WorldWideScience

Sample records for cellpro ceprate sc

  1. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  2. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  3. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  4. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  5. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  6. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  7. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  8. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  9. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  10. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  11. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  12. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  13. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  14. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  15. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  16. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  17. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  18. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  19. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  20. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  1. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  2. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  3. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  4. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  5. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  6. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  7. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  8. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  9. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  10. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  11. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  12. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  13. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  14. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  15. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

  16. 76 FR 58401 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-09-21

    ... Zone; Swim Around Charleston, Charleston, SC in the Federal Register (76 FR 38586). We received no... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  17. Human bulbar conjunctival hemodynamics in hemoglobin SS and SC disease.

    Science.gov (United States)

    Wanek, Justin; Gaynes, Bruce; Lim, Jennifer I; Molokie, Robert; Shahidi, Mahnaz

    2013-08-01

    The known biophysical variations of hemoglobin (Hb) S and Hb C may result in hemodynamic differences between subjects with SS and SC disease. The purpose of this study was to measure and compare conjunctival hemodynamics between subjects with Hb SS and SC hemoglobinopathies. Image sequences of the conjunctival microcirculation were acquired in 9 healthy control subjects (Hb AA), 24 subjects with SC disease, and 18 subjects with SS disease, using a prototype imaging system. Diameter (D) and blood velocity (V) measurements were obtained in multiple venules of each subject. Data were categorized according to venule caliber by averaging V and D for venules with diameters less than (vessel size 1) or greater than (vessel size 2) 15 µm. V in vessel size 2 was significantly greater than V in vessel size 1 in the AA and SS groups (P ≥ 0.009), but not in the SC group (P = 0.1). V was significantly lower in the SC group as compared to the SS group (P = 0.03). In AA and SS groups, V correlated with D (P ≤ 0.005), but the correlation was not statistically significant in the SC group (P = 0.08). V was inversely correlated with hematocrit in the SS group for large vessels (P = 0.03); however, no significant correlation was found in the SC group (P ≥ 0.2). Quantitative assessment of conjunctival microvascular hemodynamics in SS and SC disease may advance understanding of sickle cell disease pathophysiology and thereby improve therapeutic interventions.

  18. Thermal stability of Al-Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-tao; YAN De-sheng; RONG Li-jian

    2006-01-01

    The thermal stability of Al3(Sc,Zr) precipitates in the cold worked Al-Mg-Sc-Zr alloy after elevated temperature exposure was investigated. The evaluation was conducted using room temperature tensile, Vicker's hardness, optical metallography and scanning electron microscope (SEM) with the backscatter. The results show that the Al3(Sc,Zr) precipitates and mechanical properties have no obvious change, and the grains keep elongated along the working direction as that in cold worked sample after exposure at 300 ℃ for 1 000 h. The coarsening of Al3(Sc,Zr) precipitates occurs and is no longer effective on the recrystallization resistance, and partial recrystallization is observed after 400 ℃ exposure. In particular, after 500 ℃ exposure, the hardness decreases drastically and the alloy has fully recrystallized due to the obvious coarsening of Al3(Sc,Zr) precipitates.

  19. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  20. Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

    NARCIS (Netherlands)

    Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

    2002-01-01

    Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of s

  1. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  2. Effects of cooling rate on solidification behavior of dilute Al-Sc and Al-Sc-Zr solid solution

    Institute of Scientific and Technical Information of China (English)

    金头男; 聂祚仁; 徐国富; 阮海琼; 杨军军; 付静波; 左铁镛

    2004-01-01

    Six alloys with different compositions of Al-0.1%Sc, Al-0.3%Sc, Al-0.3%Zr, Al-0.1% Sc-0. 1%Zr,Al-0.3%Sc-0.1%Zr and Al-0.3%Sc-0.3%Zr were prepared by casting in a wedge shaped copper mould. The hardness test, microstructure observation, and DSC thermal analysis were applied to fully investigate the solidification behavior of the wedge tip (whose cooling rate is 1 000 K/s) and the top surface (cooling rate 100 K/s) of each casting. The results show that the cast structures in the hypoeutectic region of Al-Sc alloys are slightly affected by cooling rates during the solidification. In the case of hypereutectic alloy of Al-0.3%Sc-0.3%Zr , the cast grains were remarkably refined under the condition of a 100 K/s cooling rate, however, under a 1 000 K/s cooling rate condition,solute atoms contribute nothing to the grain-refinement, due to the eutectic concentration becomes higher. The hardness can be improved to a greater degree by Sc single addition, compared to single Zr addition, but it can be improved even greater when Sc added together with Zr. It is sensitive to cooling rate, the higher the cooling rate, the greater the hardness. By combining the results of TEM examination and DSC analysis, it can be seen that a supersaturated Al solid solution forms during the solidification, and the solubility of Sc in Al solution can be improved by increasing the cooling rate.

  3. The influence of shear-velocity heterogeneity on ScS2/ScS amplitude ratios and estimates of Q in the mantle

    Science.gov (United States)

    Chaves, Carlos A. M.; Ritsema, Jeroen

    2016-08-01

    Regional waveforms of deep-focus Tonga-Fiji earthquakes indicate anomalous traveltime differences (ScS2-ScS) and amplitude ratios (ScS2/ScS) of the phases ScS and ScS2. The correlation between the ScS2-ScS delay time and the ScS2/ScS amplitude ratio suggests that shear wave apparent Q in the mantle below the Tonga-Fiji region is highest when shear wave velocities are lowest. This observation is unexpected if temperature variations were responsible for the seismic anomalies. Using spectral element method waveform simulations for four tomographic models, we demonstrate that focusing and scattering of shear waves by long-wavelength 3-D heterogeneity in the mantle may overwhelm the signal from intrinsic attenuation in long-period ScS2/ScS amplitude ratios. The tomographic models reproduce the trends in recorded ScS2-ScS difference times and ScS2/ScS amplitude ratios. Although they cannot be ruled out, variations in shear wave attenuation (i.e., the quality factor Q) are not necessary to explain the data.

  4. Pascal-SC a computer language for scientific computation

    CERN Document Server

    Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

    1987-01-01

    Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

  5. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  6. Gadolinium scandium germanide, Gd2Sc3Ge4

    Directory of Open Access Journals (Sweden)

    Sumohan Misra

    2009-04-01

    Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

  7. Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

    Science.gov (United States)

    Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

    2015-01-01

    Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

  8. Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

    KAUST Repository

    Vlach, Martin

    2013-12-01

    The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

  9. Design of SC walls and slabs for impulsive loading

    Energy Technology Data Exchange (ETDEWEB)

    Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

    2015-11-11

    Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

  10. 75 FR 71734 - Outer Continental Shelf (OCS), Scientific Committee (SC)

    Science.gov (United States)

    2010-11-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS), Scientific Committee (SC) AGENCY: Bureau of Ocean Energy Management, Regulation and Enforcement (BOEMRE),...

  11. Electrochemical Characterization of Ni/(Sc)YSZ Electrodes

    DEFF Research Database (Denmark)

    Ramos, Tania; Thydén, Karl Tor Sune; Mogensen, Mogens Bjerg

    2010-01-01

    Investigations of Ni/(Sc)YSZ cermets for solid oxide cells (SOCs) were performed by electrochemical impedance spectroscopy (EIS), under varying experimental conditions and upon redox cycling, using three different designs of symmetric cells. The deconvolution and fitting of the obtained impedance...... parameters. Initial degradation results for both Ni/ScYSZ and Ni/YSZ based anodes under very high steam content are also reported. ©2010 COPYRIGHT ECS - The Electrochemical Society...

  12. Medialogy (English Information Brochure on the education M.Sc.,Medialogy, 3rd to 10th semester (B.Sc. & M.Sc) - For graduates from higher study programmes such as Multimedia Design and IT Graduates)

    DEFF Research Database (Denmark)

    Nordahl, Rolf

    2005-01-01

    An information brochure, 24 pages, in English which describes the education M.Sc., Medialogy, offered by Aalborg University in Copenhagen and Esbjerg. The brochure describes the 3rd to 10th semester (B.Sc. and M.Sc. degree) of the education. The information is primarily directed toward potential...

  13. Piezoelectric coefficients and spontaneous polarization of ScAlN.

    Science.gov (United States)

    Caro, Miguel A; Zhang, Siyuan; Riekkinen, Tommi; Ylilammi, Markku; Moram, Michelle A; Lopez-Acevedo, Olga; Molarius, Jyrki; Laurila, Tomi

    2015-06-24

    We present a computational study of spontaneous polarization and piezoelectricity in Sc(x)Al(1-x)N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e(ij), piezoelectric moduli d(ij) and elastic constants C(ij). The theoretical findings are complemented with experimental measurement of e33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material.

  14. The {\\sc Majorana Demonstrator} Neutrinoless Double-Beta Decay Experiment

    CERN Document Server

    Abgrall, N; Avignone, F T; Barabash, A S; Bertrand, F E; Boswell, M; Brudanin, V; Busch, M; Caldwell, A S; Chan, Y-D; Christofferson, C D; Combs, D C; Detwiler, J A; Doe, P J; Efremenko, Yu; Egorov, V; Ejiri, H; Elliott, S R; Esterline, J; Fast, J E; Finnerty, P; Fraenkle, F M; Galindo-Uribarri, A; Giovanetti, G K; Goett, J; Green, M P; Gruszko, J; Guiseppe, V E; Gusey, K; Hallin, A L; Hazama, R; Hegai, A; Henning, R; Hoppe, E W; Howard, S; Howe, M A; Keeter, K J; Kidd, M F; Knecht, A; Kochetov, O; Konovalov, S I; Kouzes, R T; LaFerriere, B D; Leon, J; Leviner, L E; Loach, J C; MacMullin, S; Martin, R D; Mertens, S; Mizouni, L; Nomachi, M; Orrell, J L; O'Shaughnessy, C; Overman, N R; Phillips, D G; Poon, A W P; Pushkin, K; Radford, D C; Rielage, K; Robertson, R G H; Ronquest, M C; Schubert, A G; Shanks, B; Shima, T; Shirchenko, M; Snavely, K J; Snyder, N; Steele, D; Strain, J; Suriano, A M; Thompson, J; Timkin, V; Tornow, W; Varner, R L; Vasilyev, S; Vetter, K; Vorren, K; White, B R; Wilkerson, J F; Xu, W; Yakushev, E; Young, A R; Yu, C-H; Yumatov, V

    2013-01-01

    The {\\sc Majorana Demonstrator will search for the neutrinoless double-beta decay of the isotope Ge-76 with a mixed array of enriched and natural germanium detectors. The observation of this rare decay would indicate the neutrino is its own antiparticle, demonstrate that lepton number is not conserved, and provide information on the absolute mass scale of the neutrino. The {\\sc Demonstrator} is being assembled at the 4850-foot level of the Sanford Underground Research Facility in Lead, South Dakota. The array will be situated in a low-background environment and surrounded by passive and active shielding. Here we describe the science goals of the {\\sc Demonstrator} and the details of its design.

  15. Transport of one SC coil through the village of Meyrin

    CERN Multimedia

    1956-01-01

    In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

  16. Estudo medico da hemoglobinopatia SC em negroides paulistas

    OpenAIRE

    Raquel Ribeiro Gomes

    1988-01-01

    Resumo: A hemoglobinopatia SC é a segunda síndrome falcêmica mais importante no Brasil, devido à sua significativa prevalência entre negróides e também pelas manifestações clínicas apresentadas Apesar disso, ela tem sido pouco estudada em nosso país, não existindo na literatura nacional nenhum trabalho específico sobre essa doença. No presente trabalho, procurou-se investigar o significado médico da doença SC no Estado de são Paulo, analisando-se dois tipos de casuísticas de pacientes SC. Em ...

  17. Experience with OpenMP for MADX-SC

    Energy Technology Data Exchange (ETDEWEB)

    D' Imperio, Nicholas [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Montag, Christophe [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Yu, Kwangmin [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kapin, Valery [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); McIntosh, Eric [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Renshall, Harry [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Schmidt, Frank [European Organization for Nuclear Research (CERN), Geneva (Switzerland)

    2014-07-01

    MADX-SC allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP.

  18. Bayesian narrowband interference mitigation in SC-FDMA

    KAUST Repository

    Ali, Anum

    2015-08-12

    This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

  19. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  20. Determination of Sc by Ion-exchanger Colorimetry

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Ion-exchanger colorimetry for scandium in the form of ternary color system "Sc(Ⅲ)-CPA-pc-Ac" was developed. The influences of types and grain sizes of resin, adsorption modes and the acidity on the determination were studied systematically, and the optimum operating conditions and the allowable amounts of foreign ions were determined. In comparison with the ordinary solution colorimetry, both of the sensitivity and the selectivity of this ion-exchanger colorimetry are improved obviously. The preliminary uses of this method to the determination of Sc(Ⅲ) in two synthetic samples were satisfied.

  1. Radiation protection Group (SC/RP) desperately seeking...

    CERN Multimedia

    A. Hervé, Y. Donjoux / SC

    2006-01-01

    We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

  2. Thermoelectric performance of functionalized Sc 2 C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  3. Tetrahedron dynamics in the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and the cubic 1/1-approximant Zn6Sc.

    Science.gov (United States)

    Euchner, H; Yamada, T; Rols, S; Ishimasa, T; Kaneko, Y; Ollivier, J; Schober, H; Mihalkovic, M; de Boissieu, M

    2013-03-20

    A comparison of periodic approximants and their quasicrystalline counterparts offers the opportunity to better understand the structure, physical properties and stabilizing mechanisms of these complex phases. We present a combined experimental and molecular dynamics study of the lattice dynamics of the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and compare it to recently published results obtained for the cubic 1/1-approximant Zn(6)Sc. Both phases, quasicrystal and approximant, are built up from large atomic clusters which contain a tetrahedral shell at the cluster centre and are packed either quasiperiodically or on a bcc lattice. Using quasielastic neutron scattering and atomic scale simulations, we show that in the quasicrystal the tetrahedra display a dynamics similar to that observed in the 1/1-approximant: the tetrahedra behave as a 'single molecule' and reorient dynamically on a timescale of the order of a few ps. The tetrahedra reorientation is accompanied by a large distortion of the surrounding cluster shells which provide a unique dynamical flexibility to the quasicrystal. However, whereas in the 1/1-approximant the tetrahedron reorientation is observed down to T(c) = 160 K, where a phase transition takes place, in the quasicrystal the tetrahedron dynamics is gradually freezing from 550 to 300 K, similarly to a glassy system.

  4. Programmable SC biquad using one single capacitor bank

    OpenAIRE

    Torralba Silgado, Antonio Jesús; Pérez Vega-Leal, Alfredo; García Franquelo, Leopoldo

    2001-01-01

    This paper presents a new technique for programming SC circuits using a single time-multiplexed capacitor bank, achieving a significant reduction in capacitance area. Simulation results of a programmable biquad low pass filter show the validity of the proposed method.

  5. South Carolina's SC LENDS: Optimizing Libraries, Transforming Lending

    Science.gov (United States)

    Hamby, Rogan; McBride, Ray; Lundberg, Maria

    2011-01-01

    Since SC LENDS started operating in June 2009, more public libraries have come on board. All of this on the back end connects to a Mozilla-based staff client that has distributions for Mac OS X and Microsoft Windows, using SSL encryption to keep communications secure and private between remote libraries and the servers hosted at a high-end…

  6. 77 FR 14700 - Safety Zones; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-03-13

    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; Swim Around Charleston, Charleston, SC... establish temporary moving safety zones during the Swim Around Charleston, a swimming race occurring on...

  7. 76 FR 38586 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-07-01

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... establish a temporary moving safety zone during the Swim Around Charleston, a swimming race occurring...

  8. 78 FR 54583 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2013-09-05

    ..., telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  9. 77 FR 51471 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-08-24

    ... rulemaking (NPRM) entitled Safety Zone; Swim Around Charleston, Charleston, SC in the Federal Register (77 FR...: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston,...

  10. 44gSc from metal calcium targets for PET

    DEFF Research Database (Denmark)

    Severin, Gregory; Gagnon, K.; Engle, J. W.;

    2012-01-01

    A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institu...

  11. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  12. Envíos Confianza, S.C.

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); S.C. Envíos Confianza

    2009-01-01

    Presentación acerca de Envíos Confianza, S.C., en el cual da a conocer su historia, misión, visión, valores, efecto de las remesas en comunidades e impacto de la crisis financiera. Además, señala la proyección para el 2009-2011.

  13. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  14. Calibration of the DLP-SC-3300-02 probe

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

  15. Genome Sequence of Herpes Simplex Virus 1 Strain SC16

    Science.gov (United States)

    Rastrojo, Alberto; López-Muñoz, Alberto Domingo

    2017-01-01

    ABSTRACT Herpes simplex virus 1 (HSV-1), also known as Human herpesvirus 1, is a highly prevalent human neurotropic pathogen that causes a variety of diseases, including lethal encephalitis. Here, we report the genome sequence of the HSV-1 strain SC16. PMID:28126930

  16. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  17. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  18. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  19. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan

    The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  20. Effect of Sc on Precipitation Hardening of AlSi6Mg Alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The effect of Sc on precipitation hardening of AlSi6Mg was studied. Zr was previously reported that it increased the effectiveness of Sc in wrought aluminum in many areas so Zr was also used together with Sc in this study.Different levels of Sc and Zr additions were added to AlSi6Mg before casting in the permanent mold. The samples were precipitation hardened at different aging temperatures and for various aging time before testing for tensile strength and hardness. It was found that Sc addition into Al6SiMg can change its response to age hardening. Additions of Sc and Sc with Zr increased both yield strength and hardness for both aging temperatures. In addition, Sc was found to modify eutectic Si to obtain fibrous morphology. This effect of Sc on eutectic silicon modification has never been reported before.

  1. Role of cell death in the propagation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-03-01

    A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

  2. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  3. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  4. Dynamical stability and evolution of the discs of Sc galaxies

    CERN Document Server

    Fuchs, B

    1997-01-01

    We examine the local stability of galactic discs against axisymmetric density perturbations with special attention to the different dynamics of the stellar and gaseous components. In particular the discs of the Milky Way and of NGC 6946 are studied. The Milky Way is shown to be stable, whereas the inner parts of NGC 6946, a typical Sc galaxy from the Kennicutt (1989) sample, are dynamically unstable. The ensuing dynamical evolution of the composite disc is studied by numerical simulations. The evolution is so fierce that the stellar disc heats up dynamically on a short time scale to such a degree, which seems to contradict the morphological appearance of the galaxy. The star formation rate required to cool the disc dynamically is estimated. Even if the star formation rate in NGC 6946 is at present high enough to meet this requirement, it is argued that the discs of Sc galaxies cannot sustain such a high star formation rate for longer periods.

  5. Structural, elastic and thermodynamic properties of Ti2SC

    Indian Academy of Sciences (India)

    Hongzhi Fu; Wenfang Liu; Tao Gao

    2011-12-01

    The structural parameters, elastic constants and thermodynamic properties of Ti2SC were investigated under pressure and temperature by using first-principles plane-wave pseudopotential density functional theory within the generalized gradient approximation. The obtained results are in agreement with the available experimental data. The bulk moduli along the - and -axes, $B_{a}$ and $B_{c}$, almost linearly increase with pressure, and the former is always smaller than the latter. The ratio of $B_{c}/B_{a}$ has a trend of gradual increase as the pressure increases. It is found that the elastic constants, anisotropy and Debye temperature of Ti2SC increase with pressure, while axial compressibility along the - and -axes decreases with pressure. The thermal properties including the equation of state, the Grüneisen parameter , the anisotropies $\\Delta_{p}, \\Delta_{S1}$ and $\\Delta_{S2}$, and the heat capacity are estimated at various pressures and temperatures.

  6. A Study on the Fluorescence System of Sc-BPMPHD-CTMAB and Its Analytical Application

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction The fluorescence of Sc3+ itself in solution is not observed. After complexed with an organic ligand with a chromophore, Sc3+ makes the ligand, which has no or has weak fluorescence, emit strong fluorescence.

  7. Status of Simulation Tools for the ILD ScECAL

    OpenAIRE

    Kotera, Katsushige; anduze, marc; Boudry, Vincent; Brient, Jean-Claude; Jeans, Daniel; Kawagoe, Kiyotomo; Miyamoto, Akiya; de Freitas, Paulo Mora; Musat, Gabriel; Ono, Hiroaki; Takeshita, Tohru; Uozumi, Satoru

    2010-01-01

    The scintillator-strip electromagnetic calorimeter (ScECAL) is one of the calorimeter technic for the ILC. To achieve the fine granularity from the strip-segmented layers the strips in odd layers are orthogonal with respect to those in the even layers. In order to extract the best performance from such detector concept, a special reconstruction method and simulation tools are being developed in ILD collaboration. This manuscript repots the status of developing of those tools.

  8. QUALITY MANAGEMENT OF BAKERY PRODUCTS: A CASE STUDY IN SC

    Directory of Open Access Journals (Sweden)

    Nicoleta- Luminiţa STRÂMBEANU RISTEA

    2013-01-01

    Full Text Available The paper aimed to present the benefits of implementing HACCP (Hazard Analysis and Critical Control Points to company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania. The data have been provided by the above mentioned manufacturer. The objectives of S.C. "DOBRE AND SONS" S.R.L. are protecting the health of the consumers of the products and their satisfaction regarding the consumption of products that are nutritional, tasty, fresh, free from microbiological, chemical and physical hazard, as well as possessing stable properties during the validity for consumption. In this respect, there has been implemented and maintained an integrated management system of food quality and safety according to SR EN ISO 9001:2008, SR EN ISO 22000:2005 and according to IFS standard, version 5/2007, which consists of determining the potential biological, chemical and physical hazards that might affect the safety of bread and bakery products, or the health of the consumer. HACCP team is analyzing hazard using one of the recommended techniques: brainstorming or the cause - effect diagram. In conclusion, the company S.C. "DOBRE AND SONS" S.R.L. Constanta, Romania provides awareness and employee involvement at all levels in achieving the appointed objectives.

  9. Crystal fields of dilute Tb, Dy, or Er in Sc obtained by magnetization measurements

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1976-01-01

    Crystal-field parameters for dilute Sc-Tb, Sc-Dy, and Sc-Er alloys have been obtained by fitting theoretical expressions to the experimentally measured paramagnetic susceptibility. The initial susceptibility was measured and corrected for the effects of ordering at the lowest temperatures in the ...

  10. File list: InP.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.10.AllAg.EpiSC.bed ... ...InP.PSC.10.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  11. File list: InP.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.50.AllAg.EpiSC.bed ... ...InP.PSC.50.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  12. File list: InP.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 90285 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.20.AllAg.EpiSC.bed ... ...InP.PSC.20.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX535242,SRX5

  13. File list: His.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 0286,SRX535238 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.10.AllAg.EpiSC.bed ... ...His.PSC.10.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  14. File list: Unc.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.EpiSC.bed ... ...Unc.PSC.05.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  15. File list: His.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 909,SRX1074906 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.AllAg.EpiSC.bed ... ...His.PSC.50.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX535240,

  16. File list: InP.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 35242 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.05.AllAg.EpiSC.bed ... ...InP.PSC.05.AllAg.EpiSC mm9 Input control Pluripotent stem cell EpiSC SRX590285,SRX5

  17. File list: Unc.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074905,SRX1074908 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.EpiSC.bed ... ...Unc.PSC.50.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  18. File list: His.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4916,SRX590286 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.05.AllAg.EpiSC.bed ... ...His.PSC.05.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX590288,SRX535240,

  19. File list: Unc.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 074908,SRX1074905 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.EpiSC.bed ... ...Unc.PSC.20.AllAg.EpiSC mm9 Unclassified Pluripotent stem cell EpiSC SRX1074917,SRX1

  20. File list: His.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 4906,SRX535241 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.20.AllAg.EpiSC.bed ... ...His.PSC.20.AllAg.EpiSC mm9 Histone Pluripotent stem cell EpiSC SRX535239,SRX661083,

  1. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  2. Overview of 2009 IEC/TC SC 77C Plenary Meeting%2009 IEC/TC SC 77C年会

    Institute of Scientific and Technical Information of China (English)

    孟萃

    2009-01-01

    介绍了在法国召开的2009 IEC/TC SC 77C分技术委员会工作组会议讨论的IEC 61000-4-35、IEC 6100-5-9、IEC 6100-5-8三个标准项目实施情况、标准维护需求及新的技术工作.

  3. Acid-base chemistry in the formation of Mackay-type icosahedral clusters: μ3-acidity analysis of Sc-rich phases of the Sc-Ir system.

    Science.gov (United States)

    Guo, Yiming; Stacey, Timothy E; Fredrickson, Daniel C

    2014-05-19

    The crystal structures of intermetallic phases offer a wealth of geometrical features (helices, multishelled clusters, and host-guest motifs) whose formation has yet to be explained or predicted by chemical theory. A recently developed extension of the acid-base concept to metallic systems, the μ3-acidity model, provides an avenue for developing this understanding for intermetallics formed from transition metals. In this Article, we illustrate how this approach can be used to understand one of the most striking geometrical entities to emerge in intermetallic chemistry, the Mackay cluster of icosahedral quasicrystals. We present μ3-acidity analyses, based on DFT-calibrated Hückel calculations, for a series of Sc-Ir intermetallics: ScIr (CsCl-type), Sc2Ir (Ti2Ni-type), Sc11Ir4, and the Mackay cluster containing phases Sc57Ir13 and Sc44Ir7. We begin by illustrating that a μ3-acidity model correctly predicts that each of these phases is stable relative to disproportionation into their neighboring compounds when a common set of Hückel parameters and d-orbital occupancies is used. Next, we explain these results by developing a relationship between the distance distribution of homoatomic contacts within an atom's coordination sphere and the μ3-neutralization it experiences. For a given average homoatomic distance, the role of heteroatomic contacts is higher when the distribution of homoatomic contacts is narrower. This effect is key to the strength of the acid-base neutralization of the Sc-rich phases, where the Sc atoms find a scarcity of Ir atoms from which to obtain neutralization. Under these circumstances, Sc-Ir contacts should be maximized, whereas the number and distance variations of the Sc-Sc contacts should be minimized. These expectations are borne out by the observed crystal structures. In particular, the Mackay clusters of Sc57Ir13 and Sc44Ir7, in which a central Ir atom is icosahedrally coordinated by a pentagonal dodecahedral array of face-sharing Sc

  4. Molecular and functional characterization of peptidoglycan-recognition protein SC2 (PGRP-SC2) from Nile tilapia (Oreochromis niloticus) involved in the immune response to Streptococcus agalactiae.

    Science.gov (United States)

    Gan, Zhen; Chen, Shannan; Hou, Jing; Huo, Huijun; Zhang, Xiaolin; Ruan, Baiye; Laghari, Zubair Ahmed; Li, Li; Lu, Yishan; Nie, Pin

    2016-07-01

    PGRP-SC2, the member of PGRP family, plays an important role in regulation of innate immune response. In this paper, a PGRP-SC2 gene of Nile tilapia, Oreochromis niloticus (designated as On-PGRP-SC2) was cloned and its expression pattern under the infection of Streptococcus agalactiae was investigated. Sequence analysis showed main structural features required for amidase activity were detected in the deduced amino acid sequence of On-PGRP-SC2. In healthy tilapia, the On-PGRP-SC2 transcripts could be detected in all the examined tissues, with the most abundant expression in the muscle. When infected with S. agalactiae, there was a clear time-dependent expression pattern of On-PGRP-SC2 in the spleen, head kidney and brain. The assays for the amidase activity suggested that recombinant On-PGRP-SC2 protein had a Zn(2+)-dependent PGN-degrading activity. Moreover, our works showed that recombinant On-PGRP-SC2 protein could significantly reduce bacterial load in target organs attacked by S. agalactiae. These findings indicated that On-PGRP-SC2 may play important roles in the immune response to S. agalactiae in Nile tilapia.

  5. Al-Mg-Sc-Zr合金的再结晶%Recrystallization of Al-Mg-Sc-Zr Alloys

    Institute of Scientific and Technical Information of China (English)

    张永红; 尹志民; 张杰; 潘青林; 彭志辉

    2002-01-01

    研究了添加微量Sc,Zr的Al-Mg合金的再结晶行为,结果表明:Al-Mg-Sc-Zr合金的再结晶起始温度为400℃,细小、弥散、与基体共格的析出相对位错和亚晶的钉扎作用是合金再结晶温度大幅度提高的主要原因,再结晶形核机制为亚晶聚合机制.%The recrystalization behavior of Al-Mg alloys with Sc and Zr additives was studied.It is found that the recrystallization of the alloy began at 400℃.The main reason of the great increase of recrystallization temperature is attributed to that the dislocations and subgrain boundaries.The recrystallizing nucleation mechanism was the subgrain boundary merging mechanism in the alloy are pinned by ultrafine dispersed coherent precipitates.

  6. Fourier Transform Microwave Spectroscopy of Sc13C2 and Sc12C13C: Establishing AN Accurate Structure of ScC2 (tilde{X}2A1)

    Science.gov (United States)

    Burton, Mark; Halfen, DeWayne T.; Min, Jie; Ziurys, Lucy M.

    2016-06-01

    Pure rotational spectra of Sc13C2 and Sc12C13C (tilde{X}2A1) have been obtained using Fourier Transform Microwave methods. These molecules were created from scandium vapor in combination with 13CH4 and/or 12CH4, diluted in argon, using a Discharge Assisted Laser Ablation Source (DALAS). Transitions in the frequency range of 14-30 GHz were observed for both species including hyperfine splitting due to the nuclear spin of Sc (I = 7/2) and 13C (I = 1/2). Rotational, spin-rotational, and hyperfine constants have been determined for Sc13C2 and Sc12C13C, as well as a refined structure for ScC2. In agreement with theoretical calculations and previous Sc12C2 results, these data confirm a cyclic (or T-shaped) structure for this molecule. Scandium carbides have been shown to form endohedral-doped fullerenes, which have unique electrical and magnetic properties due to electron transfer between the metal and the carbon-cage. Spectroscopy of ScC2 provides data on model systems for comparison with theory.

  7. LOCAL COLLISION SIMULATION OF AN SC WALL USING ENERGY ABSORBING STEEL

    Directory of Open Access Journals (Sweden)

    CHUL-HUN CHUNG

    2013-08-01

    Full Text Available This study evaluates the local damage of a turbine in an auxiliary building of a nuclear power plant due to an external impact by using the LS-DYNA finite element program. The wall of the auxiliary building is SC structure and the material of the SC wall plate is high manganese steel, which has superior ductility and energy absorbance compared to the ordinary steel used for other SC wall plates. The effects of the material of the wall, collision speed, and angle on the magnitude of the local damage were evaluated by local collision analysis. The analysis revealed that the SC wall made of manganese steel had significantly less damage than the SC wall made of ordinary steel. In conclusion, an SC wall made of manganese steel can have higher effective resistance than an SC wall made of ordinary steel against the local collision of an airplane engine or against a turbine impact.

  8. Performance Analysis of OFDM 60GHz System and SC-FDE 60GHz System

    Directory of Open Access Journals (Sweden)

    Han Xueyan

    2016-01-01

    Full Text Available In this paper, the performance of 60GHz wireless communication system with SC and OFDM is studied, the models of OFDM 60GHz system and SC 60GHz frequency domain equalization (SC-FDE system are established, and the bit error rate (BER performance of OFDM 60GHz system and SC-FDE 60GHz system in 802.15.3c channels is compared. The simulation results show that SC-FDE 60GHz system has a slight advantage over OFDM system in line-of-sight (LOS channels, while OFDM 60GHz system has a slight advantage over SC-FDE system in non-line-of-sight (NLOS channels. For 60GHz system, OFDM 60GHz system has a slight advantage over SC-FDE system in overcoming multipath fading, but the performance of both is close whether in the LOS or NLOS case.

  9. Heterogeneity of abnormal prion protein (PrP(Sc)) in murine scrapie prions determined by PrP(Sc)-specific monoclonal antibodies.

    Science.gov (United States)

    Ushiki-Kaku, Yuko; Shimizu, Yoshihisa; Tabeta, Naoko; Iwamaru, Yoshifumi; Ogawa-Goto, Kiyoko; Hattori, Shunji; Yokoyama, Takashi

    2014-03-01

    In prion diseases, abnormal prion protein (PrP(Sc)) is considered as the main component of the infectious agent. Delineation of PrP(Sc) conformation is expected to be a critical factor in understanding properties of prions. However, practical methods to differentiate between conformers of PrP(Sc) are inadequate. Here, we used two PrP(Sc)-specific monoclonal antibodies (mAbs), 3B7 and 3H6, and found that mAb 3H6 detected a limited portion of PrP(Sc) in five mice-adapted prion strains. The quantity of mAb 3H6-precipitated PrP(Sc) was significantly lesser in 22L compared to other strains. This result provides a direct evidence of the conformational heterogeneity of PrP(Sc) within the prion strains. Conformation-specific probes, like these mAbs, have the potential to be powerful tools for investigating conformational variations in PrP(Sc).

  10. Structural transformations in Sc/Si multilayers irradiated by EUVlasers

    Energy Technology Data Exchange (ETDEWEB)

    Voronov, D.L.; Zubarev, E.N.; Pershyn, Y.P.; Sevryukova, V.A.; Kondratenko, V.V.; Vinogradov, A.V.; Artioukov, I.A.; Uspenskiy, Y.A.; Grisham, M.; Vaschenko, G.; Menoni, C.S.; Rocca, J.J.

    2007-08-21

    Multilayer mirrors for the extreme ultraviolet (EUV) are keyelements for numerous applications of coherent EUV sources such as newtabletop lasers and free-electron lasers. However the field ofapplications is limited by the radiation and thermal stability of themultilayers. Taking into account the growing power of EUV sources thestability of the optics becomes crucial. To overcome this problem it isnecessary to study the degradation of multilayers and try to increasetheir temporal and thermal stability. In this paper we report the resultsof detailed study of structural changes in Sc/Simultilayers when exposedto intense EUV laser pulses. Various types of surface damage such asmelting, boiling, shockwave creation and ablation were observed asirradiation fluencies increase. Cross-sectional TEM study revealed thatthe layer structure was completely destroyed in the upper part ofmultilayer, but still survived below. The layers adjacent tothe substrateremained intact even through the multilayer surface melted down, thoughthe structure of the layers beneath the molten zone was noticeablychanged. The layer structure in this thermally affected zone is similarto that of isothermally annealed samples. All stages of scandium silicideformation such as interdiffusion, solid-state amorphization, silicidecrystallization, etc., are present in the thermally affected zone. Itindicates a thermal nature of the damage mechanism. The tungstendiffusion barriers were applied to the scandium/silicon interfaces. Itwas shown that the barriers inhibited interdiffusion and increased thethermal stability of Sc/Si mirrors.

  11. V-ATPase, ScNhxlp and Yeast Vacuole Fusion

    Institute of Scientific and Technical Information of China (English)

    Quan-Sheng Qiu

    2012-01-01

    Membrane fusion is the last step in trafficking pathways during which membrane vesicles fuse with target organelles to deliver cargos.It is a central cellular reaction that plays important roles in signal transduction,protein sorting and subcellular compartmentation.Recent progress in understanding the roles of ion transporters in vacuole fusion in yeast is summanzed in this article.It is becoming increasingly evident that the vacuolar proton pump V-ATPase and vacuolar Na+/H+ antiporter ScNhxlp are key components of the vacuole fusion machinery in yeast.Yeast ScNhxlp regulates vacuole fusion by controlling the luminal pH.V-ATPases serve a dual role in vacuolar integrity in which they regulate both vacuole fusion and fission reactions in yeast.Fission defects are epistatic to fusion defects.Vacuole fission depends on the proton translocation activity of the V-ATPase; by contrast,the fusion reaction does not need the transport activity but requires the physical presence of the proton pump.Vo,the membrane-integral sector of the V-ATPase,forms trans-complexes between the opposing vacuoles in the terminal phase of vacuole fusion where the Vo trans-complexes build a continuous proteolipid channel at the fusion site to mediate the bilayer fusion.

  12. The first SC-SAGD pilot in the Grosmont

    Energy Technology Data Exchange (ETDEWEB)

    Solanki, S.C.; Barrett, K.; Riva, D.; Becker, L.; Brindle, G. [Laricina Energy Ltd. (Canada)

    2011-07-01

    In north-eastern Alberta, the Grosmont Formation is an Upper Devonian carbonate succession containing a vast amount of bitumen. In an attempt to exploit this resource, Laricina Energy Ltd. and OSUM Oil Sands Corp. built the first ever solvent-cyclic steam-assisted gravity drainage (SC-SAGD) pilot. In this process, solvent and/or steam are continuously injected at reservoir pressure to heat the reservoir and thus reduce bitumen viscosity. The aim of this paper is to present the pilot project and its initial results. The reservoir's geology, the recovery process, the drilling and completion challenges as well as the design and the operational plan are discussed in this paper. Steam injection started in December 2010 and indications show that the wells are progressing as planned. Results showed an uptime greater than 90% so far and this is expected to further improve in the future. The first SC-SAGD pilot is discussed and early phases showed excellent results from the project.

