex enzymatic systems containing highly diverse carbohydrate-active enzymes for the degradation of cellulose and hemicellulose, which were functionally redundant for endoglucanases, β-glucosidases, endoxylanases, β-xylosidases, mannosidases and carbohydrate-binding modules. Luteibacter did not express any glycosyl hydrolases traditionally recognized as cellulases. Instead, cellulose decomposition was likely performed by an expressed GH23 family protein containing a cellulose-binding domain. Interestingly, the presence of plant lignocellulose as well as crystalline cellulose both trigger the production of a wide set of hydrolytic proteins including cellulases, hemicellulases and other glycosyl hydrolases. Our findings highlight the extensive and unexplored structural diversity of enzymatic systems in cellulolytic soil bacteria and indicate the roles of multiple abundant bacterial taxa in the decomposition of cellulose and other plant polysaccharides. PMID:27125755

  16. Behavior and supportive evidence of a large xylanase-containing multienzyme complex of Tepidimicrobium xylanilyticum BT14

    Directory of Open Access Journals (Sweden)

    Paripok Phitsuwan

    2012-11-01

    Full Text Available Cellular behaviors and a xylanolytic-cellulolytic enzyme system of Tepidimicrobium xylanilyticum BT14 towards xylan-rich plant biomass degradation were characterized. During the exponential growth phase, the bacterial cells were bound tightly to the growth substrate where the degradation zones appeared mostly around the cells, indicating that the xylanolytic-cellulolytic enzyme system was linked to the cell surfaces. Interestingly, several cells appeared to secrete extracellular matrix to connect to their neighbors, and the matrix disappeared when cells passed to the stationary growth phase. Cationized-ferritin staining resulted in a dense assembly of bulbs, protuberance-like structures on the growing bacterial cell surfaces. The cell-associated proteins derived by sonication contained predominated xylanase with relatively low carboxymethyl-cellulase (CMCase activities, suggesting that the xylanolytic-cellulolytic enzyme system occurred as a cell-associated enzyme. By means of gel-filtration chromatography, a high molecular mass protein with the estimated size of 2000 kDa was retrieved from the cell-associated enzymes, and it appeared as a single protein band on non-denaturing gel. However, more bands were obtained after the protein was boiled with sodium dodecyl sulfate and β-mercaptoethanol – which contained 4 xylanases and one CMCase – suggesting that these proteins were organized as a multienzyme complex (MEC in natural form. Additionally, the predominated xylanolytic MEC preferred binding to cellulose rather than xylan.

  17. Characterization of cellulases of fungal endophytes isolated from Espeletia spp.

    Science.gov (United States)

    Cabezas, Luisa; Calderon, Carolina; Medina, Luis Miguel; Bahamon, Isabela; Cardenas, Martha; Bernal, Adriana Jimena; Gonzalez, Andrés; Restrepo, Silvia

    2012-12-01

    Endophytes are microorganisms that asymptomatically invade plant tissues. They can stimulate plant growth and/or provide defense against pathogen attacks through the production of secondary metabolites. Most endophyte species are still unknown, and because they may have several applications, the study of their metabolic capabilities is essential. We characterized 100 endophytes isolated from Espeletia spp., a genus unique to the paramo ecosystem, an extreme environment in the Andean mountain range. We evaluated the cellulolytic potential of these endophytes on the saccharification of the oil palm empty fruit bunch (OPEFB). The total cellulolytic activity was measured for each endophyte on filter paper (FPA). In addition, the specific carboxymethyl cellulase (CMCase), exoglucanase, and β-glucosidase activities were determined. We found four fungi positive for cellulases. Of these fungi, Penicillium glabrum had the highest cellulolytic activity after partial purification, with maximal CMCase, exoglucanase and β-glucosidase enzyme activities of 44.5, 48.3, and 0.45 U/ml, respectively. Our data showed that the bioprospection of fungi and the characterization of their enzymes may facilitate the process of biofuel production. PMID:23274988

  18. Degradation of cellulose by basidiomycetous fungi.

    Science.gov (United States)

    Baldrian, Petr; Valásková, Vendula

    2008-05-01

    Cellulose is the main polymeric component of the plant cell wall, the most abundant polysaccharide on Earth, and an important renewable resource. Basidiomycetous fungi belong to its most potent degraders because many species grow on dead wood or litter, in environment rich in cellulose. Fungal cellulolytic systems differ from the complex cellulolytic systems of bacteria. For the degradation of cellulose, basidiomycetes utilize a set of hydrolytic enzymes typically composed of endoglucanase, cellobiohydrolase and beta-glucosidase. In some species, the absence of cellobiohydrolase is substituted by the production of processive endoglucanases combining the properties of both of these enzymes. In addition, systems producing hydroxyl radicals based on cellobiose dehydrogenase, quinone redox cycling or glycopeptide-based Fenton reaction are involved in the degradation of several plant cell wall components, including cellulose. The complete cellulolytic complex used by a single fungal species is typically composed of more than one of the above mechanisms that contribute to the utilization of cellulose as a source of carbon or energy or degrade it to ensure fast substrate colonization. The efficiency and regulation of cellulose degradation differs among wood-rotting, litter-decomposing, mycorrhizal or plant pathogenic fungi and yeasts due to the different roles of cellulose degradation in the physiology and ecology of the individual groups. PMID:18371173

  19. Cellulose and hemicellulose decomposition by forest soil bacteria proceeds by the action of structurally variable enzymatic systems

    Science.gov (United States)

    López-Mondéjar, Rubén; Zühlke, Daniela; Becher, Dörte; Riedel, Katharina; Baldrian, Petr

    2016-04-01

    Evidence shows that bacteria contribute actively to the decomposition of cellulose and hemicellulose in forest soil; however, their role in this process is still unclear. Here we performed the screening and identification of bacteria showing potential cellulolytic activity from litter and organic soil of a temperate oak forest. The genomes of three cellulolytic isolates previously described as abundant in this ecosystem were sequenced and their proteomes were characterized during the growth on plant biomass and on microcrystalline cellulose. Pedobacter and Mucilaginibacter showed complex enzymatic systems containing highly diverse carbohydrate-active enzymes for the degradation of cellulose and hemicellulose, which were functionally redundant for endoglucanases, β-glucosidases, endoxylanases, β-xylosidases, mannosidases and carbohydrate-binding modules. Luteibacter did not express any glycosyl hydrolases traditionally recognized as cellulases. Instead, cellulose decomposition was likely performed by an expressed GH23 family protein containing a cellulose-binding domain. Interestingly, the presence of plant lignocellulose as well as crystalline cellulose both trigger the production of a wide set of hydrolytic proteins including cellulases, hemicellulases and other glycosyl hydrolases. Our findings highlight the extensive and unexplored structural diversity of enzymatic systems in cellulolytic soil bacteria and indicate the roles of multiple abundant bacterial taxa in the decomposition of cellulose and other plant polysaccharides.

  20. Effect of leachate recycle and inoculation on microbial characteristics of municipal refuse in landfill bioreactors

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Population development of key groups of anaerobic and aerobic bacteria involved in municipal refuse decomposition under laboratory landfill bioreactors with and without leachate recycle adinoculation was measured since modeling municipal refuse was landfilled in bioreactors for about 210 days. Hydrolytic fermentative bacteria (HFB), hydrogen-producing acetogenic bacteria (HPAB), methane-producing bacteria (MPB), sulfate-reducing bacteria (SRB), anaerobic and aerobic cellulolytic bacteria and denitrabacteria were enumerated by the most probable number technique. The results showed that the dominant microorganismgroups were the methanogenic bacteria including hydrolytic fermentative, hydrogen-producing acetogenic and methane-producing bacteria. They were present in fresh refuse but at low values and positively affected by leachate recycle and refuse inoculation. The amounts of HFB or HPAB in digesters D4 and D5 operated with noculation and leachate recycle reached their maximum values of1010-1012 cells/g dry refuse for HFB or 105-106 cells/g dry refuse for HPAB on day 60, in digester D3 operated with leachate recycle on day 120 for HFB (109 cells/g dry refuse) or on day 90 for HPAB (105 cells/g dry refuse), and in digesters D1 and D2 on day 210 for HFB (109 cells/g dry refuse) or on day 90 for HPAB (104-106 cells/g dry refuse). The population of methane-producing bacteria in digesters D4 and D5 sharply increased on days 60 and 90 respectively, however in igesters D1, D2 and D3 on day 120. Leachate recycle and inoculation changed the cellulolytic microorganisms composition of refuse ecosystem, the higher amounts of anaerobic cellulolytic bacteria were measured in digesters D4 and D5 (107 cells/g dry refuse), followed by digesters D3 (106 cells/g dry refuse), D2 or D1(104 cells/g dry refuse). However, the amounts of aerobic cellulolytic bacteria were much lower than that of anaerobic cellulolytic bacteria. And it was higher in digester D3 than those in digesters D1, D2

  1. Taxonomic revision of Coniceromyia Borgmeier (Diptera: Phoridae), with the description of three new species from Brazil.

    Science.gov (United States)

    Ament, Danilo César; Amorim, Dalton De Souza

    2016-01-01

    The 55 known species of Coniceromyia are herein revised. Three new species from the Atlantic Forest in Brazil are described-C. apioneura, sp.nov., C. neofusca, sp.nov. and C. tanycrossa, sp.nov.-and fourteen species are redescribed. Most of the species have foreleg, wing, hind femur, and male terminalia illustrated. Characters previously unnoticed are described for the first time. Coniceromyia cubensis Brues, previously accepted as a synonym of C. latimana (Malloch), has its status reinstated. Taxonomic problems in the genus are addressed, including the condition of the damaged holotypes of C. boliviana Borgmeier and C. vespertilio Schmitz, and our inability to associate males with the female holotypes of C. arizonensis Borgmeier, C. fusca Borgmeier and C. grenadensis (Brues). The holotypes of Coniceromyia angularis Borgmeier & Prado and Coniceromyia laticosta Prado are considered to be lost. PMID:27394322

  2. Arsenic and lead contamination in soil and in feathers of three resident passerine species in a semi-arid mining region of the Mexican plateau.

    Science.gov (United States)

    Monzalvo-Santos, Karina; Alfaro-De la Torre, Ma Catalina; Chapa-Vargas, Leonardo; Castro-Larragoitia, Javier; Rodríguez-Estrella, Ricardo

    2016-08-23

    The current study aimed at quantifying arsenic and lead in feathers from three passerine species that are residents from areas exposed to mining activities (Toxostoma curvirostre, Campylorhynchus brunneicapillus, and Melozone fusca). Lead and As contents in bird feathers and in superficial soil samples were measured with AAS. Levels of these metals were compared between sites exposed and unexposed to mining. Possible correlations of As and Pb between superficial soil and bird feathers were also investigated. Soil metal concentrations were significantly higher near mining sites, and metal concentrations in bird feathers showed a behavior similar to those recorded for soil samples. Individual birds from polluted sites had higher mean feather metal concentrations in comparison with non-polluted sites; no differences in metal concentrations were recorded among bird species. This work constitutes a basis for monitoring contaminants, and for future toxicological studies attempting to understand the impact that some mining activities may have on bird populations. PMID:27220419

  3. Dicty_cDB: Contig-U16282-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , mRNA (cDNA... 159 2e-37 S53370( S53370 ;S44211) carboxylesterase (EC 3.1.1.1) B2 - souther... 159 2e-37 AF...KEN cDNA 2310038E17... 213 1e-53 CP000088_2420( CP000088 |pid:none) Thermobifida fusca YX, complete... 213 1...... 189 4e-46 AB070941_7( AB070941 |pid:none) Streptomyces avermitilis polyketid.... AY489292 |pid:none) Bombyx mori juvenile hormone ester... 150 1e-34 AB231914_1( AB231914 |pid:none) Canis l..., WORK... 42 2.4 5 ( AF503166 ) Homo sapiens xeroderma pigmentosum, complementati... 44 2.9 2 ( DX546686 ) G

  4. Kızılırmak Vadisinde Kuşları Etkileyen Olumsuz Faktörler

    Directory of Open Access Journals (Sweden)

    Ayşegül İLİKER

    2015-03-01

    Full Text Available Totally, 263 bird species were observed in the Kızılırmak valley between 2010-2012 years. Among them were 93 residents, 82 summer migrants, 51 winter migrants and 37 transit migrants. When evaluated in IUCN criteria, Egyptian vulture (Neophron percnopterus, saker falcon (Falco cherrug and velvet scoter (Melanitta fusca are endengared (EN, marbled teal (Marmaronette angustirostris, great bustard (Otis tarda and aquatic warbler (Acrocephalus paludicola are vulnareble (VU and ferruginous duck (Aythya nyroca, red kite (Milvus milvus, pallid harrier (Circus macrourus, red footed falcon (Falco vespertinus, great snipe (Gallinago media, rock partridge (Alectoris graeca, black tailed godwit (Limosa limosa, European roller (Coracias garrulus and semi collared flycatcher (Ficedula semitorquata are near threatened (NT. Among negatively affecting factors the birds, in Kızılırmak Valley; reed cutting, water regime changing, recreational activities in riverside, stubble burning, agricultural land expansion, chemical and noise pollution can be considered

  5. Dicty_cDB: Contig-U14188-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 6e-16 CP000879_1539( CP000879 |pid:none) Petrotoga mobilis SJ95, complet... 89 6e-16 Z46959_1( Z46959 |pid...quefaciens FZB4... 87 2e-15 AE008692_1139( AE008692 |pid:none) Zymomonas mobilis subsp. mobili... 87 2e-...ivorans ... 96 1e-39 CP000088_551( CP000088 |pid:none) Thermobifida fusca YX, complete ... 166 4e-39 BC00010...CP000964 |pid:none) Klebsiella pneumoniae 342, comp... 99 8e-19 AP009384_2376( AP009384 |pid:none) Azorhizobium cauli...orme PCC 73102, c... 90 3e-16 AM942759_1047( AM942759 |pid:none) Proteus mirabilis strain HI4320... 90 3e-16

  6. Dicty_cDB: Contig-U06996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 AY142891_1( AY142891 |pid:none) Heliobacillus mobilis Dephospho-Co... 93 6e-18 FN392322_502( FN392322 |pid...1034 |pid:none) Natranaerobius thermophilus JW/... 92 1e-17 CP000474_1981( CP000474 |pid:none) Arthrobacter ... CP000088 |pid:none) Thermobifida fusca YX, complete... 86 7e-16 (Q38VS6) RecName: Full=Dephospho-CoA kinase...roxidans MPO... 55 1e-06 AM942759_2031( AM942759 |pid:none) Proteus mirabilis strain HI4320... 55 1e-06 (Q5N.....................done Score E Sequences producing significant alignments: (bits) Value N ( AU269735 ) Dictyosteli

  7. Dicty_cDB: Contig-U11204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nas mobilis subsp. mobili... 40 0.17 CP000728_2340( CP000728 |pid:none) Clostridium botuli... CP000749_2832( CP000749 |pid:none) Marinomonas sp. MWYL1, complete... 115 3e-24 AM942759_2287( AM942759 |pid:none) Proteus mirabili...CP000814_754( CP000814 |pid:none) Campylobacter jejuni subsp. jeju... 45 0.009 CP000117_4283( CP000117 |pid:none) Anabaena variabili...00088_2356( CP000088 |pid:none) Thermobifida fusca YX, complete... 44 0.016 CP000241_435( CP000241 |pid:none) Helicob...**gcesskastvghhveidndrsrantrygsfei cfsntr*kvmllkelqeckckhsityigs*mpr*sifsvvq*rlcilsih***fil*eye qn*nsns--- -

  8. Dicty_cDB: Contig-U10434-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ochondrial-processing peptidase subuni... 80 3e-14 AE008692_1890( AE008692 |pid:none) Zymomonas mobilis subsp. mobili...e-23 AL591785_132( AL591785 |pid:none) Sinorhizobium meliloti 1021 comp... 110 3e-23 CP000463_4718( CP000463...37( CP001034 |pid:none) Natranaerobius thermophilus JW/... 106 4e-22 CP000908_3211( CP000908 |pid:none) Methylob...8_783( CP000088 |pid:none) Thermobifida fusca YX, complete ... 93 6e-18 CP000766_320( CP000766 |pid:none) Ri...e MTYFT1G-... 90 4e-17 CP000117_2333( CP000117 |pid:none) Anabaena variabilis ATC

  9. Revisão do gênero Mecocephala Dallas, 1851 (Heteroptera, Pentatomidae

    Directory of Open Access Journals (Sweden)

    Cristiano Feldens Schwertner

    2002-01-01

    Full Text Available Revision of the genus Mecocephala Dallas, 1851 (Heteroptera, Pentatomidae. The genus Mecocephala Dallas, 1851 is revised, and some taxonomic and geographical distribution data are evaluated. The following species are considered to belong to this genus: M. acuminata Dallas, 1851 = M. holmbergi Pirán, 1969 syn. nov., M. curculionoides Pirán, 1959, M. bonariensis sp. nov., M. magna sp. nov., M. maldonadensis sp. nov., and M. zikani sp. nov.; their distribution is restricted to southern Neotropical Region. Other species, formerly placed in Mecocephala, are considered, respectively: M. rubripes Berg, 1894 incertae sedis, M. darwini Kirkaldy, 1909 incertae sedis, M. atra Bergroth, 1914 incertae sedis, Paramecocephala uruguayensis (Pirán, 1970 comb. nov., Paramecocephala fusca (Haglund, 1868 comb. nov. A key to the species is presented.

  10. Revisão do gênero Paramecocephala Benvegnú, 1968 (Heteroptera, Pentatomidae

    Directory of Open Access Journals (Sweden)

    Angélica Frey-da-Silva

    2002-01-01

    Full Text Available Revision of the genus Paramecocephala Benvegnú, 1968 (Heteroptera, Pentatomidae. The Neotropical genus Paramecocephala Benvegnú, 1968 is revised based on morphological characters, particularly of the genitalia of both sexes. Formerly monobasic with P. foveata Benvegnú, 1968, type species, the genus received two species recently transferred from Mecocephala Dallas, 1851: M. fusca Haglund, 1868 and M. uruguayensis Pirán, 1970. Five new species are herein described: P. australis Frey-da-Silva & Grazia sp. nov., P. bachmanni Frey-da-Silva & Grazia sp. nov., P. bergrothi Frey-da-Silva & Grazia sp. nov., P. guianensis Frey-da-Silva & Grazia sp. nov. and P. subsolana Frey-da-Silva & Grazia sp. nov. Illustrations of the genitalia, a key to the species and a distribution map are provided.

  11. Phylogeny of genus Glossina (Diptera: Glossinidae) according to ITS2 sequences

    Institute of Scientific and Technical Information of China (English)

    陈小爱; 李嵩; 李昌本; 赵寿元; Aksoy; Serap

    1999-01-01

    The flies of genus Glossina (Diptera: Glossinidae) are an important vector of African trypanosomiases which cause diseases in humans and animals. The ribosomal DNA Internal Transcribed Spacer-2 (ITS-2) region sequences from different Glossina species were PCR-amplified and analyzed in order to construct a molecular phylogeny for genus Glossina. Trees generated by parsimony confirmed the monophyletic taxonomic placement of genus Glossina where fusca group species formed the deepest branch followed by morsitans and palpalis groups, respectively. The placement of Glossina austeni by both the traditional morphological and biochemical criteria has been controversial. Results presented here, based on ITS-2 locus sequence analysis, suggest that Glossina austeni can be placed into a separate subgenerus which forms a sister-group relationship with the morsitans group species.

  12. Effects of lindane on a maize ecosystem at TPRI, Arusha, Tanzania

    International Nuclear Information System (INIS)

    The effects of the organochlorine insecticide, lindane, on target and non-target organisms was studied in field plots of maize at Arusha, Tanzania for 4 growing seasons. A single application of 1 kg.ha-1 caused leaf scorch to the crop but two applications of 0.5 kg.ha-1 at an interval of 2 weeks were tolerated. The insecticide reduced damage by the stem borers Busseola fusca and Sesamia calamistis in all seasons and maize yields were higher on the treated plots although the differences were not always significant (P>0.05). Collembola and sometimes ant and spider numbers were lower in treated plots early in the season but the differences did not persist. Differences in rates of decomposition of buried leaf litter were not significant. (author). 7 refs, 4 figs, 6 tabs

  13. Diversity of plasmodial slime molds (myxomycetes in coastal, mountain, and community forests of Puerto Galera, Oriental Mindoro, the Philippines

    Directory of Open Access Journals (Sweden)

    Nikki Heherson A. Dagamac

    2015-12-01

    Full Text Available No profiling of diversity of myxomycetes has ever been conducted in one of the biodiversity hotspot areas in the Philippine archipelago, and this necessitates a swift survey of myxomycetes in Puerto Galera, Oriental Mindoro. An assessment of diversity of myxomycetes collected from seven collecting points of three different forest types in the study area showed a total of 926 records of myxomycetes. Of which, 42 morphospecies belonging to 16 genera are reported in this study. Species richness of myxomycetes was higher in collecting points that were found in inland lowland mountain forests, but the most taxonomically diverse species was found in coastal forests. Myxomycete species, namely, Arcyria cinerea, Diderma hemisphaericum, Physarum echinosporum, Lamproderma scintillans, and Stemonitis fusca, were found in all the collecting points. Manmade disturbances and forest structure may affect the occurrence of myxomycetes.