  13. Directed evolution of human scFvs in DT40 cells.

    Science.gov (United States)

    Lim, Alfred W Y; Williams, Gareth T; Rada, Cristina; Sale, Julian E

    2016-02-01

    Cells that constitutively diversify their immunoglobulin genes can be used for selection of novel antibodies and for refining existing affinities and specificities. Here, we report an adaptation of the chicken DT40 system wherein its capacity for somatic hypermutation is harnessed to evolve human antibodies expressed as single-chain variable fragments (scFvs). Expression of membrane-anchored scFvs from within the rearranged Igλ locus created self-diversifying scFv libraries from which we could both select scFvs of a desired specificity and evolve both the specificity and affinity of existing scFvs by iterative expansion and selection. From these scFvs, we were able to create fully human IgG antibodies with nanomolar affinities. We further enhanced the functionality of the system by creating a pool of DT40 scFv lines with high levels of mutation driven by the overexpression of a hyperactive variant of activation-induced deaminase. From this library, we successfully isolated scFvs that bound the spliceosome factor CWC15 and the cytokine human IFNγ. Our results demonstrate the flexibility and utility of DT40 for rapid generation of scFv repertoires and efficient selection, evolution and affinity maturation of scFv specificities.

  14. Effect of Severe Plastic Deformation on Structure and Properties of Al-Sc-Ta and Al-Sc-Ti Alloys.

    Science.gov (United States)

    Berezina, Alla; Monastyrska, Tetiana; Davydenko, Olexandr; Molebny, Oleh; Polishchuk, Sergey

    2017-12-01

    The comparative analysis of the effect of monotonous and non-monotonous severe plastic deformations (SPD) on the structure and properties of aluminum alloys has been carried out. Conventional hydrostatic extrusion (HE) with a constant deformation direction and equal-channel angular hydroextrusion (ECAH) with an abrupt change in the deformation direction were chosen for the cases of monotonous and non-monotonous SPD, respectively. Model cast hypoeutectic Al-0.3%Sc alloys and hypereutectic Al-0.6%Sc alloys with Ta and Ti additives were chosen for studying. It was demonstrated that SPD of the alloys resulted in the segregation of the material into active and inactive zones which formed a banded structure. The active zones were shown to be bands of localized plastic deformation. The distance between zones was found to be independent of the accumulated strain degree and was in the range of 0.6-1 μm. Dynamic recrystallization in the active zones was observed using TEM. The dynamic recrystallization was accompanied by the formation of disclinations, deformation bands, low-angle, and high-angle boundaries, i.e., rotational deformation modes developed. The dynamic recrystallization was more intense during the non-monotonous deformation as compared with the monotonous one, which was confirmed by the reduction of texture degree in the materials after ECAH.

  15. SC1327-312 & SC1329-313 two galaxy groups in-between a major merging event observed with Beppo-SAX

    CERN Document Server

    Bardelli, S; Ettori, S; Molendi, S; Zucca, E; Colafrancesco, Sergio

    2001-01-01

    We present the results of two Beppo-SAX observations of the poor clusters SC1327-312 and SC1329-313. These objects are located in a huge structure, formed by three ACO clusters, which is probably the remnant of one of the largest and best studied major mergings known. Given the fact that these poor clusters are in between two interacting ACO clusters, the aim of this work is to study the physics of the intracluster medium and to look for the possible presence of shocks. We derived the gas distribution profiles, the global (i.e. within 0.3 Mpc) temperatures and abundances and the temperature profiles and maps for SC1327-312 and SC1329-313. Also the presence of soft excess in LECS and hard excess in PDS have been checked. We do not find evidence of regions where the gas is shocked or significantly heated. The image of SC1327-312 seems rather symmetric, while the gas profile of SC1329-313 shows disturbed, comet-like shaped isophotes, with the tail pointing toward A3562 and a compression toward SC1327-312. The pr...

  16. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  17. In vitro neutralization of prions with PrP(Sc)-specific antibodies.

    Science.gov (United States)

    Taschuk, Ryan; Van der Merwe, Jacques; Marciniuk, Kristen; Potter, Andrew; Cashman, Neil; Griebel, Philip; Napper, Scott

    2015-01-01

    Prion diseases reflect the misfolding of a self-protein (PrP(C)) into an infectious, pathological isomer (PrP(Sc)). By targeting epitopes uniquely exposed by misfolding, our group developed PrP(Sc)-specific vaccines to 3 disease specific epitopes (DSEs). Here, antibodies induced by individual DSE vaccines are evaluated for their capacity to neutralize prions in vitro. For both purified antibodies and immunoreactive sera, the PrP(Sc)-specific antibodies were equally effective in neutralizing prions. Further, there was no significant increase in neutralizing activity when multiple DSEs were targeted within an assay. At a low antibody concentration, the PrP(Sc)-specific antibodies matched the neutralization achieved by an antibody that may act via both PrP(C) and PrP(Sc). At higher doses, however, this pan-specific antibody was more effective, potentially due to a combined deactivation of PrP(Sc) and depletion of PrP(C).

  18. Sulfated dextrans enhance in vitro amplification of bovine spongiform encephalopathy PrP(Sc and enable ultrasensitive detection of bovine PrP(Sc.

    Directory of Open Access Journals (Sweden)

    Yuichi Murayama

    Full Text Available BACKGROUND: Prions, infectious agents associated with prion diseases such as Creutzfeldt-Jakob disease in humans, bovine spongiform encephalopathy (BSE in cattle, and scrapie in sheep and goats, are primarily comprised of PrP(Sc, a protease-resistant misfolded isoform of the cellular prion protein PrP(C. Protein misfolding cyclic amplification (PMCA is a highly sensitive technique used to detect minute amounts of scrapie PrP(Sc. However, the current PMCA technique has been unsuccessful in achieving good amplification in cattle. The detailed distribution of PrP(Sc in BSE-affected cattle therefore remains unknown. METHODOLOGY/PRINCIPAL FINDINGS: We report here that PrP(Sc derived from BSE-affected cattle can be amplified ultra-efficiently by PMCA in the presence of sulfated dextran compounds. This method is capable of amplifying very small amounts of PrP(Sc from the saliva, palatine tonsils, lymph nodes, ileocecal region, and muscular tissues of BSE-affected cattle. Individual differences in the distribution of PrP(Sc in spleen and cerebrospinal fluid samples were observed in terminal-stage animals. However, the presence of PrP(Sc in blood was not substantiated in the BSE-affected cattle examined. CONCLUSIONS/SIGNIFICANCE: The distribution of PrP(Sc is not restricted to the nervous system and can spread to peripheral tissues in the terminal disease stage. The finding that PrP(Sc could be amplified in the saliva of an asymptomatic animal suggests a potential usefulness of this technique for BSE diagnosis. This highly sensitive method also has other practical applications, including safety evaluation or safety assurance of products and byproducts manufactured from bovine source materials.

  19. DC-SC Photoinjector with Low Emittance at Peking University

    CERN Document Server

    Xiang Rong; Hao, J; Huang, Senlin; Lu Xiang Yang; Quan, Shengwen; Zhang, Baocheng; Zhao, Kui

    2005-01-01

    High average power Free Electron Lasers require the high quality electron beams with the low emittance and the sub-picosecond bunches. The design of DC-SC photoinjector, directly combining a DC photoinjector with an SRF cavity, can produce high average current beam with moderate bunch charge and high duty factor. Because of the DC gun, the emittance increases quickly at the beginning, so a carefully design is needed to control that. In this paper, the simulation of an upgraded design has been done to lower the normalized emittance below 1.5mm·mrad. The photoinjector consists of a DC gap and a 2+1/2-cell SRF cavity, and it is designed to produce 4.2 MeV electron beams at 100pC bunch charge and 81.25MHz repetition rate (8 mA average current).

  20. Mean pion multiplicities in Ar+Sc collisions

    CERN Document Server

    Naskręt, Michał

    2016-01-01

    Preliminary results for mean negatively charged pion multiplicities $\\langle \\pi^- \\rangle$ using the $h^-$ method are presented for central Ar+Sc collisions at 13, 19, 30, 40, 75 and 150\\textit{A} GeV/c beam momentum. The data were recorded by the NA61/SHINE detector at the CERN SPS. Starting with rapidity distributions ${dn}/{dy}$ the procedure of obtaining total multiplicities is presented. The mean number of wounded nucleons $\\langle W\\rangle$ extracted from the Glissando MC model is used to calculate the ratio $\\langle \\pi^- \\rangle/\\langle W\\rangle.$ The results are compared to those from other experiments and their dependence on colliding systems and collision energy is discussed.

  1. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan Christian

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering. Each project description provides a brief overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually...... page. Furthermore, other ideas for projects may be discussed with a potential supervisor. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project....

  2. Domain structure and phase transition in Sc-doped zirconia

    Science.gov (United States)

    Brunauer, G.; Boysen, H.; Frey, F.; Ehrenberg, H.

    2002-01-01

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm↔R bar 3 m) in ZrO2 doped with 11% Sc2O3 has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases.

  3. Final Report for DOE Grant Number DE-SC0001481

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Edison [Rice University

    2013-12-02

    This report covers research activities, major results and publications supported by DE-SC-000-1481. This project was funded by the DOE OFES-NNSA HEDLP program. It was a joint research program between Rice University and the University of Texas at Austin. The physics of relativistic plasmas was investigated in the context of ultra-intense laser irradiation of high-Z solid targets. Laser experiments using the Texas Petawatt Laser were performed in the summers of 2011, 2012 and 2013. Numerical simulations of laser-plasma interactions were performed using Monte Carlo and Particle-in-Cell codes to design and support these experiments. Astrophysical applications of these results were also investigated.

  4. Toward low-cost affinity reagents: lyophilized yeast-scFv probes specific for pathogen antigens.

    Directory of Open Access Journals (Sweden)

    Sean A Gray

    Full Text Available The generation of affinity reagents, usually monoclonal antibodies, remains a critical bottleneck in biomedical research and diagnostic test development. Recombinant antibody-like proteins such as scFv have yet to replace traditional monoclonal antibodies in antigen detection applications, in large part because of poor performance of scFv in solution. To address this limitation, we have developed assays that use whole yeast cells expressing scFv on their surfaces (yeast-scFv in place of soluble purified scFv or traditional monoclonal antibodies. In this study, a nonimmune library of human scFv displayed on the surfaces of yeast cells was screened for clones that bind to recombinant cyst proteins of Entamoeba histolytica, an enteric pathogen of humans. Selected yeast-scFv clones were stabilized by lyophilization and used in detection assay formats in which the yeast-scFv served as solid support-bound monoclonal antibodies. Specific binding of antigen to the yeast-scFv was detected by staining with rabbit polyclonal antibodies. In flow cytometry-based assays, lyophilized yeast-scFv reagents retained full binding activity and specificity for their cognate antigens after 4 weeks of storage at room temperature in the absence of desiccants or stabilizers. Because flow cytometry is not available to all potential assay users, an immunofluorescence assay was also developed that detects antigen with similar sensitivity and specificity. Antigen-specific whole-cell yeast-scFv reagents can be selected from nonimmune libraries in 2-3 weeks, produced in vast quantities, and packaged in lyophilized form for extended shelf life. Lyophilized yeast-scFv show promise as low cost, renewable alternatives to monoclonal antibodies for diagnosis and research.

  5. File list: ALL.PSC.50.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX53...RX590290,SRX590286,SRX661084,SRX1074905,SRX1074908,SRX535237,SRX535241,SRX661085,SRX1074909,SRX1074906 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.50.AllAg.EpiSC.bed ...

  6. File list: ALL.PSC.10.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX1074917,SRX1074916,SRX590285,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535238,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.10.AllAg.EpiSC.bed ...

  7. File list: ALL.PSC.05.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX590288,SRX53...RX590290,SRX590289,SRX590285,SRX1074916,SRX1074917,SRX590286,SRX535242,SRX1074908,SRX1074905,SRX535237 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.05.AllAg.EpiSC.bed ...

  8. File list: ALL.PSC.20.AllAg.EpiSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.EpiSC mm9 All antigens Pluripotent stem cell EpiSC SRX535239,SRX66...RX590289,SRX590285,SRX590290,SRX590286,SRX1074909,SRX1074908,SRX1074905,SRX1074906,SRX535237,SRX535241 http://dbarchive.biosc...iencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.20.AllAg.EpiSC.bed ...

  9. Model of Dees and Rotco for the 600 MeV SC

    CERN Multimedia

    1978-01-01

    The accelerating frequency of the 600 MeV Synchro-Cyclotron (SC) was modulated by the varying capacity of a rotating condenser ("Rotco", the most delicate component of the SC). A 1/5-scale model, dating from the design-period of the SC, was used to study improvements to the SC RF-system, and also the acceleration of ions, first Helium and, at the time of this picture, Carbon. In the middle of the picture is the case containing the Dees. To the left, at the wide end of the cone, a rotco. Reinhold Hohbach is busy with measurements. See also 7805235 (Annual Report 1978, p.110).

  10. Nuclear Level Density and Gamma-Ray Strength Function of 43Sc

    CERN Document Server

    Bürger, A; Hilaire, S; Guttormsen, M; Harissopulos, S; Kmiecik, M; Konstantinopoulos, T; Krticka, M; Lagoyannis, A; Lönnroth, T; Mazurek, K; Norrby, M; Nyhus, H T; Perdikakis, G; Siem, S; Spyrou, A; Syed, N U H; 10.1103/PhysRevC.85.064328

    2012-01-01

    The nuclear level density and the gamma-ray strength function have been determined for 43Sc in the energy range up to 2 MeV below the neutron separation energy using the Oslo method with the 46Ti(p,alpha)43Sc reaction. A comparison to 45Sc shows that the level density of 43Sc is smaller by an approximately constant factor of two. This behaviour is well reproduced in a microscopical/combinatorial model calculation. The gamma-ray strength function is showing an increase at low gamma-ray energies, a feature which has been observed in several nuclei but which still awaits theoretical explanation.

  11. Ferromagnetism carried by highly delocalized hybrid states in Sc-doped ZnO thin films

    KAUST Repository

    Benali Kanoun, Mohammed

    2012-05-29

    We present first-principles results for Sc-doped ZnOthin films. Neighboring Sc atoms in the surface and/or subsurface layers are found to be coupled ferromagnetically, where only two of the possible configurations induce spin polarization. In the first configuration, the polarization is carried by the Sc d states as expected for transition metaldoping. However, there is a second configuration which is energetically favorable. It is governed by polarized hybrid states of the Zns, O p, and Sc d orbitals. Such highly delocalized states can be an important ingredient for understanding the magnetism of dopedZnOthin films.

  12. Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy

    Institute of Scientific and Technical Information of China (English)

    高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧

    2004-01-01

    The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.

  13. Baculovirus display of single chain antibody (scFv using a novel signal peptide

    Directory of Open Access Journals (Sweden)

    Gonzalez Gaëlle

    2010-11-01

    Full Text Available Abstract Background Cells permissive to virus can become refractory to viral replication upon intracellular expression of single chain fragment variable (scFv antibodies directed towards viral structural or regulatory proteins, or virus-coded enzymes. For example, an intrabody derived from MH-SVM33, a monoclonal antibody against a conserved C-terminal epitope of the HIV-1 matrix protein (MAp17, was found to exert an inhibitory effect on HIV-1 replication. Results Two versions of MH-SVM33-derived scFv were constructed in recombinant baculoviruses (BVs and expressed in BV-infected Sf9 cells, N-myristoylation-competent scFvG2/p17 and N-myristoylation-incompetent scFvE2/p17 protein, both carrying a C-terminal HA tag. ScFvG2/p17 expression resulted in an insoluble, membrane-associated protein, whereas scFvE2/p17 was recovered in both soluble and membrane-incorporated forms. When coexpressed with the HIV-1 Pr55Gag precursor, scFvG2/p17 and scFvE2/p17 did not show any detectable negative effect on virus-like particle (VLP assembly and egress, and both failed to be encapsidated in VLP. However, soluble scFvE2/p17 isolated from Sf9 cell lysates was capable of binding to its specific antigen, in the form of a synthetic p17 peptide or as Gag polyprotein-embedded epitope. Significant amounts of scFvE2/p17 were released in the extracellular medium of BV-infected cells in high-molecular weight, pelletable form. This particulate form corresponded to BV particles displaying scFvE2/p17 molecules, inserted into the BV envelope via the scFv N-terminal region. The BV-displayed scFvE2/p17 molecules were found to be immunologically functional, as they reacted with the C-terminal epitope of MAp17. Fusion of the N-terminal 18 amino acid residues from the scFvE2/p17 sequence (N18E2 to another scFv recognizing CD147 (scFv-M6-1B9 conferred the property of BV-display to the resulting chimeric scFv-N18E2/M6. Conclusion Expression of scFvE2/p17 in insect cells using a BV

  14. Production of single chain Fab (scFab fragments in Bacillus megaterium

    Directory of Open Access Journals (Sweden)

    Dübel Stefan

    2007-11-01

    Full Text Available Abstract Background The demand on antigen binding reagents in research, diagnostics and therapy raises questions for novel antibody formats as well as appropriate production systems. Recently, the novel single chain Fab (scFab antibody format combining properties of single chain Fv (scFv and Fab fragments was produced in the Gram-negative bacterium Escherichia coli. In this study we evaluated the Gram-positive bacterium Bacillus megaterium for the recombinant production of scFab and scFvs in comparison to E. coli. Results The lysozyme specific D1.3 scFab was produced in B. megaterium and E. coli. The total yield of the scFab after purification obtained from the periplasmic fraction and culture supernatant of E. coli was slightly higher than that obtained from culture supernatant of B. megaterium. However, the yield of functional scFab determined by analyzing the antigen binding activity was equally in both production systems. Furthermore, a scFv fragment with specificity for the human C reactive protein was produced in B. megaterium. The total yield of the anti-CRP scFv produced in B. megaterium was slightly lower compared to E. coli, whereas the specific activity of the purified scFvs produced in B. megaterium was higher compared to E. coli. Conclusion B. megaterium allows the secretory production of antibody fragments including the novel scFab antibody format. The yield and quality of functional antibody fragment is comparable to the periplasmic production in E. coli.

  15. Expression and bioactivity identification of soluble MG7 scFv

    Institute of Scientific and Technical Information of China (English)

    Zhao-Cai Yu; Jie Ding; Bo-Rong Pan; Dai-Ming Fan; Xue-Yong Zhang

    2002-01-01

    AIM: To examine the molecular mass and identify thebioactivity of MG7 scFv for its application as a targetingmediator in gene therapy of gastric cancer.METHODS: Two strongly positive recombinant phage clonesscreened from MG7 recombinant phage antibody library wereseparately transfected into E. coli TG1. Plasmid wasisolated from the transfected E. coli TG1 and digested byEcoR Ⅰ and Hind Ⅲ to examine the length of exogenousscFv gene. Then, the positive recombinant phage cloneswere individually transfected into E. coli HB2151. Thetransfectant was cultured and induced by IPTG. Perplasmicextracts was prepared from the induced transfectant byosmotic shock. ELISA was used to examine the antigen-binding affinity of the soluble MG7 scFv. Immunodottingassay was adopted to evaluate the yield of soluble MG7 scFvproduced by transfected E. coli HB2151. Western blot wasused to examine the molecular mass of MG7 scFv. Finally,the nucleotide sequence of MG7 scFv was examined by DNAsequencing.RESULTS: Two positive recombinant phage clones werefound to contain the exogenous scFv gene. ELISA showedthat MG7 scFv had strong antigen-binding affinity.Immuodotting assay showed that transfected E. coli HB2151could successfully produce the soluble MG7 scFv with highyield via induction by IPTG. The molecular mass of MG7scFv was 30 kDa by western blot. DNA sequencingdemonstrated that the VH and VL genes of MG7 scFv were363bp and 321 bp, respectively.CONCLUSION: We have successfully developed the solubleMG7 scFv which possessed strong antigen-binding affinity.

  16. NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes under internal dry reforming of simulated biogas mixtures

    Science.gov (United States)

    Shiratori, Y.; Sasaki, K.

    Solid oxide fuel cells (SOFCs) with NiO-ScSZ and Ni 0.9Mg 0.1O-ScSZ-based anodes were operated by directly feeding a fuel mixture of CH 4, CO 2 and N 2 (CH 4 to CO 2 ratio of 3:2). Stable operation under constant current load (200 mA cm -2) was achieved with a NiO-ScSZ type anode during 200 h operating hours at 900 °C. Less stable operation occurred with a Ni 0.9Mg 0.1O-ScSZ type anode. In the case of SOFC with Ni 0.9Mg 0.1O-ScSZ as the anode, the methane reforming activity was higher than that with NiO-ScSZ. This was explained by change in the microstructure promoting reforming reactions. However, the addition of MgO resulted in degradation of electrochemical performance due to increase in ohmic resistance of the anode material during operation.

  17. Final Technical Report – DOE Grant DE-SC0005904

    Energy Technology Data Exchange (ETDEWEB)

    Dear, Jody [Connecticut State Univ. System, Hartford, CT (United States)

    2013-10-23

    DOE grant DE-SC0005904 was allocated to fund the faculty development, curriculum development and travel to support the four institutions of the Connecticut State University System’s (CSUS) Initiative for Nanotechnology-related Equipment, Faculty Development and Curriculum Development. DOE grant DE-SC0005072 was also awarded for this program. In 2010, CSUS had identified the establishment of nanotechnology programs and infrastructure as a priority. At that time, the system set the goal of establishing an academic initiative in nanotechnology for the CSUS, beginning with the development of a series of courses at the graduate level. Implementation was planned via a collaborative effort including faculty from all four of the CSUS campuses. The CSUS Nanotechnology Working Group [CSUS NWG] was established to accomplish this goal. A faculty member from the Physics Department at Southern Connecticut State University [SCSU] was assigned the task of organizing and coordinating the work of the CSUS NWG. Representatives from each of the four CSUS campuses were appointed to join the CSUS NWG with the following initial representation: SCSU [Physics and Biology], Western Connecticut State University (WCSU) [Chemistry], Eastern Connecticut State University (ECSU) [Chemistry] and Central Connecticut State University (CCSU) [Chemistry. As a further outcome it was determined that this collaborative effort would lead to the establishment of a formal nanotechnology center, serving as the nucleus of CSUS student and faculty learning and research. This CSUS Nanotechnology Center [CSUS-NC] was to be located at Southern Connecticut State University (SCSU). The goal of this grant was to provide funding for curriculum and faculty development necessary to facilitate the development and implementation of a collaborative Graduate Certificate in Nanotechnology for the Connecticut State University System. This outcome has been successfully achieved. The courses and structure of the Graduate

  18. EngenuitySC Commercialization and Entrepreneurial Training Project

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Meghan; Hutton, Katherine R

    2012-12-31

    A team led by EngenuitySC has performed education and outreach on development of advanced energy markets that will enable wider use of clean energy technologies. This report details the efforts that have made significant advances to improve the market place through education, outreach, and increased communications between industry members. The project resulted in two self-funded industry clusters known as the Fuel Cell Collaborative and NuHub. This project has focused on building and strengthening the leading clean energy clusters in South Carolina: nuclear energy and fuel cell technologies. For the nuclear industry, a new cluster was developed that is now known as NuHub. This cluster has already engaged over 25 nuclear industry leaders or suppliers, four public sector partners, six community economic development foundations, and nearly ten academic partners in a 175 mile radius between Augusta, Georgia and Charlotte, North Carolina. Our outreach has touched over 2,000 stakeholders through the website alone, not including the public audiences and members of the business community reached through news stories and releases that were distributed to over 620 print and online publications. NuHub has established a formal leadership structure, developed subcommittees to focus on industry issues, instituted educational programs for the workforce, and created an industry funding structure that will sustain the industry cluster and mission. NuHub has participated in a wide-variety of community building and outreach activities since its formation under this grant. In the two years since its creation in 2010, we have initiated efforts focused in four main areas that correlate with the four NuHub subcommittees including: innovation, workforce development, industry engagement, and marketing and communications. NuHub successfully raised over $160,000 in both public and private funding, which has supported work to grow the cluster and engage partners including NuScale, Fluor, and

  19. High-efficient physical adsorption and detection of formaldehyde using Sc- and Ti-decorated graphdiyne

    Science.gov (United States)

    Chen, Xi; Gao, Pengfei; Guo, Lei; Wen, Yanni; Fang, Dangqi; Gong, Baihua; Zhang, Yang; Zhang, Shengli

    2017-03-01

    In sensitive analysis, the ultimate limit is to achieve reliable detection on trace amount of molecules. In this work, Sc- and Ti-decorated graphdiyne were proposed as promising materials for high-efficient molecular detection. Using density functional theory calculations, we investigated the electronic response of single Sc- and Ti-atom-decorated graphdiyne to HCHO (as a typical air pollutant). Thermodynamic analysis predicted that Sc or Ti adatom could be stabilized on the corner sites of single-layer graphdiyne sheet, with migration barriers high enough to prevent Sc or Ti adatom aggregation. The adsorption of HCHO on Sc- or Ti-decorated graphdiyne was found stronger than on pristine graphene or graphdiyne, which provides a prerequisite for molecular sensing. The electronegativity of HCHO leads to strong electronic attraction from Sc or Ti adatom to HCHO, resulting in a remarkable decrease of carrier density in graphdiyne. On Ti-decorated graphdiyne, the electronic attraction of HCHO appears to be stronger than on Sc-decorated graphdiyne and changes the system from metal to n-doped semiconductor. Quantum transport calculations show a decrease of current caused by the adsorbed HCHO. The results systematically exhibit the electronic response of Sc- or Ti-decorated graphdiyne to HCHO and suggest them as promising materials for molecule detection.

  20. 33 CFR 110.72c - Lake Murray, S.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Murray, S.C. 110.72c Section 110.72c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.72c Lake Murray, S.C. (a) The area beginning at the...

  1. Hydrogenation reactions using scCO2 as a solvent in microchannel reactors.

    Science.gov (United States)

    Kobayashi, Juta; Mori, Yuichiro; Kobayashi, Shū

    2005-05-28

    We have developed an effective microfluidic system for hydrogenation reactions in scCO(2); the reactions proceeded very rapidly (within 1 second), by making the best use of scCO(2) and utilizing the large specific interfacial area of the microchannel reactor, and high reaction productivity was attained in each channel.

  2. Renormalized molecular levels in a Sc3N@C-80 molecular electronic device

    DEFF Research Database (Denmark)

    Larade, Brian; Taylor, Jeremy Philip; Zheng, Q. R.;

    2001-01-01

    We address several general questions about quantum transport through molecular systems by an ab initio analysis of a scandium-nitrogen doped C-80 metallofullerene device. Charge transfer from the Sc3N is found to drastically change the current-voltage characteristics: the current through the Sc3N...

  3. SC-535, a Novel Oral Multikinase Inhibitor, Showed Potent Antitumor Activity in Human Melanoma Models

    Directory of Open Access Journals (Sweden)

    Xin Chen

    2013-07-01

    Full Text Available Background: Melanoma is considered as one of the most aggressive and deadliest cancers and current targeted therapies of melanoma often suffer limited efficacy or drug resistance. Discovery of novel multikinase inhibitors as anti-melanoma drug candidates is still needed. Methods: In this investigation, we assessed the in vitro and in vivo anti-melanoma activities of SC-535, which is a novel small molecule multikinase inhibitor discovered by us recently. We analyzed inhibitory effects of SC-535 on various melanoma cell lines and human umbilical vascular endothelial cells (HUVEC in vitro. Tumor xenografts in athymic mice were used to examine the in vivo activity of SC-535. Results: SC-535 could efficiently inhibit vascular endothelial growth factor receptor (VEGFR 1/2/3, B-RAF, and C-RAF kinases. It showed significant antiangiogenic potencies both in vitro and in vivo and considerable anti-proliferative ability against several melanoma cell lines. Oral administration of SC-535 resulted in dose-dependent suppression of tumor growth in WM2664 and C32 xenograft mouse models. Studies of mechanisms of action indicated that SC-535 suppressed the tumor angiogenesis and induced G2/M phase cell cycle arrest in human melanoma cells. SC-535 possesses favorable pharmacokinetic properties. Conclusion: All of these results support SC-535 as a potential candidate for clinical studies in patients with melanoma.

  4. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  5. Structural and electronic studies of metal carbide clusterfullerene Sc2C2@Cs-C72

    Science.gov (United States)

    Feng, Yongqiang; Wang, Taishan; Wu, Jingyi; Feng, Lai; Xiang, Junfeng; Ma, Yihan; Zhang, Zhuxia; Jiang, Li; Shu, Chunying; Wang, Chunru

    2013-07-01

    We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed.We present a metal carbide clusterfullerene Sc2C2@Cs(10528)-C72, whose structure has been baffling for many years. A motional endohedral Sc2C2 cluster, special molecule geometry and electronic structure were found in Sc2C2@Cs(10528)-C72. The paramagnetic Sc2C2@Cs-C72 anion radical was successfully prepared by a chemical reduction method and hyperfine couplings in the ESR spectrum were observed. Electronic supplementary information (ESI) available: Experimental details, HPLC chromatogram, and DFT calculations. CCDC 917712. For ESI and crystallographic data in CIF or other electronic format see DOI: 10.1039/c3nr01739g

  6. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC.

  7. Characterization of early transient accumulation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Elhelaly, Abdelazim Elsayed; Inoshima, Yasuo; Ishiguro, Naotaka

    2013-09-27

    PrP(Sc) is known to elicit no specific immune response and the immune cells are suspected to support its accumulation. In the present study, we investigated the response of some immune cell types to PrP(Sc) to characterize an observed early transient accumulation of PrP(Sc). After cells were treated with PrP(Sc)-brain homogenate, PrP(Sc) was transiently accumulated for the first 8-12h post-exposure then completely cleared by the 5th day of the experiment. The accumulated PrP(Sc) was not a de novo product of the cell PrP(C). Further investigation of this phenomenon revealed some potential factors influencing it. These factors included cholesterol homeostasis, temperature, the degradation power of the cell and the availability of sufficient PrP(C). Our in vitro results suggest that immune cells, especially macrophages are potential risk factors for the accumulation and intercellular spread of PrP(Sc) if the complete clearance of PrP(Sc) were not fulfilled.

  8. Curriculum (Study Programme) for the M.Sc., Medialogy, at Aalborg University in Copenhagen

    DEFF Research Database (Denmark)

    Serafin, Stefania; Nordahl, Rolf; Lavatino, Salvatore

    2004-01-01

    Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen.......Defining and describing the education, M.Sc., Medialogy. The curriculum (Study Programme) describes semesters, themes, projectunits, courses and contents of the eduation. offered at Aalborg University in Copenhagen....

  9. PRODUCTION, ISOLATION AND SPECTROSCOPIC STUDIES OF THE ENDOHEDRAL FULLERENE Sc2@C80 (Ⅰ-Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Chunru Wang; Lihua Gan; Chunli Bai; Hisanori Shinohara

    2004-01-01

    The isolation of multiple-isomers of Sc2@C80 (Ⅰ, Ⅱ, Ⅲ) endohedral metallofullerenes is reported for the first time. The new C80-based Sc-metallofullerenes are characterized by UV-Vis-NIR absorption spectroscopy and detailed chromatographic retention time data. A close relationship between the isomer structure and the corresponding HPLC retention time of the metallofullerenes is presented.

  10. Implementation of LTE SC-FDMA on the USRP2 Software Defined Radio Platform

    DEFF Research Database (Denmark)

    Jørgensen, Peter Bjørn; Hansen, Thomas Lundgaard; Sørensen, Troels Bundgaard;

    2011-01-01

    In this paper we discuss the implementation of a Single Carrier Frequency Division Multiple Access (SC-FDMA) transceiver running over the Universal Software Radio Peripheral 2 (USRP2). SC-FDMA is the air interface which has been selected for the uplink in the latest Long Term Evolution (LTE...

  11. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of...

  12. Effect of Sc addition on microstructure and mechanical properties of 1460 alloy

    Directory of Open Access Journals (Sweden)

    Juan Ma

    2014-02-01

    Full Text Available The effect of minor addition of Sc on microstructure, age hardening behavior, tensile properties and fracture morphology of 1460 alloy have been studied. It is found that Sc content increase from 0.11 wt% to 0.22 wt% is favorable for grain refinement in as-cast alloy but results in a coarsening of Cu-rich particles. The alloy with 0.11 wt% Sc exhibits enhanced mechanical properties and age hardening effect. Transmission electron microscopy (TEM investigations on the alloy with 0.11 wt% Sc have suggested that a large amount of Al3(Sc, Zr particles precipitated at the earlier aging may inhibit recrystallization effectively.

  13. Homogenization and Recrystallization of Al-6Mg Alloys with and without Sc and Zr

    Institute of Scientific and Technical Information of China (English)

    姜锋; 尹志民; 黄伯云; 贺跃辉; 陈苏里

    2004-01-01

    Plates of Al-6Mg alloys with and without scandium were prepared by semi-continuous cast, homogenization, hot-rolled, cold-rolled and annealing. Based on studying of effects of temperature and time on hardness and conductivity during homogenization, it was found that homogenization of ingot with Sc and Zr can result in dispersion strengthening. Recrystallization temperature of alloys was studied by hardness method and optical metallographic method. Staring recrystallization temperature of Al-6Mg alloys with Sc and Zr is 375 ℃, increasing by 150 ℃ than Al-6Mg alloys without Sc and Zr. Mechanical properties (σb, σ0.2, δ) of hot-rolled alloy with Sc and Zr are 400 MPa, 280 MPa and 18%; cold-rolled and anneal alloy with Sc and Zr are 420 MPa, 310 MPa and 12% respectively.

  14. Preliminary Tests Of The Decris-sc Ion Source

    CERN Document Server

    Efremov, A; Bechterev, V; Bogomolov, S L; Bondarenko, P G; Datskov, V I; Dmitriev, S; Drobin, V; Lebedev, A; Leporis, M; Malinowski, H; Nikiforov, A; Paschenko, S V; Seleznev, V; Shishov, Yu A; Smirnov, Yu; Tsvineva, G; Yakovlev, B; Yazvitsky, N Yu

    2004-01-01

    A new "liquid He-free" superconducting Electron Cyclotron Resonance Ion Source DECRIS-SC, to be used as injector for the IC-100 small cyclotron, has been designed by FLNR and LHE JINR. The main feature is that a compact refrigerator of Gifford-McMahon type is used to cool the solenoid coils. For the reason of very small cooling power at 4.2 K (about 1 W) our efforts were to optimize the magnetic structure and minimize an external heating of the coils. The maximum magnetic field strength is 3 T and 2 T in injection and extraction region respectively. For the radial plasma confinement a hexapole made of NdFeB permanent magnet is used. The source will be capable of ECR plasma heating using different frequencies (14 GHz or 18 GHz). To be able to deliver usable intensities of solids, the design is also allow axial access for evaporation oven and metal samples using the plasma sputtering technique. Very preliminary results of the source test are presented.

  15. Transition energy and oscillator strength of Sc18+ion

    Institute of Scientific and Technical Information of China (English)

    Wang Zhi-Wen; Yang Di; Hu Mu-Hong; Han Qiu-Ju; Li Jin-Ying

    2005-01-01

    The transition energies and the dipole oscillator strengths for the 1s22s-1s2np (2 ≤ n ≤ 9) and 1s22p-1s2nd (3≤n ≤ 9) of lithium-like Sc18+ ion are calculated by using the full core plus correlation method. The fine structure splittings of 1s2np and 1s2nd (n ≤ 9) states are determined from the expectation values of spin-orbit and spin-otherorbit interaction operators. The quantum defects of these series, as function of principal quantum number n, are obtained. The agreement between the f-values obtained from three alternative formulae is excellent. Comparisons of our results with experimental data available in the literature are carried out. Combining the single-channel quantum defect theory with the discrete oscillator strengths obtained in this work, this paper obtains the behaviour of discrete oscillator strengths and oscillator strength densities corresponding to the bound-free transitions adjacent to ionization threshold.

  16. Spectrophotometric Distances to Galactic H\\,{\\sc{ii}} Regions

    CERN Document Server

    Moisés, A P; Figuerêdo, E; Blum, R D; Conti, P S; Barbosa, C L

    2010-01-01

    We present a near infrared study of the stellar content of 35 H\\,{\\sc{ii}} regions in the Galactic plane. In this work, we have used the near infrared domain $J-$, $H-$ and $K_{s}-$ band color images to visually inspect the sample. Also, color-color and color-magnitude diagrams were used to indicate ionizing star candidates, as well as, the presence of young stellar objects such as classical TTauri Stars (CTTS) and massive young stellar objects (MYSOs). We have obtained {\\it Spitzer} IRAC images for each region to help further characterize them. {\\it Spitzer} and near infrared morphology to place each cluster in an evolutionary phase of development. {\\it Spitzer} photometry was also used to classify the MYSOs. Comparison of the main sequence in color-magnitude diagrams to each observed cluster was used to infer whether or not the cluster kinematic distance is consistent with brightnesses of the stellar sources. We find qualitative agreement for a dozen of the regions, but about half the regions have near infr...

  17. INTERVIU CU DOAMNA SIMONA CAROBENE, ADMINISTRATORUL SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available Fabrica de mozaic, înregistrată la Oficiul Registrului Comerţului în aprilie 2012 a luat fiinţă în cadrul unui proiect cu finanţare europeană nerambursabilă și are în prezent statutul de unitate protejată autorizată. În cadrul acesteia sunt angajați 10 tineri post instituţionalizați, pentru care integrarea în viaţa socială şi profesională este dificilă. Întreprinderea socială SC Proiect Mozaic SRL este rezultatul întâlnirii dintre sectorul social, non-profit şi sectorul business, deoarece are la bază un parteneriat cu un important grup de firme din domeniul construcţiilor şi amenajărilor interioare din București. În paralel cu activitatea de producţie a mozaicului, ocazional, Proiect Mozaic oferă către clienți și servicii de ambalare și asamblare produse.

  18. Domain structure and phase transition in Sc-doped zirconia

    Energy Technology Data Exchange (ETDEWEB)

    Brunauer, G.; Boysen, H.; Frey, F. [Institute for Crystallography und Applied Mineralogy, LMU Muenchen, Munich (Germany); Ehrenberg, H. [Institute for Materials Science, TU Darmstadt, Darmstadt (Germany)

    2002-01-21

    The temperature dependence of the domain structure associated with the ferroelastic phase transition (Fm{sup 3-bar}m{r_reversible}R{sup 3-bar}m) in ZrO{sub 2} doped with 11% Sc{sub 2}O{sub 3} has been determined from a peak shape analysis of high-resolution synchrotron x-ray powder diffraction data. In the temperature region of coexisting phases the observed characteristic anisotropic broadening and asymmetry of the lines is modelled by three different phases: a main rhombohedral phase, a distorted rhombohedral phase with a smaller c/a ratio, and a cubic phase. The latter two are assigned to the internal structure of the domain walls between two adjacent twin domains. The size and amount of the cubic phase show an initially slow increase with temperature followed by a very steep increase and a slow one after that. The size of the (main) rhombohedral domains remains nearly constant, while (micro-) strain in the distorted regions gradually decreases. (author)

  19. Downregulation of the Musca domestica peptidoglycan recognition protein SC (PGRP-SC) leads to overexpression of antimicrobial peptides and tardy pupation.

    Science.gov (United States)

    Gao, Yifu; Tang, Ting; Gu, Jihai; Sun, Lingling; Gao, Xiaobin; Ma, Xianyong; Wang, Xiaochun; Liu, Fengsong; Wang, Jianhui

    2015-10-01

    PGRP (peptidoglycan recognition protein) is a conserved protein family that recognizes the peptidoglycan in bacterial cell wall and causes the activation of various innate immune responses. Previous studies have reported that PGRP-SCs in Drosophila dampen the activation of Immune Deficiency (Imd) pathway to microbial infection, and participate in the lifespan extension of the insects. To facilitate understanding the function of PGRP-SCs from an evolutionary angle, we identified and functionally characterized the PGRP-SC gene in the housefly Musca domestica, a species that has adapted to a septic environment much harsher than the natural habitat of Drosophila. The gene designated as MdPGRP-SC was found most abundantly expressed in the 3rd instar larvae, and is expressed at this developmental stage predominantly in the gut. MdPGRP-SC was virtually unchanged in whole larvae after a septic injury at the second larval instar, while two antimicrobial peptides (AMPs), diptericin and attacin, were upregulated in the first 24h but not later. Through dsRNA microinjection, MdPGRP-SC was knocked down by RNA interference (RNAi), and caused the significant increased expression of diptericin and attacin. The pupation of MdPGRP-SC-depleted larvae was severely suppressed compared to controls. Opposite to the expression trend of MdPGRP-SC, a spontaneous active expression of diptericin and attacin was found in pre-pupae but not in third instar larvae. Taken together, our study reveals that downregulation of MdPGRP-SC leads to the overexpression of the AMPs, and is involved in the larvae-to-pupa transition of housefly.

  20. Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

    OpenAIRE

    Recopar, Editor

    2014-01-01

    Avance normativo del SC 8 de AENOR “Conservación, restauración y rehabilitación de edificios” = Standardisation Advance of AENOR SC 8 “Conservation, Restoration and Rehabilitation of Buildings”

  1. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  2. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  3. One-neutron knockout from {sup 51-55}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Schwertel, S.; Maierbeck, P.; Gernhaeuser, R.; Bildstein, V.; Boehmer, M.; Eppinger, K.; Faestermann, T.; Friese, J.; Fabbietti, L.; Maier, L.; Winkler, S. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Kruecken, R. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); TRIUMF, Vancouver (Canada); University of British Columbia, Department of Physics and Astronomy, Vancouver (Canada); Kroell, T. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Alvarez-Pol, H.; Benjamim, E.A.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Gascon, M.; Kurtukian, T.; Perez, D.; Rodriguez-Tajes, C. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Aksouh, F.; Aumann, T.; Behr, K.; Boretzky, K.; Bruenle, A.; Chatillon, A.; Chulkov, L.V.; Geissel, H.; Gerl, J.; Gorska, M.; Kojouharov, I.; Klimkiewicz, A.; Kurz, N.; Nociforo, C.; Schaffner, H.; Simon, H.; Stanoiu, M.; Suemmerer, K.; Weick, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Borge, M.J.G.; Pascual-Izarra, C.; Perea, A.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Buerger, A. [University of Oslo, SAFE/OCL, Oslo (Norway); CEA, Gif-sur-Yvette (France); Casarejos, E.; Brown, B.A. [University of Vigo, Vigo (Spain); Enders, J.; Schrieder, G. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Hansen, P.G. [Michigan State University, NSCL, East Lansing, Michigan (United States); Jonson, B.; Nyman, G. [Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Kanungo, R. [TRIUMF, Vancouver (Canada); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Saint Mary' s University, Halifax (Canada); Kiselev, O. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg Universitaet, Mainz (Germany); Paul Scherrer Institut, Villigen (Switzerland); Larsson, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Le Bleis, T. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); IN2P3-CNRS/Universite Louis Pasteur, Institut Pluridisciplinaire Hubert Curien, Strasbourg Cedex 2 (France); Mahata, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Paul Scherrer Institut, Villigen (Switzerland); Nilsson, T. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Chalmers Tekniska Hoegskola och Goeteborgs Universitet, Experimentell Fysik, Goeteborg (Sweden); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Rossi, D. [Johannes Gutenberg Universitaet, Mainz (Germany); Sitar, B. [Comenius University, Faculty of Mathematics and Physics, Bratislava (Slovakia); Otsuka, T. [University of Tokyo, Hongo, Bunkyo-ku, Department of Physics, Tokyo (Japan); Tostevin, J.A. [University of Surrey, Department of Physics, Faculty of Engineering and Physical Sciences, Guildford (United Kingdom); Rae, W.D.M. [Garsington, Oxfordshire (United Kingdom)

    2012-12-15

    Results are presented from a one-neutron knockout experiment at relativistic energies of {approx} 420 A MeV on {sup 51-55}Sc using the GSI Fragment Separator as a two-stage magnetic spectrometer and the MINIBALL array for gamma-ray detection. Inclusive longitudinal momentum distributions and cross-sections were measured enabling the determination of the contributions corresponding to knockout from the {nu}p{sub 1/2}, {nu}p{sub 3/2}, (L = 1) and {nu}f{sub 7/2}, {nu}f{sub 5/2} (L = 3) neutron orbitals. The observed L = 1 and L = 3 contributions are compared with theoretical cross-sections using eikonal knockout theory and spectroscopic factors from shell model calculations using the GXPF1A interaction. The measured inclusive knockout cross-sections generally follow the trends expected theoretically and given by the spectroscopic strength predicted from the shell model calculations. However, the deduced L = 1 cross-sections are generally 30-40% higher while the L = 3 contributions are about a factor of two smaller than predicted. This points to a promotion of neutrons from the {nu}f{sub 7/2} to the {nu}p{sub 3/2} orbital indicating a weakening of the N = 28 shell gap in these nuclei. While this is not predicted for the phenomenological GXPF1A interaction such a weakening is predicted by recent calculations using realistic low-momentum interactions V{sub low} {sub k} obtained by evolving a chiral N3LO nucleon-nucleon potential. (orig.)

  4. Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

    Science.gov (United States)

    Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

    2016-09-05

    The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements.

  5. Compuestos perazufrados de platino(II) con ditioéteres y tiolatos fluorados. Estructuras cristalinas de [Pt(SC6F5)2 (p-C6H4FSCH2CH2-p-SC6H4F)], [Pt(p-SC6HF4)...

    OpenAIRE

    Jorge Bautista; Agusti Bertran; Sylvain Bernès; Ubaldo Duran; Hugo Torrens

    2003-01-01

    En este articulo se describen la síntesis y caracterización de los compuestos cis-[PtCl2(RfSCH2CH2SRf)], Rf = C6F5, p-SC6HF4, o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3), y las reacciones de estos compuestos con (SC6F5)– y (p-SC6HF4)– que generan cis- [Pt(SC6F5)2(RfSCH2CH2SRf)] y cis-[Pt(p-SC6HF4) 2(RfSCH2CH2 SRf)], Rf = o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3). Para estos compuestos, los datos de RMN de 19F obtenidos a diferentes temperaturas, muestran la presencia e interconversion de isóm...

  6. Validity evaluation of Sc x Al1-x N material constants based on SAW characteristics

    Science.gov (United States)

    Tang, Gongbin; Han, Tao; Zhang, Qiaozhen; Yamazaki, Kenta; Omori, Tatsuya; Hashimoto, Ken-ya

    2016-11-01

    This paper is aimed at examining the validity of material constants reported for use in surface acoustic wave (SAW) device simulations. First, based on the full set of material constants calculated by first principle, bulk acoustic wave velocities are calculated for Sc x Al1-x N and compared with published experimental results. Then, the effects of the Sc x Al1-x N material constants with different Sc content on acoustic characteristics are calculated and the influence of shear vibrations on SAW characteristics are recognized. Then, a series of SAW devices are fabricated on Sc x Al1-x N film/Si substrate structure with various Cu and ScAlN thicknesses h Cu and h ScAlN, respectively, and measured variations of phase velocity V and effective electromechanical coupling factor K\\text{e}2 with these parameters are compared with the calculation. The fairly well-agreed results indicate a reliable set of Sc x Al1-x N material constants for SAW device simulations.

  7. Growth and Holographic Storage Properties of Sc, Fe Co-Doped Lithium Niobate Crystals

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The holographic storage properties of Fe (0.03% (mass fraction) Fe2O3):LiNbO3 doped with Sc at different levels (0, 1%, 2%, 3%) were investigated.The Sc threshold concentration in Fe:LiNbO3 was implied to be about 3%(mole fraction) because O-H vibration absorption peak of Sc (3%):Fe:LiNbO3 was at 3508 cm-1, compared with 3484 cm-1 of crystals with lower Sc doping level.Sc(3%):Fe:LiNbO3 exhibited higher optical damage resistance ability.The threshold intensity (wavelength 488 nm) of Sc (3%):Fe:LiNbO3 was 2.2×102 W·cm-2, two orders of magnitude higher than that of Fe:LiNbO3.Holographic storage properties of the crystals were determined in an extraordinary polarized laser of wavelength 632.8 nm by a two-wave coupling method.It was found that in terms of holographic storage properties, the optimal doping concentration of Sc was 2%(mole fraction) among this crystal series.

  8. New separation method of no-carrier-added {sup 47}Sc from titanium targets

    Energy Technology Data Exchange (ETDEWEB)

    Bartos, B.; Majkowska, A.; Kasperek, A.; Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warszawa (Poland). Nuclear Chemistry and Radiochemistry Center

    2012-07-01

    Radionuclides with medium energy beta emission and a several day half-life are attractive candidates for radioimmunotherapy. Among the most promising in this category is {sup 47}Sc produced by fast neutron irradiation (E{sub n} > 1 MeV) of titanium target with high energy neutrons in {sup 47}Ti(n,p){sup 47}Sc nuclear reaction. In the previously reported production scheme the dissolution of the TiO{sub 2} target in hot concentrated H{sub 2}SO{sub 4} and evaporation of the resulting solution were the most time-consuming steps. The present paper describes new, simple and efficient production method of {sup 47}Sc, where the slow dissolution of the target is avoided. After irradiation in fast neutron flux {sup 47}TiO{sub 2} and Li{sub 2}{sup 47}TiF{sub 6} targets were dissolved in HF solutions. Next {sup 47}Sc was separated from the target using anion exchange resin Dowex 1 with 0.4 M HF + 0.06 M HNO{sub 3} solution as eluent. The eluted {sup 47}Sc was adsorbed on cation exchange resin and eluted with 0.5 M of ammonium acetate. The 47Sc separation yield in the proposed procedure is about 90% with the separation time less than 2 h. The obtained no-carrier-added {sup 47}Sc was used to label DOTATATE conjugate with 96% labeling yield. (orig.)

  9. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

  10. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  11. Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

  12. Differential dynamics of splicing factor SC35 during the cell cycle

    Indian Academy of Sciences (India)

    Kaushlendra Tripathi; Veena K Parnaik

    2008-09-01

    Pre-mRNA splicing factors are enriched in nuclear domains termed interchromatin granule clusters or nuclear speckles. During mitosis, nuclear speckles are disassembled by metaphase and reassembled in telophase in structures termed mitotic interchromatin granules (MIGs). We analysed the dynamics of the splicing factor SC35 in interphase and mitotic cells. In HeLa cells expressing green fluorescent protein (GFP)-SC35, this was localized in speckles during interphase and dispersed in metaphase. In telophase, GFP-SC35 was highly enriched within telophase nuclei and also detected in MIGs. Fluorescence recovery after photobleaching (FRAP) experiments revealed that the mobility of GFP-SC35 was distinct in different mitotic compartments. Interestingly, the mobility of GFP-SC35 was 3-fold higher in the cytoplasm of metaphase cells compared with interphase speckles, the nucleoplasm or MIGs. Treatment of cells with inhibitors of cyclin-dependent kinases (cdks) caused changes in the organization of nuclear compartments such as nuclear speckles and nucleoli, with corresponding changes in the mobility of GFP-SC35 and GFP-fibrillarin. Our results suggest that the dynamics of SC35 are significantly influenced by the organization of the compartment in which it is localized during the cell cycle.

  13. Production, purification, and characterization of scFv TNF ligand fusion proteins.

    Science.gov (United States)

    Fick, Andrea; Wyzgol, Agnes; Wajant, Harald

    2012-01-01

    Single-chain variable fragments (scFvs) specific for tumor-associated cell surface antigens are the most broadly used reagents to direct therapeutic or diagnostic effector molecules, such as toxins, radioisotopes, and CD3-stimulating scFvs, to tumors. One novel class of effector molecules that can be targeted to tumors by scFvs are ligands of the tumor necrosis factor (TNF) family. Typically, these molecules have apoptosis inducing and/or immune stimulating properties and are therefore highly attractive for cancer treatment. N-terminal fusion of scFvs does not interfere with the receptor binding capabilities of TNF ligands and thus allows the straightforward generation of scFv TNF ligand fusion proteins. We report here a protocol for the purification of eukaryotically produced scFv TNF ligand fusion proteins based on affinity chromatography on anti-Flag agarose and further describe assays for the determination of the targeting index of this type of scFv-targeted proteins.

  14. Differential Attack on Five Rounds of the SC2000 Block Cipher

    Institute of Scientific and Technical Information of China (English)

    Ji-Qiang Lv

    2011-01-01

    The SC2000 block cipher has a 128-bit block size and a user key of 128,192 or 256 bits,which employs a total of 6.5 rounds if a 128-bit user key is used.It is a CRYPTREC recommended e-government cipher in Japan.In this paper we address how to recover the user key from a few subkey bits of SC2000,and describe two 4.75-round differential characteristics with probability 2-126 of SC2000 and seventy-six 4.75-round differential characteristics with probability 2-127.Finally,we present a differential cryptanalysis attack on a 5-round reduced version of SC2000 when used with a 128-bit key; the attack requires 2125.68 chosen plaintexts and has a time complexity of 212575 5-round SC2000 encryptions.The attack does not threat the security of the full SC2000 cipher,but it suggests for the first time that the safety margin of SC2000 with a 128-bit key decreases below one and a half rounds.

  15. Synergistic capture of Clostridium botulinum Type A neurotoxin by scFv antibodies to novel epitopes

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean A.; Barr, John R.; Kalb, Suzanne R.; Marks, James D.; Baird, Cheryl L.; Cangelosi, Gerard A.; Miller, Keith D.; Feldhaus, Michael J.

    2011-10-01

    A non-immune library of human single chain fragment variable (scFv) antibodies displayed on Saccharomyces cerevisiae was screened for binding to the Clostridium botulinum neurotoxin serotype A binding domain [BoNT/A (Hc)] with the goal of identifying scFv to novel epitopes. To do this, an antibody-mediated labeling strategy was used in which antigen-binding yeast clones were selected after labeling with previously characterized monoclonal antibodies (MAbs) specific to the Hc. Twenty unique scFv clones were isolated that bound Hc. Of these, three also bound to full-length BoNT/A toxin complex with affinities ranging from 5 nM to 170 nM. Epitope binning showed that the three unique clones recognized at least two epitopes that were distinct from one another and from the detection MAbs. After production in E. coli, the scFv were coupled to magnetic particles and tested for their ability to capture BoNT/A holotoxin using an Endopep-MS assay. In this assay, toxin captured by scFv coated magnetic particles was detected by incubation of the complex with a peptide containing a BoNT/A-specific cleavage sequence. Mass spectrometry was used to detect the ratio of intact peptide to cleavage products as evidence for toxin capture. When tested individually, each of the scFv showed a weak positive Endopep-MS result. However, when the particles were coated with all three scFv simultaneously, they exhibited significantly higher Endopep-MS activity, consistent with synergistic binding. These results demonstrate novel approaches toward the isolation and characterization of scFv antibodies specific to unlabeled antigen. They also provide evidence that distinct scFv antibodies can work synergistically to increase the efficiency of antigen capture onto a solid support.

  16. Flow cytometry-based methods for assessing soluble scFv activities and detecting pathogen antigens in solution

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Sean; Weigel, Kris M.; Miller, Keith D.; Ndung' u, Joseph; Buscher, Philippe; Tran, Thao N.; Baird, Cheryl L.; Cangelosi, Gerard A.

    2010-04-01

    Novel methods are reported for evaluating and utilizing single chain fragment variable (scFv) antibodies derived from yeast-display libraries. Yeast-display was used to select scFv specific to invariant surface glycoproteins (ISG) of Trypanosoma brucei. A limiting step in the isolation of scFv from nonimmune libraries is the conversion of highly active yeast-displayed scFv into soluble antibodies that can be used in standard immunoassays. Challenges include limited solubility or activity following secretion and purification of scFv. For this reason, few scFv derived from yeast-display platforms have moved into development and implementation as diagnostic reagents. To address this problem, assays were developed that employ both yeastdisplayed and secreted scFv as analytical reagents. The first is a competitive inhibition flow cytometry (CIFC) assay that detects secreted scFv by virtue of its ability to competitively inhibit the binding of biotinylated antigen to yeast-displayed scFv. The second is an epitope binning assay that uses secreted scFv toidentify additional yeast-displayed scFv that bind nonoverlapping or noncompeting epitopes on an antigen. The epitope binning assay was used not only to identify sandwich assay pairs with yeast-displayed scFv, but also to identify active soluble scFv present in low concentration in a crude expression extract. Finally, a CIFC assay was developed that bypasses entirely the need for soluble scFv expression, by using yeast displayed scFv to detect unlabeled antigen in samples. These methods will facilitate the continued development and practical implementation of scFv derived from yeast-display libraries.

  17. Magnetic properties of Sc{sub x}Ti{sub 1-x}Fe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, M. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France); Deportes, J. [Lab. Louis Neel, CNRS, 38 - Grenoble (France); Ouladdiaf, B. [Institut Laue-Langevin, 38 - Grenoble (France); Sayetat, F. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France)

    1995-02-09

    The magnetic properties and their thermal dependences of Sc{sub 0.1}Ti{sub 0.9}Fe{sub 1.96}, Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2} and Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2.04} are compared with those of TiFe{sub 2}. The substitution changes the iron-iron distances. Consequently, the Fe atoms on the 6h site show in addition to the antiferromagnetic component a small ferromagnetic one, and a weak magnetic moment appears on the 2a site. ((orig.)).

  18. Assembly of a supercrystal (SC) of the CMS endcap electromagnetic calorimeter

    CERN Multimedia

    J. Williams et al., RAL

    2004-01-01

    The first three pictures show the insertion of the first three rows of crystals into the supercrystal SC03 on Jan. 2004 and the completion of the SC endstops. Fig. 4 shows a complete supercrystal and Fig. 5 its components (alveolar, interface plate, housing, optical fibre, insert, crystal and VPT, endstop). A set of 25 inserts is shown in Fig. 6, while Fig. 7 shows housing, interface plates and inserts. Finally, a SC rear view showing the Vacum Phototriode (VPT) wires through the inserts can be seen in Fig. 8. Fig. 9 and 10 show two supercrystals under test on Dee F and R, respectively.

  19. Valence electron structure analysis of refining mecha-nism of Sc and Ti additions on aluminum

    Institute of Scientific and Technical Information of China (English)

    LI PieJie; YE YiCong; HE LiangJu

    2009-01-01

    The mechanism of the difference of refining effect between Sc and Ti adding to aluminum can not be explained substantially with traditional theory. Valence electron structures of AI-Ti and Al-Sc alloys have been studied by using the empirical electron theory of solids and molecules (EET). The covalent bond electron numbers and interfacial electron density differences are calculated. The conclusion is that, in the two alloys, different covalent bond electron numbers of nucleation particles, and different electron densities on the interface between the second phase particles and the matrix, fundamentally lead to the difference of refining effect between Sc and Ti adding to aluminum.

  20. Ionic conductivity of co-doped Sc2O3-ZrO2 ceramics

    DEFF Research Database (Denmark)

    Omar, Shobit; bin Najib, Waqas; Chen, Weiwu

    2012-01-01

    The oxide ionic conductivity of Sc0.18Zr0.82O1.91 doped with 0.5 mol.% of both Yb2O3 and In2O3 is evaluated at various temperatures in air. Among various co-doped compositions, In0.02Sc0.18Zr0.80O1.90 exhibits the highest grain ionic conductivity followed by Yb0.02Sc0.18Zr0.80O1.90 at 500°C. Howe...

  1. Upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, estimated from ScSp phase

    OpenAIRE

    Osada, Kinue; Yoshizawa, Kazunori; YOMOGIDA, Kiyoshi

    2010-01-01

    Three-dimensional geometry of the upper boundary of the Pacific plate subducting beneath Hokkaido, Japan, was obtained using the ScSp phase: the phase converted from ScS (S wave reflected at the core-mantle boundary) to P wave at the plate boundary. Taking the advantage of a dense seismic network, "Hi-net", recently deployed across the Japanese islands, we applied several seismic array analyses to the recorded waveform data for a large nearby deep earthquake, in order to enhance very weak ScS...

  2. The Fifth Annual Sc2.0 and Synthetic Genomes Conference: Synthetic Genomes in High Gear.

    Science.gov (United States)

    Walker, Roy S K; Cai, Yizhi

    2016-09-16

    The Sc2.0 project is perhaps the largest synthetic biology project in the public domain, and ultimately aims to construct a new version of the humble brewer's yeast, Saccharomyces cerevisiae. Each year, the Sc2.0 consortium gather to discuss progress in this ambitious project and highlight new developments at the forefront of synthetic genome engineering. This viewpoint summarizes some of the key moments of the 2016 conference, including updates on the Sc2.0 project itself, mammalian synthetic biology, DNA assembly automation, HGP-Write and a panel discussion on the social and ethical perspectives of synthetic biology.

  3. Promising electron mobility and high thermal conductivity in Sc2CT2 (T = F, OH) MXenes.

    Science.gov (United States)

    Zha, Xian-Hu; Zhou, Jie; Zhou, Yuhong; Huang, Qing; He, Jian; Francisco, Joseph S; Luo, Kan; Du, Shiyu

    2016-03-21

    MXenes, the new 2D transition metal carbides and nitrides, have recently attracted extensive attention due to their diverse applications and excellent performances. However, the thermal and electrical properties of most MXene materials are yet to be studied. In this work, we investigate the electrical and thermal properties of semiconducting Sc2CT2 (T = F, OH) MXenes using first-principles calculations. Both of the Sc2CT2 (T = F, OH) MXenes are determined to show excellent carrier mobilities. The electron mobility in the Sc2CF2 MXene is found to be strongly anisotropic at room temperature, with values of 5.03 × 10(3) and 1.07 × 10(3) cm(2) V(-1) s(-1) in the zigzag and armchair directions, respectively. The predicted electron mobility in the zigzag direction of the Sc2CF2 is nearly four-fold that in the armchair direction of the promising semiconductor phosphorene. In contrast to Sc2CF2, Sc2C(OH)2 presents approximately isotropic electron mobility. The values at room temperature in the zigzag and armchair directions are calculated as 2.06 × 10(3) cm(2) V(-1) s(-1) and 2.19 × 10(3) cm(2) V(-1) s(-1), respectively. In regard to the thermal properties, the thermal conductivities of the Sc2CT2 (T = F, OH) MXenes have been determined. The predicted values are higher than those of most metals and semiconducting low-dimensional materials, such as monolayer MoS2 and phosphorene. In particular, the room-temperature thermal conductivity along the Sc2CF2 armchair direction has been determined to be as high as 472 W m(-1) K(-1) based on a flake length of 5 μm, which is even higher than that of the best traditional conductor silver. The corresponding value in the zigzag direction of Sc2CF2 is calculated to be 178 W m(-1) K(-1). The thermal conductivity in Sc2C(OH)2 is less anisotropic and lower compared to that in Sc2CF2. The room-temperature value in the armchair (zigzag) direction is determined to be 173 W m(-1) K(-1) (107 W m(-1) K(-1)). Based on their excellent

  4. Sc-Si normal incidence mirrors for a VUV interval of 35-50 nm

    CERN Document Server

    Uspenskii, Y A; Vinogradov, A V; Fedorenko, A I; Kondratenko, V V; Pershin, Y P; Zubarev, E N; Mrowka, S; Schäfers, F

    2000-01-01

    The Sc/Si multilayers are suggested as high-reflectivity coatings for a VUV interval of 35-50 nm. Fabricated mirrors show the normal incidence reflectivity of 30-50% which is high enough to effectively manipulate the beams of synchrotron radiation and compact discharge and laser-driven X-ray lasers. The obtained values are not, however, limiting for the Sc/Si coatings. Theoretical estimations as well as electron microscopy studies of Sc-Si interfaces indicate a large potential for further raising the reflectivity.

  5. Crystal structure of triple oxides HO/sub 2/ScNbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/

    Energy Technology Data Exchange (ETDEWEB)

    Filip' ev, V.S.; Cherner, Ya.E.; Bunina, O.A.; Seregin, V.F.

    The structure of new Ho/sub 2/Sc NbO/sub 7/ and Sm/sub 2/ScTaO/sub 7/ compounds synthesized by the three-stage roasting at 1100-1350 deg C was investigated. Powdergrams of the synthesized compounds indicated to be like the cubic structure of pyrochlore type. Periods of unit cells were determined by Bragg reflex angles. The dependence of unreliability factor on values of the position parameter of oxygen x atoms was calculated. Data were obtained that indirectly indicated a substantial disorder in the disposition of Ho and Sc atoms over A and B positions. Values of bond lengths and valence angles were presented.

  6. Lanthanide-doped NaScF4 nanoprobes: crystal structure, optical spectroscopy and biodetection

    Science.gov (United States)

    Ai, Yu; Tu, Datao; Zheng, Wei; Liu, Yongsheng; Kong, Jintao; Hu, Ping; Chen, Zhuo; Huang, Mingdong; Chen, Xueyuan

    2013-06-01

    Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal decomposition method. The biotinylated NaScF4:Er3+/Yb3+ NPs were demonstrated for their applications as a heterogeneous UC luminescence bioprobe to detect avidin with a detection limit of 180 pM. After bioconjugation with amino-terminal fragment (ATF) of urokinase plasminogen activator (uPA), NaScF4:Ln3+ NPs also exhibited specific recognition of cancer cells overexpressed with uPA receptor (uPAR, an important marker of tumor biology and metastasis), showing great potentials in tumor-targeted bioimaging.Trivalent lanthanide ions (Ln3+)-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc3+ with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu3+ at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln3+ NPs were synthesized via a facile thermal

  7. Formation Processes of Nanocomposite Strengthening Particles in Rapidly Quenched Al-Sc-Zr Alloys

    Directory of Open Access Journals (Sweden)

    A.V. Kotko

    2012-03-01

    Full Text Available Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were obtained by the melt-spinning. Melts were quenched from temperatures of Т = 1000 C and Т = 1400 ºC. The study of the structure of rapidly solidifyed binary Al alloys alloyed with Sc and Zr showed that the crystallization of anomalously supersaturated solid solution (Tquen. = 1400 ºC or the crystallization with the formation of "fan" structure (Tquen. = 1000 ºC are possible depending on the quenching temperature of the melt. The decomposition of anomalously supersaturated solid solution is continuous, with the precipitation of nano-sized spherical Al3X (X-Sc, Zr particles of L12-ordered phase which is isomorphous to matrix. It was found that the loss of thermal stability of Al-Sc alloys is due to the loss of coherence of the strengthening Al3Sc phase. In Al-Zr alloys the loss of strength is due to the formation of a stable tetragonal DO23-ordered A13Zr phase. After co-alloying of Al by Sc and Zr a bimodal grained structure was observed for the hypereutectic ternary alloy (Tquen. = 400ºC. Nano-sized grains of 50-60 nm were present on the boundaries of 1-2 µm large-sized grains. TEM shows the formation of nanocomposite Al3Zr/Al3Sc particles. The formation of Al3Zr shell changes the nature of the interfacial fit of the particle with the matrix and slows down the decomposition during the coalescence. Ternary Al-Sc-Zr alloys have significantly higher thermal stability during aging as compared to binary Al-Sc and Al-Zr alloys. Decomposition processes of supersaturated solid solution of aluminium alloys alloyed with Sc and Zr have been studied in the work. The binary hypereutectic Al-Sc alloys, hyperperitectic Al-Zr alloys and ternary Al-Sc-Zr alloys were chosen. Alloys were

  8. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  9. Synthesis and properties of Yb:Sc2O3 transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    JIANG Benxue; HU Chen; LI Jiang; KOU Huamin; SHI Yun; LIU Wenbin; PAN Yubai

    2011-01-01

    Yb:Sc2O3 transparent ceramics were fabricated by solid-state reaction and vacuum sintering method.CaO was added as sintering aids by a high energy ball milling.Transparent nearly-fully dense samples were obtained after 1840 ℃ sintering.Using transmitted-light microscope we get the grain sizes are more than 1 00 μm.Using spectrophotometer we get the absorption coefficient centered at 975 nm was 2.65 cm-1.The phosphorescence spectra showed that the line-widths (FWHM) at 975 and 1041 nm were about 4 and 10 nm and the lifetime of Yb ions in Sc2O3 transparent ceramics was about 883 μs.According to the absorption and fluorescence band centers of Yb:Sc2O3 transparent ceramics,the level scheme of Yb3+ ions in Sc2O3 ceramics could be gotten.

  10. 76 FR 23331 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2011-04-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management, Regulation...

  11. 77 FR 4056 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2012-01-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session AGENCY: Bureau of Ocean Energy Management (BOEM), Interior. ACTION: Notice...

  12. Local Impact Simulation of SC Wall Structures using Aircraft Engine Projectile

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Chulhun; Lee, Jungwhee; Lee, Hanjoo [Dankook Univ., Yongin (Korea, Republic of); Jung, Raeyoung; Hyun, Changhun [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-05-15

    SC wall structure developed for nuclear power plant buildings consists of plain concrete and two steel plates on both surface of the concrete, while RC structure consists of re bar and concrete. SC structure has higher scabbing resistance than RC structure due to the action of steel plate on the rear side of impact. Therefore SC structure is known as more effective structure from the viewpoint of aircraft crash than RC structure. However, most of the recent researches and experiments about local impact damage deal with RC structures, and the effect of re bar and steel plate is not considered reasonably. Although Walter et al. and Make-work et al. suggested a formula for evaluating perforation depth of steel plate covered RC walls, most of the previous researches about SC structure are focused on perforation and scabbing due to the impact of hard projectile, rather than soft projectile such as an aircraft. In this research a soft projectile, i. e. aircraft engine, is utilized for impact simulation of RC and SC walls. To evaluate local damage of SC wall structures, parametric study with the variables of wall thickness and steel ratio of the cover plate is performed, and the results are compared with those of RC structures. Since scabbing was prevented by the steel plates, penetration mode of damage was observed in SC walls while scabbing damage was occurred in RC walls. It is confirmed that the rear steel plate not only contains concrete debris, but also reduces the internal damage of the concrete walls. Penetration depth of SC walls did not largely vary due to the increasing steel ratio, and similar results to RC walls were observed when the wall thickness is larger than a certain value since the impact resistance of SC wall is mainly governed by the thickness of concrete part. Therefore, it is expected that similar level of impact resistance to RC structure can be produced with the minimum thickness of steel plates of SC structure. According to these results, SC

  13. Die 3SC Trendforschung : ein kontinuierliches Programm zur Beobachtung des soziokulturellen Wandels von Sinus Sociovision

    OpenAIRE

    Appel, Cornelia

    2003-01-01

    Die 3SC Trendforschung ist neben der Lebensweltforschung und dem daraus hervorgegangenen Modell der Sinus-Milieus ein zentraler Forschungsansatz des Heidelberger Instituts Sinus Sociovision. Sinus Sociovision, Mitglied des ADM (Arbeitskreis Deutscher Markt- und Sozialforschungsinstitute e.V.), ist eines der führenden Institute für angewandte soziokulturelle Forschung in Deutschland. Die 3SC Trendforschung ist eine von drei Säulen des Forschungs- und Beratungsangebotes von Sinus Sociovision. H...

  14. RlSC & DSP Advanced Microprocessor System Design; Sample Projects, Fall 1991

    OpenAIRE

    Fredine, John E.; Goeckel, Dennis L.; Meyer, David G.; Sailer, Stuart E.; Schmottlach, Glenn E.

    1992-01-01

    RlSC & DSP Microprocessor System Design (EE 595M) provides students with an overview of reduced instruction set (RISC) microprocessors and digital signal processing (DSP) microprocessors, with emphasis on incorporating these devices in general purpose and embedded system designs, respectively. The first half of the course emphasizes design considerations for RlSC microprocessor based computer systems; a half-semester design project focuses on design principles that could be utilized in a gene...

  15. Influence of Sc on high temperature strengthening behavior of Ti-6Al-4V alloy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Vacuum arc melting technique was used to prepare Ti-6Al-4V alloy containing Sc (0.3% and 0.5%, mass fraction). The ingots were melted twice by vacuum self-consumable electrode arc furnace. Forging of ingots was started in β-phase region and finished in high (α+β)-phase region. Annealing after forging was performed in low (α+β)-phase region for 30 min. Isothermal high temperature compression tests were conducted using thermal simulation machine under Ar atmosphere at 850 ℃ and 1 000 ℃, and the strain rate were 0.001, 0.01, 0.1 and 1.0 s-1. Optical microscope(OM), scanning electron microscopy(SEM), energy dispersive spectrum(EDS) and transmission electron microscope(TEM) were used to study the microstructure evolution during high temperature deformation. The results show that, the peak stress value of alloys increases with increasing Sc content after deformation at 850 ℃,however, there is no obvious strengthening of Sc when the alloys are deformed at 1 000 ℃. Sc exists as Sc2O3 forms by internal oxidation during forging procedure, only minor Sc solutes in matrix. At 850 ℃, the interaction between dislocation and participated particles and twinning mechanism controls the deformation procedure accompanied recrystallization. At 1 000 ℃, the deformation of alloys containing Sc is mainly controlled by twinning, while the deformation of alloy without Sc is not only controlled by twinning,but also the interaction between dislocation and precipitated particles inside the twinning lamellar.