  14. Les foreurs du maïs en Côte d'Ivoire : vers une protection intégrée

    OpenAIRE

    Moyal, Pascal

    1998-01-01

    Les insectes foreurs de tige et d'épi sont des ravageurs majeurs du maïs en Côte d'Ivoire. Trois espèces, appartenant à l'ordre des Lépidoptères, représentant un réel danger pour les maïsiculteurs : deux foreurs de tige, #Eldana saccharina$ Walker (#Pyralidae$) et #Busseola fusca$ (Fuller) (#Nocturidae$), et un foreur d'épi, #Mussidia nigrivenella$ Ragonot (#Pyralidae$). L'étude de l'abondance de ces espèces dans les diverses régions du pays et au cours des cycles de culture successifs a mont...

  15. Dicty_cDB: Contig-U05819-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4_1( A93824 |pid:none) Sequence 3 from Patent WO9729194. 58 3e-07 AB183698_1( AB183698 |pid:none) Cannabis s...... 56 1e-06 AB292684_1( AB292684 |pid:none) Cannabis sativa CBDAS3 mRNA for ca... 56 1e-06 FB863225_1( FB86... AY610511_1( AY610511 |pid:none) Thalictrum flavum subsp. glaucum b... 55 3e-06 AB292683_1( AB292683 |pid:none) Cannabis...0 genomic... 53 1e-05 AB212833_1( AB212833 |pid:none) Cannabis sativa gene for tetrahydr... 53 1e-05 AF36486...58( CP000088 |pid:none) Thermobifida fusca YX, complete g... 53 1e-05 AB212830_1( AB212830 |pid:none) Cannabis

  16. A species pair of Bivesicula Yamaguti, 1934 (Trematoda: Bivesiculidae) in unrelated Great Barrier Reef fishes: implications for the basis of speciation in coral reef fish trematodes.

    Science.gov (United States)

    Trieu, Nancy; Cutmore, Scott C; Miller, Terrence L; Cribb, Thomas H

    2015-07-01

    Combined morphological and molecular analysis shows that a species of Bivesicula Yamaguti, 1934 from four species of Apogonidae Günther [Nectamia fusca (Quoy & Gaimard), Ostorhinchus angustatus (Smith & Radcliffe), O. cookii (Macleay) and Taeniamia fucata (Cantor)] on the Great Barrier Reef is morphologically similar to, but clearly distinct from B. unexpecta Cribb, Bray & Barker, 1994 which infects a sympatric pomacentrid, Acanthochromis polyacanthus (Bleeker). Bivesicula neglecta n. sp. is proposed for the form from apogonids. Novel ITS2 rDNA sequences generated for the two species differ at just one consistent base position, implying that the two species are closely related. The combination of their close relationship, high but distinct specificity and co-occurrence suggests that speciation was driven by a recent host switching event enabled by similar dietary ecomorphology. PMID:26063300

  17. Dicty_cDB: Contig-U01509-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.5 CU207211_1706( CU207211 |pid:none) Herminiimonas arsenicoxydans ch... 35 4.5 CP000677_289( CP000677 |pid...ubique ... 36 2.6 CP000088_160( CP000088 |pid:none) Thermobifida fusca YX, complete ... 35 3.4 (Q8FCT4) RecName: Full=Carboxyles...450 |pid:none) Mycoplasma gallisepticum strain ... 34 7.6 CP000449_1137( CP000449 |pid:none) Maricaulis mari...gth = 1063 Score = 1279 bits (645), Expect = 0.0 Identities = 645/645 (100%) Strand = Plus / Plus Query: 339 ccca... 56.0 bits (28), Expect = 1e-07 Identities = 28/28 (100%) Strand = Plus / Plus Query: 1 gttgttgctcactctcataatca

  18. Dicty_cDB: Contig-U16411-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 001654_2804( CP001654 |pid:none) Dickeya dadantii Ech703, comple... 330 e-110 CP000088_198( CP000088 |pid:none) Thermobifida fusca...:none) Proteus mirabilis strain HI4320,... 329 e-111 DQ387867_3( DQ387867 |pid:none) Methanohal...E... 323 e-107 AP008232_584( AP008232 |pid:none) Sodalis glossinidius str. 'morsi... 331 e-107 CP000850_119( CP000850 |pid:none) Sali...nispora arenicola CNS-205, c... 302 e-107 FM178379_666( FM178379 |pid:none) Aliivibrio salmonicida...Shigella flexneri 2a str. 301, ... 323 e-107 CP000667_121( CP000667 |pid:none) Salinispora tropica CNB-440,

  19. Dicty_cDB: Contig-U16041-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-09 AK030031_1( AK030031 |pid:none) Mus musculus adult male testis cDN... 66 4e-09 ( P31254 ) RecName: Full=Ubiquitin-like modifier...plysi... 32 3.1 2 ( BJ326447 ) Dictyostelium discoideum cDNA clone:dda16c17, 5' ... 36 3.1 3 ( AJ235273 ) Rickettsia prowaze...mobifida fusca YX, complete ... 57 3e-06 AE008384_1533( AE008384 |pid:none) Methanosarcina mazei...Bos taurus ubiquitin-like modifier... 55 1e-05 AM746676_3862( AM746676 |pid:none) Sorangium cellulosum 'So c...63( CP000561 |pid:none) Pyrobaculum calidifontis JCM 115... 52 7e-05 CP000863_564( CP000863 |pid:none) Acinetobacter bauma

  20. Palynology of predominantly Last Glaciation sediments from the Mangaroa Drillhole, Hutt Valley, New Zealand

    International Nuclear Information System (INIS)

    Spores and pollen recovered from about 40 m of sediment in a drillhole in the Mangaroa Valley, a tributary of the Hutt Valley, Wellington, indicates that the sediments are predominantly of Last Glaciation age topped by about 4 m of Holocene and modern fill. Two glacial episodes, the Last Glaciation and a much older glaciation, separated by a disconformity, are represented in the drillhole. The pollen samples are in close proximity to two tephras - the Kawakawa Tephra at a depth of 9.2 m, and the Rangitawa Tephra (locally called the Mangaroa Ash) at 38.4 m. These tephras indicate an age of c. 350,000 years for the base, and c. 22,600 years for about the top 8 m. The sediment above the Rangitawa Tephra has been zoned according to the predominant pollen types derived from woody vegetation. The zonation indicates that changes occurred from Nothofagus fusca type above the disconformity, through Phyllocladus (?alpinus) to Nothofagus menziesii, back to Phyllocladus, and finally to Dacrydium cupressinum at the base of the Holocene. Apart from the mid to basal Holocene sample, all samples are dominated by pollen from herbaceous plants, especially grasses, sedges, and occasional rushes. This sequence is similar to sequences identified in Last Glaciation sediments from previous drillholes in the Wellington area and suggests that all productive sediments below the Holocene at Mangaroa represent the Last Glaciation. Although there is the possibility that the boundaries between the pollen zones may be small disconformities, it is likely that only two major breaks occur, both within a metre or so of the top of the two tephras at the upper limits of the Nothofagus fusca and the upper Phyllocladus zones, respectively. This suggests that the sediments represent deposition from only the mid to late Holocene, the Last Glaciation, and the Nemona Glaciation, or an earlier unnamed glaciation. Pollen samples from the latter do not contain palynomorphs.(author). 43 refs., 2 figs., 2 tabs

  1. Acid epimerization of 20-keto pregnane glycosides is determined by 2D-NMR spectroscopy.

    Science.gov (United States)

    García, Víctor P

    2011-05-01

    Carbohydrates influence many essential biological events such as apoptosis, differentiation, tumor metastasis, cancer, neurobiology, immunology, development, host-pathogen interactions, diabetes, signal transduction, protein folding, and many other contexts. We now report on the structure determination of pregnane glycosides isolated from the aerial parts of Ceropegia fusca Bolle (Asclepiadaceae). The observation of cicatrizant, vulnerary and cytostatic activities in some humans and animals of Ceropegia fusca Bolle, a species endemic to the Canary Islands, encouraged us to begin a pharmacological study to determine their exact therapeutic properties. High resolution (1)H-NMR spectra of pregnane glycosides very often display well-resolved signals that can be used as starting points in several selective NMR experiments to study scalar (J coupling), and dipolar (NOE) interactions. ROESY is especially suited for molecules such that ωτ(c) ~ 1, where τ(c) are the motional correlation times and ω is the angular frequency. In these cases the NOE is nearly zero, while the rotating-frame Overhauser effect spectroscopy (ROESY) is always positive and increases monotonically for increasing values of τ(c). The ROESY shows dipolar interactions cross peaks even in medium-sized molecules which are helpful in unambiguous assignment of all the interglycosidic linkages. Selective excitation was carried out using a double pulsed-field gradient spin-echo sequence (DPFGSE) in which 180° Gaussian pulses are sandwiched between sine shaped z-gradients. Scalar interactions were studied by homonuclear DPFGSE-COSY and DPFGSE-TOCSY experiments, while DPFGSE-ROESY was used to monitor the spatial environment of the selectively excited proton. Dipolar interactions between nuclei close in space can be detected by the 1D GROESY experiment, which is a one-dimensional counterpart of the 2D ROESY method. The C-12 and C-17 configurations were determined by ROESY experiments. PMID:21431831

  2. Acid epimerization of 20-keto pregnane glycosides is determined by 2D-NMR spectroscopy

    International Nuclear Information System (INIS)

    Carbohydrates influence many essential biological events such as apoptosis, differentiation, tumor metastasis, cancer, neurobiology, immunology, development, host-pathogen interactions, diabetes, signal transduction, protein folding, and many other contexts. We now report on the structure determination of pregnane glycosides isolated from the aerial parts of Ceropegia fusca Bolle (Asclepiadaceae). The observation of cicatrizant, vulnerary and cytostatic activities in some humans and animals of Ceropegia fusca Bolle, a species endemic to the Canary Islands, encouraged us to begin a pharmacological study to determine their exact therapeutic properties. High resolution 1H-NMR spectra of pregnane glycosides very often display well-resolved signals that can be used as starting points in several selective NMR experiments to study scalar (J coupling), and dipolar (NOE) interactions. ROESY is especially suited for molecules such that ωτc ∼ 1, where τc are the motional correlation times and ω is the angular frequency. In these cases the NOE is nearly zero, while the rotating-frame Overhauser effect spectroscopy (ROESY) is always positive and increases monotonically for increasing values of τc. The ROESY shows dipolar interactions cross peaks even in medium-sized molecules which are helpful in unambiguous assignment of all the interglycosidic linkages. Selective excitation was carried out using a double pulsed-field gradient spin-echo sequence (DPFGSE) in which 180° Gaussian pulses are sandwiched between sine shaped z-gradients. Scalar interactions were studied by homonuclear DPFGSE-COSY and DPFGSE-TOCSY experiments, while DPFGSE-ROESY was used to monitor the spatial environment of the selectively excited proton. Dipolar interactions between nuclei close in space can be detected by the 1D GROESY experiment, which is a one-dimensional counterpart of the 2D ROESY method. The C-12 and C-17 configurations were determined by ROESY experiments.

  3. Fossil cladoceran record from Lake Piramide Inferiore (5067 m asl in the Nepalese Himalayas: biogeographical and paleoecological implications

    Directory of Open Access Journals (Sweden)

    Liisa Nevalainen

    2014-04-01

    Full Text Available We investigated 2500 years of community succession in Cladocera from the sediments of a mountain lake (Lake Piramide Inferiore located in the Khumbu Valley close to Mt. Everest in the Nepalese Himalayas. Our objective was to determine late Holocene changes in cladoceran species composition and abundance in a biogeographical context and with respect to previous proxy-based paleolimnological data (algal pigments and organic content. The results suggested that cladoceran fauna of Lake Piramide Inferiore was species-poor and dominated by Chydorus cf. sphaericus throughout the sequence. The sediment profile recorded the occurrence of Alona guttata type individuals, which were attributed to Alona werestschagini Sinev 1999 based on their morphology and the species' current distributional range, and this was the first record of its presence in the Himalayas. In addition, a periodic long-term succession of melanic Daphnia (Ctenodaphnia fusca Gurney, 1907 and non-melanic D. (Daphnia dentifera Forbes 1893 was observed in the sediments. The millennia-long cladoceran community changes, although subtle due to the C. cf. sphaericus dominance, were in general agreement with the previous proxy-data of lake productivity following the regional paleoclimatic development and apparently partly driven by bottom-up mechanisms. The periodic occurrence and success of D. fusca and D. dentifera throughout the late Holocene in Lake Piramide Inferiore, combined with the knowledge of their phenotypic properties (i.e. carapace melanization and previous investigations on their contemporary and past distribution in Khumbu Valley, suggested that they may have responded to altered underwater UV radiation regimes. Furthermore, they may have even periodically excluded each other subsequent to changes in the underwater UV environment. The results indicated the usefulness of fossil cladoceran analysis as a tool in biogeographical research, since the occurrence of species in space and

  4. New xenophytes from Gran Canaria (Canary Islands, Spain, with emphasis on naturalized and (potentially invasive species

    Directory of Open Access Journals (Sweden)

    Verloove, F.

    2013-12-01

    Full Text Available Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum chrysotrichum, Tecoma stans, Tipuana tipu, Urochloa mutica, U. plantaginea y Washingtonia se citan por primera vez para las Islas Canarias, mientras que Alopecurus myosuroides, Amaranthus blitoides, Bothriochloa ischaemum var. songarica, Cardamine flexuosa subsp. debilis, Heliotropium curassavicum, Leonotis nepetifolia, Medicago lupulina, Parkinsonia aculeata, Physalis peruviana, Phytolacca americana y Turnera ulmifolia son nuevas para la flora de la isla de Gran Canaria. Finalmente, se confirma la presencia de Paspalum vaginatum, P. distichum y Cortaderia selloana en Gran Canaria.Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum

  5. Acid epimerization of 20-keto pregnane glycosides is determined by 2D-NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Victor P., E-mail: vpergarw@gobiernodecanarias.org [Instituto de Productos Naturales de Canarias, Departamento de Quimica de Productos Naturales y Biotecnologia (Spain)

    2011-05-15

    Carbohydrates influence many essential biological events such as apoptosis, differentiation, tumor metastasis, cancer, neurobiology, immunology, development, host-pathogen interactions, diabetes, signal transduction, protein folding, and many other contexts. We now report on the structure determination of pregnane glycosides isolated from the aerial parts of Ceropegia fusca Bolle (Asclepiadaceae). The observation of cicatrizant, vulnerary and cytostatic activities in some humans and animals of Ceropegia fusca Bolle, a species endemic to the Canary Islands, encouraged us to begin a pharmacological study to determine their exact therapeutic properties. High resolution {sup 1}H-NMR spectra of pregnane glycosides very often display well-resolved signals that can be used as starting points in several selective NMR experiments to study scalar (J coupling), and dipolar (NOE) interactions. ROESY is especially suited for molecules such that {omega}{tau}{sub c} {approx} 1, where {tau}{sub c} are the motional correlation times and {omega} is the angular frequency. In these cases the NOE is nearly zero, while the rotating-frame Overhauser effect spectroscopy (ROESY) is always positive and increases monotonically for increasing values of {tau}{sub c}. The ROESY shows dipolar interactions cross peaks even in medium-sized molecules which are helpful in unambiguous assignment of all the interglycosidic linkages. Selective excitation was carried out using a double pulsed-field gradient spin-echo sequence (DPFGSE) in which 180 Degree-Sign Gaussian pulses are sandwiched between sine shaped z-gradients. Scalar interactions were studied by homonuclear DPFGSE-COSY and DPFGSE-TOCSY experiments, while DPFGSE-ROESY was used to monitor the spatial environment of the selectively excited proton. Dipolar interactions between nuclei close in space can be detected by the 1D GROESY experiment, which is a one-dimensional counterpart of the 2D ROESY method. The C-12 and C-17 configurations were

  6. MOLECULAR TYPING OF Giardia duodenalis ISOLATES FROM NONHUMAN PRIMATES HOUSED IN A BRAZILIAN ZOO

    Directory of Open Access Journals (Sweden)

    Erica Boarato David

    2014-01-01

    Full Text Available Giardia infections in captive nonhuman primates (NHP housed at a Brazilian zoo were investigated in order to address their zoonotic potential. Fresh fecal samples were collected from the floors of 22 enclosures where 47 primates of 18 different species were housed. The diagnosis of intestinal parasites after concentration by sedimentation and flotation methods revealed the following parasites and their frequencies: Giardia (18%; Entamoeba spp. (18%; Endolimax nana (4.5%; Iodamoeba spp. (4.5%; Oxyurid (4.5% and Strongylid (4.5%. Genomic DNA extracted from all samples was processed by PCR methods in order to amplify fragments of gdh and tpi genes of Giardia. Amplicons were obtained from samples of Ateles belzebuth, Alouatta caraya, Alouatta fusca and Alouatta seniculus. Clear sequences were only obtained for the isolates from Ateles belzebuth (BA1, Alouatta fusca (BA2 and Alouatta caraya (BA3. According to the phenetic analyses of these sequences, all were classified as assemblage A. For the tpi gene, all three isolates were grouped into sub-assemblage AII (BA1, BA2 and BA3 whereas for the gdh gene, only BA3 was sub-assemblage AII, and the BA1 and BA2 were sub-assemblage AI. Considering the zoonotic potential of the assemblage A, and that the animals of the present study show no clinical signs of infection, the data obtained here stresses that regular coproparasitological surveys are necessary to implement preventive measures and safeguard the health of the captive animals, of their caretakers and of people visiting the zoological gardens.

  7. Evaluación del estado de conservación de las microcuencas pertenecientes a los Cerros Orientales de Chía, Cundinamarca, Colombia

    Directory of Open Access Journals (Sweden)

    Arévalo Santos Carolina

    2006-06-01

    Full Text Available El trabajo se realizó en colaboración con la Alcaldía Municipal de Chía, Cundinamarca, Colombia, con el fin de
    aproximarnos al estado de conservación de las microcuencas localizadas sobre la cota de altitud 2.600-3.200 msnm, en las veredas de Yerbabuena y Fusca, donde se identificaron cuatro microcuencas de interés: Mana- Yerbabuena, Coseteja, Fusca y Honda-Pan de Azúcar. El documento final se presenta como un instrumento para el conocimiento de los cerros Orientales de Chía a una escala municipal, cuyo enfoque establece los diferentes tipos de cobertura de vegetación existentes como indicador del estado actual de las microcuencas y evidencia situaciones críticas que pueden propiciar su total degradación. Los resultados permiten concluir que los procesos de transformación son bastante intensos, debido básicamente a la acción antrópica que ha hecho de los procesos urbanísticos el factor de amenaza más significativo, que ha conducido a la pérdida acelerada de la vegetación, apertura de vías de acceso, uso inadecuado de las fuentes hídricas etc. El producto principal de este  análisis es la generación de un mapa de áreas de interés ambiental que proponemos deben ser proyectadas ya sea
    para fines de conservación, restauración, recuperación y áreas cuyo manejo de conflictos debe ser prioridad. La
    importancia de establecer el estado de conservación deriva de la necesidad de proporcionar bases para el desarrollo de planes de manejo ambiental.