  16. Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation

    KAUST Repository

    Vlach, Martin

    2015-01-29

    Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.

  17. CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1

    CERN Document Server

    Cockerill, D

    2007-01-01

    Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system

  18. Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

    CERN Multimedia

    Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

    It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

  19. Corrosion behavior of an Al-6Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    XU Guangxing; TAO Binwu; LIU Jianhua; LI Songmei

    2005-01-01

    The corrosion behavior of an Al-6Mg-Sc-Zr alloy was studied and compared with that of an Al-6Mg-Zr alloy.The addition of scandium into the Al-6Mg-Zr alloy reduced the susceptibility to exfoliation corrosion. By using the constant load tensile method in a 3.5 wt.% NaCl solution, the resistance to SCC of the Al-6Mg-Sc-Zr alloy was higher than that of the Al-6Mg-Zr alloy. When the specimens were not applied with an anodic current, the Al-6Mg-Sc-Zr alloy was resistance to SCC and no brittle cracking was found on the fracture surface. When an anodic current was applied, the Al-6Mg-Sc-Zr alloy specimens failed as a result of accelerated corrosion rather than SCC. It was believed that the addition of scandium resulted in (Al3Sc, Zr) particles that greatly refmed grains and promoted the formation of homogeneous discontinuous distribution of β-phase in the alloy base, which much contributed to good corrosion resistance of the Al-6Mg-Sc-Zr alloy.

  20. Structures and phase transitions of ScH3 under high pressure

    Institute of Scientific and Technical Information of China (English)

    Kong Bo; Zhou Zhu-Wen; Chen De-Liang; Ling-hu Rong-Feng

    2013-01-01

    The structures and the phase transitions of ScH3 under high pressure are investigated using first-principles calculations.The calculated structural parameters at zero pressure agree well with the available experimental data.With increasing pressure,the transition sequence hcp (GdH3-type)→ C2/m →fcc→hcp (YH3-type)→Cmcm of ScH3 is predicted first; the corresponding transition pressures at 0 K are 23 GPa,25 GPa,348 GPa,and 477 GPa,respectively.The C2/m symmetry structure is a possible candidate but not a good one as the intermediate state from hexagonal to cubic in ScH3.On the other hand,via the analysis of the structures of hexagonal ScH2.9,cubic ScH3,and cubic ScH2,we find that the repulsive interactions of H-H atoms must play an important role in the transition from hexagonal to cubic.

  1. Precise ab initio calculations of the 3d transition-metal clusters: Sc2

    Directory of Open Access Journals (Sweden)

    Ilya G. Kaplan

    2011-06-01

    Full Text Available The ground 5Σu− state of Sc2 was studied by the valence multireference configuration interaction method with single and double excitations plus Davidson correction (MRCISD(+Q at the complete basis set limit. The calculations were made under C2v symmetry restrictions, which allowed us to obtain at the dissociation limit the Sc atoms in different states (in all previous studies of Sc2 the D2h symmetry group was employed. From the Mulliken population analysis and energy calculations follows that in the ground state Sc2 dissociates in one Sc in the ground state and the other in the second excited quartet state, 4Fu. The corrected parameters of the ground potential curve are the following: Re = 5.2 bohr, De = 50.37 kcal/mol, and ωe = 234.5 cm-1. The dissociation energy in respect to the dissociation on two Sc in the ground states was estimated as De = 9.98 kcal/mol.

  2. Detergents modify proteinase K resistance of PrP Sc in different transmissible spongiform encephalopathies (TSEs).

    Science.gov (United States)

    Breyer, Johanna; Wemheuer, Wiebke M; Wrede, Arne; Graham, Catherine; Benestad, Sylvie L; Brenig, Bertram; Richt, Jürgen A; Schulz-Schaeffer, Walter J

    2012-05-25

    Prion diseases are diagnosed by the detection of their proteinase K-resistant prion protein fragment (PrP(Sc)). Various biochemical protocols use different detergents for the tissue preparation. We found that the resistance of PrP(Sc) against proteinase K may vary strongly with the detergent used. In our study, we investigated the influence of the most commonly used detergents on eight different TSE agents derived from different species and distinct prion disease forms. For a high throughput we used a membrane adsorption assay to detect small amounts of prion aggregates, as well as Western blotting. Tissue lysates were prepared using DOC, SLS, SDS or Triton X-100 in different concentrations and these were digested with various amounts of proteinase K. Detergents are able to enhance or diminish the detectability of PrP(Sc) after proteinase K digestion. Depending on the kind of detergent, its concentration - but also on the host species that developed the TSE and the disease form or prion type - the detectability of PrP(Sc) can be very different. The results obtained here may be helpful during the development or improvement of a PrP(Sc) detection method and they point towards a detergent effect that can be additionally used for decontamination purposes. A plausible explanation for the detergent effects described in this article could be an interaction with the lipids associated with PrP(Sc) that may stabilize the aggregates.

  3. Unraveling the Sc(3+) Hydration Geometry: The Strange Case of the Far-Coordinated Water Molecule.

    Science.gov (United States)

    Migliorati, Valentina; D'Angelo, Paola

    2016-07-05

    The hydration structure and dynamics of Sc(3+) in aqueous solution have been investigated using a combined approach based on quantum mechanical (QM) calculations, molecular dynamics (MD) simulations, and extended X-ray absorption fine structure (EXAFS) spectroscopy. An effective Sc-water two-body potential has been generated from QM calculations and then used in the MD simulation of Sc(3+) in water, and the reliability of the entire procedure has been assessed by comparing the theoretical structural results with the EXAFS experimental data. The outstanding outcome of this work is that the Sc(3+) ion forms a well-defined capped square antiprism (SAP) complex in aqueous solution, where the eight water molecules closest to the ion are located at the vertexes of a SAP polyhedron, while the ninth water molecule occupying the capping position is unusually found at a very long distance from the ion. This far-coordinated water molecule possesses a degree of structure comparable with the other first shell molecules surrounding the ion at much shorter distances, and its presence gave us the unique opportunity to easily identify the geometry of the Sc(3+) coordination polyhedron. Despite very strong ion-water interactions, the Sc(3+) hydration shell is very labile, as the far-coordinated ligand allows first shell water molecules to easily exchange their positions both inside the solvation shell and with the rest of the solvent molecules.

  4. The role of interplanetary shock orientation on SC/SI rise time and geoeffectiveness

    Science.gov (United States)

    Selvakumaran, R.; Veenadhari, B.; Ebihara, Y.; Kumar, Sandeep; Prasad, D. S. V. V. D.

    2017-03-01

    Interplanetary (IP) shocks interact with the Earth's magnetosphere, resulting in compression of the magnetosphere which in turn increases the Earth's magnetic field termed as Sudden commencement/Sudden impulse (SC/SI). Apart from IP shock speed and solar wind dynamic pressure, IP shock orientation angle also plays a major role in deciding the SC rise time. In the present study, the IP shock orientation angle and SC/SI rise time for 179 IP shocks are estimated which occurred during solar cycle 23. More than 50% of the Shock orientations are in the range of 140°-160°. The SC/SI rise time decreases with the increase in the orientation angle and IP shock speed. In this work, the type of IP shocks i.e., Radio loud (RL) and Radio quiet (RQ) are examined in connection with SC/SI rise time. The RL associated IP shock speeds show a better correlation than RQ shocks with SC/SI rise time irrespective of the orientation angle. Magnetic Cloud (MC) associated shocks dominate in producing less rise time when compared to Ejecta (EJ) shocks. Magneto hydrodynamic (MHD) simulations are used for three different IP shock orientation categories to see the importance of orientation angle in determining the geoeffectiveness. Simulations results reveal that shocks hitting parallel to the magnetosphere are more geoeffective as compared to oblique shocks by means of change in magnetic field, pressure and Field Aligned Current (FAC).

  5. Report of AAPM Therapy Physics Committee Task Group 74: in-air output ratio, Sc, for megavoltage photon beams.

    Science.gov (United States)

    Zhu, Timothy C; Ahnesjö, Anders; Lam, Kwok Leung; Li, X Allen; Ma, Chang-Ming Charlie; Palta, Jatinder R; Sharpe, Michael B; Thomadsen, Bruce; Tailor, Ramesh C

    2009-11-01

    The concept of in-air output ratio (Sc) was introduced to characterize how the incident photon fluence per monitor unit (or unit time for a Co-60 unit) varies with collimator settings. However, there has been much confusion regarding the measurement technique to be used that has prevented the accurate and consistent determination of Sc. The main thrust of the report is to devise a theoretical and measurement formalism that ensures interinstitutional consistency of Sc. The in-air output ratio, Sc, is defined as the ratio of primary collision water kerma in free-space, Kp, per monitor unit between an arbitrary collimator setting and the reference collimator setting at the same location. Miniphantoms with sufficient lateral and longitudinal thicknesses to eliminate electron contamination and maintain transient electron equilibrium are recommended for the measurement of Sc. The authors present a correction formalism to extrapolate the correct Sc from the measured values using high-Z miniphantom. Miniphantoms made of high-Z material are used to measure Sc for small fields (e.g., IMRT or stereotactic radiosurgery). This report presents a review of the components of Sc, including headscatter, source-obscuring, and monitor-backscattering effects. A review of calculation methods (Monte Carlo and empirical) used to calculate Sc for arbitrary shaped fields is presented. The authors discussed the use of Sc in photon dose calculation algorithms, in particular, monitor unit calculation. Finally, a summary of Sc data (from RPC and other institutions) is included for QA purposes.

  6. Two-gap superconductivity in R2Fe3Si5 (R=Lu, Sc and Sc5Ir4Si10

    Directory of Open Access Journals (Sweden)

    Tsuyoshi Tamegai, Yasuyuki Nakajima, Tsuyoshi Nakagawa, Guoji Li and Hisatomo Harima

    2008-01-01

    Full Text Available R2Fe3Si5 (R= Sc, Y, Lu contains nonmagnetic iron and has a relatively high superconducting transition temperature Tc among iron-containing superconductors. An anomalous temperature dependence of specific heat C(T has been reported for polycrystalline samples down to 1 K. We have grown R2Fe3Si5 single crystals, confirmed the anomalous C(T dependence, and found a second drop in specific heat below 1 K. In Lu2Fe3Si5, we can reproduce C(T below Tc, assuming two distinct energy gaps 2Δ 1/kBTc = 4.4 and 2Δ 2/kBTc = 1.1, with nearly equal weights, indicating that Lu2Fe3Si5 is a two-gap superconductor similar to MgB2. Hall coefficient measurements and band structure calculation also support the multiband contributions to the normal-state properties. The specific heat in the Sc2Fe3Si5 single crystals also shows the two-gap feature. R5Ir4Si10 (R = Sc, rare earth is also a superconductor where competition between superconductivity and the charge-density wave is known for rare earths but not for Sc. We have performed detailed specific heat measurements on Sc5Ir4Si10 single crystals and found that C(T deviates slightly from the behavior expected for weak-coupling superconductors. C(T for these superconductors can also be reproduced well by assuming two superconducting gaps.

  7. Low Temperature Synthesis and Characterization of AlScMo3O12

    Directory of Open Access Journals (Sweden)

    Rebecca Truitt

    2015-02-01

    Full Text Available Recent interest in low and negative thermal expansion materials has led to significant research on compounds that exhibit this property, much of which has targeted the A2M3O12 family (A = trivalent cation, M = Mo, W. The expansion and phase transition behavior in this family can be tuned through the choice of the metals incorporated into the structure. An undesired phase transition to a monoclinic structure with large positive expansion can be suppressed in some solid solutions by substituting the A-site by a mixture of two cations. One such material, AlScMo3O12, was successfully synthesized using non-hydrolytic sol-gel chemistry. Depending on the reaction conditions, phase separation into Al2Mo3O12 and Sc2Mo3O12 or single-phase AlScMo3O12 could be obtained. Optimized conditions for the reproducible synthesis of stoichiometric, homogeneous AlScMo3O12 were established. High resolution synchrotron diffraction experiments were carried out to confirm whether samples were homogeneous and to estimate the Al:Sc ratio through Rietveld refinement and Vegard’s law. Single-phase samples were found to adopt the orthorhombic Sc2W3O12 structure at 100 to 460 K. In contrast to all previously-reported A2M3O12 compositions, AlScMo3O12 exhibited positive thermal expansion along all unit cell axes instead of contraction along one or two axes, with expansion coefficients (200–460 K of αa = 1.7 × 10−6 K−1, αb = 6.2 × 10−6 K−1, αc = 2.9 × 10−6 K−1 and αV = 10.8 × 10−6 K−1, respectively.

  8. Evaluation of the difficulty of crystallization of organic compounds using the critical supersaturation ratio (Sc)

    Science.gov (United States)

    Nagamatsu, Daiki; Ida, Yasuo; Takiyama, Hiroshi

    2014-11-01

    In the case of solvent selection, supersolubility is an index for improving crystallization behavior. However, supersolubility is affected by kinetic factors such as the cooling rate. An index for suitable solvent selection is needed. The supersaturation ratio (S) is one of the operation design indices of controlling crystallization behavior such as supersolubility. The S at 298 K (S298) of the pharmaceutical compounds theophylline, noscapine, clotrimazole, indomethacin, carbamazepine, naproxene and tolbutamide were measured in ethanol using a polythermal method. If the compound had a large lnS298, the cooling rate strongly affected the temperature of the cloud point in the cooling crystallization method. In order to estimate the crystallization behavior without the cooling rate effect, the critical supersaturation ratio (Sc) was proposed. Sc at 298 K (Sc298) was calculated from dissolution/cloud points at 0 K/min extrapolated from that of several heating/cooling rates to remove the kinetic effects on S. The lnSc298 values of theophylline, noscapine and clotrimazole were estimated in acetonitrile, methyl ethyl ketone, tetrahydrofuran, ethyl acetate, methanol, ethanol and isopropanol. The lnSc298 value of clotrimazole was the largest in all solvents. The results showed that lnSc298 was a simple index which could be used to evaluate the crystallization behavior resulting from the interaction between the solvent and the compound. In conclusion, the proposed lnSc298 should be useful for comparing the difficulty of crystallization which indicates how we should obtain desired crystals within a certain finite time period for development API in the manufacturing field without considering the effect of the heating/cooling rate.

  9. The inhibition of lung cancer cell growth by intracellular immunization with LC-1 ScFv

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A monoclonal antibody, LC-l, recognizing lung cancer associated common antigens was obtained in authors' laboratory. Its single chain Fv fragment (ScFv) named LC-1 ScFv was constructed based on recombinant phage displayed techniques. For expression on cell membrane, LC-1 ScFv was cloned into pDisplay vector, which directed the cloned gene to express as cell membrane bound protein. The resulting plasmid was sequenced and then introduced by the lipofectin method into a lung adenocarcinoma cell line SPC-A-1. G418 resistant cells were obtained by G418 selection. After transfection, LC-1 ScFv expression was observed by Western blot analysis and the expression of cognate antigens was down-regulated as shown in ELISA assay. SPC-A-1-pDisplay-ScFv cells grew in vitro at lower speed than the control intact cells and the cells transfected with vacant vector. Flow cytometry analysis detected a substantial increase in G1 phase and decrease in S phase in population of SPC-A-1-pDisplay-ScFv cells compared to SPC-A-1 and SPC-A1-pDisplay cells. Semi-quantitative RT-PCR analysis showed that c-myc expression was down-regulated in SPC-A-1-pDisplay-ScFv cells. It seems that the antigens recognized by LC-1 may be in some way involved in a growth stimulating pathway and the antibody blocking of the function of the antigens shut down the pathway and thus down-regulate the expression of c-myc and growth of the cells.

  10. Enrichment of Sc2O3 and TiO2 from bauxite ore residues.

    Science.gov (United States)

    Deng, Bona; Li, Guanghui; Luo, Jun; Ye, Qing; Liu, Mingxia; Peng, Zhiwei; Jiang, Tao

    2017-06-05

    As a major byproduct generated in the alumina industry, bauxite ore residue is an important reserve of scandium and titanium. In this study, the feasibility and mechanism of enriching Sc2O3 and TiO2 from a non-magnetic material, which was obtained from carbothermal reductive roasting and magnetic separation of bauxite ore residue, were investigated based on a two-step (acidic and alkali) leaching process. It was revealed that approximately 78% SiO2 and 30-40% of CaO, FeO and Al2O3 were removed from a non-magnetic material with 0.0134wt.% Sc2O3 and 7.64wt.% TiO2 by phosphoric acidic leaching, while about 95% Al2O3 and P2O5 were further leached by subsequent sodium hydroxide leaching of the upper-stream leach residue. A Sc2O3-, TiO2- rich material containing 0.044wt.% Sc2O3 and 25.5wt.% TiO2 was obtained, the recovery and the enrichment factor of Sc2O3 and TiO2 were about 85% and 5, respectively. The enrichment of Sc2O3 was attributed to higher pH (>3.3) of phosphoric acid solution than its dissolution pH(0), and the enrichment of TiO2 was mainly associated with the insoluble perovskite (CaTiO3) in the acidic solution at ambient temperature. As Sc2O3 and TiO2 cannot be dissolved in the alkali solution, they were further enriched in the leach residue.

  11. Fast conversion of scFv to Fab antibodies using type IIs restriction enzymes.

    Science.gov (United States)

    Sanmark, Hanna; Huovinen, Tuomas; Matikka, Tero; Pettersson, Tiina; Lahti, Maria; Lamminmäki, Urpo

    2015-11-01

    Single chain variable fragment (scFv) antibody libraries are widely used for developing novel bioaffinity reagents, although Fab or IgG molecules are the preferred antibody formats in many final applications. Therefore, rapid conversion methods for combining multiple DNA fragments are needed to attach constant domains to the scFv derived variable domains. In this study we describe a fast and easy cloning method for the conversion of single framework scFv fragments to Fab fragments using type IIS restriction enzymes. All cloning steps excluding plating of the Fab transformants can be done in 96 well plates and the procedure can be completed in one working day. The concept was tested by converting 69 scFv clones into Fab format on 96 well plates, which resulted in 93% success rate. The method is particularly useful as a high-throughput tool for the conversion of the chosen scFv clones into Fab molecules in order to analyze them as early as possible, as the conversion can significantly affect the binding properties of the chosen clones.

  12. ScVO4 under non-hydrostatic compression: a new metastable polymorph

    Science.gov (United States)

    Garg, Alka B.; Errandonea, D.; Rodríguez-Hernández, P.; Muñoz, A.

    2017-02-01

    The high-pressure (HP) behaviour of scandium vanadate (ScVO4) is investigated under non-hydrostatic compression. The compound is studied by means of synchrotron-based powder x-ray diffraction (XRD) and optical-absorption techniques. The occurrence of a non-reversible phase transition is detected. The transition is from the zircon structure to the fergusonite-type structure and takes place around 6 GPa with nearly 10% volume discontinuity. XRD measurements on the pressure cycled sample confirm for the first time that the fergusonite-type ScVO4 can be recovered as the metastable phase at ambient conditions. Raman spectroscopic measurements verify the metastable phase to be of a fergusonite-type phase. Theoretical calculations also corroborate the experimental findings. The fergusonite phase is found to be stiffer than the ambient-pressure zircon phase, as indicated by the observed experimental and theoretical bulk moduli. The optical properties and lattice-dynamics calculation of the fergusonite ScVO4 are discussed. At ambient pressure the band gap of the zircon (fergusonite)-type ScVO4 is 2.75 eV (2.3 eV). This fact suggests that the novel metastable polymorph of ScVO4 can have applications in green technologies; for instance, it can be used as photocatalytic material for hydrogen production by water splitting.

  13. SC83288 is a clinical development candidate for the treatment of severe malaria

    Science.gov (United States)

    Pegoraro, Stefano; Duffey, Maëlle; Otto, Thomas D; Wang, Yulin; Rösemann, Roman; Baumgartner, Roland; Fehler, Stefanie K; Lucantoni, Leonardo; Avery, Vicky M; Moreno-Sabater, Alicia; Mazier, Dominique; Vial, Henri J; Strobl, Stefan; Sanchez, Cecilia P; Lanzer, Michael

    2017-01-01

    Severe malaria is a life-threatening complication of an infection with the protozoan parasite Plasmodium falciparum, which requires immediate treatment. Safety and efficacy concerns with currently used drugs accentuate the need for new chemotherapeutic options against severe malaria. Here we describe a medicinal chemistry program starting from amicarbalide that led to two compounds with optimized pharmacological and antiparasitic properties. SC81458 and the clinical development candidate, SC83288, are fast-acting compounds that can cure a P. falciparum infection in a humanized NOD/SCID mouse model system. Detailed preclinical pharmacokinetic and toxicological studies reveal no observable drawbacks. Ultra-deep sequencing of resistant parasites identifies the sarco/endoplasmic reticulum Ca2+ transporting PfATP6 as a putative determinant of resistance to SC81458 and SC83288. Features, such as fast parasite killing, good safety margin, a potentially novel mode of action and a distinct chemotype support the clinical development of SC83288, as an intravenous application for the treatment of severe malaria. PMID:28139658

  14. Influence of Sc3+ on LiMn2O4 cathode materials at elevated temperature

    Institute of Scientific and Technical Information of China (English)

    LIU Huiyong; DENG Ganqun; GUO Yonglang

    2008-01-01

    Sc3+-doped lithium manganese oxides were synthesized by solid-state reaction. The influences of doping element on structure,mean valence of manganese, and electrochemical performances were studied by X-ray diffraction (XRD), galvanostatic charge-discharge and cyclic voltammetric tests, and also electrochemical impedance spectroscopy (EIS). XRD tests showed that doped lithium manganese oxides were pure spinel structure without other phases. Redox titration and visible spectrophotometry tests indicated that the mean valence of man-ganese in doped lithium manganese oxides was higher than that of pure one. LiSc0.02Mn1.98O4 remained 92.9% of the initial specific discharge capacity after 50th cycle at a constant current of 50 m/g, and the reversibility of LiSc0.02Mn1.98O4 was improved in comparison with pure LiMn2O4 at 50 ℃. EIS indicated that film deposition on spinel particles was suppressed because of Sc3+ doping, and the charge transfer be-tween the surface film and spinel particles with increasing temperature for Sc3+-doped materials became easier as compared with undoped one.

  15. AlScN thin film based surface acoustic wave devices with enhanced microfluidic performance

    Science.gov (United States)

    Wang, W. B.; Fu, Y. Q.; Chen, J. J.; Xuan, W. P.; Chen, J. K.; Wang, X. Z.; Mayrhofer, P.; Duan, P. F.; Bittner, A.; Schmid, U.; Luo, J. K.

    2016-07-01

    This paper reports the characterization of scandium aluminum nitride (Al1-x Sc x N, x  =  27%) films and discusses surface acoustic wave (SAW) devices based on them. Both AlScN and AlN films were deposited on silicon by sputtering and possessed columnar microstructures with (0 0 0 2) crystal orientation. The AlScN/Si SAW devices showed improved electromechanical coupling coefficients (K 2, ~2%) compared with pure AlN films (droplets, and the acoustic streaming and pumping velocities were 2  ×  and 3  ×  those of the AlN/Si SAW devices, respectively. Mechanical characterization showed that the Young’s modulus and hardness of the AlN film decreased significantly when Sc was doped, and this was responsible for the decreased acoustic velocity and resonant frequency, and the increased temperature coefficient of frequency, of the AlScN SAW devices.

  16. Conductivity ageing studies on 1M10ScSZ (M4+=Ce, Hf)

    DEFF Research Database (Denmark)

    Omar, Shobit; Bin Najib, Waqas; Bonanos, Nikolaos

    2011-01-01

    The long-term conductivity stability is tested on zirconia based electrolyte materials for solid oxide fuel cell applications. The ageing studies have been performed on the samples of ZrO2 co-doped with 10mol% of Sc2O3 and 1mol% MO2, where M = Ce or Hf (denoted respectively 1Ce10ScSZ and 1Hf10Sc......SZ) in oxidising and reducing atmospheres, at 600°C for 3000h. At 600°C, these compositions show initial conductivity of around 9–12mS∙cm−1 in air. After 3000h of ageing, no phase transitions are observed in any of the samples. For the first 1000h, the degradation rate is higher than in the subsequent 2000h......; thereafter, conductivity degrades linearly with time for all samples. In air, the loss in the conductivity is lower than in reducing conditions. The 1Ce10ScSZ shows the highest degradation rate of 3.8%/1000h in wet H2/N2 after the first 1000h of ageing. A colour change of the 1Ce10ScSZ sample from white...

  17. Microstructure dependent fatigue crack growth in Al–Mg–Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mengjia [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Pan, Qinglin, E-mail: csupql@163.com [The Key Laboratory of Nonferrous Materials Science and Engineering of Ministry of Education, Central South University, Changsha 410083 (China); Shi, Yunjia; Wang, Ying [School of Materials Science and Engineering, Central South University, Changsha 410083 (China)

    2014-08-12

    The fatigue crack growth behavior of Al–Mg–Sc alloy was investigated by tensile testing and fatigue testing. Different annealing treatments were applied to the alloy. Microstructure characterization of the alloy was carried out by means of transmission electron microscopy (TEM), scanning electron microscopy (SEM) and optical microscopy (OM). The size of Al{sub 3}(Sc{sub 1−x}Zr{sub x}) particle was calculated by software. The fatigue crack growth (FCG) rate (da/dN) was discussed with stress intensity factor range (ΔK) in Paris's region. The Paris exponent m and constants C were used to calculate the fatigue life. The fatigue process and crack closure effects were discussed with the yield strength and tensile strength of Al–Mg–Sc alloy. Results show that the microstructure, tensile strength and fatigue crack growth rate were greatly dependent on the annealing temperature, and the high resistance of Al–Mg–Sc alloy was mainly due to the combination microstructures of sub-grains, dislocations and these Al{sub 3}(Sc{sub 1−x}Zr{sub x}) precipitates.

  18. Isolation of anti-T cell receptor scFv mutants by yeast surface display.

    Science.gov (United States)

    Kieke, M C; Cho, B K; Boder, E T; Kranz, D M; Wittrup, K D

    1997-11-01

    Yeast surface display and sorting by flow cytometry have been used to isolate mutants of an scFv that is specific for the Vbeta8 region of the T cell receptor. Selection was based on equilibrium binding by two fluorescently labeled probes, a soluble Vbeta8 domain and an antibody to the c-myc epitope tag present at the carboxy-terminus of the scFv. The mutants that were selected in this screen included a scFv with threefold increased affinity for the Vbeta8 and scFv clones that were bound with reduced affinities by the anti-c-myc antibody. The latter finding indicates that the yeast display system may be used to map conformational epitopes, which cannot be revealed by standard peptide screens. Equilibrium antigen binding constants were estimated within the surface display format, allowing screening of isolated mutants without necessitating subcloning and soluble expression. Only a relatively small library of yeast cells (3 x 10[5]) displaying randomly mutagenized scFv was screened to identify these mutants, indicating that this system will provide a powerful tool for engineering the binding properties of eucaryotic secreted and cell surface proteins.

  19. Spinal Cord Infarction in Hemoglobin SC Disease as an Amusement Park Accident.

    Science.gov (United States)

    Eid, Ryan; Raj, Ashok; Farber, Darren; Puri, Vinay; Bertolone, Salvatore

    2016-09-01

    Spinal cord infarction (SCI) is extremely rare in children, and only 2 other reports have described the occurrence of SCI in patients with hemoglobin SC disease (HbSC). Amusement park accidents are serious injuries. Patients with preexisting conditions, such as hypertension, cardiac disease, and recent back or neck injuries, may be at an increased risk. We report the case of a 12-year-old girl with HbSC with a past history of only 2 admissions for pain crises, who presented to the emergency department with symptoms of SCI after riding a roller coaster. Fibrocartilaginous embolism (FCE) is an increasingly recognized cause of SCI after events that put strain on the axial skeleton, such as many amusement park rides. Although radiologic criteria for FCE have been proposed, FCE remains a diagnosis of exclusion. To the best of our knowledge, this is the first documented case of SCI in a patient with HbSC and the first case of FCE after an amusement park accident. This case report highlights that HbSC may confound the differential diagnosis of SCI and aims to document an association with FCE in pediatric patients.

  20. Construction of Human ScFv Phage Display Library against Ovarian Tumor

    Institute of Scientific and Technical Information of China (English)

    XIA Jinsong; BI Hao; YAO Qin; QU Shen; ZONG Yiqiang

    2006-01-01

    In order to construct a single chain fragment variable (ScFv) phage display library against ovarian tumor, by using RT-PCR, the human heavy chain variable region genes (VH) and light chain variable region genes (VL) were amplified from lymphocytes of ovarian tumor patients and subsequently assembled into ScFv genes by SOE. The resulting ScFv genes were electrotransformed into E.coli TG1 and amplified with the co-infection of helper phage M13KO7 to obtain phage display library. The capacity and titer of the resulting library were detected. The phage antibody library with a capacity of approximately 3 × 109 cfu/μg was obtained. After amplification with helper phage, the titer of antibody library reached 5 × 1012 cfu/mL. Human ScFv library against ovarian tumor was constructed successfully, which laid a foundation for the screening of ovarian tumor specific ScFv for the radioimmunoimaging diagnosis of ovarian tumor.

  1. Preliminary Analysis of the Social and Scientific Impact of the UAEM-ININ M.Sc. and D.Sc. Graduate Programme in Medical Physics

    Science.gov (United States)

    Mitsoura, Eleni; Isaac-Olive, Keila; Torres-Garcia, Eugenio; Camacho-Lopez, Miguel Angel; Hardy-Perez, Alberto

    2010-12-01

    Sponsored by the International Atomic Energy Agency (IAEA) in 1994, the Instituto Nacional de Investigaciones Nucleares (ININ) started in Mexico a teaching and training programme (Diplomado) in Radiotherapy Medical Physics. Based on this experience, the Universidad Autónoma del Estado de México (UAEM) and the Instituto Nacional de Investigaciones Nucleares (ININ) launched two years later, the first Graduate Programme in Science (M.Sc. and D.Sc.), specialised in Medical Physics in Mexico. A preliminary analysis of the social and scientific impact of the UAEM-ININ Programme is presented in this work based on the achievements attained, regarding the number of graduated Medical Physicists, their geographic and academic origin, their current professional activities and the number of scientific publications produced as a result of the thesis, as well as their citations.

  2. Phase relations of Al-4Mg-Sc-Zr quaternary system in Al-rich range at 430 ℃

    Institute of Scientific and Technical Information of China (English)

    夏长清; 曾凡浩; 古一

    2003-01-01

    The 430 ℃ isothermal section of the Al-4Mg-Sc-Zr quaternary system in the Al-rich range was determined by means of equilibrium alloys with the use of microstructure, X-ray diffraction analysis and electron probe microanalysis. There coexist three single-phase fields, two two-phase fields and one three-phase field. It is established that the phase Al3Sc1-0.5Zr0-0.5 with L12 structure and Al3Zr1-0.8Sc0-0.2 with DO23 structure are in equilibrium with the α solid solution, Zr being dissolved in Al3Sc, further substituting for about 50% Sc(mole fraction) whilst Sc is present in the phase Al3Zr and the maximum substitution for Zr is about 20%.

  3. Gyrase-dependent stabilization of pSC101 plasmid inheritance by transcriptionally active promoters.

    Science.gov (United States)

    Beaucage, S L; Miller, C A; Cohen, S N

    1991-09-01

    The pSC101 plasmid encodes a cis-acting genetic locus termed par that ensures the stable inheritance of plasmids in a population of dividing cells. In the absence of selection, par-defective plasmids are lost rapidly from the bacterial population. We report here that the stability of par-deleted pSC101 derivatives is restored by introducing certain adventitious bacterial promoters onto the plasmid. Stabilization requires active transcription from the inserted promoter and is affected by the site and orientation of the insertion, the length of the nascent transcript and DNA gyrase activity. While a promotor-associated overall increase in negative superhelicity of plasmid DNA was observed, stabilized inheritance appeared to be dependent on localized rather than generalized supercoiling. Our demonstration that promoter-induced DNA supercoiling can mimic the effects of the pSC101 par locus provides evidence that the previously reported superhelicity-generating effects of par are intrinsic to its function.

  4. Comparison of Response between RC and SC Containment Structures Subjected to Aircraft Impact

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Sang Shup; Choi, In Kil [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Park, Tae Hyo [Hanyang University, Seoul (Korea, Republic of)

    2012-05-15

    Since the aircraft terror to the World Trade Center (WTC) on September 11, 2001, an aircraft impact problem has been increasingly interested. The possibilities of aircraft impacts against nuclear power plants are one of important category. To date, the impact load of the analysis on aircraft impacts has been applied to target structures in local areas by using the impact force-time history function of Riera. However, Riera forcing function is not recommended at the expectation of unreasonable damage or perforation to target structures. The numerical analysis of rc and sc containment structures subjected to aircraft impact is performed by using the AUTODYN-3D. It is carried out the four different types for RC and SC structures. Thus, in this study, the different behaviors of containment structures and the safety of SC structure are expected

  5. Normal-2SC mixed phase of quark matter in compact stars for large coupling constant

    CERN Document Server

    Aguilera, D N; Grigorian, H

    2004-01-01

    We study the consequences of changing the ratio $\\eta$ between the coupling constant in the diquark channel and the coupling constant in the messon channel to a quark matter equation of state under compact stars constraints. A nonlocal chiral quark model is used and the quark interaction is represented via formfactor functions. We found that a mixed phase of 2SC quark matter and normal quark matter (N-2SC) is likely to occur for rather large $\\eta$, 0.86 $\\leq \\eta \\leq$ 1.1 in the interior of compact stars for Gaussian formfactor. For the two other formfactors the range of the mixed phase is shifted to lower values of $\\eta$. This result leads us to suggest that, if the coupling is not so large, spin-1 channels may be more likely to occur rather than the 2SC phase for intermediate densities in the interior of compact stars.

  6. High efficiency recovery and epitope specific sorting of an scFv yeast display library

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, Robert W.; Coleman, James R.; Miller, Keith D.; Feldhaus, Michael

    2004-03-01

    In order to more productively utilize the rich source of antigen specific reagents present in the previously described non-immune scFv yeast display library (Feldhaus et al., 2003) one must be able to efficiently isolate and characterize clones within the library. To this end, we have developed and validated a magnetic bead sorting technique utilizing the Miltenyi MacsTm system to recover greater than 90% of the antigen specific clones present in the library. In combination with flow cytometry, we rapidly reduced diversity and enriched for antigen specific clones in three rounds of selection. Furthermore, we demonstrate the use of pre-existing monoclonal antibodies (mAbs) for antigen labeling and subsequent flow cytometric sorting and characterization of epitope specific scFv. Combining these two improvements in library screening allowed isolation and characterization of 3 epitope specific scFv (including a previously uncharacterized epitope) to a 6 kd protein, epidermal growth factor EGF.

  7. Dislocation Core Structure and Peierls Stress of B2-Based AlSc in {110} Plane

    Science.gov (United States)

    Li, S. R.; Wu, X. Z.; Zhang, T.; Tian, Y. X.; Yan, Z. X.; Zhu, H. Z.

    2016-10-01

    The core structure and Peierls stress of , , and dislocations in {110} plane of B2-based AlSc (B2-AlSc) have been investigated using improved dislocation equations combined with the generalized stacking fault (GSF) energy. The truncated approximation method is utilized to construct the dissociated and undissociated dislocations in AlSc, then the effects of dislocation angles on the elastic strain energy and misfit energy are presented. Specifically, with increasing dislocation angle, the misfit energy, elastic strain energy, and total energy, and their corresponding stresses, decrease on the {110} and {110} slip systems. However, for {110} dislocation, all energies and corresponding stresses exhibit the relationship 0° > 54.7° > 35.3° > 90°. The misfit energy is always smaller than the elastic strain energy, even by one or two orders of magnitude, and their phases are always opposite.

  8. Laboratory oscillator strengths of Sc I in the near-infrared region for astrophysical applications

    CERN Document Server

    Pehlivan, A; Hartman, H

    2015-01-01

    Context. Atomic data is crucial for astrophysical investigations. To understand the formation and evolution of stars, we need to analyse their observed spectra. Analysing a spectrum of a star requires information about the properties of atomic lines, such as wavelengths and oscillator strengths. However, atomic data of some elements are scarce, particularly in the infrared region, and this paper is part of an effort to improve the situation on near-IR atomic data. Aims. This paper investigates the spectrum of neutral scandium, Sc i, from laboratory measurements and improves the atomic data of Sc i lines in the infrared region covering lines in R, I, J, and K bands. Especially, we focus on measuring oscillator strengths for Sc i lines connecting the levels with 4p and 4s configurations. Methods. We combined experimental branching fractions with radiative lifetimes from the literature to derive oscillator strengths (f - values). Intensity-calibrated spectra with high spectral resolution were recorded with Fouri...

  9. Magnetic anisotropy in the incommensurate ScFe{sub 4}Al{sub 8} system

    Energy Technology Data Exchange (ETDEWEB)

    Rećko, K., E-mail: k.recko@uwb.edu.pl [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland); Dobrzyński, L. [National Centre for Nuclear Research, A. Soltan 7, 05-400 Otwock-Świerk (Poland); Waliszewski, J.; Szymański, K. [Faculty of Physics, University of Białystok, K. Ciołkowskiego 1L, 15-245 Białystok (Poland)

    2015-08-15

    Neutron scattering and magnetization data are used for estimation of the spin ordering in ScFe{sub 4}Al{sub 8}. Results of experimental measurements are compared with the ground state configurations obtained by simulated annealing algorithms. The origins of the magnetocrystalline anisotropy of the scandium intermetallic alloy and the conditions of the coexistence of two different magnetic modulations as a function of the exchange integrals are discussed. The influence of the dipolar interactions for the noncollinearity and incommensurability in ScFe{sub 4}Al{sub 8} was determined. - Highlights: • We found dipolar and DM interactions as the anisotropy origins of 3d–3d–3p alloy. • We covered the explanation of incommensurability and noncollinearity of ScFe{sub 4}Al{sub 8}. • We discussed the magnetism resulting from competitiveness of exchange effects.

  10. Thermodynamics-Based Computational Design of Al-Mg-Sc-Zr Alloys

    Science.gov (United States)

    Haidemenopoulos, G. N.; Katsamas, A. I.; Kamoutsi, H.

    2010-04-01

    Alloying additions of Sc and Zr raise the yield strength of Al-Mg alloys significantly. We have studied the effects of Sc and Zr on the grain refinement and recrystallization resistance of Al-Mg alloys with the aid of computational alloy thermodynamics. The grain refinement potential has been assessed by Scheil-Gulliver simulations of solidification paths, while the recrystallization resistance (Zener drag) has been assessed by calculation of the precipitation driving forces of the Al3Sc and Al3Zr intermetallics. Microstructural performance indices have been derived, used to rank several alloy composition variants, and finally select the variant with the best combination of grain refinement and recrystallization resistance. The method can be used, with certain limitations, for a thermodynamics-based design of Al-Mg and other alloy compositions.

  11. Thermal neutron capture and resonance integral cross sections of {sup 45}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Van Do, Nguyen; Duc Khue, Pham; Tien Thanh, Kim [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Thi Hien, Nguyen [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Guinyun, E-mail: gnkim@knu.ac.kr [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Kwangsoo [Department of Physics and Center for High Energy Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Shin, Sung-Gyun; Cho, Moo-Hyun [Department of Advanced Nuclear Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Lee, Manwoo [Research Center, Dongnam Institute of Radiological and Medical Science, Busan 619-953 (Korea, Republic of)

    2015-11-01

    The thermal neutron cross section (σ{sub 0}) and resonance integral (I{sub 0}) of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been measured relative to that of the {sup 197}Au(n,γ){sup 198}Au reaction by means of the activation method. High-purity natural scandium and gold foils without and with a cadmium cover of 0.5 mm thickness were irradiated with moderated pulsed neutrons produced from the Pohang Neutron Facility (PNF). The induced activities in the activated foils were measured with a high purity germanium (HPGe) detector. In order to improve the accuracy of the experimental results the counting losses caused by the thermal (G{sub th}) and resonance (G{sub epi}) neutron self-shielding, the γ-ray attenuation (F{sub g}) and the true γ-ray coincidence summing effects were made. In addition, the effect of non-ideal epithermal spectrum was also taken into account by determining the neutron spectrum shape factor (α). The thermal neutron cross-section and resonance integral of the {sup 45}Sc(n,γ){sup 46}Sc reaction have been determined relative to the reference values of the {sup 197}Au(n,γ){sup 198}Au reaction, with σ{sub o,Au} = 98.65 ± 0.09 barn and I{sub o,Au} = 1550 ± 28 barn. The present thermal neutron cross section has been determined to be σ{sub o,Sc} = 27.5 ± 0.8 barn. According to the definition of cadmium cut-off energy at 0.55 eV, the present resonance integral cross section has been determined to be I{sub o,Sc} = 12.4 ± 0.7 barn. The present results are compared with literature values and discussed.

  12. Isolation and characterization of anti c-met single chain fragment variable (scFv) antibodies.

    Science.gov (United States)

    Qamsari, Elmira Safaie; Sharifzadeh, Zahra; Bagheri, Salman; Riazi-Rad, Farhad; Younesi, Vahid; Abolhassani, Mohsen; Ghaderi, Sepideh Safaei; Baradaran, Behzad; Somi, Mohammad Hossein; Yousefi, Mehdi

    2017-12-01

    The receptor tyrosine kinase (RTK) Met is the cell surface receptor for hepatocyte growth factor (HGF) involved in invasive growth programs during embryogenesis and tumorgenesis. There is compelling evidence suggesting important roles for c-Met in colorectal cancer proliferation, migration, invasion, angiogenesis, and survival. Hence, a molecular inhibitor of an extracellular domain of c-Met receptor that blocks c-Met-cell surface interactions could be of great thera-peutic importance. In an attempt to develop molecular inhibitors of c-Met, single chain variable fragment (scFv) phage display libraries Tomlinson I + J against a specific synthetic oligopeptide from the extracellular domain of c-Met receptor were screened; selected scFv were then characterized using various immune techniques. Three c-Met specific scFv (ES1, ES2, and ES3) were selected following five rounds of panning procedures. The scFv showed specific binding to c-Met receptor, and significantly inhibited proliferation responses of a human colorectal carcinoma cell line (HCT-116). Moreover, anti- apoptotic effects of selected scFv antibodies on the HCT-116 cell line were also evaluated using Annexin V/PI assays. The results demonstrated rates of apoptotic cell death of 46.0, 25.5, and 37.8% among these cells were induced by use of ES1, ES2, and ES3, respectively. The results demonstrated ability to successfully isolate/char-acterize specific c-Met scFv that could ultimately have a great therapeutic potential in immuno-therapies against (colorectal) cancers.

  13. Local character of the highest antiferromagnetic Ce-system CeTi{1-x}Sc{x} Ge

    OpenAIRE

    2014-01-01

    The highest antiferromagnetic (AFM) temperature in Ce based compounds has been reported for CeScGe with Tn=47K, but its local or itinerant nature was not deeply investigated yet. In order to shed more light into this unusually high ordering temperature we have investigated structural, magnetic, transport and thermal properties of CeTi{1-x}Sc{x}Ge alloys within the range of stability of the CeScSi-type structure: 0.25

  14. Significance Assessment of Site 16SC61, Luling Revetment, Mississippi River M-116.7-R

    Science.gov (United States)

    1993-03-01

    After 1731, they increasingly switched to cultivating fruit trees and vegetables, and to raising poultry and cattle. This resulted in an improvement of...the city, many vegetables, corn, milk products and poultry , but very little indigo and sugar. This is because the inhabitants do not have enough...Items from Trench 1, 16SC61. TIL7 160-163 3.62-3.59 Kaolin pipestem 1 Table 21. Metal from Trench 1, 16SC61. T1L4 T1L7 TIL7 TOTAL 160-164 166-169 172-177

  15. Preparation, microstructure and properties of Al-Zn-Mg-Sc alloy tubes

    Institute of Scientific and Technical Information of China (English)

    何振波; 尹志民; 林森; 邓英; 商宝川; 周向

    2010-01-01

    The Al-6.0Zn-2.0Mg-0.2Sc-0.10Zr hollow tube ingots, prepared by semi-continuous casting technology, were subjected to ho- mogenization treatment, hot extrusion, intermediate annealing, tension, solution and aging treatment. The microstructures and properties of as-cast Al-Zn-Mg-Sc alloy at different homogenization treatment conditions were studied using hardness measurement, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analysis. The results showed th...

  16. Axial compression behavior and partial composite action of SC walls in safety-related nuclear facilities

    Science.gov (United States)

    Zhang, Kai

    Steel-plate reinforced concrete (SC) composite walls typically consist of thick concrete walls with two exterior steel faceplates. The concrete core is sandwiched between the two steel faceplates, and the faceplates are attached to the concrete core using shear connectors, for example, ASTM A108 steel headed shear studs. The shear connectors and the concrete infill enhance the stability of the steel faceplates, and the faceplates serve as permanent formwork for concrete placement. SC composite walls were first introduced in the 1980's in Japan for nuclear power plant (NPP) structures. They are used in the new generation of nuclear power plants (GIII+) and being considered for small modular reactors (SMR) due to their structural efficiency, economy, safety, and construction speed. Steel faceplates can potentially undergo local buckling at certain locations of NPP structures where compressive forces are significant. The steel faceplates are usually thin (0.25 to 1.50 inches in Customary units, or 6.5 to 38 mm in SI units) to maintain economical and constructional efficiency, the geometric imperfections and locked-in stresses induced during construction make them more vulnerable to local buckling. Accidental thermal loading may also reduce the compressive strength and exacerbate the local buckling potential of SC composite walls. This dissertation presents the results from experimental and numerical investigations of the compressive behavior of SC composite walls at ambient and elevated temperatures. The results are used to establish a slenderness limit to prevent local buckling before yielding of the steel faceplates and to develop a design approach for calculating the compressive strength of SC composite walls with non-slender and slender steel faceplates at ambient and elevated temperatures. Composite action in SC walls is achieved by the embedment of shear connectors into the concrete core. The strength and stiffness of shear connectors govern the level of

  17. Population of positive-parity states in Sc53 through one-proton knockout

    Science.gov (United States)

    McDaniel, S.; Gade, A.; Janssens, R. V. F.; Bazin, D.; Brown, B. A.; Campbell, C. M.; Carpenter, M. P.; Cook, J. M.; Deacon, A. N.; Dinca, D.-C.; Freeman, S. J.; Glasmacher, T.; Hansen, P. G.; Kay, B. P.; Mantica, P. F.; Mueller, W. F.; Terry, J. R.; Tostevin, J. A.; Zhu, S.

    2010-02-01

    The one-proton knockout reaction Be9(Ti54,Sc53+γ)X at 72 MeV/nucleon has been measured. The location of the first 3/2- state at 2110(3) keV was confirmed, and new γ-ray transitions were observed at 1111(2), 1273(2), 1539(4), and 2495(5) keV. Large spectroscopic strength to excited states in Sc53 was found and attributed to the knockout of sd-shell protons.

  18. Supervising M.Sc. Students working in the 100 Gigabit Ethernet field using OPNET Modeler

    DEFF Research Database (Denmark)

    Ruepp, Sarah Renée; Berger, Michael Stübert; Wessing, Henrik

    2010-01-01

    This paper deals with supervision methods for M.Sc. students who are using OPNET Modeler for their thesis work within the field of 100 Gigabit Ethernet. We detail how we use OPNET Modeler in our M.Sc. projects at the Technical University of Denmark. In particular, we discuss on how we teach...... students to learn OPNET independently and in a short timeframe, and we outline what students find challenging and rewarding by using OPNET Modeler. Furthermore, we show some cases on how OPNET was applied in specific projects within the field of 100 Gigabit Ethernet....

  19. Synergistic Antivascular and Antitumor Efficacy with Combined Cediranib and SC6889 in Intracranial Mouse Glioma.

    Directory of Open Access Journals (Sweden)

    Merryl R Lobo

    Full Text Available Prognosis remains extremely poor for malignant glioma. Targeted therapeutic approaches, including single agent anti-angiogenic and proteasome inhibition strategies, have not resulted in sustained anti-glioma clinical efficacy. We tested the anti-glioma efficacy of the anti-angiogenic receptor tyrosine kinase inhibitor cediranib and the novel proteasome inhibitor SC68896, in combination and as single agents. To assess anti-angiogenic effects and evaluate efficacy we employed 4C8 intracranial mouse glioma and a dual-bolus perfusion MRI approach to measure Ktrans, relative cerebral blood flow and volume (rCBF, rCBV, and relative mean transit time (rMTT in combination with anatomical MRI measurements of tumor growth. While single agent cediranib or SC68896 treatment did not alter tumor growth or survival, combined cediranib/SC68896 significantly delayed tumor growth and increased median survival by 2-fold, compared to untreated. This was accompanied by substantially increased tumor necrosis in the cediranib/SC68896 group (p<0.01, not observed with single agent treatments. Mean vessel density was significantly lower, and mean vessel lumen area was significantly higher, for the combined cediranib/SC68896 group versus untreated. Consistent with our previous findings, cediranib alone did not significantly alter mean tumor rCBF, rCBV, rMTT, or Ktrans. In contrast, SC68896 reduced rCBF in comparison to untreated, but without concomitant reductions in rCBV, rMTT, or Ktrans. Importantly, combined cediranib/SC68896 substantially reduced rCBF, rCBV. rMTT, and Ktrans. A novel analysis of Ktrans/rCBV suggests that changes in Ktrans with time and/or treatment are related to altered total vascular surface area. The data suggest that combined cediranib/SC68896 induced potent anti-angiogenic effects, resulting in increased vascular efficiency and reduced extravasation, consistent with a process of vascular normalization. The study represents the first demonstration

  20. A Saccharomyces cerevisiae mitochondrial transcription factor, sc-mtTFB, shares features with sigma factors but is functionally distinct.

    Science.gov (United States)

    Shadel, G S; Clayton, D A

    1995-04-01

    In Saccharomyces cerevisiae mitochondria, sc-mtTFB is a 341-amino-acid transcription factor required for initiation of transcription from mitochondrial DNA promoters. Specific transcription in vitro requires only sc-mtTFB and the bacteriophage-related core sc-mtRNA polymerase. Mutational analysis of sc-mtTFB has defined two regions of the protein that are important for normal function both in vivo and in vitro. These regions overlap portions of the protein that exhibit similarity to conserved region 2 of bacterial sigma factors. One mutation in this region of sc-mtTFB (tyrosine 108 to arginine [Y108R]) has a defective phenotype that matches that observed for mutations in the corresponding residue of Bacillus subtilis sigma A and sigma E proteins. However, mutations in the sigma 2.4-like region, including a 5-amino-acid deletion corresponding to crucial promoter-contacting amino acids of sigma factors, did not eliminate the ability of sc-mtTFB to initiate transcription specifically in vitro. This suggests a mechanism of promoter recognition for sc-mtRNA polymerase different from that used by bacterial RNA polymerases. Two mutations in a basic region of sc-mtTFB resulted in defective proteins that were virtually dependent on supercoiled DNA templates in vitro. These mutations may have disrupted a DNA-unwinding function of sc-mtTFB that is only manifested in vitro and is partially rescued by DNA supercoiling.

  1. Thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera

    NARCIS (Netherlands)

    Van der Tempel, L.

    2011-01-01

    An acceptance test for thermography of semi-transparent materials by a FLIR ThermaCAM SC3000 infrared camera with 8.0 µm low-wavelength-pass filter has been developed and performed on polycarbonate, PEN, quartz, Corning 1737 glass, G427 cone glas, G443 screen glass, Schott Zerodur, silicon and a bl

  2. Electronic Bands of ScC in the Region 620 - 720 NM

    Science.gov (United States)

    Chen, Chiao-Wei; Merer, Anthony; Hsu, Yen-Chu

    2016-06-01

    ScC molecules have been observed by laser-induced fluorescence, following the reaction of laser-ablated scandium metal with acetylene under supersonic jet-cooled conditions. Rotational analyses have been carried out for about 40 bands of Sc{}12C and Sc{}13C in the region 14000 - 16000 cm-1. Two lower states are found, with Ω = 3/2 and 5/2, indicating that the ground state is ^4Π_i or ^2Δ. As yet we cannot distinguish between these alternatives, but note that the ground state of the isoelectronic YC molecule is ^4Π_i. The ground state bond length in ScC is 1.95{}_5 Å, and the vibrational frequency is 712 cm-1. At least eight electronic transitions occur in the region studied, the majority obeying the selection rule ΔΩ = +1. Rotational perturbations are widespread, consistent with a high density of excited electronic states. B. Simard, P.A. Hackett and W.J. Balfour, Chem. Phys. Lett., 230, 103 (1994).

  3. Atomic structure and phason modes of the Sc-Zn icosahedral quasicrystal.

    Science.gov (United States)

    Yamada, Tsunetomo; Takakura, Hiroyuki; Euchner, Holger; Pay Gómez, Cesar; Bosak, Alexei; Fertey, Pierre; de Boissieu, Marc

    2016-07-01

    The detailed atomic structure of the binary icosahedral (i) ScZn7.33 quasicrystal has been investigated by means of high-resolution synchrotron single-crystal X-ray diffraction and absolute scale measurements of diffuse scattering. The average atomic structure has been solved using the measured Bragg intensity data based on a six-dimensional model that is isostructural to the i-YbCd5.7 one. The structure is described with a quasiperiodic packing of large Tsai-type rhombic triacontahedron clusters and double Friauf polyhedra (DFP), both resulting from a close-packing of a large (Sc) and a small (Zn) atom. The difference in chemical composition between i-ScZn7.33 and i-YbCd5.7 was found to lie in the icosahedron shell and the DFP where in i-ScZn7.33 chemical disorder occurs on the large atom sites, which induces a significant distortion to the structure units. The intensity in reciprocal space displays a substantial amount of diffuse scattering with anisotropic distribution, located around the strong Bragg peaks, that can be fully interpreted as resulting from phason fluctuations, with a ratio of the phason elastic constants K 2/K 1 = -0.53, i.e. close to a threefold instability limit. This induces a relatively large perpendicular (or phason) Debye-Waller factor, which explains the vanishing of 'high-Q perp' reflections.

  4. High-performance Cr/Sc multilayers for the soft x-ray range

    Science.gov (United States)

    Yulin, Sergiy A.; Schaefers, Franz; Feigl, Torsten; Kaiser, Norbert

    2004-01-01

    Results of soft x-ray reflection measurements of Cr/Sc multilayer mirrors close to the Sc absorption edge at 3.11 nm are presented. Improvements in the deposition technology and the adjustment of the multilayer period with an accuracy of better than 0.01 nm to this absorption edge enabled a step forward towards soft x-ray mirrors with an adequate reflectance that allow the realization of normal incidence optical components in the water window. In particular, reflectivity measurements performed at the PTB reflectometer at BESSY II in Berlin revealed a reflectivity of R = 14.8% at an incidence angle of θ = 1.5° and R = 15.0% at θ = 5°. Simulation results show that the interface widths between the Cr and Sc nanolayers are less than 0.4 nm. The annealing effect in short-period Cr/Sc multilayers was studied in the temperature range from 50°C to 500°C by X-ray scattering and transmission electron microscopy. Structural and phase transformations and the corresponding changes of the optical properties are presented and discussed.

  5. Dynamics of self-directed learning in M.Sc. nursing students: A qualitative research

    Directory of Open Access Journals (Sweden)

    FATEMEH SHIRAZI

    2017-01-01

    Full Text Available Introduction: Working in the complex and ever changing healthcare settings forces the nurses and nursing students to be equipped with lifelong learning skills. One of the lifelong learning skills is self-directed learning. This study aimed to explore the M.Sc. nursing students’ self-directed learning activities. Methods: A qualitative design using conventional content analysis approach was used in this study. Semi-structured interviews were conducted with twelve Iranian M.Sc. nursing students who were selected using purposive sampling. Results: Data analysis indicated that the M.Sc. nursing students performed different activities in their self-directed learning. These activities were categorized into four main themes and ten subthemes. The main themes were “sensory perceptions”, “knowledge construction”, “problem-centered orientation”, and “interaction with others”. Conclusion: According to the findings, the M.Sc. nursing students performed different intellectual and experiential self-directed activities for promoting their learning. Besides, the students’ perseverance and inquisitiveness played an important role in their self-directed learning in the challenging clinical environments.

  6. 75 FR 67968 - Arkwright Dump Site, Spartanburg, Spartanburg County, SC; Notice of Settlement

    Science.gov (United States)

    2010-11-04

    ...] Arkwright Dump Site, Spartanburg, Spartanburg County, SC; Notice of Settlement AGENCY: Environmental... Dump Site located in Spartanburg, Spartanburg County, South Carolina for publication. DATES: The Agency..., identified by Docket ID No. EPA-RO4- SFUND-2010-0892 or Site name Arkwright Dump Site by one of the...

  7. CERN Technical Training 2004: New Short Course III (SC III) on Microsoft Outlook - Meetings and Delegation

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled session of the 3rd module will take place as follows: Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14:00-16:00) SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she will be available some time after each session to answer specific questions, or provide further explanations following demand. The cost of attending any SC module on Outlook is 70.- CHF. The above session will be confirmed if there are enough participants, and the attendance costs will be lower in case of a full class. If you are interested in...

  8. 76 FR 9221 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River, Charleston, SC

    Science.gov (United States)

    2011-02-17

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulations; Patriot Challenge Kayak Race... Guard is establishing special local regulations for the Patriot Challenge Kayak Race in Charleston, SC... this rule because the Coast Guard did not receive notice of the Patriot Challenge Kayak Race...

  9. 78 FR 21258 - Special Local Regulations; Patriot Challenge Kayak Race, Ashley River; Charleston, SC

    Science.gov (United States)

    2013-04-10

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulations; Patriot Challenge Kayak Race... Guard is establishing a special local regulation for the Patriot Challenge Kayak Race in Charleston, SC... 13, 2013, the Patriot Challenge Kayak Race is scheduled to take place on the waters of the...

  10. Pressure-induced structural transformations in the molybdate Sc-2(MoO4)(3)

    DEFF Research Database (Denmark)

    Paraguassu, W.; Maczka, M.; Filho, A. G. Sonza

    2004-01-01

    High pressure Raman scattering and x-ray diffraction studies of the molybdate Sc-2(MoO4)(3) are presented. A sequence of changing symmetry effects is observed through two structural phase transitions ending up with an amorphous state. The observed two structural phase transformations are reversib...

  11. Biogas Upgrading Using SOEC with a Ni-ScYSZ Electrode

    DEFF Research Database (Denmark)

    Ebbesen, Sune Dalgaard; Bøgild Hansen, John; Mogensen, Mogens Bjerg

    2013-01-01

    Biogas consists mainly of CH4, CO2 and small amounts of H2S. The value of biogas will increase significantly if it is upgraded to pipeline quality by converting CO2 and H2O in the biogas to CO and H2 using a Solid Oxide Electrolysis Cell (SOEC) followed by methanation. The Ni-ScYSZ-cermet electrode...

  12. Rheological Modeling with Hookean Bead-Spring Cubes (SC, BBC and FCC)

    NARCIS (Netherlands)

    Denneman, A.I.M.; Jongschaap, R.J.J.; Mellema, J.

    1998-01-01

    In this study a general bead-spring model is used for predicting some rheological properties of a cubic bead-spring structure of arbitrary size immersed in a Newtonian solvent. The topology of this bead-spring structure is based upon the well-known cubic crystals (SC, BCC or FCC) and it consists of

  13. 75 FR 34170 - Plastic Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium Automotive Exteriors, LLC...

    Science.gov (United States)

    2010-06-16

    ... Employment and Training Administration Plastic Omnium Automotive Exteriors, LLC, Anderson, SC; Plastic Omnium... Assistance on March 18, 2010, applicable to workers of Plastic Omnium Automotive Exteriors, LLC, Anderson... have occurred involving workers in support of the Anderson, South Carolina location of Plastic...

  14. Automatic symbolic analysis of SC networks using a modified nodal approach

    NARCIS (Netherlands)

    Zivkovic, V.A.; Petkovic, P.M.; Milanovic, D.P.

    1998-01-01

    This paper presents a symbolic analysis of Switched-Capacitor (SC) circuits in the z-domain using Modified Nodal Approach (MNA). We have selected the MNA method as one of the widely established approaches in circuit analysis. The analyses are performed using SymsimC symbolic simulator which also ena

  15. Electronic structure and physical properties of ScN in pressure: density-functional theory calculations

    Institute of Scientific and Technical Information of China (English)

    Guan Peng-Fei; Wang Chong-Yu; Yu Tao

    2008-01-01

    Local density functional is investigated by using the full-potential linearized augmented plane wave (FP-LAPW) method for ScN in the hexagonal structure and the rocksalt structure and for hexagonal structures linking a layered hexagonal phase with wurtzite structure along a homogeneous strain transition path. It is found that the wurtzite ScN is unstable and the layered hexagonal phase, labelled as ho, in which atoms are approximately fivefold coordinated,is metastable, and the rocksalt ScN is stable. The electronic structure, the physical properties of the intermediate structures and the energy band structure along the transition are presented. It is found that the band gaps change from 4.0 to 1.0eV continuously when c/a value varies from 1.68 to 1.26. It is noticeable that the study of ScN provides an opportunity to apply this kind of material (in wurtzite[h]-derived phase).

  16. Final Report for Research supported by US DoE grant DE-SC0006721

    Energy Technology Data Exchange (ETDEWEB)

    Brizard, Alain J. [Saint Michael' s College

    2014-08-27

    A final report is presented on research carried out by Alain J. Brizard (Principal Investigator) with funding provided by the U.S. DoE grant No. DE-SC0006721 during the period of 08/01/2011 to 07/31/2014.

  17. 77 FR 59451 - Pickens Railway Company-Abandonment Exemption-in Pickens County, SC

    Science.gov (United States)

    2012-09-27

    ... abandon approximately 8.5 miles of rail line between approximate milepost 0.0 (at or near Pickens) and the end of the line at approximate milepost 8.5 (at or near Easley), in Pickens County, S.C. The line traverses United States Postal Service Zip Codes 29671 and 29641. Pickens has certified that: (1) No...

  18. Spatial Frequency Scheduling for Uplink SC-FDMA based Linearly Precoded LTE Multiuser MIMO Systems

    DEFF Research Database (Denmark)

    Lin, Zihuai; Xiao, Pei; Sørensen, Troels Bundgaard;

    2010-01-01

    This paper investigates the performance of the 3GPP Long Term Evolution (LTE) uplink Single Carrier (SC) Frequency Division Multiple Access (FDMA) based linearly precoded multiuserMultiple InputMultiple Output (MIMO) systems with frequency domain packet scheduling. A mathematical expression...

  19. Far infrared transmittance of Sc2@C84 and Er2@C82

    NARCIS (Netherlands)

    Grannan, S.M.; Birmingham, J.T.; Richards, P.L.; Bethune, D.S.; Vries, M.S. de; Loosdrecht, P.H.M. van; Dorn, H.C.; Burbank, P.; Bailey, J.; Stevenson, S.

    1997-01-01

    We have measured the far infrared transmittance of Sc2@C84 and Er2@C82 at 1.5 K between 30 and 200 cm-1. Both materials are observed to have a large primary absorption feature centered at 95 cm-1 with a width of approximately 50 cm-1, as well as a number of secondary absorption features which are di

  20. SC-FDE for MMF short reach optical interconnects using directly modulated 850 nm VCSELs

    DEFF Research Database (Denmark)

    Teichmann, Victor S. C.; Barreto, Andre N.; Pham, Tien Thang

    2012-01-01

    We propose the use of single-carrier frequency-domain equalization (SC-FDE) for the compensation of modal dispersion in short distance optical links using multimode fibers and 850 nm VCSELs. By post-processing of experimental data, we demonstrate, at 7.9% overhead, the error-free transmission (ov...

  1. Dynamics of self-directed learning in M.Sc. nursing students: A qualitative research

    Science.gov (United States)

    SHIRAZI, FATEMEH; SHARIF, FARKHONDEH; MOLAZEM, ZAHRA; ALBORZI, MAHBOOBEH

    2017-01-01

    Introduction: Working in the complex and ever changing healthcare settings forces the nurses and nursing students to be equipped with lifelong learning skills. One of the lifelong learning skills is self-directed learning. This study aimed to explore the M.Sc. nursing students’ self-directed learning activities. Methods: A qualitative design using conventional content analysis approach was used in this study. Semi-structured interviews were conducted with twelve Iranian M.Sc. nursing students who were selected using purposive sampling. Results: Data analysis indicated that the M.Sc. nursing students performed different activities in their self-directed learning. These activities were categorized into four main themes and ten subthemes. The main themes were “sensory perceptions”, “knowledge construction”, “problem-centered orientation”, and “interaction with others”. Conclusion: According to the findings, the M.Sc. nursing students performed different intellectual and experiential self-directed activities for promoting their learning. Besides, the students’ perseverance and inquisitiveness played an important role in their self-directed learning in the challenging clinical environments. PMID:28124019

  2. Natural moisturizing factors (NMF) in the stratum corneum (SC). I. Effects of lipid extraction and soaking.

    Science.gov (United States)

    Robinson, Marisa; Visscher, Marty; Laruffa, Angela; Wickett, Randy

    2010-01-01

    Natural moisturizing factor (NMF) is essential for appropriate stratum corneum hydration, barrier homeostasis, desquamation, and plasticity. It is formed from filaggrin proteolysis to small, hygroscopic molecules including amino acids. We hypothesized that common lipid extraction and soaking in water would alter the level of NMF in the upper SC and its biophysical properties. A novel method of measuring and quantifying the amino acid components of NMF is presented. Adhesive tapes were used to collect samples of the stratum corneum (SC) and were extracted with 6mM perchloric acid for analysis by reverse-phase HPLC. HPLC results were standardized to the amount of protein removed by the tapes. An increase in NMF was found with increased SC depth. Also, the combination of extraction and soaking was found to increase NMF loss relative to control or to extraction or soaking alone. Our results indicate that common skin care practices significantly influence the water binding materials in the upper SC. The findings have implications for the evaluation and formulation of skin care products.

  3. 33 CFR 334.460 - Cooper River and tributaries at Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Cooper River and tributaries at... ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.460 Cooper River and tributaries at Charleston, SC. (a) The areas: (1) That portion of the Cooper River beginning on the west...

  4. 33 CFR 334.470 - Cooper River and Charleston Harbor, S.C.; restricted areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Cooper River and Charleston....470 Cooper River and Charleston Harbor, S.C.; restricted areas. (a) The restricted areas. (1) Area No. 1 is that portion of the Cooper River beginning near the westerly shore north of Shipyard Creek...

  5. Data of evolutionary structure change: 1A4SC-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SC-2ONNF 1A4S 2ONN C F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...----- EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- EVID>...hain> 2ONN F 2ONNF

  6. 77 FR 74472 - Application to Export Electric Energy; Energia Renovable S.C., LLC

    Science.gov (United States)

    2012-12-14

    ... Application to Export Electric Energy; Energia Renovable S.C., LLC AGENCY: Office of Electricity Delivery and... Renovable) has applied for authority to transmit electric energy from the United States to Mexico pursuant... application from Energia Renovable for authority to transmit electric energy from the United States to...

  7. Self-assembly of the hydrophobin SC3 proceeds via two structural intermediates

    NARCIS (Netherlands)

    Vocht, Marcel L. de; Reviakine, Ilya; Ulrich, Wolf-Peter; Bergsma-Schutter, Wilma; Wösten, Han A.B.; Vogel, Horst; Brisson, Alain; Wessels, Joseph G.H.; Robillard, George T.

    2002-01-01

    Hydrophobins self assemble into amphipathic films at hydrophobic–hydrophilic interfaces. These proteins are involved in a broad range of processes in fungal development. We have studied the conformational changes that accompany the self-assembly of the hydrophobin SC3 with polarization-modulation in

  8. Structural, electrical and magnetic properties of Sc3+ doped Mn-Zn ferrite nanoparticles

    Science.gov (United States)

    Angadi, V. Jagdeesha; Choudhury, Leema; Sadhana, K.; Liu, Hsiang-Lin; Sandhya, R.; Matteppanavar, Shidaling; Rudraswamy, B.; Pattar, Vinayak; Anavekar, R. V.; Praveena, K.

    2017-02-01

    Sc3+ doped Mn0.5Zn0.5ScyFe2-yO4 (y=0.00, 0.01, 0.03 and 0.05) nanoparticles were synthesized by solution combustion method using mixture of fuels were reported for the first time. The mixture of fuels plays an important role in obtaining nano crystalline, single phase present without any heat treatment. X-ray diffraction (XRD) results confirm the formation of the single-phase ferrites which crystallize in cubic spinel structure. The Fourier transform infrared spectra (FTIR) exhibit two prominent bands around 360 cm-1 and 540 cm-1 which are characteristic feature of spinel ferrite. The transmission electron microscope (TEM) micrographs revealed the nanoparticles to be nearly spherical in shape and of fairly uniform size. The room temperature impedance spectra (IS) and vibrating sample magnetometry (VSM) measurements were carried out in order to study the effect of doping (Sc3+) on the characteristic properties of Mn-Zn ferrites. Further, the frequency dependent dielectric constant and dielectric loss were found to decrease with increasing multiple Sc3+ concentration. Nyquist plot in the complex impedance spectra suggest the existence of multiple electrical responses. Magnetic measurements reveals that saturation magnetization (Ms), remnant magnetization (Mr), magnetic moment (ηB) and magnetic particle size (Dm) increase with Sc3+ ion concentration up to x=0.03 and then decrease. The values of spin canting angle (αY-K) and the magnetic particle size (Dm) are found to be in the range of 68-75° and 10-19 nm respectively with Sc3+ concentration. The room temperature Mössbauer spectra were fitted with two sextets corresponding to ions at tetrahedral (A-) and octahedral (B-) sites confirms the spinel lattice. The ferromagnetic resonance (FMR) spectra's has shown that high concentration of scandium doping leads to an increase in dipolar interaction and decrease in super exchange interaction.

  9. Recombinant norovirus-specific scFv inhibit virus-like particle binding to cellular ligands

    Directory of Open Access Journals (Sweden)

    Hardy Michele E

    2008-01-01

    Full Text Available Abstract Background Noroviruses cause epidemic outbreaks of gastrointestinal illness in all age-groups. The rapid onset and ease of person-to-person transmission suggest that inhibitors of the initial steps of virus binding to susceptible cells have value in limiting spread and outbreak persistence. We previously generated a monoclonal antibody (mAb 54.6 that blocks binding of recombinant norovirus-like particles (VLP to Caco-2 intestinal cells and inhibits VLP-mediated hemagglutination. In this study, we engineered the antigen binding domains of mAb 54.6 into a single chain variable fragment (scFv and tested whether these scFv could function as cell binding inhibitors, similar to the parent mAb. Results The scFv54.6 construct was engineered to encode the light (VL and heavy (VH variable domains of mAb 54.6 separated by a flexible peptide linker, and this recombinant protein was expressed in Pichia pastoris. Purified scFv54.6 recognized native VLPs by immunoblot, inhibited VLP-mediated hemagglutination, and blocked VLP binding to H carbohydrate antigen expressed on the surface of a CHO cell line stably transfected to express α 1,2-fucosyltransferase. Conclusion scFv54.6 retained the functional properties of the parent mAb with respect to inhibiting norovirus particle interactions with cells. With further engineering into a form deliverable to the gut mucosa, norovirus neutralizing antibodies represent a prophylactic strategy that would be valuable in outbreak settings.

  10. 2D-ELDOR using full Sc- fitting and absorption lineshapes

    Science.gov (United States)

    Chiang, Yun-Wei; Costa-Filho, Antonio; Freed, Jack H.