  8. Characteristics of the production of underground fruits and seed dispersal of Crocus alatavicus, a geophytic-geocarpic species

    Directory of Open Access Journals (Sweden)

    Ziyan Fu

    2013-09-01

    Full Text Available Geophytic-geocarpy is a special type of fruit production in angiosperms, whereby flowers with a long tubular perianth arise from underground buds and bloom above ground with the ovary and subsequent fruit remaining below ground. Crocus alatavicus, a geophytic-geocarpic species, is a perennial early-spring ephemeral that grows in subalpine areas of the western Tianshan Mountains. Based on field observations and controlled experiments, development of the underground ovaries and young fruits and seed dispersal were investigated for C. alatavicus and their adaptive significance analyzed. The results showed that developmental time from flowering to emergence of the underground capsules above the soil was about 35 days, and emergence of the underground capsules results from elongation of the peduncles, and then capsules dehisce and seeds are dispersed. Seeds of C. alatavicus have an elaiosome, which is typical of myrmecochores. Ants make a significant contribution to seed dispersal, and three ant species, Formica pressilabris, F. gagates and F. fusca, were recorded near newly-dispersed seeds of C. alatavicus. The visiting frequency of F. pressilabris was the highest, but F. fusca removed seeds faster and to a greater distance than the other two species. The average dispersal distance of the three ant species was 62.4±1.7 cm. Formica pressilabris, the major ant species taking seeds, ate the elaiosome after it moved the seeds into its nest and then stored more than 50% of the transported seeds in the nest. Rodents and birds had no effect on seed dispersal of C. alatavicus, but hydrophily and anemophily played a minor role in short-distance dispersal. Formation of seeds underground and their dispersal by ants help ensure that seeds escape damage from herbivores and fire and that they are dispersed in a manner that reduces sib-competition and competition between mother plant and offspring, thereby ensuring seed germination and seedling establishment in

  9. Molecular typing of Giardia duodenalis isolates from nonhuman primates housed IN a Brazilian zoo.

    Science.gov (United States)

    David, Érica Boarato; Patti, Mariella; Coradi, Silvana Torossian; Oliveira-Sequeira, Teresa Cristina Goulart; Ribolla, Paulo Eduardo Martins; Guimarães, Semíramis

    2014-01-01

    Giardia infections in captive nonhuman primates (NHP) housed at a Brazilian zoo were investigated in order to address their zoonotic potential. Fresh fecal samples were collected from the floors of 22 enclosures where 47 primates of 18 different species were housed. The diagnosis of intestinal parasites after concentration by sedimentation and flotation methods revealed the following parasites and their frequencies: Giardia (18%); Entamoeba spp. (18%); Endolimax nana (4.5%); Iodamoeba spp. (4.5%); Oxyurid (4.5%) and Strongylid (4.5%). Genomic DNA extracted from all samples was processed by PCR methods in order to amplify fragments of gdh and tpi genes of Giardia. Amplicons were obtained from samples of Ateles belzebuth, Alouatta caraya, Alouatta fusca and Alouatta seniculus. Clear sequences were only obtained for the isolates from Ateles belzebuth (BA1), Alouatta fusca (BA2) and Alouatta caraya (BA3). According to the phenetic analyses of these sequences, all were classified as assemblage A. For the tpi gene, all three isolates were grouped into sub-assemblage AII (BA1, BA2 and BA3) whereas for the gdh gene, only BA3 was sub-assemblage AII, and the BA1 and BA2 were sub-assemblage AI. Considering the zoonotic potential of the assemblage A, and that the animals of the present study show no clinical signs of infection, the data obtained here stresses that regular coproparasitological surveys are necessary to implement preventive measures and safeguard the health of the captive animals, of their caretakers and of people visiting the zoological gardens. PMID:24553608

  10. Defining the genome-wide role of CRE1 during carbon catabolite repression in Trichoderma reesei using RNA-Seq analysis.

    Science.gov (United States)

    Antoniêto, Amanda Cristina Campos; dos Santos Castro, Lílian; Silva-Rocha, Rafael; Persinoti, Gabriela Felix; Silva, Roberto Nascimento

    2014-12-01

    The ascomycete Trichoderma reesei is one of the most well-studied cellulolytic fungi and is widely used by the biotechnology industry in the production of second generation bioethanol. The carbon catabolite repression (CCR) mechanism adopted by T. reesei is mediated by the transcription factor CRE1. CCR represses genes related to cellulase production when a carbon source is readily available in the medium. Using RNA sequencing, we investigated CCR during the synthesis of cellulases, comparing the T. reesei Δcre1 mutant strain with its parental strain, QM9414. Of 9129 genes in the T. reesei genome, 268 genes were upregulated and 85 were downregulated in the presence of cellulose (Avicel). In addition, 251 genes were upregulated and 230 were downregulated in the presence of a high concentration of glucose. Genes encoding cellulolytic enzymes and transcription factors and genes related to the transport of nutrients and oxidative metabolism were also targets of CCR, mediated by CRE1 in a carbon source-dependent manner. Our results also suggested that CRE1 regulates the expression of genes related to the use of copper and iron as final electron acceptors or as cofactors of enzymes that participate in biomass degradation. As a result, the final effect of CRE1-mediated transcriptional regulation is to modulate the access of cellulolytic enzymes to cellulose polymers or blocks the entry of cellulase inducers into the cell, depending on the glucose content in the medium. These results will contribute to a better understanding of the mechanism of carbon catabolite repression in T. reesei, thereby enhancing its application in several biotechnology fields. PMID:25459535

  11. Saccharification of Sugarcane Bagasse by Enzymatic Treatment for bioethanol production

    Directory of Open Access Journals (Sweden)

    Ahmed, F. M.

    2012-06-01

    Full Text Available Aims: The escalating demands for traditional fossil fuels with unsecured deliverance and issues of climate change compel the researchers to develop alternative fuels like bioethanol. This study examines the prospect of biofuel production from high carbohydrate containing lignocellulosic material, e.g. sugarcane bagasse through biological means. Methodology and Results: Cellulolytic enzymes were collected from the culture filtrate of thermotolerant Trichodermaviride grown on variously pre-treated sugarcane bagasse. CMCase and FPase enzyme activities were determined as a measure of suitable substrate pre-treatment and optimum condition for cellulolytic enzyme production. The highest CMCase and FPase activity was found to be 1.217 U/ml and 0.109 U/ml respectively under the production conditions of 200 rpm, pH 4.0 and 50 °C using steamed NaOH treated bagasse as substrate. SEM was carried out to compare and confirm the activity of cellulolytic enzymes on sugarcane bagasse. Saccharification of pre-treated bagasse was carried out with crude enzymes together using a two-factor experimental design. Under optimized conditions the pre-treated bagasse was saccharified up to 42.7 % in 24 h. The hydrolysate was concentrated by heating to suitable concentration and then used for fermentation by an indigenous isolate of Saccharomyces cerevisiae. With 50 and 80 % brix containing liquor the concentration of alcohol was 0.579 % and 1.15 % respectively. Conclusion, significance and impact of study: This is the first report in Bangladesh for the production of cellulosicethanol using local isolates. Though the rate of alcohol production was very low, a great impetus in this field can maximize the production thereby meet the demand for fuel in future.

  12. Complete genome of the cellyloytic thermophile Acidothermus cellulolyticus 11B provides insights into its ecophysiological and evloutionary adaptations

    Energy Technology Data Exchange (ETDEWEB)

    Barabote, Ravi D.; Xie, Gary; Leu, David H.; Normand, Philippe; Necsulea, Anamaria; Daubin, Vincent; Medigue, Claudine; Adney, William S.; Xu,Xin Clare; Lapidus, Alla; Detter, Chris; Pujic, Petar; Bruce, David; Lavire, Celine; Challacombe, Jean F.; Brettin, Thomas S.; Berry, Alison M.

    2009-01-01

    We present here the complete 2.4 Mb genome of the cellulolytic actinobacterial thermophile, Acidothermus cellulolyticus 11B. New secreted glycoside hydrolases and carbohydrate esterases were identified in the genome, revealing a diverse biomass-degrading enzyme repertoire far greater than previously characterized, and significantly elevating the industrial value of this organism. A sizable fraction of these hydrolytic enzymes break down plant cell walls and the remaining either degrade components in fungal cell walls or metabolize storage carbohydrates such as glycogen and trehalose, implicating the relative importance of these different carbon sources. A novel feature of the A. cellulolyticus secreted cellulolytic and xylanolytic enzymes is that they are fused to multiple tandemly arranged carbohydrate binding modules (CBM), from families 2 and 3. Interestingly, CBM3 was found to be always N-terminal to CBM2, suggesting a functional constraint driving this organization. While the catalytic domains of these modular enzymes are either diverse or unrelated, the CBMs were found to be highly conserved in sequence and may suggest selective substrate-binding interactions. For the most part, thermophilic patterns in the genome and proteome of A. cellulolyticus were weak, which may be reflective of the recent evolutionary history of A. cellulolyticus since its divergence from its closest phylogenetic neighbor Frankia, a mesophilic plant endosymbiont and soil dweller. However, ribosomal proteins and non-coding RNAs (rRNA and tRNAs) in A. cellulolyticus showed thermophilic traits suggesting the importance of adaptation of cellular translational machinery to environmental temperature. Elevated occurrence of IVYWREL amino acids in A. cellulolyticus orthologs compared to mesophiles, and inverse preferences for G and A at the first and third codon positions also point to its ongoing thermoadaptation. Additional interesting features in the genome of this cellulolytic, hot

  13. In Situ Production of Branched Glycerol Dialkyl Glycerol Tetraethers in a Great Basin Hot Spring (USA

    Directory of Open Access Journals (Sweden)

    ChuanlunZhang

    2013-07-01

    Full Text Available Branched glycerol dialkyl glycerol tetraethers (bGDGTs are predominantly found in soils and peat bogs. In this study, we analyzed core-bGDGTs and polar (P- bGDGTs after hydrolysis of polar fractions using liquid chromatography-atmospheric pressure chemical ionization-mass spectrometry and analyzed intact P-bGDGTs using total lipid extract (TLE without hydrolysis by liquid chromatography-electrospray ionization-multiple stage mass spectrometry. Our results show multiple lines of evidence for the production of bGDGTs in sediments and cellulolytic enrichments in a hot spring (62-86°C in the Great Basin (USA. First, in situ cellulolytic enrichment led to an increase in the relative abundance of hydrolysis-derived P-bGDGTs over their Core (C-bGDGT counterparts. Second, the hydrolysis-derived P- and C-bGDGT profiles in the hot spring were different from those of the surrounding soil samples; in particular, a monoglycosidic bGDGT Ib containing 13,16-dimethyloctacosane and one cyclopentane moiety was detected in the TLE but it was undetectable in surrounding soil samples even after sample enrichments. Third, previously published 16S rRNA gene pyrotag analysis from the same lignocellulose samples demonstrated the enrichment of thermophiles, rather than mesophiles, and total bGDGT abundance in cellulolytic enrichments correlated with the relative abundance of 16S rRNA gene pyrotags from thermophilic bacteria in the phyla Bacteroidetes, Dictyoglomi, EM3, and OP9 (“Atribacteria”. These observations conclusively demonstrate the production of bGDGTs in this hot spring; however, the identity of organisms that produce bGDGTs in the geothermal environment remains unclear.

  14. Unravelling the molecular basis for light modulated cellulase gene expression - the role of photoreceptors in Neurospora crassa

    Directory of Open Access Journals (Sweden)

    Schmoll Monika

    2012-03-01

    Full Text Available Abstract Background Light represents an important environmental cue, which exerts considerable influence on the metabolism of fungi. Studies with the biotechnological fungal workhorse Trichoderma reesei (Hypocrea jecorina have revealed an interconnection between transcriptional regulation of cellulolytic enzymes and the light response. Neurospora crassa has been used as a model organism to study light and circadian rhythm biology. We therefore investigated whether light also regulates transcriptional regulation of cellulolytic enzymes in N. crassa. Results We show that the N. crassa photoreceptor genes wc-1, wc-2 and vvd are involved in regulation of cellulase gene expression, indicating that this phenomenon is conserved among filamentous fungi. The negative effect of VVD on production of cellulolytic enzymes is thereby accomplished by its role in photoadaptation and hence its function in White collar complex (WCC formation. In contrast, the induction of vvd expression by the WCC does not seem to be crucial in this process. Additionally, we found that WC-1 and WC-2 not only act as a complex, but also have individual functions upon growth on cellulose. Conclusions Genome wide transcriptome analysis of photoreceptor mutants and evaluation of results by analysis of mutant strains identified several candidate genes likely to play a role in light modulated cellulase gene expression. Genes with functions in amino acid metabolism, glycogen metabolism, energy supply and protein folding are enriched among genes with decreased expression levels in the wc-1 and wc-2 mutants. The ability to properly respond to amino acid starvation, i. e. up-regulation of the cross pathway control protein cpc-1, was found to be beneficial for cellulase gene expression. Our results further suggest a contribution of oxidative depolymerization of cellulose to plant cell wall degradation in N. crassa.

  15. DECENTRALIZED THERMOPHILIC BIOHYDROGEN: A MORE EFFICIENT AND COST EFFECTIVE PROCESS

    Directory of Open Access Journals (Sweden)

    Rajesh K. Sani

    2011-11-01

    Full Text Available Nonfood lignocellulosic biomass is an ideal substrate for biohydrogen production. By avoiding pretreatment steps (acid, alkali, or enzymatic, there is potential to make the process economical. Utilization of regional untreated lignocellulosic biomass by cellulolytic and fermentative thermophiles in a consolidated mode using a single reactor is one of the ways to achieve economical and sustainable biohydrogen production. Employing these potential microorganisms along with decentralized biohydrogen energy production will lead us towards regional and national independence having a positive influence on the bioenergy sector.

  16. Ability of some species of fungi of the Basidiomycetes class to degrade cellulose and lignocellulose substrates

    Directory of Open Access Journals (Sweden)

    Zdzisław Tagoński

    2014-08-01

    Full Text Available Studies were carried-out on the ability of 18 strains of 15 white-rot and brown-rot basidiomycetons fungi to degrade wood components and to synthesize cellulolytic enzymes and laccase. 28,5% lignin and 26,1% carbohydrates of pine wood meal, 46,2% lignin and 67,8% carbohydrates of beech wood meal was degraded after 6 weeks incubation by the white-rot fungus Phanerochate chrysosporium. The highest activity of laccase was obtained in from fungi Coriotus zonatus and Fomes fomentarius.

  17. Microwave Influence in Fungi a Preliminary Study

    International Nuclear Information System (INIS)

    The behavior of two cellulolytic fungus species under the influence of low intensity microwaves was studied: Chaetomium globosum and Alternaria alternata. Enzyme activity of dehydrogenase complex was investigated by spectrophotometric method in order to real the effect of relatively short daily exposure times. Inhibitory effect was noticed for malate dehydrogenase and succinate dehydrogenase in both fungi while differentiated influence was revealed in alpha ceto glutarate dehydrogenase (inhibitory in Chaetomium globosum but stimulatory in Alternaria alternata). Isocitrate dehydrogenase activity was significantly stimulated in both fungi for 3 hours exposure time. (Author) 15 refs

  18. Microwave Influence in Fungi a Preliminary Study

    Energy Technology Data Exchange (ETDEWEB)

    Manoliu, A. I.; Tufescu, F. M.; Oprica, L.; Olteanu, Z.; Creanga, D. E.

    2004-07-01

    The behavior of two cellulolytic fungus species under the influence of low intensity microwaves was studied: Chaetomium globosum and Alternaria alternata. Enzyme activity of dehydrogenase complex was investigated by spectrophotometric method in order to real the effect of relatively short daily exposure times. Inhibitory effect was noticed for malate dehydrogenase and succinate dehydrogenase in both fungi while differentiated influence was revealed in alpha ceto glutarate dehydrogenase (inhibitory in Chaetomium globosum but stimulatory in Alternaria alternata). Isocitrate dehydrogenase activity was significantly stimulated in both fungi for 3 hours exposure time. (Author) 15 refs.

  19. Dicty_cDB: Contig-U02161-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available snsinanvkvdyinanlgksvfli kditnynqplisenplvsnlsslyfdenykscfhclksifvnescygekmkkqkelfiek psftcdknckfevycsenckneawkqyhnll...m clone DKEY-29B14. 36 3.6 11 ( CP000770 ) Candidatus Sulcia muelleri GWSS, compl....5 7 ( AC189153 ) Cavia porcellus clone CH234-66P5, WORKING DRAFT S... 38 5.5 8 ( AC018575 ) Homo sapiens ch...e-06 CP000568_3003( CP000568 |pid:none) Clostridium thermocellum ATCC 2... 57 2e-06 CR380954_320( CR380954 |... strain OTTH05... 56 2e-06 CP001348_1156( CP001348 |pid:none) Clostridium cellulolyt

  20. Enhancement of Cellulase Production by Cellulomonas Fimi and Bacillus Subtilis

    International Nuclear Information System (INIS)

    Two bacterial strains identified as Cellulomonas fimi and Baciliius subtilus are cosidered as highly active cellulytic bacteria. Trials for maximizing the cellulolytic activites of the two strains were conducted. A maximum cellulase production was achieved at 1 and 1.5%carboxy methyl cellulose as carbon source, sodium nitrate and yeast as nitrogen source for Cellulomonas fimi and Bacillus subtilis, respectively. Incubation temprature at 30 and 45 degree C, ph at 6 and 7 achieved the highest activity of cellulase for Cellulomonas fimi and bacillus subtilis, respectively

  1. Karakterisasi Tepung Kasava Yang Dimodifikasi Dengan Bakteri Selulolitik

    OpenAIRE

    Wati, Putri Purnama

    2010-01-01

    The aim of the research was to find the characterisation of modified cassava flour using cellulolytic bacteria. The research had been performed using randomized block design with two factors, i.e: cassava varieties (V1: perenial cassava, V2: malaysian cassava, V3: yellow cassava, V4: gunting saga cassava) and concentration of celulolytic bacteria (K1: 2 ml/l water, K2: 4 ml/l water, K3: 6 ml/l water). Parameters analysed were the physicochemical properties: water content...

  2. Comparison of methods to assess the enzyme accessibility and hydrolysis of pretreated lignocellulosic substrates.

    Science.gov (United States)

    Chandra, Richard P; Ewanick, Shannon M; Chung, Pablo A; Au-Yeung, Kathy; Del Rio, Luis; Mabee, Warren; Saddler, Jack N

    2009-08-01

    Fiber size analysis, water retention value, and Simons' stain measurements were assessed for their potential to predict the susceptibility of a given substrate to enzymatic hydrolysis. Slight modifications were made to the fiber size analysis and water retention protocols to adapt these measurements to evaluate substrates for cellulolytic hydrolysis rather than pulps for papermaking. Lodgepole pine was pretreated by the steam and ethanol-organosolv processes under varying conditions. The Simons' stain procedure proved to be an effective method for indicating the potential ease of enzymatic hydrolysis of substrates pretreated by either process or when the pretreatment conditions were altered. PMID:19357812

  3. An enzymatic signal amplification system for calorimetric studies of cellobiohydrolases

    DEFF Research Database (Denmark)

    Murphy, Leigh; Baumann, Martin Johannes; Borch, Kim;

    2010-01-01

    The study of cellulolytic enzymes has traditionally been carried out using endpoint measurements by quantitation of reaction products using high-performance liquid chromatography (HPLC) or overall determination of produced reducing ends. To measure catalytic activity, model substrates such as...... is heat production. This can be converted to the rate of reaction and allows direct and continuous monitoring of the hydrolysis of complex substrates. To overcome the low molar enthalpy of the hydrolysis of the glycosidic bond, which is typically on the order of −2.5 kJ mol−1, an enzymatic signal...

  4. Nutrition and feeding of swamp buffalo: feed resources and rumen approach

    Directory of Open Access Journals (Sweden)

    P. Rowlins

    2010-02-01

    Full Text Available Seasonal feed resources are of prime importance for swamp buffaloes to support the efficient production under the prevailing small-holder farming systems. Manipulations of rumen microorganisms, fermentation and subsequent absorption by the animals are essential. Current research work on locally available feed resources such as urea-treated rice straw, cassava hay etc. revealed significant improvement in rumen ecology with higher cellulolytic bacteria and fungal zoospores and subsequent fermentation endproducts. However, investigation of rumen microorganisms diversity of swamp buffalo and their roles in fermentation using molecular technique especially the use of PCR – DGGE/ Real Time- PCR warrant future research undertakings.

  5. Biotechnological valorisation of agro-industrial wastes for the production of cellulases

    OpenAIRE

    DAMATO, GIUSEPPE

    2012-01-01

    This experimental work is embedded in a wider European-funded project named Etoile (FP7/2007-2013, Project n° 222331). The aim of Etoile project was to develop a new integrated process where the two main wastes coming from olive oil traditional three-phase production process, the solid lignocellulosic olive pomace (OP) and the liquid olive oil mill waste water (OOMW), are exploited for the production of cellulolytic enzymes and bioethanol.More specifically, this experimental work was focus...

  6. Mageeibacillus indolicus gen. nov., sp. nov: A novel bacterium isolated from the female genital tract

    OpenAIRE

    Austin, Michele N.; Rabe, Lorna K.; Srinivasan, Sujatha; Fredricks, David N.; Wiesenfeld, Harold C.; Hillier, Sharon L.

    2014-01-01

    Three isolates of a bacterium recovered from human endometrium using conventional culture methods were characterized biochemically and subjected to 16S rRNA gene sequencing and phylogenetic analysis. Isolates were non-motile, obligately anaerobic, non-spore forming, asaccharolytic, non-cellulolytic, indole positive, Gram positive rods. Cell wall fatty acid profiling revealed C14:0, C16:0, C18:2 ω6, 9c, C18:1 ω9c and C18:0 to be the major fatty acid composition. The DNA mol % G+C was determine...