    2007-10-01

    Recent progress in developing 2D-ELDOR (2D electron-electron double resonance) techniques to better capture molecular dynamics in complex fluids, particularly in model and biological membranes, is reported. The new "full Sc- method", which corrects the spectral analysis for the phase distortion effects present in the experiments, is demonstrated to enhance the sensitivity of 2D-ELDOR in reporting on molecular dynamics in complex membrane environments. That is, instead of performing spectral fitting in the magnitude mode, our new method enables simultaneous fitting of both the real and imaginary components of the Sc- signal. The full Sc- fitting not only corrects the phase distortions in the experimental data but also more accurately determines instrumental dead times. The phase corrections applied to the Sc- spectrum enable the extraction of the pure absorption-mode spectrum, which is characterized by much better resolution than the magnitude-mode spectrum. In the absorption mode, the variation of homogeneous broadening, which reports on the dynamics of the spin probe, can even be observed by visual inspection. This new method is illustrated with results from model membranes of dipalmitoyl-sn-glycero-phosphatidylcholine (DPPC)-cholesterol binary mixtures, as well as with results from plasma membrane vesicles of mast cells. In addition to the dynamic parameters, which provide quantitative descriptions for membranes at the molecular level, the high-resolution absorption spectra themselves may be used as a "fingerprint" to characterize membrane phases and distinguish coexisting components in biomembranes. Thus we find that 2D-ELDOR is greatly improved with the new "full Sc- method" especially for exploring the complexity of model and biological membranes.

  11. 2D-ELDOR using full S(c-) fitting and absorption lineshapes.

    Science.gov (United States)

    Chiang, Yun-Wei; Costa-Filho, Antonio; Freed, Jack H

    2007-10-01

    Recent progress in developing 2D-ELDOR (2D electron-electron double resonance) techniques to better capture molecular dynamics in complex fluids, particularly in model and biological membranes, is reported. The new "full S(c-) method", which corrects the spectral analysis for the phase distortion effects present in the experiments, is demonstrated to enhance the sensitivity of 2D-ELDOR in reporting on molecular dynamics in complex membrane environments. That is, instead of performing spectral fitting in the magnitude mode, our new method enables simultaneous fitting of both the real and imaginary components of the S(c-) signal. The full S(c-) fitting not only corrects the phase distortions in the experimental data but also more accurately determines instrumental dead times. The phase corrections applied to the S(c-) spectrum enable the extraction of the pure absorption-mode spectrum, which is characterized by much better resolution than the magnitude-mode spectrum. In the absorption mode, the variation of homogeneous broadening, which reports on the dynamics of the spin probe, can even be observed by visual inspection. This new method is illustrated with results from model membranes of dipalmitoyl-sn-glycero-phosphatidylcholine (DPPC)-cholesterol binary mixtures, as well as with results from plasma membrane vesicles of mast cells. In addition to the dynamic parameters, which provide quantitative descriptions for membranes at the molecular level, the high-resolution absorption spectra themselves may be used as a "fingerprint" to characterize membrane phases and distinguish coexisting components in biomembranes. Thus we find that 2D-ELDOR is greatly improved with the new "full S(c-) method" especially for exploring the complexity of model and biological membranes.

  12. Medialogi (Dansk informations brochure om Medialogi-uddannelsen, 1. til 10. semester (B.Sc. & Cand.Scient))

    DEFF Research Database (Denmark)

    Andersen, Hans Jørgen

    2006-01-01

    Informationsbrochure, 28 sider, om Medialogi uddannelsen (Cand. Scient.), der udbydes af Aalborg Universitet i Aalborg, Esbjerg og København. Brochuren beskriver 1. til 10. semester af uddannelsen (B.Sc. og M.Sc.). Informationen er primært rettet mod potentielle ansøgere til Medialogi uddannelsen...

  13. Identification of the Most Stable Sc2C80 Isomers: Structure, Electronic Property, and Molecular Spectra Investigations

    Institute of Scientific and Technical Information of China (English)

    吴静怡; 王太山; 舒春英; 吕鑫; 王春儒

    2012-01-01

    A systematic density functional theory investigation has been carried out to explore the possible structures of Sc2C80 at the BMK/6-31 G(d) level. The results clearly show that Sc2@C80-Ih, Sc2@Cso-Dsh, and Sc2C2@C78-C2v can be identified as three isomers of Sc2C80 metallofullerene with the lowest energy. Frontier molecular orbital analysis indicates that the two Sc2@C80 isomers have a charge state as (Sc〉)2@ C60 and the Sc2C2@C78 has a charge state of (Sc3+)2 C22- @ C784-. Moreover, the metal-cage covalent interactions have been studied to reveal the dynamics of endohedral moiety. The vertical electron affinity, vertical ionization potential, infrared spectra and 13C nuclear mag- netic resonance spectra have been also computed to further disclose the molecular structures and properties.

  14. SC1, an immunoglobulin-superfamily cell adhesion molecule, is involved in the brain metastatic activity of lung cancer cells

    Science.gov (United States)

    KUBOTA, YUKA; KIRIMURA, NAOKI; SHIBA, HATSUKI; ADACHI, KAZUHIDE; TSUKAMOTO, YASUHIRO

    2015-01-01

    SC1 is a cell adhesion molecule that belongs to the immunoglobulin superfamily; this molecule was initially purified from the chick embryonic nervous system and was reported to exhibit homophilic adhesion activity. SC1 is transiently expressed in various organs during development and has been identified in numerous neoplastic tissues, including lung cancer and colorectal carcinomas. The present study focused on the encephalic metastasis of lung cancer cells with respect to the potential function of SC1, as this molecule is known to be consistently expressed in the central nervous system as well as lung cancers. SC1 complementary DNA was introduced into A549 cells, a human lung cancer-derived cell line. The stable overexpression of the SC1 protein in A549 cells was demonstrated to enhance the self-aggregation of the cells. In addition, the SC1 transfectants enhanced the metastatic and invasive potential to the encephalic parenchyma following implantation into nude mice. In conclusion, the results of the present study demonstrated that cell adhesion due interactions between SC1 on brain tissue and SC1 on lung cancer cells was involved in the malignant aspects of lung cancer, including invasion and metastasis to the brain. PMID:26622821

  15. Curriculum (Study Programme) for the 3rd to 6th semester of the B.Sc., Medialogy, at Aalborg University

    DEFF Research Database (Denmark)

    Nordahl, Rolf; Serafin, Stefania; Lavatino, Salvatore

    2004-01-01

    Major revision of the original curriculum of the B.Sc., Medialogy. Significant changes (extensive restructuring) in comparison with the first version of the curriculum.......Major revision of the original curriculum of the B.Sc., Medialogy. Significant changes (extensive restructuring) in comparison with the first version of the curriculum....

  16. Effect of minor Sc and Zr addition on microstructures and mechanical properties of Al-Zn-Mg-Cu alloys

    Institute of Scientific and Technical Information of China (English)

    ZOU Liang; PAN Qing-lin; HE Yun-bin; WANG Chang-zhen; LIANG Wen-jie

    2007-01-01

    Three kinds of Al-Zn-Mg-Cu based alloys with 0.22%, 0.36%(Sc+Zr) (mass fraction, %), and without Sc, Zr addition were prepared by ingot metallurgy. By using optical microscopy, transmission electronic microscopy and scanning electron microscopy, the effects of microalloying elements of Sc, Zr on the microstructure of super-high-strength Al-Zn-Mg-Cu alloys related to mechanical properties were investigated. The tensile properties and microstructures of the studied alloys under different heat treatment conditions were studied. The addition of minor Sc, Zr results in the formation of Al3(Sc,Zr) particles. These particles are highly effective in refining the microstructures, retarding recrystallization, pinning dislocations and subboundaries. The strength of Al-Zn-Mg-Cu alloys was greatly improved by simultaneously adding minor Sc, Zr, meanwhile the ductility of the studied alloys remains at a higher level. The 0.36%(Sc+Zr) alloys gain the optimal properties after 465 ℃/h solution and 120 ℃/24 h aging. The increment of strength is mainly due to strengthening of fine grain and substructure and precipitation of Al3(Sc, Zr) particles.

  17. Structure, phase transition, and controllable thermal expansion behaviors of Sc(2-x)Fe(x)Mo₃O₁₂.

    Science.gov (United States)

    Wu, Meimei; Liu, Xinzhi; Chen, Dongfeng; Huang, Qingzhen; Wu, Hui; Liu, Yuntao

    2014-09-02

    The crystal structures, phase transition, and thermal expansion behaviors of solid solutions of Sc(2-x)Fe(x)Mo3O12 (0 ≤ x ≤ 2) have been examined using X-ray diffraction (XRD), neutron powder diffraction (NPD), and differential scanning calorimetry (DSC). At room temperature, samples crystallize in a single orthorhombic structure for the compositions of x thermal expansion, and the volumetric coefficients of thermal expansion derived from XRD and NPD are 0.28 × 10(-6) °C(-1) (250-800 °C) and 0.65 × 10(-6) °C(-1) (227-427 °C), respectively. NPD results of Sc2Mo3O12 (x = 0) and Sc(1.3)Fe(0.7)Mo3O12 (x = 0.7) indicate that Fe substitution for Sc induces reduction of the mean Sc(Fe)-Mo nonbond distance and the different thermal variations of Sc(Fe)-O5-Mo2 and Sc(Fe)-O3-Mo2 bond angles. The correlation between the displacements of oxygen atoms and the variation of unit cell parameters was investigated in detail for Sc2Mo3O12.

  18. Naked (C5Me5)(2)M cations (M = Sc, Ti, and V) and their fluoroarene complexes

    NARCIS (Netherlands)

    Bouwkamp, MW; Budzelaar, PHM; Gercama, J; Morales, ID; de Wolf, J; Meetsma, A; Troyanov, SI; Teuben, JH; Hessen, B; Budzelaar, Peter H.M.; Hierro Morales, Isabel Del; Troyanov, Sergei I.

    2005-01-01

    The ionic metallocene complexes [Cp*M-2][BPh4] (CP* = C5Me5) of the trivalent 3d metals Sc, Ti, and V were synthesized and structurally characterized. For M Sc, the anion interacts weakly with the metal center through one of the phenyl groups, but for M = Ti and V, the cations are naked. They each c

  19. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    OpenAIRE

    Luis Fernando Pinto; Javier Molina; Francisco Cuellar; Amado Karduss

    1989-01-01

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH) secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y ...

  20. 链霉菌SC120细胞毒活性代谢产物的研究%A CYTOTOXIC METABOLITE OF STREPTOMYCES SP. SC120

    Institute of Scientific and Technical Information of China (English)

    王继栋; 魏孝义; 朱西儒; 谢海辉; 陈贻竹

    2003-01-01

    在研究链霉菌Streptomyces sp. SC120抗荔枝霜疫霉菌活性代谢产物的过程中,分离得到一对人鼻咽癌细胞具有细胞毒作用的抗生素.通过UV、IR、HR-MS、1H-NMR、13C-NMR、DEPT、1H-1H COSY、HMQC、HMBC等波谱分析,鉴定其结构与Pimprinine相同.首次报道Pimprinine对人鼻咽癌细胞具有细胞毒作用.

  1. Construction, Expression and In Vitro Biological Behaviors of Ig scFv Fragment in Patients with Chronic B Cell Leukemia

    Institute of Scientific and Technical Information of China (English)

    ZHU Lijuan; LIAO Wenjun; ZHU Huifen; LEI Ping; WANG Zhihua; SHAO Jingfang; ZHANG Yue; SHEN Guanxin

    2006-01-01

    The expression vector of SmIg scFv fragment was constructed in patient with B cell chronic lymphocyte leukemia (B-CLL) and expressed in E. coli to obtain scFv fragment, and the effect of the protein on the proliferation of stimulated peripheral blood mononuclear cells (PBMC) was investigated in vitro. Two pairs of primers were designed, and variable region genes of light chain and heavy chain were amplified by PCR respectively from the pGEM-T vectors previously constructed in our laboratory which containing light chain gene or Fd fragment of heavy chain gene. The PCR product was digested, purified and inserted into pHEN2 vector to construct the soluble expression vector pHEN2-scFv. After the induction by IPTG, the scFv protein was identified by SDSPAGE electrophoresis and purified by Ni-NTA-Chromatography. MTT was used to determine the effect of purified protein on the proliferation of stimulated PBMC in vitro. Plasmid PCR and restriction enzyme digestion of pHEN2-scFv revealed the pHEN2-scFv vector was constructed successfully. Id-scFv protein was expressed in positive clone after induced by IPTG. SDS-PAGE analysis showed that the relative molecular weight of fusion protein was about 30 kD (1 kD=0.9921 ku),which was consistent with the theoretically predicted value. Proliferation of PBMC could be induced by purified Id-scFv. It was suggested that the expression vector of SmIg scFv fragment was constructed successfully, and scFv protein was expressed and secreted from E. coli, which could induce proliferation of PBMC. This may lay an experimental foundation for further research of IdHSP complex vaccine for B-CLL.

  2. Generation of a recombinant single-chain variable fragment (scFv) targeting 5-methyl-2'-deoxycytidine.

    Science.gov (United States)

    Ohshima, Motohiro; Tadakuma, Tomomi; Hayashi, Hideki; Inoue, Kazuyuki; Itoh, Kunihiko

    2010-01-01

    We generated a single-chain variable fragment (scFv) against 5-methyl-2'-deoxycytidine (m(5)dCyd) using phage display technology. The heavy and light chain variable region genes were amplified by the polymerase chain reaction (PCR) from hybridoma cell line FMC9 and assembled as an scFv fragment with a flexible linker (Gly(4)-Ser)(3). The scFv DNA fragment was then cloned into pCANTAB-5E, and a phage displaying the scFv was produced. Antigen-positive phage clones were successfully selected by enzyme-linked immunosorbent assay (ELISA). The scFv was modified with FLAG and His tags for detection and purification. The scFv reacted strongly with m(5)dCyd and weakly with 5-methylcytidine (m(5)Cyd) but not with cytidine (Cyd) and 1-methyladenosine in a manner similar to the monoclonal antibody (MoAb). Although the specificities of scFv and MoAb were almost identical, the sensitivity of the scFv (IC(50) 0.054 microg/ml) was approximately 80 times higher than that of the parent MoAb (IC(50) 4.27 microg/ml), determined by inhibition ELISA. As a biochemical application of this scFv, we quantified the m(5)dCyd content of genomic DNA by enzymatic hydrolysis using inhibition ELISA. The cancer cell lines HeLa, HeLa S3 and MDA-MB-453 contained approximately 1% of the methylated DNA in total genomic DNA, as did peripheral blood cell genomic DNA from healthy volunteers, but HT29 and T-47D showed hypomethylation compared with the HeLa, HeLa S3 and MDA-MB-453 cell lines. The scFv generated here may be applicable to the assessment of cellular DNA methylation levels and is more sensitive than the MoAb.

  3. Performance analysis of combined transmit SC/Receive MRC in Nakagami fading channels%Nakagami衰落信道上组合SC/MRC的性能分析

    Institute of Scientific and Technical Information of China (English)

    李光球

    2007-01-01

    研究Nakagami衰落信道上组合发射机选择合并(SC)/接收机最大比合并(MRC)天线分集系统的性能.使用矩生成函数方法,推导采用组合SC/MRC天线分集和相干检测的MPSK(M进制相移键控)、MQAM(M进制正交幅度调制)、MPAM(M进制脉冲幅度调制)、BFSK(二进制频移键控)、最小相关BFSK(BFSKmin)、差分编码BPSK(DE-BPSK)和预编码MSK(最小频移键控)等几种M进制数字调制方式在Nakagami衰落信道上的误符号率性能,获得了M进制数字调制系统误符号率性能的精确数学表达式.数值计算结果阐明了发射天线和接收天线数目以及衰落参数对数字调制系统误符号率性能的影响.

  4. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    Directory of Open Access Journals (Sweden)

    Luis Fernando Pinto

    1989-02-01

    Full Text Available

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y leishmaniasis.

    We report a case of hemophagocytlc syndrome occurrlng In a 14 year old boy with SC hemoglobinopathy and salmonellosis; the clinical features of the syndrome are discussed; the need to consider this syndrome In the differential diagnosis is emphazised, since several of the infections that may lead to It- tuberculosis, salmonellosis, lelsmaniasis. are frequently found in colombian patients

  5. Hydroxyurea decreases hospitalizations in pediatric patients with Hb SC and Hb SB+ thalassemia

    Directory of Open Access Journals (Sweden)

    Lebensburger JD

    2015-12-01

    Full Text Available Jeffrey D Lebensburger, Rakeshkumar J Patel, Prasannalaxmi Palabindela, Christina J Bemrich-Stolz, Thomas H Howard, Lee M HilliardDivision of Pediatric Hematology Oncology, University of Alabama at Birmingham, Birmingham, AL, USAPurpose: Patients with hemoglobin SC (Hb SC and hemoglobin SB+ (Hb SB+ thalassemia suffer from frequent hospitalizations yet strong evidence of a clinical benefit of hydroxyurea (HU in this population is lacking. Patients with recurrent hospitalizations for pain crisis are offered HU at our institution based on small cohort data and anecdotal benefit. This study identifies outcomes from a large cohort of patients with Hb SC and SB+ thalassemia who were treated with HU for 2 years.Materials and methods: A retrospective review was conducted of 32 patients with Hb SC and SB+ thalassemia who were treated with HU. We reviewed the number, and reasons for hospitalization in the 2 years prior to, and 2 years post-HU treatment as well as laboratory changes from baseline, over 1 year.Results: Patients with Hb SC and SB+ thalassemia started on HU for frequent pain, had a significant reduction in hospitalizations over 2 years as compared to the 2 years prior to HU initiation (mean total hospitalizations/year: pre-HU: 1.6 vs post-HU 0.4 hospitalizations, P<0.001; mean pain hospitalizations/year: pre-HU 1.5 vs post-HU 0.3 hospitalizations, P<0.001. Patients demonstrated hematologic changes including an increase in percent fetal hemoglobin (%HbF pre–post HU (4.5% to 7.7%, P=0.002, mean corpuscular volume (74 to 86 fL, P<0,0001, and decrease in absolute neutrophil count (5.0 to 3.2×109/L, P=0.007. Patients with higher doses of HU demonstrated the greatest reduction in hospitalizations but this was unrelated to absolute neutrophil count.Conclusion: This cohort of patients with Hb SC and SB+ thalassemia provides additional support for using HU in patients with recurrent hospitalizations for pain. A large randomized multicenter trial of

  6. Investigation on Mg and Sc co-doped Ceria electrolyte for IT-SOFC

    Directory of Open Access Journals (Sweden)

    P.Ravi Chandran

    2014-07-01

    Full Text Available Nanocrystalline form of pure ceria (CeO2 and metal (Mg or Sc doped ceria was attempted for 10 mol %. Also, Mg and Sc co-doped ceria with Ce1-x(Mg0.5Sc0.5xO2 (x=0-0.24 was prepared as an electrolyte for intermediate temperature solid oxide fuel cells (IT-SOFCs by co-precipitation method. The synthesized different compositions of pure and doped nanocrystalline powders were then subjected to powder X-ray diffraction (XRD for phase and structural identification. All the nanocrystalline samples were found to be ceria based solid solutions of fluorite type structures. A.C. impedance spectroscopy measurements in the frequency range of 50Hz to 5MHz was carried out to study the grain, grain boundary and ionic conductivity of doped ceria samples in the temperature range of 400-600oC. The sample Ce0.84(Mg0.5Sc0.50.16O2 composition showed highest ionic conductivity i.e., 1.923 x 10-2 S/cm at 500oC. Its morphology and composition was investigated using scanning electron microscopic analysis (SEM and energy dispersive X-ray spectrometry (EDS and conductivity behavior was compared with those of pure ceria and singly doped ceria electrolytes namely Ce0.9Mg0.1O2 and Ce0.9Sc0.1O2. The impedance analysis reveals that the sample Ce0.9Mg0.1O2 was found to have higher ionic conductivity compared to Ce0.9Sc0.1O2 in the temperature range of 400–600°C. The co-doped ceria showed a much higher conductivity in air at 500oC in comparison to that of singly doped ceria. Therefore, these co-doped ceria are also the more ideal electrolyte materials for IT-SOFCs. Nyquist plot shows the major contributions were due to the grain boundary resistance contributions which accounts for the higher ionic conductivity in case of the dopants. These dopant effect on the ceria is discussed in detail.

  7. L-Arginine ethylester enhances in vitro amplification of PrP(Sc) in macaques with atypical L-type bovine spongiform encephalopathy and enables presymptomatic detection of PrP(Sc) in the bodily fluids.

    Science.gov (United States)

    Murayama, Y; Ono, F; Shimozaki, N; Shibata, H

    2016-02-12

    Protease-resistant, misfolded isoforms (PrP(Sc)) of a normal cellular prion protein (PrP(C)) in the bodily fluids, including blood, urine, and saliva, are expected to be useful diagnostic markers of prion diseases, and nonhuman primate models are suited for performing valid diagnostic tests for human Creutzfeldt-Jakob disease (CJD). We developed an effective amplification method for PrP(Sc) derived from macaques infected with the atypical L-type bovine spongiform encephalopathy (L-BSE) prion by using mouse brain homogenate as a substrate in the presence of polyanions and L-arginine ethylester. This method was highly sensitive and detected PrP(Sc) in infected brain homogenate diluted up to 10(10) by sequential amplification. This method in combination with PrP(Sc) precipitation by sodium phosphotungstic acid is capable of amplifying very small amounts of PrP(Sc) contained in the cerebrospinal fluid (CSF), saliva, urine, and plasma of macaques that have been intracerebrally inoculated with the L-BSE prion. Furthermore, PrP(Sc) was detectable in the saliva or urine samples as well as CSF samples obtained at the preclinical phases of the disease. Thus, our novel method may be useful for furthering the understanding of bodily fluid leakage of PrP(Sc) in nonhuman primate models.

  8. Acute Splenic Sequestration Crisis in a 70-Year-Old Patient With Hemoglobin SC Disease

    Directory of Open Access Journals (Sweden)

    John J. Squiers BSE

    2016-03-01

    Full Text Available A 70-year-old African American female with a past medical history significant for chronic bilateral shoulder pain and reported sickle cell trait presented with acute-onset bilateral thoracolumbar pain radiating to her left arm. Two days after admission, Hematology was consulted for severely worsening microcytic anemia and thrombocytopenia. Examination of the patient’s peripheral blood smear from admission revealed no cell sickling, spherocytes, or schistocytes. Some targeting was noted. A Coombs test was negative. The patient was eventually transferred to the medical intensive care unit in respiratory distress. Hemoglobin electrophoresis confirmed a diagnosis of hemoglobin SC disease. A diagnosis of acute splenic sequestration crisis complicated by acute chest syndrome was crystallized, and red blood cell exchange transfusion was performed. Further research is necessary to fully elucidate the pathophysiology behind acute splenic sequestration crisis, and the role of splenectomy to treat hemoglobin SC disease patients should be better defined.

  9. Theoretical Calculations of Transition Probabilities and Oscillator Strengths for Sc(Ⅲ) and Y(Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Tian-yi Zhang; Neng-wu Zheng

    2009-01-01

    The Weakest Bound Electron Potential Model theory is used to calculate transition probability-values and oscillator strength-values for individual lines of Sc(Ⅲ) and Y(Ⅲ). In this method, by solving the SchrSdinger equation of the weakest bound electron, the expressions of energy eigenvalue and the radial function can be obtained. And a coupled equation is used to determine the parameters which are needed in the calculations. The ob-tained results of Sc(Ⅲ) from this work agree very well with the accepted values taken from the National Institute of Standards and Technoligy (NIST) data base, most deviations are within the accepted level. For Y(Ⅲ) there are no accepted values reported by the NIST data base. So we compared our results of Y(Ⅲ) with other theoretical results, good agreement is also obtained.

  10. Atomic physics modeling of transmission spectra of Sc-doped aerogel foams to support OMEGA experiments

    Science.gov (United States)

    Johns, H. M.; Lanier, N. E.; Kline, J. L.; Fontes, C. J.; Perry, T. S.; Fryer, C. L.; Brown, C. R. D.; Morton, J. W.; Hager, J. D.; Sherrill, M. E.

    2016-11-01

    We present synthetic transmission spectra generated with PrismSPECT utilizing both the ATBASE model and the Los Alamos opacity library (OPLIB) to evaluate whether an alternative choice in atomic data will impact modeling of experimental data from radiation transport experiments using Sc-doped aerogel foams (ScSi6O12 at 75 mg/cm3 density). We have determined that in the 50-200 eV Te range there is a significant difference in the 1s-3p spectra, especially below 100 eV, and for Te = 200 eV above 5000 eV in photon energy. Examining synthetic spectra generated using OPLIB with 300 resolving power reveals spectral sensitivity to Te changes of ˜3 eV.

  11. Fatigue Performance of Friction-Stir-Welded Al-Mg-Sc Alloy

    Science.gov (United States)

    Zhemchuzhnikova, Daria; Mironov, Sergey; Kaibyshev, Rustam

    2017-01-01

    Fatigue behavior of a friction-stir-welded Al-Mg-Sc alloy was examined in cast and hot-rolled conditions. In both cases, the joints failed in the base material region and therefore the joint efficiency was 100 pct. The specimens machined entirely from the stir zone demonstrated fatigue strength superior to that of the base material in both preprocessed tempers. It was shown that the excellent fatigue performance of friction-stir joints was attributable to the ultra-fine-grained microstructure, the low dislocation density evolved in the stir zone, and the preservation of Al3Sc coherent dispersoids during welding. The formation of such structure hinders the initiation and growth of fatigue microcracks that provides superior fatigue performance of friction-stir welds.

  12. Generation and Characterization of an scFv Directed against Site II of Rabies Glycoprotein

    Directory of Open Access Journals (Sweden)

    Shukra M. Aavula

    2011-01-01

    Full Text Available Recombinant antibody phage display technology is a vital tool that facilitates identification of specific binding molecules to a target enabling the rapid generation and selection of high affinity, fully human, or mouse antibody product candidates essentially directed towards disease target appropriate for antibody therapy. In this study, a recombinant single-chain Fv antibody fragment (scFv A11 was isolated from immune spleen cells obtained from mice immunized with inactivated rabies virus (Pasteur strain using standard methodology and was characterized for its specificity towards the rabies virus glycoprotein. Epitope mapping using peptide libraries and truncated glycoprotein polypeptides suggested that A11 bound to the antigenic site II of rabies glycoprotein against which a majority of rabies virus neutralizing antibodies are directed. The use of the above technology could, therefore, allow development of scFvs with different specificities against the rabies glycoprotein as an alternative to the more cumbersome protocols used for the development of monoclonal antibodies.

  13. Two-dimensional nanoscale correlations in the strong negative thermal expansion material ScF3

    Science.gov (United States)

    Handunkanda, Sahan U.; Occhialini, Connor A.; Said, Ayman H.; Hancock, Jason N.

    2016-12-01

    We present diffuse x-ray scattering data on the strong negative thermal expansion (NTE) material ScF3 and find that two-dimensional nanoscale correlations exist at momentum-space regions associated with possibly rigid rotations of the perovskite octahedra. We address the extent to which rigid octahedral motion describes the dynamical fluctuations behind NTE by generalizing a simple model supporting a single floppy mode that is often used to heuristically describe instances of NTE. We find this model has tendencies toward dynamic inhomogeneities and its application to recent and existing experimental data suggest an intricate link between the nanometer correlation length scale, the energy scale for octahedral tilt fluctuations, and the coefficient of thermal expansion in ScF3. We then investigate the breakdown of the rigid limit and propose a resolution to an outstanding debate concerning the role of molecular rigidity in strong NTE materials.

  14. Special Issue: SC13 – The International Conference for High Performance Computing, Networking, Storage and Analysis

    Directory of Open Access Journals (Sweden)

    William Gropp

    2014-01-01

    Full Text Available The technical papers program for SC13 received 449 submissions of which 90 where selected for the program giving an acceptance rate of 20%. A rigorous peer review process, including author rebuttals and a 1.5 day face-to-face program committee meeting ensured that selected papers were the very best in our field. One of the tasks at the face-to-face meeting was also to select finalists for the best paper award, from which one is selected by a committee during the conference. To further highlight their achievement of being selected as the very top tier of all the submitted papers to SC13, the authors of these finalist papers were offered the opportunity to publish extended versions of their papers in this special issue journal; all eight authors accepted.

  15. Structural characterization and ytterbium spectroscopy in Sc{sub 2}O{sub 3} nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Galceran, M. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Pujol, M.C., E-mail: mariacinta.pujol@urv.ca [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Carvajal, J.J.; Mateos, X. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain); Zaldo, C. [Instituto de Ciencia de Materiales de Madrid (ICMM), Consejo Superior de Investigaciones Cientificas (CSIC), c/ Sor Juana Ines de la Cruz 3, E-28049 Madrid (Spain); Aguilo, M.; Diaz, F. [Fisica i Cristal.lografia de Materials i Nanomaterials (FiCMA-FiCNA), Universitat Rovira i Virgili (URV), Campus Sescelades, c/ Marcel. li Domingo, s/n, E-43007 Tarragona (Spain)

    2010-08-15

    Ytterbium-doped scandium oxide nanocrystals measuring less than 25 nm with compositions of Sc{sub 2-x}Yb{sub x}O{sub 3} (x=0.001-1) were prepared using the modified Pechini method. The Yb:Sc{sub 2}O{sub 3} nanocrystals were obtained by calcination at low temperature such as 1073 K for 2 h. X-ray powder diffraction (XRD) and transmission electronic microscopy (TEM) were used to perform the structural characterization of nanocrystals; these studies indicated that the nanocrystals have high crystalline quality with cubic structure and Ia3-bar space group. The morphology and particle size were studied using electron microscopy. A detailed study of the effect of the nanodimension and the ytterbium concentration on the spectroscopic characteristics of Yb{sup 3+} as an active ion was carried out in terms of optical absorption, optical emission and fluorescence decay time at room and low temperature.

  16. A Differential MIMO SC-FDE Transceiver Design over Multipath Fast Fading Channels

    Science.gov (United States)

    Deng, Juinn-Horng; Hwang, Jeng-Kuang

    In this paper, we propose a new differential MIMO single-carrier system with frequency-domain equalization (SC-FDE) aided by the insertion of cyclic prefix. This block transmission system not only inherits all the merits of the SISO SC-FDE system, but is also equipped with a differential space-time block coding (DSTBC) such as to combat the fast-changing frequency selective fading channels without the needs to estimate and then compensate the channel effects. Hence, for practical applications, it has the additional merits of decoding simplicity and robustness against high mobility transmission environments. Computer simulations show that the proposed system can provide diversity benefit as the non-differential system does, while greatly reducing the receiver complexity.

  17. Spectroscopy of the odd-odd fp-shell nucleus 52Sc from secondary fragmentation

    CERN Document Server

    Gade, A; Brown, B A; Campbell, C M; Carpenter, M P; Cook, J M; Deacon, A N; Dinca, D C; Freeman, S J; Glasmacher, T; Janssens, R V F; Kay, B P; Mantica, P F; Müller, W F; Terry, J R; Zhu, S

    2006-01-01

    The odd-odd fp-shell nucleus 52Sc was investigated using in-beam gamma-ray spectroscopy following secondary fragmentation of a 55V and 57Cr cocktail beam. Aside from the known gamma-ray transition at 674(5)keV, a new decay at E_gamma=212(3) keV was observed. It is attributed to the depopulation of a low-lying excited level. This new state is discussed in the framework of shell-model calculations with the GXPF1, GXPF1A, and KB3G effective interactions. These calculations are found to be fairly robust for the low-lying level scheme of 52Sc irrespective of the choice of the effective interaction. In addition, the frequency of spin values predicted by the shell model is successfully modeled by a spin distribution formulated in a statistical approach with an empirical, energy-independent spin-cutoff parameter.

  18. mini Style 松下直板手机SC3评测

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    松下2005年最拉风的产品莫过于6系列和7系列的折叠机.屏幕清晰靓丽.可谓出尽风头。同时.松下还发布了两款低端直板手机.使得产品线更趋丰富,A210和SC3造型小巧到极至.一规矩方正一可爱圆润.是非常不错的学生机。尽管上市有些时日.仍得到用户关注.其中SC3更是得到师哥靓妹的青睐。

  19. Pressure-induced phase transition for ScVO{sub 4}: A first-principles study

    Energy Technology Data Exchange (ETDEWEB)

    Sheng, Shu-Fang, E-mail: shengshf@gmail.com [School of Physical Science and Information Engineering, Liaocheng University, Liaocheng 252059 (China); Shandong Provincial Key Laboratory of Optical Communication Science and Technology, Liaocheng 252059 (China)

    2013-10-01

    We theoretically investigated the structural stability and electronic properties of ScVO{sub 4} by the first-principles pseudopotential method. The tetragonal zircon-type and scheelite-type structures, LaTaO{sub 4}-type structure of ScVO{sub 4} have been considered. The calculations indicate that the LaTaO{sub 4}-type phase is not stable in the pressure 0–100 GPa, and the structural phase transformation from zircon to scheelite-type structure occurs at 5.4 GPa. The band structure shows that zircon-type structure at zero pressure and scheelite-type structure at transition pressure have direct gaps of 2.58 eV and 2.35 eV, respectively. The detailed volume changes during the phase transition were analyzed.

  20. Anomalously high thermoelectric power factor in epitaxial ScN thin films

    DEFF Research Database (Denmark)

    Kerdsongpanya, Sit; Van Nong, Ngo; Pryds, Nini;

    2011-01-01

    Thermoelectric properties of ScN thin films grown by reactive magnetron sputtering on Al2O3(0001) wafers are reported. X-ray diffraction and elastic recoil detection analyses show that the composition of the films is close to stoichiometry with trace amounts (∼1 at. % in total) of C, O, and F. We...... found that the ScN thin-film exhibits a rather low electrical resistivity of ∼2.94 μΩm, while its Seebeck coefficient is approximately ∼−86 μV/K at 800 K, yielding a power factor of ∼2.5 × 10−3 W/mK2. This value is anomalously high for common transition-metal nitrides. © 2011 American Institute...

  1. [Human amniotic epithelium (HAE) as a possible source of stem cells (SC)].

    Science.gov (United States)

    García-López, Guadalupe; García-Castro, Irma Lydia; Avila-González, Daniela; Molina-Hernández, Anayansi; Flores-Herrera, Héctor; Merchant-Larios, Horacio; Díaz-Martínez, Fabián

    2015-01-01

    There have been major recent advances in the field of developmental biology due to the investigation on stem cells (SC). Stem cells are characterized by their capacity of auto-renewal and differentiation to different cellular phenotypes. Based on the developmental stage, they can be classified into two different types: embryonic SCs and adult SCs. It has been widely reported that several problems need to be resolved before their possible clinical applications. As a result, fetal membranes have been suggested as an alternative source of SCs. In the human amniotic epithelium, the presence of markers of pluripotent SC´s has been reported, and its capacity as a feeder layer for expansion of different SC types. Also, fetal membranes are a discarded product after delivery, and thus there are not any ethical issues related to its use. In conclusion, the human amniotic epithelium can be a strong candidate for regenerative medicine.

  2. Improving SC-FDMA performance by Turbo Equalization in UTRA LTE Uplink

    DEFF Research Database (Denmark)

    Berardinelli, Gilberto; Priyanto, Basuki Endah; Sørensen, Troels Bundgaard;

    2008-01-01

    does not have stringent power constraints. In this paper, a turbo equalization technique to improve Single Carrier Frequency Division Multiple Access (SC-FDMA) performance is proposed. A new adaptive coefficients solution for frequency domain equalization is considered. The work is in the context...... that the turbo equalizer can improve the BLER performance around 1 dB with only a few iterations, and improve the SC-FDMA performance over OFDM, especially at high coding rate.......Turbo equalization is known as an advanced iterative equalization and decoding technique that allows to enhance the performance of the data transmission over a frequency selective fading channel. The turbo equalizer will result in extra receiver complexity, but isolated to the base-station, which...

  3. Effects of SC-560 in Combination with Cisplatin or Taxol on Angiogenesis in Human Ovarian Cancer Xenografts

    Directory of Open Access Journals (Sweden)

    Wei Li

    2014-10-01

    Full Text Available This study was designed to evaluate the effect of cyclooxygenase-1 (COX-1 inhibitor, SC-560, combined with cisplatin or taxol, on angiogenesis in human ovarian cancer xenografts. Mice were treated with intraperitoneal (i.p. injections of SC-560 6 mg/kg/day, i.p. injections of cisplatin 3 mg/kg every other day and i.p. injections of taxol 20 mg/kg once a week for 21 days. Vascular endothelial growth factor (VEGF mRNA levels were detected by reverse transcription-polymerase chain reaction (RT-PCR; microvessel density (MVD was determined by immunohistochemistry; and prostaglandin E2 (PGE2 levels were determined using ELISA. Expression levels of VEGF mRNA and MVD in treatment groups were inhibited significantly when compared with the control group (p < 0.05 for all, and SC-560 combined with cisplatin displayed a greater reduction in the expression of VEGF and MVD than SC-560 or cisplatin alone (p < 0.05. SC-560 combined with taxol showed a greater inhibition on VEGF mRNA expression than SC-560 or taxol alone (p < 0.05. The level of PGE2 in treatment groups was significantly reduced when compared with the control group (p < 0.01 for all. These findings may indicate that cisplatin or taxol supplemented by SC-560 in human ovarian cancer xenografts enhances the inhibition effect of cisplatin or taxol alone on angiogenesis.