  7. Laboratory decomposition of Dalbergia nigra all. ex. benth and Eucalyptus grandis w.hill ex. maiden leaves in forest and eucalypt plantation soils

    OpenAIRE

    Rezende Juliana L. P.; Garcia Queila S.; Scotti Maria Rita M. M. L.

    2001-01-01

    The objective was to evaluate the decomposition of D. nigra and E. grandis leaves under laboratory conditions when incubated in soils from Atlantic Forest and from a 40-year-old eucalypt plantation for a year. The obtained values of pH in forest and eucalypt plantation soils were 5.61 and 4.47 and for aluminum 0.32 and 1.89mEqx100, respectively. A great number of microorganisms (total fungi, phosphate solubilising and cellulolytic organisms) were found in forest soil. Litterbag study revealed...

  8. EndB, a Multidomain Family 44 Cellulase from Ruminococcus flavefaciens 17, Binds to Cellulose via a Novel Cellulose-Binding Module and to Another R. flavefaciens Protein via a Dockerin Domain

    OpenAIRE

    Rincón, Marco T.; McCrae, Sheila I.; Kirby, James; Scott, Karen P.; Flint, Harry J.

    2001-01-01

    The mechanisms by which cellulolytic enzymes and enzyme complexes in Ruminococcus spp. bind to cellulose are not fully understood. The product of the newly isolated cellulase gene endB from Ruminococcus flavefaciens 17 was purified as a His-tagged product after expression in Escherichia coli and found to be able to bind directly to crystalline cellulose. The ability to bind cellulose is shown to be associated with a novel cellulose-binding module (CBM) located within a region of 200 amino aci...

  9. Celluloytic enzymes, nucleic acids encoding them and methods for making and using them

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Kevin A; Zhao, Lishan; Cayouette, Michelle H

    2015-11-04

    The invention is directed to polypeptides having any cellulolytic activity, e.g., a cellulase activity, e.g., endoglucanase, cellobiohydrolase, beta-glucosidase, xylanase, mannanse, .beta.-xylosidase, arabinofuranosidase, and/or oligomerase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. The polypeptides of the invention can be used in a variety of pharmaceutical, agricultural, food and feed processing and industrial contexts. The invention also provides compositions or products of manufacture comprising mixtures of enzymes comprising at least one enzyme of this invention.

  10. Effects of Essential Oils on Methane Production and Fermentation by, and Abundance and Diversity of, Rumen Microbial Populations

    OpenAIRE

    Patra, Amlan K.; Yu, Zhongtang

    2012-01-01

    Five essential oils (EOs), namely, clove oil (CLO), eucalyptus oil (EUO), garlic oil (GAO), origanum oil (ORO), and peppermint oil (PEO), were tested in vitro at 3 different doses (0.25, 0.50, and 1.0 g/liter) for their effect on methane production, fermentation, and select groups of ruminal microbes, including total bacteria, cellulolytic bacteria, archaea, and protozoa. All the EOs significantly reduced methane production with increasing doses, with reductions by 34.4%, 17.6%, 42.3%, 87%, a...

  11. Laboratory decomposition of Dalbergia nigra all. ex. benth and Eucalyptus grandis w.hill ex. maiden leaves in forest and eucalypt plantation soils Decomposição em laboratório de folhas de Dalbergia nigra e de Eucalyptus grandis em terra de mata e de eucaliptal

    OpenAIRE

    Juliana L. P. Rezende; Queila S. Garcia; Maria Rita M. M. L. Scotti

    2001-01-01

    The objective was to evaluate the decomposition of D. nigra and E. grandis leaves under laboratory conditions when incubated in soils from Atlantic Forest and from a 40-year-old eucalypt plantation for a year. The obtained values of pH in forest and eucalypt plantation soils were 5.61 and 4.47 and for aluminum 0.32 and 1.89mEqx100, respectively. A great number of microorganisms (total fungi, phosphate solubilising and cellulolytic organisms) were found in forest soil. Litterbag study revealed...

  12. Celluloytic enzymes, nucleic acids encoding them and methods for making and using them

    Science.gov (United States)

    Gray, Kevin A.; Zhao, Lishan; Cayouette, Michelle H.

    2015-09-08

    The invention is directed to polypeptides having any cellulolytic activity, e.g., a cellulase activity, e.g., endoglucanase, cellobiohydrolase, beta-glucosidase, xylanase, mannanse, .beta.-xylosidase, arabinofuranosidase, and/or oligomerase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. The polypeptides of the invention can be used in a variety of pharmaceutical, agricultural, food and feed processing and industrial contexts. The invention also provides compositions or products of manufacture comprising mixtures of enzymes comprising at least one enzyme of this invention.

  13. Cell-wall properties contributing to improved deconstruction by alkaline pre-treatment and enzymatic hydrolysis in diverse maize (Zea mays L.) lines

    OpenAIRE

    Li, Muyang; Heckwolf, Marlies; Crowe, Jacob D.; Williams, Daniel L.; Magee, Timothy D.; Shawn M Kaeppler; Leon, Natalia de; Hodge, David B

    2015-01-01

    A maize (Zea mays L. subsp. mays) diversity panel consisting of 26 maize lines exhibiting a wide range of cell-wall properties and responses to hydrolysis by cellulolytic enzymes was employed to investigate the relationship between cell-wall properties, cell-wall responses to mild NaOH pre-treatment, and enzymatic hydrolysis yields. Enzymatic hydrolysis of the cellulose in the untreated maize was found to be positively correlated with the water retention value, which is a measure of cell-wall...

  14. Effect and Modeling of Glucose Inhibition and In Situ Glucose Removal During Enzymatic Hydrolysis of Pretreated Wheat Straw

    DEFF Research Database (Denmark)

    Andric, Pavle; Meyer, Anne S.; Jensen, Peter Arendt;

    2010-01-01

    The enzymatic hydrolysis of lignocellulosic biomass is known to be product-inhibited by glucose. In this study, the effects on cellulolytic glucose yields of glucose inhibition and in situ glucose removal were examined and modeled during extended treatment of heat-pretreated wheat straw with the......, during 96 h of reaction. When glucose was removed by dialysis during the enzymatic hydrolysis, the cellulose conversion rates and glucose yields increased. In fact, with dialytic in situ glucose removal, the rate of enzyme-catalyzed glucose release during 48-72 h of reaction recovered from 20-40% to...... removal during enzymatic hydrolysis of lignocellulose....

  15. A Laboratory Exercise To Understand the Importance of Enzyme Technology in the Fruit-Processing Industry: Viscosity Decrease and Phenols Release from Apple Mash

    DEFF Research Database (Denmark)

    Pinelo, Manuel; Nielsen, Michael Krogsgaard; Meyer, Anne S.

    2011-01-01

    In a 4-h laboratory exercise, students accomplish a series of enzymatic macerations of apple mash, assess the viscosity of the mash during the maceration, extract the juice by centrifugation, and measure the levels of antioxidant phenols extracted into the juice after different enzyme treatments....... The exercise shows the impact of enzyme-catalyzed plant cell-wall degradation on the viscosity of apple fruit mash and on the extraction of antioxidant phenols into experimentally prepared apple juice. The exercise also demonstrates that pectinolytic and cellulolytic enzymes have different effects on...

  16. Flux Analysis of the Metabolism of Clostridium cellulolyticum Grown in Cellulose-Fed Continuous Culture on a Chemically Defined Medium under Ammonium-Limited Conditions

    OpenAIRE

    Desvaux, Mickaël; Petitdemange, Henri

    2001-01-01

    An investigation of cellulose degradation by the nonruminal, cellulolytic, mesophilic bacterium Clostridium cellulolyticum was performed in cellulose-fed chemostat cultures with ammonium as the growth-limiting nutrient. At any dilution rate (D), acetate was always the main product of the catabolism, with a yield of product from substrate ranging between 37.7 and 51.5 g per mol of hexose equivalent fermented and an acetate/ethanol ratio always higher than 1. As D rose, the acetyl coenzyme A wa...

  17. Nutritional Interdependence Among Rumen Bacteria During Cellulose Digestion In Vitro

    OpenAIRE

    Miura, Hideki; HORIGUCHI, Masaaki; Ogimoto, Keiji; MATSUMOTO, Tatsuro

    1983-01-01

    A study has been made of the promoting effect of starch on cellulose digestion by mixed rumen bacteria in a cellulose-urea medium. Starch supplementation of the medium promoted the growth of bacteria that required neither amino acids (AA) nor branched-chain fatty acids (BrFA). The growth of these bacteria was followed by the growth of AA-dependent bacteria, AA- or BrFA-dependent bacteria, BrFA-producing bacteria, and finally, BrFA-dependent cellulolytic bacteria. Population changes of these b...

  18. Cellulosic ethanol production using a yeast consortium displaying a minicellulosome and β-glucosidase

    Directory of Open Access Journals (Sweden)

    Kim Sujin

    2013-02-01

    Full Text Available Abstract Background Cellulosic biomass is considered as a promising alternative to fossil fuels, but its recalcitrant nature and high cost of cellulase are the major obstacles to utilize this material. Consolidated bioprocessing (CBP, combining cellulase production, saccharification, and fermentation into one step, has been proposed as the most efficient way to reduce the production cost of cellulosic bioethanol. In this study, we developed a cellulolytic yeast consortium for CBP, based on the surface display of cellulosome structure, mimicking the cellulolytic bacterium, Clostridium thermocellum. Results We designed a cellulolytic yeast consortium composed of four different yeast strains capable of either displaying a scaffoldin (mini CipA containing three cohesin domains derived from C. thermocellum, or secreting one of the three types of cellulases, C. thermocellum CelA (endoglucanase containing its own dockerin, Trichoderma reesei CBHII (exoglucanase fused with an exogenous dockerin from C. thermocellum, or Aspergillus aculeatus BGLI (β-glucosidase. The secreted dockerin-containing enzymes, CelA and CBHI, were randomly assembled to the surface-displayed mini CipA via cohesin-dockerin interactions. On the other hand, BGLI was independently assembled to the cell surface since we newly found that it already has a cell adhesion characteristic. We optimized the cellulosome activity and ethanol production by controlling the combination ratio among the four yeast strains. A mixture of cells with the optimized mini CipA:CelA:CBHII:BGLI ratio of 2:3:3:0.53 produced 1.80 g/l ethanol after 94 h, indicating about 20% increase compared with a consortium composed of an equal amount of each cell type (1.48 g/l. Conclusions We produced cellulosic ethanol using a cellulolytic yeast consortium, which is composed of cells displaying mini cellulosomes generated via random assembly of CelA and CBHII to a mini CipA, and cells displaying BGLI independently. One

  19. Continuous cellulosic bioethanol fermentation by cyclic fed-batch cocultivation.

    Science.gov (United States)

    Jiang, He-Long; He, Qiang; He, Zhili; Hemme, Christopher L; Wu, Liyou; Zhou, Jizhong

    2013-03-01

    Cocultivation of cellulolytic and saccharolytic microbial populations is a promising strategy to improve bioethanol production from the fermentation of recalcitrant cellulosic materials. Earlier studies have demonstrated the effectiveness of cocultivation in enhancing ethanolic fermentation of cellulose in batch fermentation. To further enhance process efficiency, a semicontinuous cyclic fed-batch fermentor configuration was evaluated for its potential in enhancing the efficiency of cellulose fermentation using cocultivation. Cocultures of cellulolytic Clostridium thermocellum LQRI and saccharolytic Thermoanaerobacter pseudethanolicus strain X514 were tested in the semicontinuous fermentor as a model system. Initial cellulose concentration and pH were identified as the key process parameters controlling cellulose fermentation performance in the fixed-volume cyclic fed-batch coculture system. At an initial cellulose concentration of 40 g liter(-1), the concentration of ethanol produced with pH control was 4.5-fold higher than that without pH control. It was also found that efficient cellulosic bioethanol production by cocultivation was sustained in the semicontinuous configuration, with bioethanol production reaching 474 mM in 96 h with an initial cellulose concentration of 80 g liter(-1) and pH controlled at 6.5 to 6.8. These results suggested the advantages of the cyclic fed-batch process for cellulosic bioethanol fermentation by the cocultures. PMID:23275517

  20. Cellulose-Enriched Microbial Communities from Leaf-Cutter Ant (Atta colombica) Refuse Dumps Vary in Taxonomic Composition and Degradation Ability.

    Science.gov (United States)

    Lewin, Gina R; Johnson, Amanda L; Soto, Rolando D Moreira; Perry, Kailene; Book, Adam J; Horn, Heidi A; Pinto-Tomás, Adrián A; Currie, Cameron R

    2016-01-01

    Deconstruction of the cellulose in plant cell walls is critical for carbon flow through ecosystems and for the production of sustainable cellulosic biofuels. Our understanding of cellulose deconstruction is largely limited to the study of microbes in isolation, but in nature, this process is driven by microbes within complex communities. In Neotropical forests, microbes in leaf-cutter ant refuse dumps are important for carbon turnover. These dumps consist of decaying plant material and a diverse bacterial community, as shown here by electron microscopy. To study the portion of the community capable of cellulose degradation, we performed enrichments on cellulose using material from five Atta colombica refuse dumps. The ability of enriched communities to degrade cellulose varied significantly across refuse dumps. 16S rRNA gene amplicon sequencing of enriched samples identified that the community structure correlated with refuse dump and with degradation ability. Overall, samples were dominated by Bacteroidetes, Gammaproteobacteria, and Betaproteobacteria. Half of abundant operational taxonomic units (OTUs) across samples were classified within genera containing known cellulose degraders, including Acidovorax, the most abundant OTU detected across samples, which was positively correlated with cellulolytic ability. A representative Acidovorax strain was isolated, but did not grow on cellulose alone. Phenotypic and compositional analyses of enrichment cultures, such as those presented here, help link community composition with cellulolytic ability and provide insight into the complexity of community-based cellulose degradation. PMID:26999749

  1. Dynamics of bacterial community in the gut of Cornu aspersum

    Directory of Open Access Journals (Sweden)

    ZDRAVKA KOLEVA

    2015-12-01

    Full Text Available The dynamics of the bacterial community in the intestinal tract of Cornu aspersum was investigated during different states of its life cycle. Two approaches were applied – culture and non-culture. The non-culture approach was performed by ARDRA of 16S rDNA using two of the six tested endonucleases. Data were analyzed by hierarchical cluster analysis. The restriction of 16S rDNA samples from the snail of different physiological states with endonucleases HinfI and Csp6I resulted in generation of different profiles depending on the snail states. By the culture approach we found that the total number of cultivable bacteria, representatives of Enterobacteriaceae, lactic acid bacteria, amylolitic and cellulolytic bacteria were the most abundant in active state of the snails. Cellulolytic bacteria were not detected in juveniles of C. aspersum. Escherichia coli, Clostridium perfringens as well as bacteria from the genus Salmonella, Shigella and Pseudomonas were not detected. Bacteria of the genus Aeromonas were found in juveniles of C. aspersum, after that their number decrease and were not found in hibernating snails. On the base of the two applied approaches this study shows that the bacterial flora in the intestinal tract of C. aspersum is affected by the seasonal and environmental variations and undergoes quantitative and qualitative changes during the different states of the life cycle. The snails harbor in their gut intestinal bacteria, which possess biochemical potentiality to degrade the plant components.

  2. Effect of steroidal saponin from Yucca schidigera extract on ruminal microbes.

    Science.gov (United States)

    Wang, Y; McAllister, T A; Yanke, L J; Cheeke, P R

    2000-05-01

    The effects of steroidal saponins (SAP) isolated from Yucca schidigera extract on ruminal bacteria and fungi were investigated in pure culture studies. Prevotella bryantii, Ruminobacter amylophilus, Selenomonas ruminantium and Streptococcus bovis were cultured through ten 24-h transfers in ruminal fluid medium containing 0 or 25 microg SAP ml-1 (measured as smilagenin equivalents). The four strains, each non-exposed or pre-exposed to SAP, were then inoculated into medium containing 0 or 250 microgram smilagenin equivalents ml-1 and 24-h growth curves were determined. The cellulolytic ruminal bacteria Ruminococcus flavefaciens, Fibrobacter succinogenes and Rc. albus were cultured for 72 h on Whatman no. 1 filter paper in medium containing 0, 9, 90 or 180 microgram SAP ml-1 for the determination of filter paper digestion and endoglucanase activity. The ruminal bacteria differed in their responses to SAP. Steroidal saponins in the medium reduced the growth of Strep. bovis (P 0.05) between pre-exposed and non-exposed cultures and the concentrations of total SAP and soluble (deglycosylated) SAP in the liquid fraction were unchanged (P > 0.05) over time. Steroidal saponins inhibited the digestion of filter paper by all three cellulolytic bacteria, but F. succinogenes was less (P starch-digesting ruminal micro-organisms. PMID:10792550

  3. Heterologous expression of Pycnoporus cinnabarinus cellobiose dehydrogenase in Pichia pastoris and involvement in saccharification processes

    Directory of Open Access Journals (Sweden)

    Bey Mathieu

    2011-12-01

    Full Text Available Abstract Background Cellobiose dehydrogenase (CDH is an extracellular hemoflavoenzyme produced by lignocellulose-degrading fungi including Pycnoporus cinnabarinus. We investigated the cellulolytic system of P. cinnabarinus, focusing on the involvement of CDH in the deconstruction of lignocellulosic biomass. Results First, P. cinnabarinus growth conditions were optimized for CDH production. Following growth under cellulolytic conditions, the main components secreted were cellulases, xylanases and CDH. To investigate the contribution of P. cinnabarinus secretome in saccharification processes, the Trichoderma reesei enzymatic cocktail was supplemented with the P. cinnabarinus secretome. A significant enhancement of the degradation of wheat straw was observed with (i the production of a large amount of gluconic acid, (ii increased hemicellulose degradation, and (iii increased overall degradation of the lignocellulosic material. P. cinnabarinus CDH was heterologously expressed in Pichia pastoris to obtain large amounts of pure enzyme. In a bioreactor, the recombinant CDH (rCDH expression level reached 7800 U/L. rCDH exhibited values of biochemical parameters similar to those of the natural enzyme, and was able to bind cellulose despite the absence of a carbohydrate-binding module (CBM. Following supplementation of purified rCDH to T. reesei enzymatic cocktail, formation of gluconic acid and increased hemicellulose degradation were observed, thus confirming the previous results observed with P. cinnabarinus secretome. Conclusions We demonstrate that CDH offers an attractive tool for saccharification process enhancement due to gluconic acid production from raw lignocellulosic material.

  4. Integrated ‘omics analysis for studying the microbial community response to a pH perturbation of a cellulose-degrading bioreactor culture

    Energy Technology Data Exchange (ETDEWEB)

    Boaro, Amy A.; Kim, Young-Mo; Konopka, Allan; Callister, Stephen J.; Ahring, Birgitte K.

    2014-12-01

    Integrated ‘omics have been used on pure cultures and co-cultures, yet they have not been applied to complex microbial communities to examine questions of perturbation response. In this study, we used integrated ‘omics to measure the perturbation response of a cellulose-degrading bioreactor community fed with microcrystalline cellulose (Avicel). We predicted that a pH decrease by addition of a pulse of acid would reduce microbial community diversity and temporarily reduce reactor function such as cellulose degradation. However, 16S rDNA pyrosequencing results revealed increased alpha diversity in the microbial community after the perturbation, and a persistence of the dominant community members over the duration of the experiment. Proteomics results showed a decrease in activity of proteins associated with Fibrobacter succinogenes two days after the perturbation followed by increased protein abundances six days after the perturbation. The decrease in cellulolytic activity suggested by the proteomics was confirmed by the accumulation of Avicel in the reactor. Metabolomics showed a pattern similar to that of the proteome, with amino acid production decreasing two days after the perturbation and increasing after six days. This study demonstrated that community ‘omics data provides valuable information about the interactions and function of anaerobic cellulolytic community members after a perturbation.

  5. Functional and structural analyses of a 1,4-β-endoglucanase from Ganoderma lucidum.

    Science.gov (United States)

    Liu, Guizhi; Li, Qian; Shang, Na; Huang, Jian-Wen; Ko, Tzu-Ping; Liu, Weidong; Zheng, Yingying; Han, Xu; Chen, Yun; Chen, Chun-Chi; Jin, Jian; Guo, Rey-Ting

    2016-05-01

    Ganoderma lucidum is a saprotrophic white-rot fungus which contains a rich set of cellulolytic enzymes. Here, we screened an array of potential 1,4-β-endoglucanases from G. lucidum based on the gene annotation library and found that one candidate gene, GlCel5A, exhibits CMC-hydrolyzing activity. The recombinant GlCel5A protein expressed in Pichia pastoris is able to hydrolyze CMC and β-glucan but not xylan and mannan. The enzyme exhibits optimal activity at 60°C and pH 3-4, and retained 50% activity at 80 and 90°C for at least 15 and 10min. The crystal structure of GlCel5A and its complex with cellobiose, solved at 2.7 and 2.86Å resolution, shows a classical (β/α)8 TIM-barrel fold as seen in other members of glycoside hydrolase family 5. The complex structure contains a cellobiose molecule in the +1 and +2 subsites, and reveals the interactions with the positive sites of the enzyme. Collectively, the present work provides the first comprehensive characterization of an endoglucanase from G. lucidum that possesses properties for industrial applications, and strongly encourages further studying in the cellulolytic enzyme system of G. lucidum. PMID:26992795

  6. Endo- and exoglucanase activities in bacteria from mangrove sediment.

    Science.gov (United States)

    Soares Júnior, Fábio Lino; Dias, Armando Cavalcante Franco; Fasanella, Cristiane Cipola; Taketani, Rodrigo Gouvêa; de Souza Lima, André Oliveira; Melo, Itamar Soares; Andreote, Fernando Dini

    2013-01-01

    The mangrove ecosystem is an unexplored source for biotechnological applications. In this unique environment, endemic bacteria have the ability to thrive in the harsh environmental conditions (salinity and anaerobiosis), and act in the degradation of organic matter, promoting nutrient cycles. Thus, this study aimed to assess the cellulolytic activities of bacterial groups present in the sediment from a mangrove located in Ilha do Cardoso (SP, Brazil). To optimize the isolation of cellulolytic bacteria, enrichments in two types of culture media (tryptone broth and minimum salt medium), both supplemented with 5% NaCl and 1% of cellulose, were performed. Tests conducted with the obtained colonies showed a higher occurrence of endoglycolytic activity (33 isolates) than exoglycolytic (19 isolates), and the degradation activity was shown to be modulated by the presence of NaCl. The isolated bacteria were clustered by BOX-PCR and further classified on the basis of partial 16S rRNA sequences as Alphaproteobacteria, Gammaproteobacteria, Actinobacteria, Firmicutes or Bacteroidetes. Therefore, this study highlights the importance of studies focusing on the endemic species found in mangroves to exploit them as novel biotechnological tools for the degradation of cellulose. PMID:24516466

  7. Endo-and exoglucanase activities in bacteria from mangrove sediment

    Directory of Open Access Journals (Sweden)

    Fábio Lino Soares Júnior

    2013-09-01

    Full Text Available The mangrove ecosystem is an unexplored source for biotechnological applications. In this unique environment, endemic bacteria have the ability to thrive in the harsh environmental conditions (salinity and anaerobiosis, and act in the degradation of organic matter, promoting nutrient cycles. Thus, this study aimed to assess the cellulolytic activities of bacterial groups present in the sediment from a mangrove located in Ilha do Cardoso (SP, Brazil. To optimize the isolation of cellulolytic bacteria, enrichments in two types of culture media (tryptone broth and minimum salt medium, both supplemented with 5% NaCl and 1% of cellulose, were performed. Tests conducted with the obtained colonies showed a higher occurrence of endoglycolytic activity (33 isolates than exoglycolytic (19 isolates, and the degradation activity was shown to be modulated by the presence of NaCl. The isolated bacteria were clustered by BOX-PCR and further classified on the basis of partial 16S rRNA sequences as Alphaproteobacteria, Gammaproteobacteria, Actinobacteria, Firmicutes or Bacteroidetes. Therefore, this study highlights the importance of studies focusing on the endemic species found in mangroves to exploit them as novel biotechnological tools for the degradation of cellulose.

  8. Endo- and exoglucanase activities in bacteria from mangrove sediment

    Science.gov (United States)

    Júnior, Fábio Lino Soares; Dias, Armando Cavalcante Franco; Fasanella, Cristiane Cipola; Taketani, Rodrigo Gouvêa; de Souza Lima, André Oliveira; Melo, Itamar Soares; Andreote, Fernando Dini

    2013-01-01

    The mangrove ecosystem is an unexplored source for biotechnological applications. In this unique environment, endemic bacteria have the ability to thrive in the harsh environmental conditions (salinity and anaerobiosis), and act in the degradation of organic matter, promoting nutrient cycles. Thus, this study aimed to assess the cellulolytic activities of bacterial groups present in the sediment from a mangrove located in Ilha do Cardoso (SP, Brazil). To optimize the isolation of cellulolytic bacteria, enrichments in two types of culture media (tryptone broth and minimum salt medium), both supplemented with 5% NaCl and 1% of cellulose, were performed. Tests conducted with the obtained colonies showed a higher occurrence of endoglycolytic activity (33 isolates) than exoglycolytic (19 isolates), and the degradation activity was shown to be modulated by the presence of NaCl. The isolated bacteria were clustered by BOX-PCR and further classified on the basis of partial 16S rRNA sequences as Alphaproteobacteria, Gammaproteobacteria, Actinobacteria, Firmicutes or Bacteroidetes. Therefore, this study highlights the importance of studies focusing on the endemic species found in mangroves to exploit them as novel biotechnological tools for the degradation of cellulose. PMID:24516466

  9. Trichoderma species occurring on wood with decay symptoms in mountain forests in Central Europe: genetic and enzymatic characterization.

    Science.gov (United States)

    Błaszczyk, Lidia; Strakowska, Judyta; Chełkowski, Jerzy; Gąbka-Buszek, Agnieszka; Kaczmarek, Joanna

    2016-08-01

    The aim of this study was to explore the species diversity of Trichoderma obtained from samples of wood collected in the forests of the Gorce Mountains (location A), Karkonosze Mountains (location B) and Tatra Mountains (location C) in Central Europe and to examine the cellulolytic and xylanolytic activity of these species as an expression of their probable role in wood decay processes. The present study has led to the identification of the following species and species complex: Trichoderma atroviride P. Karst., Trichoderma citrinoviride Bissett, Trichoderma cremeum P. Chaverri & Samuels, Trichoderma gamsii Samuels & Druzhin., Trichoderma harzianum complex, Trichoderma koningii Oudem., Trichoderma koningiopsis Samuels, C. Suárez & H.C. Evans, Trichoderma longibrachiatum Rifai, Trichoderma longipile Bissett, Trichoderma sp. (Hypocrea parapilulifera B.S. Lu, Druzhin. & Samuels), Trichoderma viride Schumach. and Trichoderma viridescens complex. Among them, T. viride was observed as the most abundant species (53 % of all isolates) in all the investigated locations. The Shannon's biodiversity index (H), evenness (E), and the Simpson's biodiversity index (D) calculations for each location showed that the highest species diversity and evenness were recorded for location A-Gorce Mountains (H' = 1.71, E = 0.82, D = 0.79). The preliminary screening of 119 Trichoderma strains for cellulolytic and xylanolytic activity showed the real potential of all Trichoderma species originating from wood with decay symptoms to produce cellulases and xylanases-the key enzymes in plant cell wall degradation. PMID:26586561

  10. Modeling the minimum enzymatic requirements for optimal cellulose conversion

    International Nuclear Information System (INIS)

    Hydrolysis of cellulose is achieved by the synergistic action of endoglucanases, exoglucanases and β-glucosidases. Most cellulolytic microorganisms produce a varied array of these enzymes and the relative roles of the components are not easily defined or quantified. In this study we have used partially purified cellulases produced heterologously in the yeast Saccharomyces cerevisiae to increase our understanding of the roles of some of these components. CBH1 (Cel7), CBH2 (Cel6) and EG2 (Cel5) were separately produced in recombinant yeast strains, allowing their isolation free of any contaminating cellulolytic activity. Binary and ternary mixtures of the enzymes at loadings ranging between 3 and 100 mg g−1 Avicel allowed us to illustrate the relative roles of the enzymes and their levels of synergy. A mathematical model was created to simulate the interactions of these enzymes on crystalline cellulose, under both isolated and synergistic conditions. Laboratory results from the various mixtures at a range of loadings of recombinant enzymes allowed refinement of the mathematical model. The model can further be used to predict the optimal synergistic mixes of the enzymes. This information can subsequently be applied to help to determine the minimum protein requirement for complete hydrolysis of cellulose. Such knowledge will be greatly informative for the design of better enzymatic cocktails or processing organisms for the conversion of cellulosic biomass to commodity products. (letter)

  11. Fundamental study of the mechanism and kinetics of cellulose hydrolysis by acids and enzymes. Final report, June 1, 1978-January 31, 1981

    Energy Technology Data Exchange (ETDEWEB)

    Gong, C.S.; Chang, M.

    1981-02-01

    There are three basic enzymes (e.g., endoglucanase (C/sub x/), exoglucanase (C/sub 1/) and cellobiase) comprising the majority of extracellular cellulase enzymes produced by the cellulolytic mycelial fungi, Trichoderma reesei, and other cellulolytic microorganisms. The enzymes exhibited different mode of actions in respect to the hydrolysis of cellulose and cellulose derived oligosaccharides. In combination, these enzymes complimented each other to hydrolyze cellulose to its basic constituent, glucose. The kinetics of cellobiase were developed on the basis of applying the pseudo-steady state assumption to hydrolyze cellobiose to glucose. The results indicated that cellobiase was subjected to end-product inhibition by glucose. The kinetic modeling of exoglucanase (C/sub 1/) with respect to cellodextrins was studied. Both glucose and cellobiose were found to be inhibitors of this enzyme with cellobiose being a stronger inhibitor than glucose. Similarly, endoglucanase (C/sub x/) is subject to end-product inhibition by glucose. Crystallinity of the cellulose affects the rate of hydrolysis by cellulases. Hence, the changes in crystallinity of cellulose in relation to chemical pretreatment and enzyme hydrolysis was compared. The study of cellulase biosynthesis resulted in the conclusion that exo- and endo-glucanases are co-induced while cellobiase is synthesized independent of the other two enzymes. The multiplicity of cellulase enzymes are the end results of post-translational modification during and/or after the secretion of enzymes into growth environment.

  12. Gas hold-up and oxygen mass transfer in three pneumatic bioreactors operating with sugarcane bagasse suspensions.

    Science.gov (United States)

    Esperança, M N; Cunha, F M; Cerri, M O; Zangirolami, T C; Farinas, C S; Badino, A C

    2014-05-01

    Sugarcane bagasse is a low-cost and abundant by-product generated by the bioethanol industry, and is a potential substrate for cellulolytic enzyme production. The aim of this work was to evaluate the effects of air flow rate (QAIR), solids loading (%S), sugarcane bagasse type, and particle size on the gas hold-up (εG) and volumetric oxygen transfer coefficient (kLa) in three different pneumatic bioreactors, using response surface methodology. Concentric tube airlift (CTA), split-cylinder airlift (SCA), and bubble column (BC) bioreactor types were tested. QAIR and %S affected oxygen mass transfer positively and negatively, respectively, while sugarcane bagasse type and particle size (within the range studied) did not influence kLa. Using large particles of untreated sugarcane bagasse, the loop-type bioreactors (CTA and SCA) exhibited higher mass transfer, compared to the BC reactor. At higher %S, SCA presented a higher kLa value (0.0448 s−1) than CTA, and the best operational conditions in terms of oxygen mass transfer were achieved for %S 27.0 L min−1. These results demonstrated that pneumatic bioreactors can provide elevated oxygen transfer in the presence of vegetal biomass, making them an excellent option for use in three-phase systems for cellulolytic enzyme production by filamentous fungi. PMID:24078146

  13. Yeasts from sub-Antarctic region: biodiversity, enzymatic activities and their potential as oleaginous microorganisms.

    Science.gov (United States)

    Martinez, A; Cavello, I; Garmendia, G; Rufo, C; Cavalitto, S; Vero, S

    2016-09-01

    Various microbial groups are well known to produce a range of extracellular enzymes and other secondary metabolites. However, the occurrence and importance of investment in such activities have received relatively limited attention in studies of Antarctic soil microbiota. Sixty-one yeasts strains were isolated from King George Island, Antarctica which were characterized physiologically and identified at the molecular level using the D1/D2 region of rDNA. Fifty-eight yeasts (belonging to the genera Cryptococcus, Leucosporidiella, Rhodotorula, Guehomyces, Candida, Metschnikowia and Debaryomyces) were screened for extracellular amylolytic, proteolytic, esterasic, pectinolytic, inulolytic xylanolytic and cellulolytic activities at low and moderate temperatures. Esterase activity was the most common enzymatic activity expressed by the yeast isolates regardless the assay temperature and inulinase was the second most common enzymatic activity. No cellulolytic activity was detected. One yeast identified as Guehomyces pullulans (8E) showed significant activity across six of seven enzymes types tested. Twenty-eight yeast isolates were classified as oleaginous, being the isolate 8E the strain that accumulated the highest levels of saponifiable lipids (42 %). PMID:27469174

  14. Effect of Dietary Starch Source and Concentration on Equine Fecal Microbiota

    Science.gov (United States)

    Harlow, Brittany E.; Lawrence, Laurie M.; Hayes, Susan H.; Crum, Andrea; Flythe, Michael D.

    2016-01-01

    Starch from corn is less susceptible to equine small intestinal digestion than starch from oats, and starch that reaches the hindgut can be utilized by the microbiota. The objective of the current study was to examine the effects of starch source on equine fecal microbiota. Thirty horses were assigned to treatments: control (hay only), HC (high corn), HO (high oats), LC (low corn), LO (low oats), and LW (low pelleted wheat middlings). Horses received an all-forage diet (2 wk; d -14 to d -1) before the treatment diets (2 wk; d 1 to 14). Starch was introduced gradually so that horses received 50% of the assigned starch amount (high = 2 g starch/kg BW; low = 1 g starch/kg BW) by d 4 and 100% by d 11. Fecal samples were obtained at the end of the forage-only period (S0; d -2), and on d 6 (S1) and d 13 (S2) of the treatment period. Cellulolytics, lactobacilli, Group D Gram-positive cocci (GPC), lactate-utilizers and amylolytics were enumerated. Enumeration data were log transformed and analyzed by repeated measures ANOVA. There were sample day × treatment interactions (P 0.05). All treatments except LO resulted in increased amylolytics and decreased cellulolytics, but the changes were larger in horses fed corn and wheat middlings (P starch source can have a differential effect on the equine fecal microbiota. PMID:27128793

  15. Metagenomics of the Svalbard reindeer rumen microbiome reveals abundance of polysaccharide utilization loci.

    Directory of Open Access Journals (Sweden)

    Phillip B Pope

    Full Text Available Lignocellulosic biomass remains a largely untapped source of renewable energy predominantly due to its recalcitrance and an incomplete understanding of how this is overcome in nature. We present here a compositional and comparative analysis of metagenomic data pertaining to a natural biomass-converting ecosystem adapted to austere arctic nutritional conditions, namely the rumen microbiome of Svalbard reindeer (Rangifer tarandus platyrhynchus. Community analysis showed that deeply-branched cellulolytic lineages affiliated to the Bacteroidetes and Firmicutes are dominant, whilst sequence binning methods facilitated the assemblage of metagenomic sequence for a dominant and novel Bacteroidales clade (SRM-1. Analysis of unassembled metagenomic sequence as well as metabolic reconstruction of SRM-1 revealed the presence of multiple polysaccharide utilization loci-like systems (PULs as well as members of more than 20 glycoside hydrolase and other carbohydrate-active enzyme families targeting various polysaccharides including cellulose, xylan and pectin. Functional screening of cloned metagenome fragments revealed high cellulolytic activity and an abundance of PULs that are rich in endoglucanases (GH5 but devoid of other common enzymes thought to be involved in cellulose degradation. Combining these results with known and partly re-evaluated metagenomic data strongly indicates that much like the human distal gut, the digestive system of herbivores harbours high numbers of deeply branched and as-yet uncultured members of the Bacteroidetes that depend on PUL-like systems for plant biomass degradation.

  16. Cellulose-Enriched Microbial Communities from Leaf-Cutter Ant (Atta colombica) Refuse Dumps Vary in Taxonomic Composition and Degradation Ability

    Science.gov (United States)

    Lewin, Gina R.; Johnson, Amanda L.; Soto, Rolando D. Moreira; Perry, Kailene; Book, Adam J.; Horn, Heidi A.; Pinto-Tomás, Adrián A.; Currie, Cameron R.

    2016-01-01

    Deconstruction of the cellulose in plant cell walls is critical for carbon flow through ecosystems and for the production of sustainable cellulosic biofuels. Our understanding of cellulose deconstruction is largely limited to the study of microbes in isolation, but in nature, this process is driven by microbes within complex communities. In Neotropical forests, microbes in leaf-cutter ant refuse dumps are important for carbon turnover. These dumps consist of decaying plant material and a diverse bacterial community, as shown here by electron microscopy. To study the portion of the community capable of cellulose degradation, we performed enrichments on cellulose using material from five Atta colombica refuse dumps. The ability of enriched communities to degrade cellulose varied significantly across refuse dumps. 16S rRNA gene amplicon sequencing of enriched samples identified that the community structure correlated with refuse dump and with degradation ability. Overall, samples were dominated by Bacteroidetes, Gammaproteobacteria, and Betaproteobacteria. Half of abundant operational taxonomic units (OTUs) across samples were classified within genera containing known cellulose degraders, including Acidovorax, the most abundant OTU detected across samples, which was positively correlated with cellulolytic ability. A representative Acidovorax strain was isolated, but did not grow on cellulose alone. Phenotypic and compositional analyses of enrichment cultures, such as those presented here, help link community composition with cellulolytic ability and provide insight into the complexity of community-based cellulose degradation. PMID:26999749

  17. Analysis of genomic regions of Trichoderma harzianum IOC-3844 related to biomass degradation.

    Directory of Open Access Journals (Sweden)

    Aline Crucello

    Full Text Available Trichoderma harzianum IOC-3844 secretes high levels of cellulolytic-active enzymes and is therefore a promising strain for use in biotechnological applications in second-generation bioethanol production. However, the T. harzianum biomass degradation mechanism has not been well explored at the genetic level. The present work investigates six genomic regions (~150 kbp each in this fungus that are enriched with genes related to biomass conversion. A BAC library consisting of 5,760 clones was constructed, with an average insert length of 90 kbp. The assembled BAC sequences revealed 232 predicted genes, 31.5% of which were related to catabolic pathways, including those involved in biomass degradation. An expression profile analysis based on RNA-Seq data demonstrated that putative regulatory elements, such as membrane transport proteins and transcription factors, are located in the same genomic regions as genes related to carbohydrate metabolism and exhibit similar expression profiles. Thus, we demonstrate a rapid and efficient tool that focuses on specific genomic regions by combining a BAC library with transcriptomic data. This is the first BAC-based structural genomic study of the cellulolytic fungus T. harzianum, and its findings provide new perspectives regarding the use of this species in biomass degradation processes.

  18. A Metagenomic Advance for the Cloning and Characterization of a Cellulase from Red Rice Crop Residues.

    Science.gov (United States)

    Meneses, Carlos; Silva, Bruna; Medeiros, Betsy; Serrato, Rodrigo; Johnston-Monje, David

    2016-01-01

    Many naturally-occurring cellulolytic microorganisms are not readily cultivable, demanding a culture-independent approach in order to study their cellulolytic genes. Metagenomics involves the isolation of DNA from environmental sources and can be used to identify enzymes with biotechnological potential from uncultured microbes. In this study, a gene encoding an endoglucanase was cloned from red rice crop residues using a metagenomic strategy. The amino acid identity between this gene and its closest published counterparts is lower than 70%. The endoglucanase was named EglaRR01 and was biochemically characterized. This recombinant protein showed activity on carboxymethylcellulose, indicating that EglaRR01 is an endoactive lytic enzyme. The enzymatic activity was optimal at a pH of 6.8 and at a temperature of 30 °C. Ethanol production from this recombinant enzyme was also analyzed on EglaRR01 crop residues, and resulted in conversion of cellulose from red rice into simple sugars which were further fermented by Saccharomyces cerevisiae to produce ethanol after seven days. Ethanol yield in this study was approximately 8 g/L. The gene found herein shows strong potential for use in ethanol production from cellulosic biomass (second generation ethanol). PMID:27347917

  19. Penicillium oxalicum PoFlbC regulates fungal asexual development and is important for cellulase gene expression.

    Science.gov (United States)

    Yao, Guangshan; Li, Zhonghai; Wu, Ruimei; Qin, Yuqi; Liu, Guodong; Qu, Yinbo

    2016-01-01

    Filamentous fungi can initiate vegetative growth on complex plant polysaccharides in nature through secreting a large amount of lignocellulose-degrading enzymes. These fungi develop a large amount of asexual spores to disperse and survive under harsh conditions, such as carbon and nitrogen depletion. Numerous studies report the presence of a cross-talk between asexual development and extracellular enzyme production, especially at the regulation level. This study identified and characterized a C2H2-type transcription factor called PoFlbC, which is an Aspergillus FlbC ortholog, in cellulolytic fungus Penicillium oxalicum. Results showed that the native level of PoFlbC was crucial for the normal growth and asexual development of P. oxalicum. Importantly, deletion of the PoflbC gene substantially reduced cellulase and hemicellulase productions. Comparative transcriptome analysis by RNA sequencing revealed a global downregulation of genes encoding cellulases, hemicellulases, and other proteins with functions in lignocellulose degradation. A similar defect was also observed in the OEPoflbC strain, suggesting that the production of cellulolytic enzymes was maintained by native expression of the PoflbC. In this study, an essential activator for both fungal asexual development and cellulase production was established in P. oxalicum. PMID:26724278

  20. Comparative analysis of carbohydrate active enzymes in Clostridium termitidis CT1112 reveals complex carbohydrate degradation ability.