  4. Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids

    Science.gov (United States)

    Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V.; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; żyła, Gaweł

    2016-08-01

    The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.

  5. Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids.

    Science.gov (United States)

    Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; Żyła, Gaweł

    2016-12-01

    The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.

  6. Production Potential of 47Sc Using Spallation Neutron Flux at the Los Alamos Isotope Production Facility

    Science.gov (United States)

    2014-03-27

    Ohio DISTRIBUTION STATEMENT A APPROVED FOR PUBLIC RELEASE; DISTRIBUTION UNLIMITED The views expressed in this document are those of the author and do...targets at the Los Alamos National Laboratory ( LANL ) Isotope Production Facility (IPF). Targets were activated for 1 hr using an average proton beam...for 47SC production is the unique neutron flux that results from this unique beam/target structure [8]. 1.3 Summary The remainder of this document is

  7. Three-phase-boundary dynamics at the Ni/ScYSZ interface

    DEFF Research Database (Denmark)

    Schmidt, Michael Stenbæk; Hansen, Karin Vels; Norrman, Kion;

    2009-01-01

    Chronoamperometry using a three-electrode cell configuration was undertaken with a nickel point-electrode acting as the working electrode on a polished ScYSZ electrolyte in a hydrogen atmosphere at 750–850 °C. High anodic overpotentials resulted in the occurrence of distinct sawtooth oscillation...... of the current oscillations. A mechanism accounting for the observed phenomena and possible implications for solid oxide fuel cell operation are presented...

  8. Puzzling γ-ray strength functions in 44,45Sc and 50,51V

    Science.gov (United States)

    Larsen, A. C.; Guttormsen, M.; Chankova, R.; Ingebretsen, F.; Lönnroth, T.; Messelt, S.; Rekstad, J.; Schiller, A.; Siem, S.; Syed, N. U. H.; Voinov, A.

    2008-05-01

    The nuclear physics group at the Oslo Cyclotron Laboratory (OCL) has developed a method to extract nuclear level density and γ-ray strength function simultaneously from primary γ-ray spectra. The resulting γ-ray strength functions of 44,45Sc and 50,51V show an unexpected, large enhancement at low γ-ray energies, indicating an increased probability of emitting low-energy γ rays in the quasi-continuum.

  9. Sickle Cell Disease: quality of life in patients with hemoglobin SS and SC disorders

    OpenAIRE

    2013-01-01

    OBJECTIVE Sickle cell disease comprises chronic, genetically determined disorders, presenting significant morbidity and high prevalence in Brazil. The goal of this study was to evaluate the quality of life of sickle cell disease patients (hemoglobin SS and SC) and their sociodemographic and clinical characteristics. METHODS Data was collected from clinical records and semi-structured interviews consisting of clinical questionnaires and the World Health Organization Quality of Life-brief qu...

  10. Fatal pulmonary thromboembolism associated with hemoglobin SC disease in a 15 year-old boy

    Directory of Open Access Journals (Sweden)

    Thiago Trolez Amancio

    2011-09-01

    Full Text Available We report a case of hemoglobin SC disease complicated by fatal pulmonarythromboembolism in a 15 year-old Brazilian boy, submitted to autopsy. Thiscase shows the importance of early diagnosis and treatment of sickle celldisease, which generates systemic involvement in youth and the importanceof considering the hypercoagulability in these patients. The autopsy was veryinstructive, revealing the florid morphologic aspect of sickle cell disease andits complications.

  11. Precise Determination of 40Ti Mass by Measuring the 40Sc Isospin Analogue State

    Institute of Scientific and Technical Information of China (English)

    LIU Wei-Ping(柳卫平); E. Roeckl; M. Pfützner; L. Chulkov; A. Piechaczek; R. Raabe; I. Reusen; G. Vancraeynest; A. Wohr; M. Hellstrom2; R. Collatz; J. Benlliure; D. Cortina Gil; F. Farget; H. Grawe; Z. Hu; N. Iwasa

    2001-01-01

    The mass of 40 Ti has been determined by using the isobaric multiplet mass equation method. The experimental data of the 40Tiβ-decay were used to determine the level of the isospin analogue state of 40Sc. The ground-state mass excess and the QEc value for 40 Ti were determined to be -9060 ± 12 keV and 11 466 ± 13keV, respectively.

  12. PrP(Sc) detection and infectivity in semen from scrapie-infected sheep.

    Science.gov (United States)

    Rubenstein, Richard; Bulgin, Marie S; Chang, Binggong; Sorensen-Melson, Sharon; Petersen, Robert B; LaFauci, Giuseppe

    2012-06-01

    A scrapie-positive ewe was found in a flock that had been scrapie-free for 13 years, but housed adjacent to scrapie-positive animals, separated by a wire fence. Live animal testing of the entire flock of 24 animals revealed seven more subclinical scrapie-positive ewes. We hypothesized that they may have contracted the disease from scrapie-positive rams used for breeding 4 months prior, possibly through the semen. The genotypes of the ewe flock were highly scrapie-susceptible and the rams were infected with the 'Caine' scrapie strain having a short incubation time of 4.3-14.6 months in sheep with 136/171 VQ/VQ and AQ/VQ genotypes. PrP(Sc) accumulates in a variety of tissues in addition to the central nervous system. Although transmission of prion diseases, or transmissible spongiform encephalopathies, has been achieved via peripheral organ or tissue homogenates as well as by blood transfusion, neither infectivity nor PrP(Sc) have been found in semen from scrapie-infected animals. Using serial protein misfolding cyclic amplification followed by a surround optical fibre immunoassay, we demonstrate that semen from rams infected with a short-incubation-time scrapie strain contains prion disease-associated-seeding activity that generated PrP(Sc) in sPMCA (serial protein misfolding cyclic amplification). Injection of the ovinized transgenic mouse line TgSShpPrP with semen from scrapie-infected sheep resulted in PrP(Sc)-seeding activity in clinical and, probably as a result of the low titre, non-clinical mouse brain. These results suggest that the transmissible agent, or at least the seeding activity, for sheep scrapie is present in semen. This may be a strain-specific phenomenon.

  13. Structural and Controllable Thermal Expansion Properties of Sc2-xAlxMo3O12

    Institute of Scientific and Technical Information of China (English)

    WU; Mei-mei; CHEN; Dong-feng

    2013-01-01

    Materials with controllable thermal expansion are the subject of fundamental studies because of the important applications in high-precision optical mirrors,fiber optic systems,and electronic materials.Samples Sc2-xAlxMo3O12(x=0.0,0.3,0.7,1.0,1.3,1.7,and 2.0)were prepared by the solid-state reaction,

  14. Thermodynamic modeling of the RE–Pb (RE = Sc, Dy, Gd) systems

    Energy Technology Data Exchange (ETDEWEB)

    Iddaoudi, A., E-mail: iddaoudi19@gmail.com [Laboratoire de Thermodynamique et Energétique, LTE, Université Ibn-Zohr, B.P. 8106 Agadir (Morocco); Servant, C., E-mail: colette.servant@orange.fr [Laboratoire de Physicochimie de l’Etat Solide, ICMMO, Université Paris-Sud, 91405 Orsay Cedex (France); Selhaoui, N.; Kardellass, S.; Mahdouk, K.; Bouirden, L. [Laboratoire de Thermodynamique et Energétique, LTE, Université Ibn-Zohr, B.P. 8106 Agadir (Morocco)

    2014-03-15

    Highlights: • Rare earth (RE) and Pb alloys or compounds are interesting as magnetic materials. • The phase diagrams and thermodynamic properties of RE–Pb (RE = Sc, Dy, Gd) systems have been assessed. • The CALPHAD method was used with the Redlich–Kister model to optimize the solution phases. • A self-consistent set of thermodynamic parameters has been evaluated. • A good agreement was found between the calculation and experiments. -- Abstract: The phase diagrams and thermodynamic properties of RE–Pb (RE = Sc, Dy, Gd) systems have been assessed by means of the CALPHAD method. The solution phases (liquid, fcc, bcc and hcp) were described by the sublattice formalism and the excess term of the Gibbs energy with the Redlich–Kister equation. The stoichiometric intermetallic compounds (Sc{sub 5}Pb{sub 3}, Sc{sub 6}Pb{sub 5}, Dy{sub 5}Pb{sub 4}, DyPb, DyPb{sub 2}, DyPb{sub 3}, β-Gd{sub 5}Pb{sub 4}, α-Gd{sub 5}Pb{sub 4}, Gd{sub 11}Pb{sub 10}, Gd{sub 6}Pb{sub 7}, GdPb{sub 2} and GdPb{sub 2}) were modeled as line compounds. The non-stoichiometric Dy{sub 5}Pb{sub 3} and Gd{sub 5}Pb{sub 3} phases with a narrow homogeneity range were modeled using a two-sublattice model with substitution. A consistent set of the thermodynamic parameters leading to a reasonable agreement between the calculated results and literature data was obtained.

  15. Peak effect of flux pinning in Sc5Ir4Si10 superconductors

    Science.gov (United States)

    Sun, Y.; Shi, Z. X.; Gu, D. M.; Miura, M.; Tamegai, T.

    2010-10-01

    Magnetic hysteresis loops (MHLs) have been comparatively measured on both textured and single crystalline Sc5Ir4Si10 superconductors. Critical current densities and flux pinning forces are calculated from MHLs by Bean model. Three kinds of peaks of the flux pinning force are found at low fields near zero, intermediated fields, and high fields near the upper critical field, respectively. The characters and origins of these peaks are studied in detail.

  16. Inoculation with Metal-Mobilizing Plant-Growth-Promoting Rhizobacterium Bacillus sp. SC2b and Its Role in Rhizoremediation.

    Science.gov (United States)

    Ma, Ying; Oliveira, Rui S; Wu, Longhua; Luo, Yongming; Rajkumar, Mani; Rocha, Inês; Freitas, Helena

    2015-01-01

    A plant growth-promoting bacterial (PGPB) strain SC2b was isolated from the rhizosphere of Sedum plumbizincicola grown in lead (Pb)/zinc (Zn) mine soils and characterized as Bacillus sp. based on (1) morphological and biochemical characteristics and (2) partial 16S ribosomal DNA sequencing analysis. Strain SC2b exhibited high levels of resistance to cadmium (Cd) (300 mg/L), Zn (730 mg/L), and Pb (1400 mg/L). This strain also showed various plant growth-promoting (PGP) features such as utilization of 1-aminocyclopropane-1-carboxylate, solubilization of phosphate, and production of indole-3-acetic acid and siderophore. The strain mobilized high concentration of heavy metals from soils and exhibited different biosorption capacity toward the tested metal ions. Strain SC2b was further assessed for PGP activity by phytagar assay with a model plant Brassica napus. Inoculation of SC2b increased the biomass and vigor index of B. napus. Considering such potential, a pot experiment was conducted to assess the effects of inoculating the metal-resistant PGPB SC2b on growth and uptake of Cd, Zn and Pb by S. plumbizincicola in metal-contaminated agricultural soils. Inoculation with SC2b elevated the shoot and root biomass and leaf chlorophyll content of S. plumbizincicola. Similarly, plants inoculated with SC2b demonstrated markedly higher Cd and Zn accumulation in the root and shoot system, indicating that SC2b enhanced Cd and Zn uptake by S. plumbizincicola through metal mobilization or plant-microbial mediated changes in chemical or biological soil properties. Data demonstrated that the PGPB Bacillus sp. SC2b might serve as a future biofertilizer and an effective metal mobilizing bioinoculant for rhizoremediation of metal polluted soils.

  17. Inhibition of the signal transduction through the AtoSC system by histidine kinase inhibitors in Escherichia coli.

    Science.gov (United States)

    Theodorou, Evaggelos C; Theodorou, Marina C; Kyriakidis, Dimitrios A

    2011-08-01

    AtoSC two-component system participates in many indispensable processes of Escherichia coli. We report here that the AtoSC signal transduction is inhibited by established histidine kinase inhibitors. Closantel, RWJ-49815 and TNP-ATP belonging to different chemical classes of inhibitors, abrogated the in vitro AtoS kinase autophosphorylation. However, when AtoS was embedded in the membrane fractions, higher inhibitor concentrations were required for total inhibition. When AtoS interacted with AtoC forming complex, the intrinsic histidine kinase was protected by the response regulator, requiring increased inhibitors concentrations for partially AtoS autophosphorylation reduction. The inhibitors exerted an additional function on AtoSC, blocking the phosphotransfer from AtoS to AtoC, without however, affecting AtoC~P dephosphorylation. Their in vivo consequences through the AtoSC inhibition were elucidated on atoDAEB operon expression, which was inhibited only in AtoSC-expressing bacteria where AtoSC was induced by acetoacetate or spermidine. The inhibitor effects were extended on the AtoSC regulatory role on cPHB [complexed poly-(R)-3-hydroxybutyrate] biosynthesis. cPHB was decreased upon the blockers only in acetoacetate-induced AtoSC-expressing cells. Increased ATP amounts during bacterial growth reversed the inhibitory TNP-ATP-mediated effect on cPHB. The alteration of pivotal E. coli processes as an outcome of AtoSC inhibition, establish this system as a target of two-component systems inhibitors.

  18. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa3

    Science.gov (United States)

    Parvin, F.; Hossain, M. A.; Ali, M. S.; Islam, A. K. M. A.

    2015-01-01

    The rare occurrence of type-I superconductivity in binary system ScGa3 has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ~13 eV and thus ScGa3 can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa3 are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0-1000 K and 0-40 GPa, respectively. The calculated electron-phonon coupling constant λ=0.52 yields Tc=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg-Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  19. Cereal crops as viable production and storage systems for pharmaceutical scFv antibodies.

    Science.gov (United States)

    Stöger, E; Vaquero, C; Torres, E; Sack, M; Nicholson, L; Drossard, J; Williams, S; Keen, D; Perrin, Y; Christou, P; Fischer, R

    2000-03-01

    This report describes the stable expression of a medically important antibody in the staple cereal crops rice and wheat. We successfully expressed a single-chain Fv antibody (ScFvT84.66) against carcinoembryonic antigen (CEA), a well characterized tumor-associated marker antigen. scFv constructs were engineered for recombinant antibody targeting to the plant cell apoplast and ER. Up to 30 microg/g of functional recombinant antibody was detected in the leaves and seeds of wheat and rice. We confirmed that transgenic dry seeds could be stored for at least five months at room temperature, without significant loss of the amount or activity of scFvT84.66. Our results represent the first transition from model plant expression systems, such as tobacco and Arabidopsis, to widely cultivated cereal crops, such as rice and wheat, for expression of an antibody molecule that has already shown efficacy in clinical applications. Thus, we have established that molecular pharming in cereals can be a viable production system for such high-value pharmaceutical macromolecules. Our findings provide a strong foundation for exploiting alternative uses of cereal crops both in industrialized and developing countries.

  20. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Parvin, F. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Hossain, M.A. [Department of Physics, Mawlana Bhashani Science and Technology University, Santosh, Tangail 1902 (Bangladesh); Ali, M.S. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Islam, A.K.M.A., E-mail: azi46@ru.ac.bd [International Islamic University Chittagong, 154/A College Road, Chittagong 4203 (Bangladesh)

    2015-01-15

    The rare occurrence of type-I superconductivity in binary system ScGa{sub 3} has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ∼13 eV and thus ScGa{sub 3} can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa{sub 3} are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0–1000 K and 0–40 GPa, respectively. The calculated electron–phonon coupling constant λ=0.52 yields T{sub c}=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg–Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  1. Acute Sickle Hepatic Crisis after Liver Transplantation in a Patient with Hb SC Disease

    Directory of Open Access Journals (Sweden)

    J. H. Gillis

    2015-01-01

    Full Text Available Acute sickle hepatic crisis (ASHC has been observed in approximately 10% of patients with sickle cell disease. It occurs predominantly in patients with homozygous (Hb SS sickle cell anemia and to a lesser degree in patients with Hb SC disease, sickle cell trait, and Hb S beta thalassemia. Patients commonly present with jaundice, right upper quadrant pain, nausea, low-grade fever, tender hepatomegaly, and mild to moderate elevations in serum AST, ALT, and bilirubin. We describe the case of a patient with a history of hemoglobin SC disease and cirrhosis caused by hepatitis C presenting approximately 1 year after liver transplantation with an ASHC. The diagnosis was confirmed by liver biopsy. Our patient was treated with RBC exchange transfusions, IV hydration, and analgesia and made a complete recovery. Only a limited number of patients with sickle cell disease have received liver transplants, and, to our knowledge, this is the first case of ASHC after transplantation in a patient with Hb SC disease.

  2. Structural and magnetic properties of Ti12M clusters (M=Sc to Zn)

    Science.gov (United States)

    Sun, Houqian; Xu, Ning

    2016-12-01

    The geometries, electronic, and magnetic properties of the 3d atom doped icosahedron (ICO) Ti12M (M=Sc to Zn), where a dopant atom replaces either the centra l(Ti12Mc) or surface (Ti12Ms) Ti atom in ICO Ti13 cluster, have been systematically investigated by using the density functional theory. The structures of all the optimized Ti12Mc and Ti12Ms clusters are distorted ICO. Sc, Ni, Cu, and Zn atoms prefer to displace surface Ti atom, V, Cr, Mn, and Fe atoms prefer to displace central Ti atom. The position of impurity atom depends on the strength of the interaction between the central atom and the surface atoms. As compared to the pure Ti13 cluster, Ti12Mc and Ti12Ms (M=V, Fe, Co, and Ni) clusters are more stable, Ti12Mc and Ti12Ms (M=Sc, Cr, Mn, Cu, and Zn) are less stable. Both Ti12Nis and Ti12Nic are magic clusters, which originate from their electronic as well as geometric closed shells. Because the exchange interaction prevails over the crystal field in Ti12M clusters, the valence electrons fill molecular orbitals in terms of Hund's rule of maximum spin.

  3. Cloning, expression, purification, and characterization of LC-1 ScFv with GFP tag

    Institute of Scientific and Technical Information of China (English)

    LU Min; GONG Xing-guo; YU Hong; LI Jian-yong

    2005-01-01

    Total RNA was isolated from the hybridoma cell line (LC-1), which secretes anti-lung adenocarcinoma monoclonal antibody, and was transferred into cDNA. Based on the FR1 (framework region 1) and FR4 conserved regions of LC-I gene, the variable regions of heavy chain (Vh) and light chain (Vl) were amplified, and the Vh and modified Vl were connected to single chain Fv (ScFv) by SOE-PCR (splice overlap extension PCR). The modified ScFv was fused with green fluorescent protein (GFP)and introduced into E. coli JMi09. The fusion protein induced by IPTG (Isopropylthiogalactoside) was about 57000 on a 10%SDS-PAGE gel (10% Sds Polyacrylamide Gel Electrophoresis), and primarily manifested as inclusion bodies. The renatured protein purified by Ni-NTA Superflow resins showed ability to bind to antigen on SPC-A-1 lung adenocarcinoma. In addition, the induced host cells fluoresced bright green under 395 nm wavelength, which indicated that the expected protein with dual activity was expressed in the prokaryotic system. The ScFv with GFP tag used in this research can be applied as a new reagent to detect immunological dye, and provide a feasible way to detect adenocarcinoma in a clinical setting.

  4. EMP Attachment 3 DOE-SC PNNL Site Dose Assessment Guidance

    Energy Technology Data Exchange (ETDEWEB)

    Snyder, Sandra F.

    2011-12-21

    This Dose Assessment Guidance (DAG) describes methods to use to determine the Maximally-Exposed Individual (MEI) location and to estimate dose impact to that individual under the U.S. Department of Energy Office of Science (DOE-SC) Pacific Northwest National Laboratory (PNNL) Site Environmental Monitoring Plan (EMP). This guidance applies to public dose from radioactive material releases to the air from PNNL Site operations. This document is an attachment to the Pacific Northwest National Laboratory (PNNL) Environmental Monitoring Plan (EMP) and describes dose assessment guidance for radiological air emissions. The impact of radiological air emissions from the U.S. Department of Energy Office of Science (DOE-SC) PNNL Site is indicated by dose estimates to a maximally exposed member of the public, referred to as the maximally exposed individual (MEI). Reporting requirements associated with dose to members of the public from radiological air emissions are in 40 CFR Part 61.94, WAC 246-247-080, and DOE Order 458.1. The DOE Order and state standards for dose from radioactive air emissions are consistent with U.S. Environmental Protection Agency (EPA) dose standards in 40 CFR 61.92 (i.e., 10 mrem/yr to a MEI). Despite the fact that the current Contract Requirements Document (CRD) for the DOE-SC PNNL Site operations does not include the requirement to meet DOE CRD 458.1, paragraph 2.b, public dose limits, the DOE dose limits would be met when EPA limits are met.

  5. Doping of BiScO3-PbTiO3 Ceramics for Enhanced Properties

    Science.gov (United States)

    Sehirlioglu, Alp; Sayir, Ali; Dynys, Fred

    2008-01-01

    High-temperature piezoelectrics are a key technology for aeronautics and aerospace applications such as fuel modulation to increase the engine efficiency and decrease emissions. The principal challenge for the insertion of piezoelectric materials is the limitation on upper use temperature which is due to low Curie-Temperature (T(sub c) and increasing electrical conductivity. BiScO3 -PbTiO3 (BS-PT) system is a promising candidate for improving the operating temperature for piezoelectric actuators due to its high TC (>400 C). Effects of Zr and Mn doping of the BS-PT ceramics have been studied and all electrical and electromechanical properties for Sc-deficient and Ti-deficient BS- PT ceramics are reported as a function of electrical field and temperature. Donor doping with Zr and Mn (in Sc deficient compositions) increased the DC-resistivity and decreased tan at all temperatures. Resulting ceramics exhibited saturated hysteresis loops with low losses and showed no dependence on the applied field (above twice the coercive field) and measurement frequency.

  6. FPA Tuned Fuzzy Logic Controlled Synchronous Buck Converter for a Wave/SC Energy System

    Directory of Open Access Journals (Sweden)

    SAHIN, E.

    2017-02-01

    Full Text Available This paper presents a flower pollination algorithm (FPA tuned fuzzy logic controlled (FLC synchronous buck converter (SBC for an integrated wave/ supercapacitor (SC hybrid energy system. In order to compensate the irregular wave effects on electrical side of the wave energy converter (WEC, a SC unit charged by solar panels is connected in parallel to the WEC system and a SBC is controlled to provide more reliable and stable voltage to the DC load. In order to test the performance of the designed FLC, a classical proportional-integral-derivative (PID controller is also employed. Both of the controllers are optimized by FPA which is a pretty new optimization algorithm and a well-known optimization algorithm of which particle swarm optimization (PSO to minimize the integral of time weighted absolute error (ITAE performance index. Also, the other error-based objective functions are considered. The entire energy system and controllers are developed in Matlab/Simulink and realized experimentally. Real time applications are done through DS1104 Controller Board. The simulation and experimental results show that FPA tuned fuzzy logic controller provides lower value performance indices than conventional PID controller by reducing output voltage sags and swells of the wave/SC energy system.

  7. A self-consistent determination of the RVB and SC gaps in the YRZ ansatz

    Science.gov (United States)

    Rao, Zi-Ye; Wang, Xiao-Min; Jiang, Hong-Min

    2017-03-01

    A correct understanding of the origin of the pseudogap in high temperature (high-T c) cuprate superconductors is considered to be a peripheral breakthrough in the understanding of the microscopic mechanism of the high-T c superconductivity. Yang-Rice-Zhang (YRZ) ansatz is an important phenomenological theory to describe the phenomenon of pseudogap. However, in the framework of YRZ, the pseudogap (resonant valence bond (RVB) gap) and the superconducting (SC) gap are unable to have a self-consistent determination at different doping concentrations, and this severely limits the application of the YRZ ansatz. Based on the YRZ ansatz, this study develops a technical method to determine the RVB and SC gaps in a self-consistent manner. It is revealed that the self-consistent calculations of the doping dependence of RVB, SC gaps and spectral function are not only consistent with the empirical gap formula in the YRZ framework, but also consistent with the doping evolution of the Fermi surface observed in the angle-resolved photoemission spectroscopy (ARPES) experiments. Our method will greatly extend the applications of the YRZ ansatz, and will deepen our understanding of the origin of pseudogap as well as the mechanism of high-T c superconductivity.

  8. Spectroscopic characterization of Yb:Sc2O3 transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    Lu Shen-Zhou; Yang Qiu-Hong

    2012-01-01

    Yb:Sc2O3 transparent ceramics are fabricated by a conventional ceramic process and sintering in H2 atmosphere.The room-temperature spectroscopic properties are investigated,and the Raman spectrum shows an obvious vibration characteristic band centred at 415 cm-1. There are three broad absorption bands around 891,937,and 971 nm,respectively.The strongest emission peak is centred at 1.04 μm with a broad bandwidth (11 nm) and an emission cross-section of 1.8× 10-20 cm2.The gain coefficient implies a possible laser ability in a range from 990 nm to 1425 nm.The energy-level structure shows that Yb:Sc2O3 ceramics have large Stark splitting at the ground state level due to their strong crystal field.All the results show that Yb:Sc2Oa transparent ceramics are a promising material for short pulse lasers.

  9. Synthesis and Reaction of [MnRe(CO)6(μ-SH)(μ-SC(H)PPri3)(PPh3)

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The synthesis, the crystal structure and the reaction of the hetero-binuclear complex [MnRe(CO)6(μ-SH)(μ-SC(H)PPri3)(PPh3)] are reported. The results of single crystal X-ray structure analysis showed that the fragments Mn(CO)3 and Re(CO)3 were bridged by SH and SC(H)PPri3. The title complexes can react with BunLi and RX forming complexes MnRe(CO)6(μ-SR)(μ-SC(H)PPri3)(PPh3) (R = Me, CH2CH=CH2, SnBu3n).

  10. Genome Sequencing of Bacillus subtilis SC-8, Antagonistic to the Bacillus cereus Group, Isolated from Traditional Korean Fermented-Soybean Food

    Science.gov (United States)

    Yeo, In-Cheol; Lee, Nam Keun

    2012-01-01

    Bacillus subtilis SC-8 is a Gram-positive bacterium displaying narrow antagonistic activity for the Bacillus cereus group. B. subtilis SC-8 was isolated from Korean traditional fermented-soybean food. Here we report the draft genome sequence of B. subtilis SC-8, including biosynthetic genes for antibiotics that may have beneficial effects for control of food-borne pathogens. PMID:22207744

  11. The FERRUM Project: experimental and theoretical transition rates of forbidden [Sc II] lines and radiative lifetimes of metastable Sc II levels

    CERN Document Server

    Hartman, H; Lundin, P; Schef, P; Hibbert, A; Lundberg, H; Mannervik, S; Norlin, L -O; Royen, P

    2008-01-01

    Context. In many plasmas, long-lived metastable atomic levels are depopulated by collisions (quenched) before they decay radiatively. In low-density regions, however, the low collision rate may allow depopulation by electric dipole (E1) forbidden radiative transitions, so-called forbidden lines (mainly M1 and E2 transitions). If the atomic transition data are known, these lines are indicators of physical plasma conditions and used for abundance determination. Aims. Transition rates can be derived by combining relative intensities between the decay channels, so-called branching fractions (BFs), and the radiative lifetime of the common upper level. We use this approach for forbidden [Sc ii] lines, along with new calculations. Methods. Neither BFs for forbidden lines, nor lifetimes of metastable levels, are easily measured in a laboratory. Therefore, astrophysical BFs measured in Space Telescope Imaging Spectrograph (STIS) spectra of the strontium filament of Eta Carinae are combined with lifetime measurements u...

  12. Interaction in (Ti,Sc)Fe{sub 2}-H{sub 2} and (Zr,Sc)Fe{sub 2}-H{sub 2} systems

    Energy Technology Data Exchange (ETDEWEB)

    Zotov, T.; Movlaev, E. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation); Mitrokhin, S. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation)], E-mail: Mitrokhin@hydride.chem.msu.ru; Verbetsky, V. [Chemistry Department, Lomonosov Moscow State University, Lenin Hill, 119992 Moscow (Russian Federation)

    2008-07-14

    Results of investigation of hydrogen sorption properties of Ti(Zr){sub x}Sc{sub 1-x}Fe{sub 2} (x = 1, 0.8 and 0.5) alloys are presented. The measurements were performed for pressures up to 3000 atm. In case of titanium alloys hydride formation was established only for x = 0.5. Estimated equilibrium absorption pressure for x = 0.8 and 1.0 was too high for experimental limits of the device. In case of zirconium alloys hydride formation was found for all three concentrations. Absorption-desorption isotherms were measured for the first time for ZrFe{sub 2}-H{sub 2} system. Calculated enthalpy of hydrogen desorption was found to be 21.3 kJ/mole H{sub 2}.

  13. Structural characterization and biological activities of SC4,an acidic polysaccharide from Salvia chinensis%石见穿酸性多糖SC4的结构特征和生物活性

    Institute of Scientific and Technical Information of China (English)

    刘翠平; 方积年; 李晓玉; 萧晓秋

    2002-01-01

    AIM:To study the chemical characterization and some biological activities of an acidic polysaccharide,named SC4 from Salvia chinensis.METHODS:Chemical and spectral methods were employed to identify the structural characterization of SC4.Effect of SC4 on the proliferation of T- and B-lymphocytes both in vivo and in vitro was measured at various concentrations,and the protective effects of SC4 on PC12 cells against H2O2-induced injury was observed.RESULTS:SC4 was a highly branched polysaccharide with mean molecular weight of 4.5 × 105,composed of Rha,Xyl,Set,Gal,and GalA in the molar ratio of 1.0:7.0:5.3:1.2:4.2.Methylation analysis and NMR identified the linkages of the residues of SC4.SC4 increased the B-lymphocyte proliferation and spleen weight remarkably while no obvious changes were examined in T-lymphocyte proliferation,thymus weight,and the level of IgG and C3 in blood of mice.Moreover,SC4 enhanced the PC12 cells viability after H2O2 treatment.CONCLU-SION:SC4,the acidic polysaccharide with complicated structure,was a B-lymphocyte stimulator and protected PC12 cells at the concentration of 20 mg/L against H2O2-induced injury.%目的:研究从石见穿(Salvia chinensis)中得到的酸性多糖SC4的化学结构和生物活性.方法:利用化学和光谱方法分析了SC4的结构特征,并观察了SC4对淋巴细胞增殖的影响以及增强PC12细胞对抗H2O2造成的损伤的作用.结果:SC4的分子量为4.5×105,由Rha,Xyl,Ser,Gal和GalA组成,摩尔比为1.0:7.0:5.3:1.2:4.2.甲基化和13C NMR进一步确定了SC4中各糖残基的连接方式.SC4能显著促进B淋巴细胞的增殖,增加小鼠脾重,增强PC12细胞对抗H2O2造成的氧化损伤的能力.结论:SC4为一多分枝的酸性多糖,其免疫活性的靶细胞为B淋巴细胞,并显著增强PC12细胞对抗H2O2造成的损伤的能力.

  14. b172sc.m77t - MGD77 data file for Geophysical data from field activity B-1-72-SC in Central California from 11/11/1972 to 11/15/1972

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetics data along with transit satellite navigation data was collected as part of field activity B-1-72-SC in Central...

  15. Design of IGBT driver based on 2SC0108T%基于2SC0108T的IGBT驱动器设计

    Institute of Scientific and Technical Information of China (English)

    白娅梅; 李钰玺; 张亚军

    2011-01-01

    针对IGBT驱动电路复杂且保护功能不尽完善的问题,设计了一个基于2SC0108T的即插即用型IGBT驱动器,以及相应的前级驱动电路、后级功率驱动电路和故障报警电路.该驱动器具有直接模式和半桥模式、驱动信号硬件互锁、硬件死区时间可调节、IGBT过流及短路保护、驱动电源过欠压监控和易于安装的特点.结合英飞凌EconoDUAL3封装IGBT模块,完成了即插即用型IGBT驱动器的硬件设计及调试,有效减小了双绞线传输方式寄生电容及寄生电感的影响.%Aiming at the problems of IGBT drive circuity complexity and indequate protection, a plug-and-play IGBT driver is designed based on the 2SC0108T, and the primary side and secondary side drive circuitry and failure alarm circuitry are designed. Two modes including direct mode and half-bridge mode are available. Drive signals are interlocked by hardware and the dead time is adjustable. It possesses the functions of over-current and short-circuit protection, low-voltage and over-voltage monitoring as well as easily Installation. Based on the EconoDUAL3 IGBT module, the hardware of the plug-and-play driver is designed and the functions are tested. It effectively reduces the impact of parasitic inductance and capacitance exists in the twisted pair transmission.

  16. IEC SC 32B Low-voltage fuses strategic business plan (SBP)%IEC SC 32B低压熔断器战略业务方案(SBP)

    Institute of Scientific and Technical Information of China (English)

    吴庆云; 季慧玉

    2010-01-01

    分析了低压熔断器的市场需求和技术趋势,介绍了IEC SC 32B低压熔断器分技术委员会的SC 32B战略业务方案(SBP),包括系统联络情况、目标和战略、行动方案及与IEC网站的有效链接.

  17. Effects of micro-alloying with Sc and Mn on microstructure and mechanical properties of Al-Mg based alloys

    Institute of Scientific and Technical Information of China (English)

    CHEN Xian-ming; LUO Cheng-ping; PAN Qing-lin; YIN Zhi-ming

    2005-01-01

    An extensive investigation was made on the effects of micro-alloying with small amounts of Sc and Mn on the microstructure and mechanical properties of the Al-Mg based alloys. It is found that the micro-alloying can significantly enhance the tensile strength of the alloys, and eliminate the dendritic cast structure in it. Many fine,spherical and dispersive Al3Sc particles are found in the annealed Al-Mg-Mn-Sc alloys, which can strongly pin up dislocations and subgrain boundaries, thus strongly retarding the recrystallization of the alloys. The strengthening of the micro-alloyed Al-Mg alloys is attributed to the precipitation strengthening by the Al3Sc particles and to the substructure strengthening.

  18. Effects of substituting ytterbium for scandium on the microstructure and age-hardening behaviour of Al–Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Tuan, N.Q., E-mail: quoctuan1884@gmail.com [CT2M – Centre for Mechanical and Materials Technologies, University of Minho, Azurém, 4800-058 Guimarães (Portugal); Pinto, A.M.P.; Puga, H. [CT2M – Centre for Mechanical and Materials Technologies, University of Minho, Azurém, 4800-058 Guimarães (Portugal); Rocha, L.A. [CT2M – Centre for Mechanical and Materials Technologies, University of Minho, Azurém, 4800-058 Guimarães (Portugal); Universidade Estadual Paulista (Unesp), Faculdade de Ciências de Bauru, SP 17033-360 (Brazil); Barbosa, J. [CT2M – Centre for Mechanical and Materials Technologies, University of Minho, Azurém, 4800-058 Guimarães (Portugal)

    2014-04-01

    In order to reduce the cost of Al–Sc alloys and maintain their mechanical properties, the microstructure and mechanical properties of Al–0.24 wt% Sc–0.07 wt% Yb in comparison with Al–0.28 wt% Sc alloys were studied. The aging behaviour, precipitate morphologies, precipitate coarsening and precipitation hardening of both alloys were investigated. The average diameter and the size distribution of nanoscale Al{sub 3}Sc and Al{sub 3}(Sc,Yb) precipitates at various aging conditions were measured. Transmission electron microscopy (TEM) and high-resolution TEM were used to deeply understand the precipitate evolution. A maximum hardness around 73 (HV{sub 30}) was obtained with a precipitate diameter from 4.3 to 5.6 nm for both alloys.

  19. Over-Expression of ScMnSOD, a SOD Gene Derived from Jojoba, Improve Drought Tolerance in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    LIU Xiao-fei; ZHANG Gen-fa; SUN Wei-min; LI Ze-qin; BAI Rui-xue; LI Jing-xiao; SHI Zi-han; GENG Hong-wei; ZHENG Ying; ZHANG Jun

    2013-01-01

    Jojoba (Simmondsia chinensis) is mainly distributed in desert, and the molecular mechanisms of jojoba in response to abiotic stress still remain elusive. In this paper, we cloned and characterized a SOD gene from jojoba named as ScMnSOD, and introduced into Arabidopsis to investigate its functions of responding to drought stress. The transgenic Arabidopsis showed an improvement in drought tolerance. Moreover, under a water deifcit condition, the accumulation of reactive oxygen species (ROS) was remarkably decreased in the transgenic lines compared to the WT. Furthermore, the ScMnSOD promoter was cloned to the 5´-upstream of GUS coding region in a binary vector, and introduced into Arabidopsis. And results showed that ScMnSOD expression can be induced by drought, salt, ABA, and low temperature. In conclusion, ScMnSOD plays an important role in drought tolerance which is, at least partially, attributed to its role in ROS detoxiifcation.