    Directory of Open Access Journals (Sweden)

    Riffat I Munir

    Full Text Available Clostridium termitidis strain CT1112 is an anaerobic, gram positive, mesophilic, cellulolytic bacillus isolated from the gut of the wood-feeding termite, Nasutitermes lujae. It produces biofuels such as hydrogen and ethanol from cellulose, cellobiose, xylan, xylose, glucose, and other sugars, and therefore could be used for biofuel production from biomass through consolidated bioprocessing. The first step in the production of biofuel from biomass by microorganisms is the hydrolysis of complex carbohydrates present in biomass. This is achieved through the presence of a repertoire of secreted or complexed carbohydrate active enzymes (CAZymes, sometimes organized in an extracellular organelle called cellulosome. To assess the ability and understand the mechanism of polysaccharide hydrolysis in C. termitidis, the recently sequenced strain CT1112 of C. termitidis was analyzed for both CAZymes and cellulosomal components, and compared to other cellulolytic bacteria. A total of 355 CAZyme sequences were identified in C. termitidis, significantly higher than other Clostridial species. Of these, high numbers of glycoside hydrolases (199 and carbohydrate binding modules (95 were identified. The presence of a variety of CAZymes involved with polysaccharide utilization/degradation ability suggests hydrolysis potential for a wide range of polysaccharides. In addition, dockerin-bearing enzymes, cohesion domains and a cellulosomal gene cluster were identified, indicating the presence of potential cellulosome assembly.

  1. Effect of gamma irradiation and environmental factors on the production of extracellular cellulase enzyme by trichoderma Spp. using banana waste under solid state bio processing

    International Nuclear Information System (INIS)

    Fungal strains were isolated from degraded banana waste including leaves, pseudo stems and skins. Many isolated strains showed cellulolytic activities using the plate screening medium. The hyper cellulolytic isolates were selected on the basis of the diameter of the hydrolysis zone surrounding the colonies and identified to the genus level. The identified strains were found to belong to one of the genera Trichoderma, Aspergillus, Pleurotus or Penicillium. The strain with the larger diameter of the hydrolysis zone was found to belong to the genus Trichoderma. It was further identified to be Trichoderma harzianum, which was selected to be studied. Banana waste including leaves and pseudo stems were inoculated by the selected fungus and the production of the carboxymethyl cellulase (CMCase) and filter paper cellulase (FPCase) was followed during changes of the growth conditions under solid state fermentation. It was found that the two enzymes shared the same incubation temperature (25 degree C) and incubation period (18 days) for the maximum enzyme production. The gamma radiation dose of 1.5 KGy increased the production of CMCase produced on leaves by 4.0% and on pseudo stems by 5.6% and the production of FPCase produced on leaves by 2.4% and on pseudo stems by 2.3%. The results also suggest that FPCase and CMCase enzymes produced on leaves were higher than those produced from pseudo stems and the level of CMCase enzyme produced was higher than that of FPCase

  2. Biochemical passive reactors for treatment of acid mine drainage: Effect of hydraulic retention time on changes in efficiency, composition of reactive mixture, and microbial activity.

    Science.gov (United States)

    Vasquez, Yaneth; Escobar, Maria C; Neculita, Carmen M; Arbeli, Ziv; Roldan, Fabio

    2016-06-01

    Biochemical passive treatment represents a promising option for the remediation of acid mine drainage. This study determined the effect of three hydraulic retention times (1, 2, and 4 days) on changes in system efficiency, reactive mixture, and microbial activity in bioreactors under upward flow conditions. Bioreactors were sacrificed in the weeks 8, 17 and 36, and the reactive mixture was sampled at the bottom, middle, and top layers. Physicochemical analyses were performed on reactive mixture post-treatment and correlated with sulfate-reducing bacteria and cellulolytic and dehydrogenase activity. All hydraulic retention times were efficient at increasing pH and alkalinity and removing sulfate (>60%) and metals (85-99% for Fe(2+) and 70-100% for Zn(2+)), except for Mn(2+). The longest hydraulic retention time (4 days) increased residual sulfides, deteriorated the quality of treated effluent and negatively impacted sulfate-reducing bacteria. Shortest hydraulic retention time (1 day) washed out biomass and increased input of dissolved oxygen in the reactors, leading to higher redox potential and decreasing metal removal efficiency. Concentrations of iron, zinc and metal sulfides were high in the bottom layer, especially with 2 day of hydraulic retention time. Sulfate-reducing bacteria, cellulolytic and dehydrogenase activity were higher in the middle layer at 4 days of hydraulic retention time. Hydraulic retention time had a strong influence on overall performance of passive reactors. PMID:27016821

  3. MICROFLORA CULTIVABLE Y ENDOMICORRIZAS OBTENIDAS EN HOJARASCA DE BOSQUE (PÁRAMO GUERRERO FINCA PUENTE DE TIERRA ZIPAQUIRÁ, COLOMBIA Cultivable Microflora and Endomycorrhizas Obtained in Litter Forest (Paramo Guerrero Finca Puente de Tierra Zipaquirá, Colombia

    Directory of Open Access Journals (Sweden)

    ELEONORA BERNAL

    2006-06-01

    Full Text Available Se realizó el recuento de microorganismos cultivables (bacterias y hongos, microorganismos celulolíticos y endomicorrizas presentes en la hojarasca de bosque (finca Puente de Tierra en el páramo Guerrero, Colombia. Los microorganismos aislados con mayor frecuencia pertenecían a los géneros Staphylococcus, Bacillus, Pseudomonas, Micrococcus, Penicillium, Rhodotorula y se aisló una cepa de Cladosporium sp. en un medio selectivo con carboximetil celulosa. Así mismo, se encontraron ocho morfotipos de endomicorrizas, entre los cuales predominaron especies de Glomus y Acaulospora. Este estudio contribuye con el conocimiento de la microbiota cultivable de hojarasca, que ha sido poco explorada en ecosistemas de páramo.The count of cultivable microorganisms (bacteria and fungi, cellulolytic microorganisms and endomycorrhizas present in litter forest (property Puente de Tierra in the Guerrero’s moor, Colombia was made. The most frequently isolated microorganisms belonged to the Staphylococcus, Bacillus, Pseudomonas, Micrococcus, Penicillium and Rhodotorula genus and Cladosporium sp., which is a cellulolytic microorganism, was isolated in carboxymethyl cellulose agar. In addition eight morphotypes of endomycorrhizas were found, species of Glomus and Acaulospora predominated among them. This study contributes with the knowledge of the cultivable microorganisms of litter that have been little explored in moor ecosystems.

  4. Cellulose degrading bacteria isolated from industrial samples and the gut of native insects from Northwest of Argentina.

    Science.gov (United States)

    Manfredi, Adriana P; Perotti, Nora I; Martínez, María A

    2015-12-01

    The raw materials used to produce bioethanol mostly are food crops, which has led to conflicts on food security. It is, therefore, recommended the gradual replacement for second generation substrates such as lignocellulosic materials. Herein, cellulolytic bacteria were isolated from the gut content of native larvae from Lepidoptera, Coleoptera, and adults of Isoptera. Few environmental samples from the pulp and paper feedstock were also assessed. A total of 233 isolates were obtained using enrichment cultures and classic criteria. Interestingly, several halo-forming colonies were found to be bacterial consortia that presented difficulties to take apart the microbial members. Those pure isolates which hydrolyzed cellulose in larger extend (45 strains) were selected and identified by means of 16S rRNA sequence analysis. Firmicutes was the prevalent phylum (62.2%) being Bacillus spp. the most frequent genus, while Paenibacillus, Brevibacillus, Cohnella, and Staphylococcus species were less frequent. The phylum Actinobacteria (6.7%) was represented by isolates related to Agromyces spp. and Microbacterium spp. Regarding Gram-negative bacteria (31.1%), the more depicted genus was Pseudomonas spp., and members of Achromobacter spp., Enterobacter spp., and Bacteroidetes phylum were also selected. These native bacterial strains are expected to enlarge the cellulolytic toolbox for efficient biomass deconstruction. PMID:26370071

  5. Ruminococcus flavefaciens 007C cellulosomes and cellulase consortium

    Directory of Open Access Journals (Sweden)

    Maša VODOVNIK

    2015-11-01

    Full Text Available Ruminococcus flavefaciens is among the most important cellulolytic bacterial species in rumen and gastrointestinal tract of monogastric herbivorous animals. Its efficiency in degradation of (hemicellulosic substrates is associated with the production of remarkably intricate extracellular multienzyme complexes, named cellulosomes. In the present work we investigated the cellulolytic system of 007C. The bioinformatic analysis of the draft genome sequence revealed identical organization of sca gene cluster as has previously been found in four other strains of R. flavefaciens. The cluster consists of five genes in the following order: scaC-scaA-scaB-cttA-scaE. The cellulases of R. flavefaciens 007C belong to four families of glycoside hydrolases, namely GH48, GH44, GH9 in GH5. Majority of these enzymes are putative endoglucanases, belonging to families GH5 and GH9, whereas only one gene encoding GH44 and GH48 was found. Apart from catalytic domains, most of these proteins also contain dockerins – signature sequences, which indicate their attachement to cellulosomes. On the other hand, carbohydrate-binding modules were only found coupled to GH9 catalytic domains. Zymogram analysis showed that larger endoglucanases were mostly constitutively expressed, wheras smaller enzymes were only detected in later phases of Avicel-grown cultures.

  6. Cellulose-Enriched Microbial Communities from Leaf-Cutter Ant (Atta colombica Refuse Dumps Vary in Taxonomic Composition and Degradation Ability.

    Directory of Open Access Journals (Sweden)

    Gina R Lewin

    Full Text Available Deconstruction of the cellulose in plant cell walls is critical for carbon flow through ecosystems and for the production of sustainable cellulosic biofuels. Our understanding of cellulose deconstruction is largely limited to the study of microbes in isolation, but in nature, this process is driven by microbes within complex communities. In Neotropical forests, microbes in leaf-cutter ant refuse dumps are important for carbon turnover. These dumps consist of decaying plant material and a diverse bacterial community, as shown here by electron microscopy. To study the portion of the community capable of cellulose degradation, we performed enrichments on cellulose using material from five Atta colombica refuse dumps. The ability of enriched communities to degrade cellulose varied significantly across refuse dumps. 16S rRNA gene amplicon sequencing of enriched samples identified that the community structure correlated with refuse dump and with degradation ability. Overall, samples were dominated by Bacteroidetes, Gammaproteobacteria, and Betaproteobacteria. Half of abundant operational taxonomic units (OTUs across samples were classified within genera containing known cellulose degraders, including Acidovorax, the most abundant OTU detected across samples, which was positively correlated with cellulolytic ability. A representative Acidovorax strain was isolated, but did not grow on cellulose alone. Phenotypic and compositional analyses of enrichment cultures, such as those presented here, help link community composition with cellulolytic ability and provide insight into the complexity of community-based cellulose degradation.

  7. AISLAMIENTO Y SELECCIÓN DE BACTERIAS AUTÓCTONAS DE MANABÍ-ECUADOR CON ACTIVIDAD CELULOLÍTICA

    Directory of Open Access Journals (Sweden)

    Ángel M. Guzmán Cedeño

    2015-01-01

    Full Text Available The present study aimed to isolate and select bacteria with cellulolytic capacity, having future application as inoculum in the fibrous organic waste composting. Five sampling environments were considered: organic agriculture (AO, conventional agriculture (AQ, forest (BM; sugarcane area (RC and compost piles (AC. For bacterial isolation the nutrient agar medium was used changing the carbon source by cellulose. The main selection criterion of the bacterial isolates was the growth on above medium and its positive reaction to congo red test, showing clear zones around the colonies. The 93 bacterial isolates obtained were subjected to Gram staining, catalase test, presence of endospores and aerobically growth; having 70 bacteria Bacillus spp. like characteristics. Their cellulolytic activities were determined and 30 bacteria produced hydrolysis halo. Eight of these bacterial isolates were selected according to the largest halo production (AO-19, AO-28, AO-29, AQ-2, BM-7, RC-2, RC-6, CR-18 and their growth at different pH (3, 5, 7, 9 and temperatures (50 and 70 °C were evaluated. The bacteria AO-19 showed higher hydrolysis halo with 12,33 mm and growth stability at different pH and temperature levels, for which its growth dynamic and amylolytic and pectinolytic capacity was determined. According to results the bacteria AO-19 has potential to be used as inoculum in composting.

  8. Cost-effective production of biotechnologically important hydrolytic enzymes by Sporotrichum thermophile.

    Science.gov (United States)

    Bala, Anju; Singh, Bijender

    2016-01-01

    Economical production of xylanase and three cellulases, endo-β-1,4-glucanase (CMCase), exo-β-1,4-glucanase (FPase), β-glucosidase (BGL) was studied in submerged fermentation using cane molasses medium. A statistical optimization approach involving Plackett-Burman design and response surface methodology (RSM) resulted in the production of 72,410, 36,420, 32,420 and 5180 U/l of xylanase, CMCase, FPase and β-glucosidase, respectively. Optimization resulted in more than fourfold improvements in production of xylanolytic and cellulolytic enzymes. Scale up of enzymes production in shake flasks of varied volumes was sustainable, suggesting a good scope for large scale enzyme production. Addition of microparticles engineered fungal morphology and enhanced enzymes production. Xylanase of S. thermophile is a neutral xylanase displaying its optimal activity at 60 °C while all the cellulases are optimally active at pH 5.0 and 60 °C. The efficacy of enzyme cocktail in waste tea cup paper and rice straw hydrolysis showed that maximum sugar yield of 578.12 and 421.79 mg/g substrate for waste tea cup and rice straw, respectively, were achieved after 24 h. Therefore, concomitant production of cellulolytic and xylanolytic enzymes will be beneficial for the saccharification of lignocellulosics in generating both monomeric and oligomeric sugars for biofuels and other biotechnological applications. PMID:26581490

  9. Fundamental study of the mechanism and kinetics of cellulose hydrolysis by acids and enzymes

    Science.gov (United States)

    Gong, C. S.; Chang, M.

    1981-02-01

    There are three basic enzymes e.g., endoglucanase (C/sub x/), exoglucanase (C1) and cellobiase comprising the majority of extracellular cellulase enzymes produced by the cellulolytic mycelial fungi, Trichoderma reesei, and other cellulolytic microorganisms. The kinetics of cellobiase were developed on the basis of applying the pseudo-steady state assumption to hydrolyze cellobiose to glucose. The results indicated that cellobiase was bjected to end-product inhibition by glucose. The kinetic modeling of exoglucanase (C1) with respect to cellodextrins was studied. Both glucose and cellobiose were found to be inhibitors of this enzyme with cellobiose being a stronger inhibitor than glucose. Similarly, endoglucanase (C/sub x) is subject to end-product inhibition by glucose. Crystallinity of the cellulose affects the rate of hydrolysis by cellulases. Hence, the changes in crystallinity of cellulose in relation to chemical pretreatment and enzyme hydrolysis was compared. The study of cellulase biosynthesis resulted in the conclusion that exo-and endo-glucanases are coinduced while cellobiase is synthesized independent of the other two enzymes.

  10. Determinación de la actividad lignocelulolítica en sustrato natural de aislamientos fúngicos obtenidos de sabana de pastoreo y de bosque secundario de sabana inundable tropical Determination of lignocellulolytic activity in a natural substrate of native fungi strains obtained from savanna and of secondary forest from a tropical flooded savanna

    Directory of Open Access Journals (Sweden)

    Martha Lucía Ortiz Moreno

    2010-12-01

    Full Text Available El objetivo de este trabajo fue identificar aislamientos de hongos ligninolíticos y celulolíticos que pudieran degradar desechos de cosecha y mejorar las características del suelo en los Llanos Orientales, se realizó un muestreo siguiendo la metodología de transepto y muestras integradas. Se obtuvo una cepa ligninolítica (005L Verticillium spp. y 72 cepas celulolíticas. La comparación de los usos del suelo (sabana de pastoreo y bosque secundario mostró que no existía una relación entre el número de géneros obtenidos y las características del suelo. Posteriormente, se realizó la cuantificación de la actividad celulolítica y ligninolítica de los aislamientos para identificar las cepas que posteriormente serían evaluadas en el sustrato natural pasto seco (Brachiaria spp.. Se encontraron dos cepas con alta actividad exoglucanasa (055C y 061C Penicillium spp. y una cepa con alta actividad endoglucanasa (019C Trichoderma spp. respecto al control Trichoderma viride. En el sustrato natural se evaluaron los consorcios de las cepas seleccionadas formados por pares: una ligninolítica y una celulolítica. Las pruebas mostraron que los aislamientos promisorios aumentaron su actividad enzimática en el sustrato pasto superando a los controles positivos (Pleurotus ostreatus para lignina y T. viride para celulosa y que los consorcios no afectaron la capacidad enzimática de las cepas que los formaban. Por lo tanto, se recomienda utilizar estos consorcios para el desarrollo de biofertilizantes acondicionadores del suelo, empleando especialmente el consorcio formado por las cepas 005L (Verticillium spp. y 055C (Penicillium spp., que mostró alta actividad ligninolítica y celulolítica.The aim of this work was to identify lignolytic and cellulolytic fungal strains capable of degrading harvest waste and thereby improving the soil characteristics of the eastern Llanos of Colombia. Sampling was carried out using the transept methodology and

  11. Egg Brochosomes of Proconiini (Hemiptera: Cicadellidae, Cicadellinae species associated with cultivation of grapevines Brocossomos de ovos de espécies de Proconiini (Hemiptera: Cicadellidae, Cicadellinae associadas à cultura da videira

    Directory of Open Access Journals (Sweden)

    Wilson Sampaio de Azevedo Filho

    2008-04-01

    Full Text Available Brochosomes production is considered a feature of Cicadellidae, and may represent an outstanding innovation which has played an important role in the development and diversification of this insect group. The objective of this study was to identify the species of Proconiini that produced egg brochosomes associated with grapevines in the Serra Gaúcha region of Brazil. Egg brochosome characteristics and an identification key are also discussed. The specimens were collected using yellow sticky cards in four vineyards (Vitis vinifera L. from October 2004 to May 2006. Eight species capable of producing egg brochosomes were identified:Acrogonia citrina Marucci & Cavichioli; Homalodisca ignorata Melichar; Molomea consolida Schröder; Molomea lineiceps Young; Molomea personata (Signoret; Oncometopia facialis (Signoret; Oncometopia fusca Melichar; and Tapajosa rubromarginata (Signoret. Egg brochosomes are useful structures to identify Proconiini species in vine.A produção de brocossomos é considerada uma característica dos Cicadellidae e pode representar uma inovação importante no desenvolvimento e diversificação deste grupo. O objetivo do estudo foi identificar as espécies de Proconiini formadoras de brocossomos de ovos associadas à cultura da videira na região da Serra Gaúcha. As características dos brocossomos de ovos e uma chave para identificação também são discutidas. Os espécimes foram coletados com cartões adesivos amarelos em quatro vinhedos (Vitis vinifera L. no período de outubro de 2004 a maio de 2006. Foram identificadas oito espécies com capacidade de produzir brocossomos de ovos: Acrogonia citrina Marucci & Cavichioli; Homalodisca ignorata Melichar; Molomea consolida Schröder; Molomea lineiceps Young; Molomea personata (Signoret; Oncometopia facialis (Signoret; Oncometopia fusca Melichar e Tapajosa rubromarginata (Signoret. Os brocossomos de ovos são estruturas que podem ser utilizadas na identificação de esp

  12. MaxBin: an automated binning method to recover individual genomes from metagenomes using an expectation-maximization algorithm

    Science.gov (United States)

    2014-01-01

    Background Recovering individual genomes from metagenomic datasets allows access to uncultivated microbial populations that may have important roles in natural and engineered ecosystems. Understanding the roles of these uncultivated populations has broad application in ecology, evolution, biotechnology and medicine. Accurate binning of assembled metagenomic sequences is an essential step in recovering the genomes and understanding microbial functions. Results We have developed a binning algorithm, MaxBin, which automates the binning of assembled metagenomic scaffolds using an expectation-maximization algorithm after the assembly of metagenomic sequencing reads. Binning of simulated metagenomic datasets demonstrated that MaxBin had high levels of accuracy in binning microbial genomes. MaxBin was used to recover genomes from metagenomic data obtained through the Human Microbiome Project, which demonstrated its ability to recover genomes from real metagenomic datasets with variable sequencing coverages. Application of MaxBin to metagenomes obtained from microbial consortia adapted to grow on cellulose allowed genomic analysis of new, uncultivated, cellulolytic bacterial populations, including an abundant myxobacterial population distantly related to Sorangium cellulosum that possessed a much smaller genome (5 MB versus 13 to 14 MB) but has a more extensive set of genes for biomass deconstruction. For the cellulolytic consortia, the MaxBin results were compared to binning using emergent self-organizing maps (ESOMs) and differential coverage binning, demonstrating that it performed comparably to these methods but had distinct advantages in automation, resolution of related genomes and sensitivity. Conclusions The automatic binning software that we developed successfully classifies assembled sequences in metagenomic datasets into recovered individual genomes. The isolation of dozens of species in cellulolytic microbial consortia, including a novel species of

  13. Response surface optimization for enhanced production of cellulases with improved functional characteristics by newly isolated Aspergillus niger HN-2.

    Science.gov (United States)

    Oberoi, Harinder Singh; Rawat, Rekha; Chadha, Bhupinder Singh

    2014-01-01

    Fungi isolated from partially decayed wood log samples showing characteristic diversity for spore colour, colony morphology and arrangement of spores were assessed for cellulolytic enzyme production. Isolates showing a cellulolytic index of ≥2.0 were assayed for filter paper (FP) cellulase and β-glucosidase (BGL) production. Molecular characterization confirmed the identity of the selected cellulolytic isolate as a strain of Aspergillus niger (A. niger HN-2). Addition of 2 % (w/v) urea enhanced FP and BGL activity by about 20 and 60 %, respectively. Validation studies conducted at parameters (29 °C, pH 5.4, moisture content 72 % and 66 h) optimized through response surface methodology in a solid-state static tray fermentation resulted in FP, BGL, cellobiohydrolase I (CBHI), endoglucanase (EG), xylanase activity and protein content of 25.3 FPU/g ds, 750 IU/g ds, 13.2 IU/g ds, 190 IU/g ds, 2890 IU/g ds and 0.9 mg/ml, respectively. In comparison, A. niger N402 which is a model organism for growth and development studies, produced significantly lower FP, BGL, CBHI, EG, xylanase activity and protein content of 10.0 FPU/g ds, 100 IU/g ds, 2.3 IU/g ds, 50 IU/g ds, 500 IU/g ds and 0.75 mg/ml, respectively under the same process conditions as were used for A. niger HN-2. Process optimization led to nearly 1.8- and 2.2-fold increase in FP and BGL activity, respectively showing promise for cellulase production by A. niger HN-2 at a higher scale of operation. Zymogram analysis revealed two isoforms each for EG and cellobiohydrolase and three isoforms for BGL. Crude cellulase complex produced by A. niger HN-2 exhibited thermostability under acidic conditions showing potential for use in biofuel industry. PMID:24158534

  14. The Mycoparasite Ampelomyces quisqualis Expresses exgA Encoding an exo-beta-1,3-Glucanase in Culture and During Mycoparasitism.

    Science.gov (United States)

    Rotem, Y; Yarden, O; Sztejnberg, A

    1999-08-01

    ABSTRACT Ampelomyces quisqualis, a mycoparasite of fungi causing powdery mildews, exhibited high levels of extracellular exo-beta-1,3-glucanase activity in culture compared with Neurospora crassa and Gliocladium roseum. A. quisqualis culture filtrates affected powdery mildew caused by Sphaerotheca fusca in a manner indicative of cell wall degradation, as determined by microscopic examination. A gene encoding an exo-beta-1,3-glucanase in A. quisqualis, designated exgA, was isolated and sequenced. The predicted polypeptide deduced from exgA had 46, 42, and 30% identity with amino acid sequences of Trichoderma harzianum exo-beta-1,3-glucanase and Cochliobolus carbonum EXG1 (both encoding exo-beta-1,3-glucanase) and T. harzianum bng13.1 (encoding an endo-beta-1,3-glucanase), respectively. The exgA gene had a predicted molecular mass of 84 kDa and a pI of 4.79. The gene was expressed during the late stages of growth in culture, and transcription was induced by fungal cell wall components. Transcript levels for exgA were present during late stages of hyperpar-asitism and were abundant along A. quisqualis mycelium and were slightly less abundant in A. quisqualis pycnidia. PMID:18944674

  15. Ecological Factors Acting on the Microfauna in Mangrove Swamps. The Case of Foraminiferal Assemblages in French Guiana

    Science.gov (United States)

    Debenay, J.-P.; Guiral, D.; Parra, M.

    2002-10-01

    Thirty-seven surface sediment samples were collected in January 1999 and July 2000 in the mangrove swamps and mud flats of French Guiana where strong seasonal contrasts occur. Sampling stations were selected to provide information on the foraminiferal assemblages associated with different environmental conditions, on the mud banks and in the mangrove forest. A total of 44 species have been identified. The main parameter acting on the distribution of foraminiferal assemblages is the hydrodynamics of the estuary, characterized by the double influence of coastal water and low-Ca fresh water, with drastic seasonal changes. The coastal end member is dominated by the calcareous species Ammonia tepida, A. parkinsoniana and Cribroelphidium spp., the continental (freshwater) end member is characterized by Miliammina fusca and Trochamminita irregularis . The calcareous species penetrate into the estuary, even into the mangrove forest during the dry season, but totally disappear from the estuary during the rainy season. The second parameter acting on the distribution of foraminiferal assemblages is the vertical elevation that acts indirectly by influencing the time of aerial exposure and the colonization by mangrove trees. Both canopy and litter of the mangrove forest protect the sediment from heating, drying and increases in salinity due to sun and wind. Foraminifera are very rare or absent on the open mud banks affected by mud cracks, but begin to grow as soon as young Avicennia are present. In the mangrove swamps, local conditions influence the composition of the assemblages and the taphonomic processes.

  16. Microfaunal indicators, Ciliophora phylogeny and protozoan population shifts in an intermittently aerated and fed bioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Ntougias, Spyridon, E-mail: sntougia@env.duth.gr [Democritus University of Thrace, Department of Environmental Engineering, Laboratory of Wastewater Management and Treatment Technologies, Vas. Sofias 12, 67100 Xanthi (Greece); Tanasidis, Spartakos; Melidis, Paraschos [Democritus University of Thrace, Department of Environmental Engineering, Laboratory of Wastewater Management and Treatment Technologies, Vas. Sofias 12, 67100 Xanthi (Greece)

    2011-02-28

    Microfauna community structure was examined in the mixed liquor of a bench-scale bioreactor equipped with an intermittent aeration and feeding system. The reactor was operated under an intermittent aeration of 25 min in every 1 h and varying feeding conditions (0.264, 0.403 and 0.773 kg BOD{sub 5}/m{sup 3} d). A total of 14 protozoan and metazoan taxa were identified by microscopic examination. Sessile ciliates, followed by crawling ciliates, were the major protozoan groups under 0.403 kg BOD{sub 5}/m{sup 3} d organic loading conditions, while sessile ciliate population was remarkably increased under an organic loading of 0.773 kg BOD{sub 5}/m{sup 3} d. Principal Component Analysis and Pearson correlation coefficient tests were performed in order to reveal relationships between microfauna community and operational parameters. Ciliophora specific-18S rRNA gene clone library was constructed to identify ciliate diversity under 0.773 kg BOD{sub 5}/m{sup 3} d organic loading conditions. Ciliophora diversity consisted of members of Aspidiscidae, Epistylidae, Opisthonectidae and Vorticellidae, with the majority of the clones being associated with the species Vorticella fusca. At least one novel phylogenetic linkage among Ciliophora was identified. Comparisons made after molecular characterization and microscopic examination of Ciliophora community showed that the estimation of broad ciliate groups is useful for ecological considerations and evaluation of the operational conditions in wastewater treatment plants.

  17. Tsetse ecology in a Liberian rain-forest focus of Gambian sleeping sickness.

    Science.gov (United States)

    Kaminsky, R

    1987-07-01

    Investigations on tsetse ecology were undertaken in Bong County of Liberia during the dry season, October 1981 to February 1982, around villages where the human infection rate with Trypanosoma brucei gambiense Dutton was about 2%. Most tsetse captured in biconical traps were Glossina palpalis Robineau-Desvoidy and G. pallicera Bigot, with relatively few G. fusca Walker and G. nigrofusca Newstead. Swamps and water-gathering places were predominant habitats of all four species, but tsetse were also found in coffee and cocoa plantations. Breeding-places of G. palpalis were found in the leaf axils of oilpalm trees (Elaeis guineensis Jacquin), especially beside paths where people would risk being bitten. Bloodmeals of twenty-nine wild-caught G. palpalis were identified as mostly from man (fifteen) and bushbuck (Tragelaphus scriptus (Pallas] or other wild ruminants (eleven), plus three from reptiles. It is concluded that man may be the principal host of tsetse in the area, while man or bushbuck could be the main reservoir to T.b. gambiense infection. Most of the activity of G. palpalis occurs in the early afternoon from noon to 16.00 hours. Mean life-span of G. palpalis and G. pallicera, estimated from wing-fray age-groups, was consistent with the females, and to a lesser degree the males, having vector potential. PMID:2979539

  18. Availability of microhabitats for Myxomycetes in the Atlantic Forest: Bromeliaceae

    Directory of Open Access Journals (Sweden)

    Inaldo do Nascimento Ferreira

    2010-09-01

    Full Text Available Some species belonging to the Bromeliaceae family are called tank-bromeliads, due to the arrangement of its leave in rosettes that accumulate water and organic debris, allowing the development of diversified organisms. Considering that information about the presence of myxomycetes on Bromeliaceae is scarce, we evaluated the availability and occupation of microhabitats for these organisms offered by bromeliads in fragments of Atlantic Forest located in the Pernambuco Endemism Center. Sampling of sporocarps and substrates for cultivation in moist chambers was carried out at the Janga Ecological Reserve (Paulista Municipality, Tapacurá Ecological Station (São Lourenço da Mata Municipality and Mata do Estado (São Vicente Férrer Municipality, between 2007 and 2008. Ten species were present in the dead parts of representatives of Bromelioideae and Tillandsioideae: Arcyria cinerea, Craterium leucocephalum, C. paraguayense, Cribraria intricata, Diachea silvaepluvialis, Hemitrichia serpula, Physarum compressum, P. nucleatum, Stemonitis fusca and Trichia affinis. All taxa are newly reported for the sites studied, including rare species in Brazil, such as D. silvaepluvialis. The microhabitat studied had high taxonomic diversity, and the species recorded in it were rare or occasional.

  19. Biofilm inhibition activity of compounds isolated from two Eunicea species collected at the Caribbean Sea

    Directory of Open Access Journals (Sweden)

    Yenny Martínez Díaz

    2015-12-01

    Full Text Available Abstract Biofilm has a primary role in the pathogenesis of diseases and in the attachment of multicellular organisms to a fouled surface. Because of that, the control of bacterial biofilms has been identified as an important target. In the present study, five lipid compounds isolated from soft coral Eunicea sp. and three terpenoids together with a mixture of sterols from Eunicea fusca collected at the Colombian Caribbean Sea showed different effectiveness against biofilm formation by three marine bacteria associated with immersed fouled surfaces, Ochrobactrum pseudogringnonense,Alteromona macleodii and Vibrio harveyi, and against two known biofilm forming bacteria, Pseudomonas aeruginosa ATCC 27853 and Staphylococcus aureus ATCC 25923. The pure compounds were characterized by NMR, HRESI-MS, HRGC-MS and optical rotation. The most effective compounds were batyl alcohol (1 and fuscoside E peracetate (6, acting against four strains without affecting their microbial growth. Compound 1 showed biofilm inhibition greater than 30% against A. macleodii, and up to 60% against O. pseudogringnonense,V. harveyi and S. aureus. Compound 6 inhibited O. pseudogringnonense and V. harveyi between 25 and 50%, and P. aeruginosa or S. aureus up to 60% at 0.5 mg/ml. The results suggest that these compounds exhibit specific biofilm inhibition with lower antimicrobial effect against the bacterial species assayed.

  20. Screening for estrogenic and antiestrogenic activities of plants growing in Egypt and Thailand

    Directory of Open Access Journals (Sweden)

    Ali M El-Halawany

    2011-01-01

    Full Text Available Background: There is a growing demand for the discovery of new phytoestrogens to be used as a safe and effective hormonal replacement therapy. Materials and Methods: The methanol extracts of 40 plants from the Egyptian and Thailand folk medicines were screened for their estrogen agonist and antagonist activities. The estrogenic and antiestrogenic effects of the tested extracts were carried out using the yeast two-hybrid assay system expressing ERα and ERβ. In addition, all the extracts were subjected to a naringinase treatment and retested for their estrogenic activity. Results: The methanol extracts of Derris reticulata and Dracaena lourieri showed the most potent estrogenic activity on both estrogen-receptor subtypes, while, the methanol extracts of Butea monosperma, Erythrina fusca, and Dalbergia candenatensis revealed significant estrogenic activity on ERβ only. Nigella sativa, Sophora japonica, Artabotrys harmandii, and Clitorea hanceana showed estrogenic effect only after naringinase treatment. The most potent antiestrogenic effect was revealed by Aframomum melegueta, Dalbergia candenatensis, Dracena loureiri, and Mansonia gagei.

  1. Prey-induced changes in the accumulation of amino acids and phenolic metabolites in the leaves of Drosera capensis L.

    Science.gov (United States)

    Kováčik, Jozef; Klejdus, Bořivoj; Stork, František; Hedbavny, Josef

    2012-04-01

    Effect of prey feeding (ants Formica fusca) on the quantitative changes in the accumulation of free amino acids, soluble proteins, phenolic metabolites and mineral nutrients in the leaves of carnivorous plant Drosera capensis was studied. Arginine was the most abundant compound in Drosera leaves, while proline was abundant in ants. The amount of the majority of amino acids and their sum were elevated in the fed leaves after 3 and 21 days, and the same, but with further enhancement after 21 days, was observed in ants. Accumulation of amino acids also increased in young non-fed leaves of fed plants. Soluble proteins decreased in ants, but were not enhanced in fed leaves. This confirms the effectiveness of sundew's enzymatic machinery in digestion of prey and suggests that amino acids are not in situ deposited, but rather are allocated within the plant. The content of total soluble phenols, flavonoids and two selected flavonols (quercetin and kaempferol) was not affected by feeding in Drosera leaves, indicating that their high basal level was sufficient for the plant's metabolism and prey-induced changes were mainly N based. The prey also showed to be an important source of other nutrients besides N, and a stimulation of root uptake of some mineral nutrients is assumed (Mg, Cu, Zn). Accumulation of Ca and Na was not affected by feeding. PMID:21140278

  2. Maize Cob Rot in Kenya and Its Association with Stalk Borer Damage

    International Nuclear Information System (INIS)

    Cob rots are a major cause of crop loss in areas such as western Kenya that experience prolonged rainfall during the period of crop maturation. Cob rot fungi cause spoilage of the grain and some of them produce mycotoxins which can pose a health risk to humans and animals consuming foods prepared from contaminate grain. survey conducted in western Kenya in 1998 showed that cob rot incidence exceeded 20%. In the following year when rainfall was greater around the harvest period, cob rot fungi affected 68% of cobs. in 1998 stalk borer larvae (mainly Busseola fusca) damaged 20% of the cobs and there was a strong correlation (R= 0.87) between cob rot incidence and borer damage. In 1999 almost half of the cobs sampled showed evidence of borer damage. The result indicate that the high cob rot incidence in this pert of Kenya is due to stalk bore damage, which predisposes the cobs to fungal infection, and that management of the borer would greatly decrease cob rot incidence

  3. Leopard (Panthera pardus) status, distribution, and the research efforts across its range.

    Science.gov (United States)

    Jacobson, Andrew P; Gerngross, Peter; Lemeris, Joseph R; Schoonover, Rebecca F; Anco, Corey; Breitenmoser-Würsten, Christine; Durant, Sarah M; Farhadinia, Mohammad S; Henschel, Philipp; Kamler, Jan F; Laguardia, Alice; Rostro-García, Susana; Stein, Andrew B; Dollar, Luke

    2016-01-01

    The leopard's (Panthera pardus) broad geographic range, remarkable adaptability, and secretive nature have contributed to a misconception that this species might not be severely threatened across its range. We find that not only are several subspecies and regional populations critically endangered but also the overall range loss is greater than the average for terrestrial large carnivores. To assess the leopard's status, we compile 6,000 records at 2,500 locations from over 1,300 sources on its historic (post 1750) and current distribution. We map the species across Africa and Asia, delineating areas where the species is confirmed present, is possibly present, is possibly extinct or is almost certainly extinct. The leopard now occupies 25-37% of its historic range, but this obscures important differences between subspecies. Of the nine recognized subspecies, three (P. p. pardus, fusca, and saxicolor) account for 97% of the leopard's extant range while another three (P. p. orientalis, nimr, and japonensis) have each lost as much as 98% of their historic range. Isolation, small patch sizes, and few remaining patches further threaten the six subspecies that each have less than 100,000 km(2) of extant range. Approximately 17% of extant leopard range is protected, although some endangered subspecies have far less. We found that while leopard research was increasing, research effort was primarily on the subspecies with the most remaining range whereas subspecies that are most in need of urgent attention were neglected. PMID:27168983

  4. Crystal structure and biochemical characterization of Chlamydomonas FDX2 reveal two residues that, when mutated, partially confer FDX2 the redox potential and catalytic properties of FDX1.

    Science.gov (United States)

    Boehm, Marko; Alahuhta, Markus; Mulder, David W; Peden, Erin A; Long, Hai; Brunecky, Roman; Lunin, Vladimir V; King, Paul W; Ghirardi, Maria L; Dubini, Alexandra

    2016-04-01

    The green alga Chlamydomonas reinhardtii contains six plastidic [2Fe2S]-cluster ferredoxins (FDXs), with FDX1 as the predominant isoform under photoautotrophic growth. FDX2 is highly similar to FDX1 and has been shown to interact with specific enzymes (such as nitrite reductase), as well as to share interactors with FDX1, such as the hydrogenases (HYDA), ferredoxin:NAD(P) reductase I (FNR1), and pyruvate:ferredoxin oxidoreductase (PFR1), albeit performing at low catalytic rates. Here we report the FDX2 crystal structure solved at 1.18 Å resolution. Based on differences between the Chlorella fusca FDX1 and C. reinhardtii FDX2 structures, we generated and purified point-mutated versions of the FDX2 protein and assayed them in vitro for their ability to catalyze hydrogen and NADPH photo-production. The data show that structural differences at two amino acid positions contribute to functional differences between FDX1 and FDX2, suggesting that FDX2 might have evolved from FDX1 toward a different physiological role in the cell. Moreover, we demonstrate that the mutations affect both the midpoint potentials of the FDX and kinetics of the FNR reaction, possibly due to altered binding between FDX and FNR. An effect on H2 photo-production rates was also observed, although the kinetics of the reaction were not further characterized. PMID:26526668

  5. Solar energy conversion by green microalgae: a photosystem for hydrogen peroxide production.

    Science.gov (United States)

    de la Rosa, F F; Montes, O; Galván, F

    2001-09-20

    A photosystem for solar energy conversion, comprised of a culture of green microalgae supplemented with methyl viologen, is proposed. The capture of solar energy is based on the Mehler reaction. The reduction of methyl viologen by the photosynthetic apparatus and its subsequent reoxidation by oxygen produces hydrogen peroxide. This is a rich-energy compound that can be used as a nonpollutant and efficient fuel. Four different species of green microalgae, Chlamydomonas reinhardtii (21gr) C. reinhardtii (CW15), Chlorella fusca, and Monoraphidium braunii, were tested as a possible biocatalyst. Each species presented a different efficiency level in the transformation of energy. Azide was an efficient inhibitor of the hydrogen peroxide scavenging system while maintaining photosynthetic activity of the microalgae, and thus significantly increasing the production of the photosystem. The strain C. reinhardtii (21gr), among the species studied, was the most efficient with an initial production rate of 185 micromol H(2)O(2)/h x mg Chl and reaching a maximum of 42.5 micromol H(2)O(2)/mg Chl when assayed in the presence of azide inhibitor. PMID:11494222

  6. Insectes ravageurs et propriétés biocides de Jatropha curcas L. (Euphorbiaceae : synthèse bibliographique

    Directory of Open Access Journals (Sweden)

    Abdoul Habou, Z.

    2013-01-01

    Full Text Available Insect pests and biocidal properties of Jatropha curcas L. (Euphorbiaceae. A review. Jatropha curcas is a Euphorbiaceae shrub widely distributed in many tropical countries. Its seeds are rich in oil that can be used as biofuel in modified diesel engines. Several insect species, mainly belonging to Hemiptera, Coleoptera and Orthoptera, have been referenced as insect pests of J. curcas. These insects attack the plant and cause damage to fruits, inflorescences and leaves. The most frequently observed pests belong to the genus Pachycoris (Heteroptera: Scutelleridae, which are widely distributed in Mexico, Australia, United States of America, Brazil and Nicaragua. Pachycoris spp. cause significant damage to the fruits, leading to the malformation of seeds and a reduction in their oil content. Although Jatropha shrubs are subjected to insect infestations, the oil has been shown to demonstrate biocidal activity, including insecticidal effects against several insect pests, including Busseola fusca (Fuller (Lepidoptera: Noctuidae, Sesamia calamistis Hampson (Lepidoptera: Noctuidae, Aphis gossypii Glover (Homoptera: Aphididae and Callosobruchus chinensis L. (Coleoptera: Bruchidae. In the present paper, we summarize the work carried out on inventories of J. curcas insect pests as well as on the biocidal activity of its oil.

  7. Experiences in management of area-wide control of Glossina palpalis palpalis (Diptera: Glossinidae) in Ghana using bait technology and releases of sterile males

    International Nuclear Information System (INIS)

    Ghana is infested with ten species of morsitans, palpalis and fusca groups of tsetse fly in approximately 37% of the country including areas where mixed farming is practiced, hence making animal trypanosomiasis a major constraint to rural agricultural production and other socioeconomic development. There have been many tsetse and trypanosomiasis control schemes implemented since the 1920s using a variety of methods. In the control of animal trypanosomiasis, the country has relied mainly on chemotherapy and chemoprophylaxis regimes using homidium chloride (Novidium), diaminazene aceturate (Berenil) and isometamidium chloride (Samorin) in cattle, goats and sheep, keeping of trypanotolerant cattle and game elimination. Methods for tsetse control include discriminate bush clearance, settlements and land use, insecticidal dips, ground spraying of tsetse habitats with insecticides, use of traps of various designs, insecticide-impregnated biconical traps, screens and targets and pour-ons. Despite successes in the various control programmes, the magnitude of the tsetse and trypanosomiasis problem is increasing due to the advance of tsetse flies into previously uninfested areas and development of drug resistance by trypanosome parasites to different types of trypanocidal drugs in use in Ghana. Sustainable tsetse and trypanosomiasis control require the use of appropriate strategies which take into account the environmental and socioeconomic considerations to facilitate adequate community participation. In the 1983 Ghana entered into a Technical Assistance Cooperation Programme with IAEA to provide technical support for the control of riverine tsetse flies in critical cattle-rearing areas in the northern sector of the country

  8. Co-existence and interaction between myxomycetes and other organisms in shared niches

    Directory of Open Access Journals (Sweden)

    Irina O. Dudka

    2013-12-01

    Full Text Available The ecology of myxomycetes co-existing with the Latridiidae (Coleoptera, bryophytes and ascomycetous, basidiomycetous and anamorphic fungi were studied in Crimea and at different locations on the left bank of Ukraine. Results from the left bank indicate that the Latridiidae feed on myxomycetes. Colonies of the most common 13 myxomycete species (which included Stemonitis axifera (Bull. Macbr., S. fusca Roth, S. splendens Rost., Fuligo septica (L. Wigg. and Mucilago crustacea Wigg. were inhabited by 5 species of the Latridiidae. Myxomycete spores were present in guts of 19 of the 25 beetle specimens investigated. Beetles Latridius hirtus, Enicmus rugosus and E fungicola seem to be obligate myxomycete feeders, while Corticarina truncatella was clearly facultative. 13 species of myxomycetes were recorded on 9 species of moss and 3 species of liverwort developing on decaying wood or bark in the Crimean Nature Reserve. Relations between myxomycetes and bryophytes on woody substrata are spatial rather than trophic, and are possibly regulated by specific microclimatic conditions inside bryophyte thallomes. 69 species of myxomycetes were found co-existing with 36 species of ascomycetes, 21 species of basidiomycetes and 9 species of anamorphic fungi in the Crimean Nature Reserve. Associations formed by myxomycetes and fungi on different woody substrata are analyzed.

  9. Heterogeneity of Soil and Vegetation in the Urban Habitats of New Industrial Cities in the Desert Landscape of Egypt

    Directory of Open Access Journals (Sweden)

    Monier Abd EL-GHANI

    2015-03-01

    Full Text Available The relationship between vegetation and soil supporting the habitats in 4 new industrial cities were assessed. Five main habitats were distinguished from inner city toward outskirts: lawns, home gardens, public gardens, waste lands and desert outskirts. After application of Twinspan, 26 vegetation groups were identified in the 5 recognized habitats, demonstrating that some groups are chatracteristic of a certain city, e.g. Asphodelus aestivus - Deverra tortuosa - Thymelaea hirsuta group was confined to the desert habitat of Burg El-Arab city; Thymelaea hirsuta - Linaria albifrons and Atriplex halimus - Atriplex lindleyi subsp. inflata - Suaeda vermiculata - Typha domingensis groups were found in the waste lands of Burg El-Arab city; Conyza bonariensis - Cynodon dactylon - Sonchus oleraceus group in the home garden habitat of 10th Ranadan city; Cynodon dactylon group in the lawns of Burg El-Arab city; Bassia indica - Plantago major group in the public gardens of Burg El-Arab city; Oxalis corniculata - Plantago lagopus group in the public gardens of 10th Ramadan city; Sonchus oleraceus - Cynodon dactylon and Dactyloctenium aegyptium - Leptochloa fusca - Phragmites australis groups in the public gardens of 6th October city. Silt, clay, organic matter, carbonates and carbon contents showed significant diffrences among the 5 habitats.

  10. Structural and Functional Characterizations of SsgB, a Conserved Activator of Developmental Cell Division in Morphologically Complex Actinomycetes

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Qingping; Traag, Bjørn A.; Willemse, Joost; McMullan, Daniel; Miller, Mitchell D.; Elsliger, Marc-André; Abdubek, Polat; Astakhova, Tamara; Axelrod, Herbert L.; Bakolitsa, Constantina; Carlton, Dennis; Chen, Connie; Chiu, Hsiu-Ju; Chruszcz, Maksymilian; Clayton, Thomas; Das, Debanu; Deller, Marc C.; Duan, Lian; Ellrott, Kyle; Ernst, Dustin; Farr, Carol L.; Feuerhelm, Julie; Grant, Joanna C.; Grzechnik, Anna; Grzechnik, Slawomir K.; Han, Gye Won; Jaroszewski, Lukasz; Jin, Kevin K.; Klock, Heath E.; Knuth, Mark W.; Kozbial, Piotr; Krishna, S. Sri; Kumar, Abhinav; Marciano, David; Minor, Wladek; Mommaas, A. Mieke; Morse, Andrew T.; Nigoghossian, Edward; Nopakun, Amanda; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Puckett, Christina; Reyes, Ron; Rife, Christopher L.; Sefcovic, Natasha; Tien, Henry J.; Trame, Christine B.; van den Bedem, Henry; Wang, Shuren; Weekes, Dana; Hodgson, Keith O.; Wooley, John; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.; van Wezel, Gilles P.; (Leiden-MC); (SLAC); (Scripps); (UV); (UCSD); (Burnham)

    2010-01-20

    SsgA-like proteins (SALPs) are a family of homologous cell division-related proteins that occur exclusively in morphologically complex actinomycetes. We show that SsgB, a subfamily of SALPs, is the archetypal SALP that is functionally conserved in all sporulating actinomycetes. Sporulation-specific cell division of Streptomyces coelicolor ssgB mutants is restored by introduction of distant ssgB orthologues from other actinomycetes. Interestingly, the number of septa (and spores) of the complemented null mutants is dictated by the specific ssgB orthologue that is expressed. The crystal structure of the SsgB from Thermobifida fusca was determined at 2.6 {angstrom} resolution and represents the first structure for this family. The structure revealed similarities to a class of eukaryotic 'whirly' single-stranded DNA/RNA-binding proteins. However, the electro-negative surface of the SALPs suggests that neither SsgB nor any of the other SALPs are likely to interact with nucleotide substrates. Instead, we show that a conserved hydrophobic surface is likely to be important for SALP function and suggest that proteins are the likely binding partners.

  11. Influence of Dietary Experience on the Induction of Preference of Adult Moths and Larvae for a New Olfactory Cue.

    Directory of Open Access Journals (Sweden)

    Christophe Petit

    Full Text Available In Lepidoptera, host plant selection is first conditioned by oviposition site preference of adult females followed by feeding site preference of larvae. Dietary experience to plant volatile cues can induce larval and adult host plant preference. We investigated how the parent's and self-experience induce host preference in adult females and larvae of three lepidopteran stem borer species with different host plant ranges, namely the polyphagous Sesamia nonagrioides, the oligophagous Busseola fusca and the monophagous Busseola nairobica, and whether this induction can be linked to a neurophysiological phenotypic plasticity. The three species were conditioned to artificial diet enriched with vanillin from the neonate larvae to the adult stage during two generations. Thereafter, two-choice tests on both larvae and adults using a Y-tube olfactometer and electrophysiological (electroantennography [EAG] recordings experiments on adults were carried out. In the polyphagous species, the induction of preference for a new olfactory cue (vanillin by females and 3rd instar larvae was determined by parents' and self-experiences, without any modification of the sensitivity of the females antennae. No preference induction was found in the oligophagous and monophagous species. Our results suggest that lepidopteran stem borers may acquire preferences for new olfactory cues from the larval to the adult stage as described by Hopkins' host selection principle (HHSP, neo-Hopkins' principle, and the concept of 'chemical legacy.'

  12. Diversity and abundance of water birds in a subarctic lake during three decades

    Directory of Open Access Journals (Sweden)

    Anders Klemetsen

    2013-12-01

    Full Text Available The numbers of divers, ducks, gulls, terns and waders in the 15 km2 oligotrophic lake Takvatn, North Norway were estimated six times during 1983-2012. Systematic mapping surveys were done by boat within the first week after ice-break in June. Twenty-one species were observed over the years and 12 were regarded as breeding on the lake. Red-breasted merganser Mergus serrator was the dominant diving bird, with estimated minimum number of pairs varying from 15 to 39 among years. Black-throated diver Gavia arctica (1-3 pairs, tufted duck Aythya fuligula (2-15 pairs and common scoter Melanitta nigra (1-5 pairs bred regularly, while velvet scoter Melanitta fusca (1-2 and goldeneye Bucephala clangula (2-4 were found in some years and mallard Anas platyrhynchos (1 pair and wigeon Anas penelope (1 pair in one year. Common gull Larus canus (6-30 pairs and arctic tern Sterna paradisaea (2-35 pairs bred in all years. Common sandpiper Tringa hypoleucos (3-9 pairs and redshank Tringa totanus (1-4 pairs were regular waders. Density variations of mergansers, gulls and terns are possibly related to density variations of three-spined sticklebacks Gasterosteus aculeatus, their dominant fish prey. The water birds are important links in the food web of the lake.

  13. Lichen communities as bioindicators of the Aburra Valley air quality

    International Nuclear Information System (INIS)

    Lichens have been used as bioindicators of air quality. They are sensitive to changes in air composition at any given site affecting their abundance, biomass and vitality.This study evaluated lichen affectation as a consequence of air pollution. Two study areas within the Aburra Valley and the RedAire network were selected: Miguel Aguinaga (high pollution station) and the Medellin University (low pollution station). Four phorophytic tree species were chosen at each site Terminalia catappa Linneaus, Eritrina fusca Loureiro, Mangifera indica Linneaus y Fraxinus chinensis Roxb. The lichen cover by species, the vitality and the fructification were used to analyze the effect of air pollution. Finally, the lichen cover information was used to calculate the index of atmospheric purity (IAP) and the Q factor determination. Total qualitative and quantitative information obtained made evident that Canoparmelia sp. and Parmotrema austrosinensis (Zahlbr) Hale. lichen species are the most sensitive, and therefore appropriate to assess air quality. Additionally, the statistical analysis carried out using the relative abundances by phorophytic trees, showed that Fraxinus chinensis Roxb is the most appropriate tree species for bioindicator lichens studies into the Aburra valley.

  14. Selection of a Thermophilic Alkalitolerant Actinomycete and Conditions for CMCase Production

    Institute of Scientific and Technical Information of China (English)

    QI Yun; ZHAO Lin; LIAO Yinzhang; TAN Xin

    2005-01-01

    Five thermophilic strains that can degrade cellulose were isolated from the compost of a waste management in Guangzhou, China. Since one of them degraded cellulose effectively, it was chosen as the study strain. Based on its morphology, spores′ susceptibility to heat, cell wall composition and other characteristics, the organism was classified as Thermomonospora fusca. Conditions for production of carboxy methyl cellulase (CMCase) were examined. The optimal temperature and pH value for enzyme production were 50 ℃ and 10.5, respectively. Cellulosic materials and easily metabolisable carbohydrates served as carbon sources for the growth of the strain. Only cotton, avicel,carboxy methyl cellulose (CMC) acted as potent inducers for the production of cellulases by this strain. Despite excellent growth on easily metabolisable carbohydrates, only constitutive levels of cellulases were produced. The optimal carbon and nitrogen sources for CMCase production were cotton and soybean respectively. The high thermostability, wide pH stability, and cheap nitrogen source show well potential use for composting treatment and commercial detergents.

  15. The loop structure of Actinomycete glycoside hydrolase family 5 mannanases governs substrate recognition.

    Science.gov (United States)

    Kumagai, Yuya; Yamashita, Keitaro; Tagami, Takayoshi; Uraji, Misugi; Wan, Kun; Okuyama, Masayuki; Yao, Min; Kimura, Atsuo; Hatanaka, Tadashi

    2015-10-01

    Endo-β-1,4-mannanases from Streptomyces thermolilacinus (StMan) and Thermobifida fusca (TfMan) demonstrated different substrate specificities. StMan hydrolyzed galactosylmannooligosaccharide (GGM5; 6(III) ,6(IV) -α-d-galactosyl mannopentaose) to GGM3 and M2, whereas TfMan hydrolyzed GGM5 to GGM4 and M1. To determine the region involved in the substrate specificity, we constructed chimeric enzymes of StMan and TfMan and evaluated their substrate specificities. Moreover, the crystal structure of the catalytic domain of StMan (StMandC) and the complex structure of the inactive mutant StE273AdC with M6 were solved at resolutions of 1.60 and 1.50 Å, respectively. Structural comparisons of StMandC and the catalytic domain of TfMan lead to the identification of a subsite around -1 in StMandC that could accommodate a galactose branch. These findings demonstrate that the two loops (loop7 and loop8) are responsible for substrate recognition in GH5 actinomycete mannanases. In particular, Trp281 in loop7 of StMan, which is located in a narrow and deep cleft, plays an important role in its affinity toward linear substrates. Asp310 in loop8 of StMan specifically bound to the galactosyl unit in the -1 subsite. PMID:26257335

  16. Use of fibre-optic endoscopes in studies of gastric digestion in carnivorous vertebrates.

    Science.gov (United States)

    Jackson, S; Cooper, J

    1988-01-01

    1. Two methods of assessing gastric digestion rates of three prey types fed to Sooty albatrosses Phoebetria fusca were compared: removal of stomach contents, using a water-flushing stomach pump (a technique used commonly in diet studies), and inspection using a fibre-optic gastroscope (a previously unused technique). 2. The stomach pump yielded quantitative information, but proved stressful and resulted in incomplete recovery of meals ingested 3-6 hr before pumping. Gastric morphology of the animals studied and digestion state of their stomach contents may influence the effectiveness of this technique. 3. Inspection using the gastroscope yielded qualitative information only but permitted serial inspection of the same animal, and was less stressful than the stomach pump. Times for total evacuation of the stomach were 6-12 hr less when estimated using the gastroscope than when using the stomach pump. 4. The specifications of endoscopes relevant to their use by biologists are given. 5. Previous non-medical biological uses of endoscopes are given. Potential uses include underwater observations, sampling of digestive juices and stomach linings for enzyme analyses, observations of ingested prey, and assessment of parasite infestation. PMID:2904343

  17. Microfaunal indicators, Ciliophora phylogeny and protozoan population shifts in an intermittently aerated and fed bioreactor

    International Nuclear Information System (INIS)

    Microfauna community structure was examined in the mixed liquor of a bench-scale bioreactor equipped with an intermittent aeration and feeding system. The reactor was operated under an intermittent aeration of 25 min in every 1 h and varying feeding conditions (0.264, 0.403 and 0.773 kg BOD5/m3 d). A total of 14 protozoan and metazoan taxa were identified by microscopic examination. Sessile ciliates, followed by crawling ciliates, were the major protozoan groups under 0.403 kg BOD5/m3 d organic loading conditions, while sessile ciliate population was remarkably increased under an organic loading of 0.773 kg BOD5/m3 d. Principal Component Analysis and Pearson correlation coefficient tests were performed in order to reveal relationships between microfauna community and operational parameters. Ciliophora specific-18S rRNA gene clone library was constructed to identify ciliate diversity under 0.773 kg BOD5/m3 d organic loading conditions. Ciliophora diversity consisted of members of Aspidiscidae, Epistylidae, Opisthonectidae and Vorticellidae, with the majority of the clones being associated with the species Vorticella fusca. At least one novel phylogenetic linkage among Ciliophora was identified. Comparisons made after molecular characterization and microscopic examination of Ciliophora community showed that the estimation of broad ciliate groups is useful for ecological considerations and evaluation of the operational conditions in wastewater treatment plants.

  18. A New Esterase from Thermobifida halotolerans Hydrolyses Polyethylene Terephthalate (PET and Polylactic Acid (PLA

    Directory of Open Access Journals (Sweden)

    Georg Steinkellner

    2012-02-01

    Full Text Available A new esterase from Thermobifida halotolerans (Thh_Est was cloned and expressed in E. coli and investigated for surface hydrolysis of polylactic acid (PLA and polyethylene terephthalate (PET. Thh_Est is a member of the serine hydrolases superfamily containing the -GxSxG- motif with 85–87% homology to an esterase from T. alba, to an acetylxylan esterase from T. fusca and to various Thermobifida cutinases. Thh_Est hydrolyzed the PET model substrate bis(benzoyloxyethylterephthalate and PET releasing terephthalic acid and mono-(2-hydroxyethyl terephthalate in comparable amounts (19.8 and 21.5 mmol/mol of enzyme while no higher oligomers like bis-(2-hydroxyethyl terephthalate were detected. Similarly, PLA was hydrolyzed as indicated by the release of lactic acid. Enzymatic surface hydrolysis of PET and PLA led to a strong hydrophilicity increase, as quantified with a WCA decrease from 90.8° and 75.5° to 50.4° and to a complete spread of the water drop on the surface, respectively.

  19. Fine structure and meiotic behaviour of the male multiple sex chromosomes in the genus Alouatta.

    Science.gov (United States)

    Solari, A J; Rahn, M I

    2005-01-01

    The meiotic cytology and fine structure of the sex multiples in males from two species of the genus Alouatta are presented and compared with descriptions from other species of this genus. As shown in pachytene by synaptonemal complex analysis and in metaphase I by spreading, there is a quadrivalent in male meiosis in A. caraya, which is formed by an X(1)X(2)Y(1)Y(2) complex, while in A. palliata there is a trivalent formed by an X(1)X(2)Y(1) complex. Chromosome painting with human probes shows that A. caraya sex multiples share the same components as those of A. seniculus sara and A. seniculus arctoidea. However, as shown here for A. palliata and by others in A. fusca, there are differences among the multiples of some species. It is shown that in this genus there are several varieties of sex multiples that share some features, and that the origin of these multiples is most probably a primitive development in the genus Alouatta. PMID:15545739

  20. Molecular phylogenetics of howler monkeys (Alouatta, Platyrrhini). A comparison with karyotypic data.

    Science.gov (United States)

    Bonvicino, C R; Lemos, B; Seuánez, H N

    2001-07-01

    Molecular phylogenetic analyses of seven Brazilian Alouatta species, based on cytochrome b DNA sequence data were carried out. Parsimony and neighbor joining topologies grouped Alouatta belzebul and A. fusca as sister groups in one clade while another, well-supported clade contained A. seniculus as the most basal offshoot, followed by A. nigerrima as a sister lineage of A. macconnelli/A. stramineus. Estimates of inter-specific sequence divergence were generally low, and estimates of the time of divergence indicated that the main Alouatta lineages emerged during a short evolutionary interval. A comparison with karyotypic data confirmed the molecular topology showing a closer relationship between A. macconnelli and A. stramineus in respect to A. nigerrima. It also showed that the XX/XY sex chromosome system was maintained in several lineages while the X1X2Y/X1X1X2X2 system appeared independently at least three times during the radiation of howler monkeys. Moreover, the X1X2Y1Y2/X1X1X2X2 system might have appeared once or, alternatively, twice and independently. PMID:11513299