  20. Effect of Sc and Zr on the in-plane anisotropy of Al-Mg-Mn alloy sheets

    Institute of Scientific and Technical Information of China (English)

    PENG Yongyi; YIN Zhimin; YANG Jin; DU Yuxuan

    2005-01-01

    The Al-Mg-Mn alloy sheets with and without trace Sc and Zr were investigated by means of tensile test, X-ray diffraction, optical microscope, and transmission electron microscope. The indexes of in-plane anisotropy (IIPA) of their tensile mechanical properties were calculated and their inverse pole figures were obtained by Harris method. The two alloy sheets have the same law of in-plane anisotropy and remarkable in-plane anisotropy of mechanical properties, and the IIPA of the alloy sheet with Sc and Zr is bigger than that of the alloy sheet without Sc and Zr. The relationships of the in-plane anisotropy and the anisotropy of the crystallographic texture were analyzed based on the model of monocrystal. It is the common action of the anisotropy of crystallography and microstructures that causes the in-plane anisotropy of their mechanical sotropy of the alloy sheet containing trace Sc and Zr.

  1. ETV TEST REPORT OF MOBILE SOURCE EMISSIONS CONTROL DEVICES: LUBRIZOL ENGINE CONTROL SYSTEMS PURIFILTER SC17L

    Science.gov (United States)

    The Environmental Technology Verification report discusses the technology and performance of the Lubrizol Engine Control Systems Purifilter SC17L manufactured by Lubrizol Engine Control Systems. The technology is a precious and base metal, passively regenerated particulate filter...

  2. Effects of Sc and Y substitution on the structure and thermoelectric properties of Yb14MnSb11

    Science.gov (United States)

    Grebenkemper, Jason H.; Klemenz, Sebastian; Albert, Barbara; Bux, Sabah K.; Kauzlarich, Susan M.

    2016-10-01

    Yb14MnSb11 is the most efficient bulk p-type thermoelectric material for high temperature applications. Materials with Y and Sc substitutions in Yb14MnSb11 were made both in Sn-flux and by ball milling. These small 3+ rare earth (RE) cations were introduced with the goal of providing chemical pressure on the structure. The RE3+ cation is smaller than Yb2+ and also donates one additional electron to this p-type semiconductor. In Yb14-xRExMnSb11 (RE = Sc, Y) the maximum x was about 0.5. X-ray diffraction experiments on the single crystals obtained from Sn-flux showed that Sc preferentially substitutes for Yb(1) and Yb(3), and decreases the size of the unit cell by about 0.3%. Y substitutes on all Yb sites and increases the size of the unit cell by about 0.2%. Samples with Yb14-xRExMnSb11 (x~0.3) were prepared via powder metallurgy and spark plasma sintering for transport and thermal conductivity measurements. Electron microprobe of the Sc-substituted sample showed small regions (≤1 μ m) containing greater amounts of Sc, and X-ray powder diffraction of the ball milled Sc sample could be fitted as phase pure Yb14-xScxMnSb11. Y-substituted samples showed larger regions of excess Y in electron microprobe, and small amounts of Yb4Sb3 in X-ray powder diffraction. The Sc sample has slightly reduced carrier concentration over optimized Yb14MnSb11, while the Y samples have even lower carrier concentrations. These carrier concentrations lead to comparable resistivity to Yb14MnSb11 in the Sc-substituted material, and higher resistivities in the Y-substituted material. All materials had similar Seebeck coefficients that slightly exceed Yb14MnSb11 at high temperatures, with the Sc-substituted sample having the highest despite having a higher carrier concentration. Sc-substituted samples also had a slightly higher thermal conductivity over the Y-substituted samples, which had comparable thermal conductivity to Yb14MnSb11. The zT values of the Sc and Y substituted samples are

  3. In vivo production of scFv-displaying biopolymer beads using a self-assembly-promoting fusion partner.

    Science.gov (United States)

    Grage, Katrin; Rehm, Bernd H A

    2008-01-01

    Recombinant production and, in particular, immobilization of antibody fragments onto carrier materials are of high interest with regard to diagnostic and therapeutic applications. In this study, the recombinant production of scFv-displaying biopolymer beads intracellularly in Escherichia coli was investigated. An anti-beta-galactosidase scFv (single chain variable fragment of an antibody) was C-terminally tagged with the polymer-synthesizing enzyme PhaC from Cupriavidus necator by generating the respective hybrid gene. The functionality of the anti-beta-galactosidase scFv-PhaC fusion protein was assessed by producing the respective soluble fusion protein in an Escherichia coli AMEF mutant strain. AMEF (antibody-mediated enzyme formation) strains contain an inactive mutant beta-galactosidase, which can be activated by binding of an anti-beta-galactosidase antibody. In vivo activation of AMEF beta-galactosidase indicated that the scFv is functional with the C-terminal fusion partner PhaC. It was further demonstrated that polymer biosynthesis and bead formation were mediated by the scFv-PhaC fusion protein in the cytoplasm of recombinant E. coli when the polymer precursor was metabolically provided. This suggested that the C-terminal fusion partner PhaC acts as a functional insolubility partner, providing a natural cross-link to the bead and leading to in vivo immobilization of the scFv. Overproduction of the fusion protein at the polymer bead surface was confirmed by SDS-PAGE and MALDI-TOF/MS analysis of purified beads. Antigen binding functionality and specificity of the beads was assessed by analyzing the binding of beta-galactosidase to scFv-displaying beads and subsequently eluting the bound protein at pH 2.7. A strong enrichment of beta-galactosidase suggested the functional display of scFv at the bead surface as well as the applicability of these beads for antigen purification. Binding of beta-galactosidase to the scFv-displaying beads was quantitatively

  4. Moments Of Microdiversity EGC Receivers And Macrodiversity SC Receiver Output Signal Over Gamma Shadowed Nakagami-m Multipath Fading Channel

    Science.gov (United States)

    Djordjević, Nebojša; Jaksić, Branimir S.; Matović, Ana; Matović, Marija; Smilić, Marko

    2015-11-01

    A system with macrodiversity selection combining (SC) receiver and for microdiversity equal gain combining (EGC) receivers is considered. Received signal is subjected, simultaneously to multipath fading and shadowing, resulting in signal envelope and signal power variation. Closed form expressions for moments of macrodiversity SC receiver output signal envelope are calculated. Numerical expressions are plotted to present the influences of Gamma shadowing severity and Nakagami-m severity on moments of proposed system output signal.

  5. Synthesis, microstructural characterization and optical properties of undoped, V and Sc doped ZnO thin films

    Energy Technology Data Exchange (ETDEWEB)

    Amezaga-Madrid, P.; Antunez-Flores, W.; Ledezma-Sillas, J.E.; Murillo-Ramirez, J.G.; Solis-Canto, O.; Vega-Becerra, O.E.; Martinez-Sanchez, R. [Centro de Investigacion en Materiales Avanzados S.C. and Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Chihuahua, Chih., C.P. 31109 (Mexico); Miki-Yoshida, M., E-mail: mario.miki@cimav.edu.mx [Centro de Investigacion en Materiales Avanzados S.C. and Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Chihuahua, Chih., C.P. 31109 (Mexico)

    2011-06-15

    Research highlights: > Undoped, V and Sc doped ZnO thin films by Aerosol Assisted Chemical Vapour Deposition. > Optimum substrate temperatures of 673 K and 623 K for Sc and V doped films. > Around one third of the dopants in solution were deposited into the films. > Crystallite and grain size decreased with the increase of dopant concentration. > Optical band gap increased from 3.29 to 3.32 eV for undoped to 7 Sc/Zn at. %. - Abstract: Many semiconductor oxides (ZnO, TiO{sub 2}, SnO{sub 2}) when doped with a low percentage of non-magnetic (V, Sc) or magnetic 3d (Co, Mn, Ni, Fe) cation behave ferromagnetically. They have attracted a great deal of interest due to the integration of semiconducting and magnetic properties in a material. ZnO is one of the most promising materials to carry out these tasks in view of the fact that it is optically transparent and has n or p type conductivity. Here, we report the synthesis, microstructural characterization and optical properties of undoped, V and Sc doped zinc oxide thin films. ZnO based thin films with additions of V and Sc were deposited by the Aerosol Assisted Chemical Vapour Deposition method. V and Sc were incorporated separately in the precursor solution. The films were uniform, transparent and non-light scattering. The microstructure of the films was characterized by Grazing Incidence X-ray Diffraction, Scanning Electron Microscopy, and Scanning Probe Microscopy. Average grain size and surface rms roughness were estimated by the measurement of Atomic Force Microscopy. The microstructure of doped ZnO thin films depended on the type and amount of dopant material incorporated. The optical properties were determined from specular reflectance and transmittance spectra. Results were analyzed to determine the optical constant and band gap of the films. An increase in the optical band gap with the content of Sc dopant was obtained.

  6. Bullying prevention in schools by targeting cognitions, emotions, and behavior: Evaluating the effectiveness of the REBE-ViSC program.

    Science.gov (United States)

    Trip, Simona; Bora, Carmen; Sipos-Gug, Sebastian; Tocai, Ioana; Gradinger, Petra; Yanagida, Takuya; Strohmeier, Dagmar

    2015-10-01

    The effectiveness of a class-based antibullying prevention program on cognitions, emotions, and behaviors was investigated. The program consists of a cognitive-behavioral (Rational Emotive Behavioral Education; REBE) and a behavioral (Viennese Social Competence; ViSC) component. The REBE program is based on rational emotive behavioral theory and contains 9 student lessons. The ViSC program is based on social learning theory and comprises 10 student lessons. The order of the programs was experimentally manipulated. The REBE-ViSC program was implemented in 5 schools (14 classes), the ViSC-REBE program was implemented in 3 schools (9 classes), and 3 schools (11 classes) served as an untreated control group. Data were collected during 1 school year at pretest, midpoint, and posttest. Emotions (overt and internalizing anger), cognitions (learning and entitlement), and behaviors (bullying perpetration and bullying victimization) were measured with self-assessments. To examine the effectiveness of the REBE-ViSC/ViSC-REBE program, multilevel growth models were applied (time points at Level 1, individuals at Level 2, and classes at Level 3). The analyses revealed that the program effects differed depending on the order of the programs. The REBE-ViSC condition was more effective in changing negative emotions than the ViSC-REBE condition; both experimental conditions were effective in reducing dysfunctional cognitions, whereas no behavioral change was found in the 2 experimental groups when compared with the control group. To improve program effectiveness regarding behavioral changes, a multilevel whole-school approach including a teacher component is recommended.

  7. K2SC: flexible systematics correction and detrending of K2 light curves using Gaussian process regression

    Science.gov (United States)

    Aigrain, S.; Parviainen, H.; Pope, B. J. S.

    2016-07-01

    We present K2SC (K2 Systematics Correction), a PYTHON pipeline to model instrumental systematics and astrophysical variability in light curves from the K2 mission. K2SC uses Gaussian Process regression to model position-dependent systematics and time-dependent variability simultaneously, enabling the user to remove both (e.g. for transit searches) or to remove systematics while preserving variability (for variability studies). For periodic variables, K2SC automatically computes estimates of the period, amplitude and evolution time-scale of the variability. We apply K2SC to publicly available K2 data from Campaigns 3-5 showing that we obtain photometric precision approaching that of the original Kepler mission. We compare our results to other publicly available K2 pipelines, showing that we obtain similar or better results, on average. We use transit injection and recovery tests to evaluate the impact of K2SC on planetary transit searches in K2 Pre-search Data Conditioning data, for planet-to-star radius ratios down to Rp/R* = 0.01 and periods up to P = 40 d, and show that K2SC significantly improves the ability to distinguish between true and false detections, particularly for small planets. K2SC can be run automatically on many light curves, or manually tailored for specific objects such as pulsating stars or large amplitude eclipsing binaries. It can be run on ASCII and FITS light-curve files, regardless of their origin. Both the code and the processed light curves are publicly available, and we provide instructions for downloading and using them. The methodology used by K2SC will be applicable to future transit search missions such as TESS and PLATO.

  8. Ab Initio Calculations and Synthesis of Sc2InC-Y2InC Solid Solution

    Science.gov (United States)

    2010-02-03

    tribological materials. It will study a solid solution of this fascinating new class of nanolaminated materials using both theoretical and experimental means...Sc2InC-Y2InC solid solution using ab initio calculations and 2) to synthesize Sc2InC-Y2InC thin films using magnetron sputtering and to determine the correlation between composition, structure, and mechanical properties thereof.

  9. Pregnancy in Sickle Cell-Haemoglobin C (SC) Disease, A Retrospective Study of Birth Size and Maternal Weight Gain

    Science.gov (United States)

    Thame, Minerva M.; Singh-Minott, Indira; Osmond, Clive; Melbourne-Chambers, Roxanne H.; Serjeant, Graham R

    2017-01-01

    Objective To assess pregnancy and fetal outcomes in Jamaican subjects with sickle cell-haemoglobin C (SC) disease. Study Design A retrospective chart review over 21 years (1992-2012) of all pregnancies in SC disease and a comparison group matched by gender and date of delivery in mothers with a normal haemoglobin (AA) phenotype at the University Hospital of the West Indies, Jamaica. There were 118 pregnancies in 81 patients with SC disease and 110 pregnancies in 110 in the normal comparison group. Corrections were made for repeat pregnancies from the same mother. Outcome measures included maternal weight at 20, 25, 30, 35 and 38 weeks gestation, maternal pregnancy complications, birth weight, head circumference and crown heel length and were used to analyse possible predictors of birth weight. Results First antenatal visits occurred later in women with SC disease, who also had lower haemoglobin level and lower systolic blood pressure. The prevalence of pregnancy-induced hypertension, pre-eclampsia, ante-partum or postpartum haemorrhage did not differ between genotypes. Maternal weight gain was significantly lower in SC disease and there was a significantly lower birth weight, head circumference, and gestational age. Conclusions Pregnancy in SC disease is generally benign but mothers had lower weight gain and lower birth weight babies, the difference persisting after correction for gestational age. PMID:27235631

  10. Origin and dissemination of the pollen-part mutated SC haplotype which confers self-compatibility in apricot (Prunus armeniaca).

    Science.gov (United States)

    Halász, Júlia; Pedryc, Andrzej; Hegedus, Attila

    2007-01-01

    In China, its centre of origin, apricot (Prunus armeniaca) is self-incompatible. However, most European cultivars are self-compatible. In most cases, self-compatibility is a result of a loss-of-function mutation within the pollen gene (SFB) in the SC haplotype. Controlled pollinations performed in this work revealed that the cross 'Ceglédi óriás' (S8S9)x'Ceglédi arany' (SCS9) set well, as expected, but the reciprocal cross did not. Apricot S8, S9 and SC haplotypes were analysed using a multilevel approach including fruit set evaluation, pollen tube growth analysis, RNase activity assays, polymerase chain reaction (PCR) analysis and DNA sequencing of the S-RNase and SFB alleles. SFB8 was revealed to be the first known progenitor allele of a naturally occurring self-compatibility allele in Prunus, and consequently SC=The first intron of SC-RNase is a phase one intron, indicating its more recent evolutionary origin compared with the second intron. Sequence analysis of different cultivars revealed that more single nucleotide polymorphisms accumulated in SC-RNase than in SFBC. New methods were designed to allow high-throughput analysis of S genotypes of apricot cultivars and selections. S-RNase sequence data from various sources helped to elucidate the putative origin and dissemination of self-compatibility in apricot conferred by the SC haplotype.

  11. Lanthanide-doped Na xScF 3+ x nanocrystals: Crystal structure evolution and multicolor tuning

    KAUST Repository

    Teng, Xue

    2012-05-23

    Rare-earth-based nanomaterials have recently drawn considerable attention because of their unique energy upconversion (UC) capabilities. However, studies of Sc 3+-based nanomaterials are still absent. Herein we report the synthesis and fine control of Na xScF 3+x nanocrystals by tuning of the ratio of oleic acid (OA, polar surfactant) to 1-octadecene (OD, nonpolar solvent). When the OA:OD ratio was increased from low (3:17) to high (3:7), the nanocrystals changed from pure monoclinic phase (Na 3ScF 6) to pure hexagonal phase (NaScF 4) via a transition stage at an intermediate OA:OD ratio (3:9) where a mixture of nanocrystals in monoclinic and hexagonal phases was obtained and the coexistence of the two phases inside individual nanocrystals was also observed. More significantly, because of the small radius of Sc 3+, Na xScF 3+x:Yb/Er nanocrystals show different UC emission from that of NaYF 4:Yb/Er nanocrystals, which broadens the applications of rare-earth-based nanomaterials ranging from optical communications to disease diagnosis. © 2012 American Chemical Society.

  12. Chemical Chaperones Increasing Expression Level of Soluble Single-chain Fv Antibody(scFv2F3)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Glutathione peroxidase (GPX) is a selenoenzyme that protects the biomembrane and other cellular components against oxidative damage. The selenium-containing single chain Fv fragment of monoclonal antibody 2F3 (SescFv2F3 ) is a kind of GPX mimic and it has a wide clinical applications because of its high activity and low antigenicity. Se-scFv2F3 is generated by the chemical modification of the single chain Fy fragment of monoclonal antibody 2F3 ( scFv2F3 ), which can be expressed in E. coli. In this article, the effect of chemical chaperones, such as glycerol, glucose, and β-cyclodextrin added to the culture medium, on the expression of soluble scFv2F3 was investigated. The expression level was evaluated by the determination of soluble scFv2F3 contents in the whole cell lysates.The results suggest that both glycerol and β-cyclodextrin greatly increase the expression level of soluble scFv2F3, and β-cyclodextrin is found to be more effective compared with glycerol. Glucose has a slight effect on the expression level of soluble scFv2F3. This is the first example, wherein β-cyclodextrin has been used as a chemical chaperone during the cell culture to improve the expression level of recombinant proteins. In addition, chemical chaperones are found to decrease the toxic effect of IPTG on cells.

  13. Effects of minor Sc on the microstructure and mechanical properties of Al-Zn-Mg-Cu-Zr based alloys

    Institute of Scientific and Technical Information of China (English)

    LI Wenbin; PAN Qinglin; Zou Liang; LIANG Wenjie; HE Yunbin; LIU Junsheng

    2009-01-01

    Five kinds of Al-Zn-Mg-Cu-Zr based alloys with different Sc additions were prepared by ingot metallurgy. The effects of minor Sc on the microstructure and mechanical properties of Al-Zn-Mg-Cu-Zr based alloys were investigated using tensile tests, optical microscopy (OM), and transmission electron microscopy (TEM). The results show that the ultimate tensile strength and yield strength are improved by 94 and 110 Mpa, respectively, and the elongation to failure remains at a reasonable extent (11.1%) in the Al-Zn-Mg-Cu-Zr based alloy with 0.21 wt.% Sc addition after solution heat treatment at 475℃ for 40 min and then aged at 120℃ for 24 h. The addition of minor Sc induces the formation of Al3(Sc,Zr) particles, which are highly effective in refining the cast microstructures, retarding recrystallization, and pinning dislocations. The increment of strength is attributed mainly to fine grain strengthening, precipitation strengthening of Al3(Sc,Zr) particles, and substructure strengthening.

  14. Separation of cyclotron-produced 44Sc from a natural calcium target using a dipentyl pentylphosphonate functionalized extraction resin

    Science.gov (United States)

    Valdovinos, H.F.; Hernandez, R.; Barnhart, T.E.; Graves, S.; Cai, W.; Nickles, R.J.

    2014-01-01

    Significant interest in 44Sc as a radioactive synthon to label small molecules for positron emission tomography (PET) imaging has been recently observed. Despite the efforts of several research groups, the ideal 44Sc production and separation method remains elusive. Herein, we propose a novel separation method to obtain 44Sc from the proton irradiation of calcium targets based on extraction chromatography, which promises to greatly simplify current production methodologies. Using the commercially available Uranium and Tetravalent Actinides (UTEVA) extraction resin we were able to rapidly ( 80% of the activity generated at end of bombardment (EoB) in small ~1 M HCl fractions (400 μL). The chemical purity of the 44Sc eluates was evaluated through chelation with DOTA and DTPA, and by trace metal analysis using microwave induced plasma atomic emission spectrometry. The distribution coefficients (Kd) of Sc(III) and Ca(II) in UTEVA were determined in HCl medium in a range of concentrations from zero to 12.1 M The 44Sc obtained with our method proved to be suitable for the direct labeling of small biomolecules for PET imaging, with excellent specific activities and radiochemical purity. PMID:25464172

  15. Mechanical Properties and Microstructure of TIG and FSW Joints of a New Al-Mg-Mn-Sc-Zr Alloy

    Science.gov (United States)

    Xu, Guofu; Qian, Jian; Xiao, Dan; Deng, Ying; Lu, Liying; Yin, Zhimin

    2016-04-01

    A new Al-5.8%Mg-0.4%Mn-0.25%Sc-0.10%Zr (wt.%) alloy was successfully welded by tungsten inert gas (TIG) and friction stir welding (FSW) techniques, respectively. The mechanical properties and microstructure of the welded joints were investigated by microhardness measurements, tensile tests, and microscopy methods. The results show that the ultimate tensile strength, yield strength, and elongation to failure are 358, 234 MPa, and 27.6% for TIG welded joint, and 376, 245 MPa and 31.9% for FSW joint, respectively, showing high strength and superior ductility. The TIG welded joint fails in the heat-affected zone and the fracture of FSW joint is located in stirred zone. Al-Mg-Mn-Sc-Zr alloy is characterized by lots of dislocation tangles and secondary coherent Al3(Sc,Zr) particles. The superior mechanical properties of the TIG and FSW joints are mainly derived from the Orowan strengthening and grain boundary strengthening caused by secondary coherent Al3(Sc,Zr) nano-particles (20-40 nm). For new Al-Mg-Mn-Sc-Zr alloy, the positive effect from secondary Al3(Sc, Zr) particles in the base metal can be better preserved in FSW joint than in TIG welded joint.

  16. ScVEGF-PEG-HBED-CC and scVEGF-PEG-NOTA conjugates: comparison of easy-to-label recombinant proteins for [{sup 68}Ga]PET imaging of VEGF receptors in angiogenic vasculature

    Energy Technology Data Exchange (ETDEWEB)

    Eder, Matthias [German Cancer Research Center (DKFZ), 69120 Heidelberg (Germany)], E-mail: m.eder@dkfz.de; Krivoshein, Arcadius V.; Backer, Marina; Backer, Joseph M. [SibTech, Inc., Brookfield, CT 06804 (United States); Haberkorn, Uwe [Department of Nuclear Medicine, University of Heidelberg, 69120 Heidelberg (Germany); Eisenhut, Michael [German Cancer Research Center (DKFZ), 69120 Heidelberg (Germany)

    2010-05-15

    Introduction: VEGF receptors play a key role in angiogenesis and are important targets for several approved and many experimental drugs. Imaging of VEGF receptor expression in malignant tumors would provide important information, which can influence patient management. The aim of this study was the development of an easy-to-label positron-emitting tracer for imaging VEGF receptors. The tracer is based on engineered single-chain VEGF (scVEGF), expressed with cysteine-containing fusion tag (Cys-tag) for site-specific conjugation of PEGylated bifunctional chelating agents, HBED-CC or NOTA, suitable for labeling with {sup 68}Ga at ambient temperature. Methods: scVEGF-PEG-HBED-CC was synthesized by activating a single carboxyl group of the [Fe(HBED-CC)]{sup -} complex with N-hydroxysuccinimide. Reaction of the activated complex with NH{sub 2}-PEG-maleimide was followed by site-specific conjugation of PEGylated chelator to a thiol group in Cys-tag of scVEGF. The scVEGF-PEG-NOTA conjugate was synthesized using NHS-PEG-maleimide and p-NH{sub 2}-Bn-NOTA. {sup 68}Ga complexation was performed in HEPES buffer (pH 4.2) at room temperature. The functional activity after labeling was tested by radioligand cell binding assays. Biodistribution and PET studies in tumor-bearing mice were performed after 1, 2, 3 and 4 h postinjection. Results: The radiolabeling of scVEGF-PEG-HBED-CC proved more efficient than scVEGF-PEG-NOTA allowing to stop the reaction after 4 min (>97% radiochemical yield). Radioligand cell binding assays performed on HEK-293 cells overexpressing VEGFR-2 revealed no change in the binding properties of {sup 68}Ga-radiolabeled scVEGF relative to other scVEGF-based tracers. Both tracers showed comparable results in biodistribution, such as tumor accumulation and low liver uptake. The tracers were stable in 50% human serum for at least 72 h. Conclusions: The conjugates scVEGF-PEG-HBED-CC and scVEGF-PEG-NOTA revealed comparable in vivo characteristics and allowed easy

  17. Selection of affinity-improved neutralizing human scFv against HBV PreS1 from CDR3 VH/VL mutant library.

    Science.gov (United States)

    Chen, YanMin; Bai, Yin; Guo, XiaoChen; Wang, WenFei; Zheng, Qi; Wang, FuXiang; Sun, Dejun; Li, DeShan; Ren, GuiPing; Yin, JieChao

    2016-07-01

    A CDR3 mutant library was constructed from a previously isolated anti-HBV neutralizing Homo sapiens scFv-31 template by random mutant primers PCR. Then the library was displayed on the inner membrane surface in Escherichia coli periplasmic space. Seven scFv clones were isolated from the mutant library through three rounds of screening by flow cytometry. Competition ELISA assay indicates that isolated scFv fragments show more efficient binding ability to HBV PreS1 compared with parental scFv-31. HBV neutralization assay indicated that two clones (scFv-3 and 59) show higher neutralizing activity by blocking the HBV infection to Chang liver cells. Our method provides a new strategy for rapid screening of mutant antibody library for affinity-enhanced scFv clones and the neutralizing scFvs obtained from this study provide a potential alternative of Hepatitis B immune globulin.

  18. Molecular dynamics study of ion capture from water by a model ionophore, tetraprotonated cryptand SC24

    Science.gov (United States)

    Owenson, Brian; Macelroy, Robert D.; Pohorille, Andrew

    1988-01-01

    The molecular dynamics of chloride capture from water by the tetraprotonated cryptand SC24 has been studied for the cases of 19 distances between the criptand and the chloride. The chloride capture is found to be characterized by a rapid cooperative change in the conformation of the cryptand when the Cl(-) begins to enter the ligand and just as it encounters the energy barrier. The conformational transition is associated with a shift of three N-H bonds from the pure endo orientation, such that they point toward the chloride.

  19. Bacillus cereus bacteremia and hemolytic anemia in a patient with hemoglobin SC disease.

    Science.gov (United States)

    Rodgers, G M; Barrera, E; Martin, R R

    1980-08-01

    A patient with hemoglobin SC disease and cholelithiasis was found to have Bacillus cereus bacteremia. Hemolytic anemia developed, for which common causes of hemolysis were excluded, suggesting a relationship with the bacteremia. Following in vitro incubation, type O erythrocytes were hemolyzed by the culture, but not by a bacteria-free filtrate. This case confirms the association between sickle cell disorders and cholelithiasis with B cereus infections. In addition, it provides evidence for in vivo hemolysis with B cereus bacteremia, an organism not previously associated with hemolytic anemia.

  20. Evaluation of Sc-Bearing Aluminum Alloy C557 for Aerospace Applications

    Science.gov (United States)

    Domack, Marcia S.; Dicus, Dennis L.

    2002-01-01

    The performance of the Al-Mg-Sc alloy C557 was evaluated to assess its potential for a broad range of aerospace applications, including airframe and launch vehicle structures. Of specific interest were mechanical properties at anticipated service temperatures and thermal stability of the alloy. Performance was compared with conventional airframe aluminum alloys and with other emerging aluminum alloys developed for specific service environments. Mechanical properties and metallurgical structure were evaluated for commercially rolled sheet in the as-received H116 condition and after thermal exposures at 107 C. Metallurgical analyses were performed to de.ne grain morphology and texture, strengthening precipitates, and to assess the effect of thermal exposure.

  1. Conversion of the dual training aircraft (DC into single control advanced training aircraft (SC. Part I

    Directory of Open Access Journals (Sweden)

    Ioan ŞTEFĂNESCU

    2011-03-01

    Full Text Available Converting the DC school jet aircraft into SC advanced training aircraft - and use them forthe combat training of military pilots from the operational units, has become a necessity due to thebudget cuts for Air Force, with direct implications on reducing the number of hours of flight assignedto operating personnel for preparing and training.The purpose of adopting such a program is to reduce the number of flight hours allocated annuallyfor preparing and training in advanced stages of instruction, for every pilot, by more intensive use ofthis type of aircraft, which has the advantage of lower flight hour costs as compared to a supersoniccombat plane.

  2. Proton and oxide ion conductivity of doped LaScO3

    DEFF Research Database (Denmark)

    Lybye, D.; Bonanos, N.

    1999-01-01

    The conductivity of La0.9Sr0.1Sc0.9Mg0.1O3 has been studied by impedance spectroscopy in controlled atmospheres. The material was found to be a mixed conductor with p-type conduction at high oxygen partial pressures and a combined proton and oxide ion conductor at low oxygen partial pressures....... At temperatures below 800 degrees C and low partial pressure of oxygen, proton conduction was dominant. Above this temperature, the ionic conductivity is dominated by oxide ion transport. The protonic transport number was estimated from the conductivities measured in dry and in water-moisturised gas. An isotope...

  3. Epidemiological profile of live births in the city of Chapecó-SC

    OpenAIRE

    Silva, Rodrigo Aguiar da; Ferraz, Lucimare; Busato,Maria Assunta

    2016-01-01

    This article presents the results of a study to investigate the epidemiological profile of birth in Chapecó/SC, from July 2011 to June 2013, based on the Sistema de Informações sobre Nascidos Vivos – Sinasc (Live Birth Information System – Sinasc, na sigla em português). It is a descriptive research, retrospective, of quantitative approach. From 5,918 live births, 9.2% were born weighing less than 2,500 g; 9.4% were premature children; 15.7% were babies born to adolescent mothers; and 20% of ...

  4. The [Fe/H] Dependence on the Ca {\\sc ii}-$M_V$ Relationship

    CERN Document Server

    Gomez, Thomas; Pancino, Elena

    2012-01-01

    We examined the Wilson-Bappu effect, a relationship between the absolute magnitude of the star, $M_V$, and the logarithm of the Ca {\\sc ii} emission width, $W_0$, over the largest $M_V$ range to date, +13 to -5, covering M-dwarfs to type Ia supergiants. We used an extensive literature, the latest Hipparcos reduction, data from two globular clusters, and new observations from Apache Point Observatory to compile a sample that allowed us to study the effect of [Fe/H] on the Wilson-Bappu relationship. Our results include reporting the deviations from linearity and demonstrating that the Wilson-Bappu relationship is insensitive to metallicity.

  5. Unnatural-parity states in {sup 44}{sub 21}Sc{sub 23}

    Energy Technology Data Exchange (ETDEWEB)

    Lach, M.; Styczen, J.; Meczynski, W.; Grebosz, J.; Maj, A.; Zieblinski, M. [Polish Academy of Sciences, Henryk Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Bednarczyk, P. [Polish Academy of Sciences, Henryk Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Gesellschaft fuer Schwerionen, Darmstadt (Germany); Bracco, A. [Universita degli Studi di Milano and INFN, Milano (Italy); Merdinger, J.C.; Schulz, N. [Institut de Recherches Subatomiques, Strasbourg (France); Smith, M.B.; Spohr, K.M. [University of Paisley, Paisley, Scotland (United Kingdom)

    2005-07-01

    High-spin states of the {sup 44}Sc nucleus, populated in the 68 MeV {sup 18}O+{sup 30}Si reaction, have been studied in a {gamma}-{gamma}-recoil coincidence experiment. The detailed decay pattern, with various paths and cross-transitions, has been extended up to 9.1 MeV. High-quality DCO and polarization information assign spins and parities for the majority of the observed levels. The negative-parity states are discussed and compared with rotational bands in neighbouring f{sub 7/2}-shell nuclei. (orig.)

  6. SC-FDE for MMF short reach optical interconnects using directly modulated 850 nm VCSELs.

    Science.gov (United States)

    Teichmann, Victor S C; Barreto, Andre N; Pham, Tien-Thang; Rodes, Roberto; Monroy, Idelfonso T; Mello, Darli A A

    2012-11-05

    We propose the use of single-carrier frequency-domain equalization (SC-FDE) for the compensation of modal dispersion in short distance optical links using multimode fibers and 850 nm VCSELs. By post-processing of experimental data, we demonstrate, at 7.9% overhead, the error-free transmission (over a 4 Mbit sequence) of OOK-modulated 5 Gbps over 2443 meters of OM3 fiber (with a nominal 3300 MHz×km bandwidth). The proposed solution may be applied as a low cost alternative for data center and supercomputer interconnects.

  7. A humanized anti-M2 scFv shows protective in vitro activity against influenza

    Energy Technology Data Exchange (ETDEWEB)

    Bradbury, Andrew M [Los Alamos National Laboratory; Velappan, Nileena [Los Alamos National Laboratory; Schmidt, Jurgen G [Los Alamos National Laboratory

    2008-01-01

    M2 is one of the most conserved influenza proteins, and has been widely prospected as a potential universal vaccine target, with protection predominantly mediated by antibodies. In this paper we describe the creation of a humanized single chain Fv from 14C2, a potent monoclonal antibody against M2. We show that the humanized scFv demonstrates similar activity to the parental mAb: it is able to recognize M2 in its native context on cell surfaces and is able to show protective in vitro activity against influenza, and so represents a potential lead antibody candidate for universal prophylactic or therapeutic intervention in influenza.

  8. Design of the plasma chamber and beam extraction system for SC ECRIS of RAON accelerator

    Science.gov (United States)

    Kim, Y.; Choi, S.; Hong, I. S.

    2014-02-01

    The RAON accelerator is the heavy ion accelerator being built in Korea. It contains a 3rd generation SC ECRIS which uses 28 GHz/18 GHz microwave power to extract 12 puA uranium ion beams. A plasma chamber for that ECRIS is made of aluminum machined from bulk Al. That chamber contains cooling channels to remove dumped power and another access port for microwave introduction and plasma diagnostics. Beam extraction electrodes were designed considering the engineering issues and preliminary beam extraction analysis was done. That plasma chamber will be assembled with a cryostat, and beam extraction experiment will be done.

  9. Development of cyclodextrin-hydrogel polymeric systems in scCO2 for drug delivery

    OpenAIRE

    Romão, Joana Isabel Sobral

    2011-01-01

    Thesis for the Degree of Master of Science in Bioorganic Universidade Nova de Lisboa, Faculdade de Ciências e Tecnologia This work describes the studies on the development of new cyclodextrin-hydrogel systems in supercritical carbon dioxide (scCO2) with potential application in drug delivery. Three β-cyclodextrin (CDs) derivatives were synthesized: 6-monoacryloyl-β-CD, 2-monoacryloyl-β-CD and 6-monoacryloly-heptakis-(2,3-di-O-benzyl)-β-CD. Their structures were assigned by nuclear magne...

  10. Comparison of renal allograft (AG) biopsy diagnosis and temporal quantitation of Tc-99m sulfur colloid (SC) in clinically suspected AG rejection

    Energy Technology Data Exchange (ETDEWEB)

    George, E.A.; Brown, W.N.; Carney, K.; Naidu, R.G.; Palmer, D.C.

    1984-01-01

    The purpose of this study was to evaluate the diagnostic efficacy of temporal quantitation of SC compared to tissue diagnosis of AG needle biopsy (Bx). The principal clinical criteria for patient selection were sequential or persistent reduction (at least 40-50%) of AG function as determined by serial serum creatinine levels. Thirty-four AG recipients were examined with SC and subsequent AG Bx in 37 instances. %SC AG accumulation and bone marrow extraction were interpreted in view of the significant sequential of persistent reduction of Ag function. Each AG Bx was collected from multiple needle aspirates and processed for light microscopy and immunoflorescent staining. Bx and SC exam were evaluated for acute rejection (AR), chronic rejection (CR) or other, non-rejection pathology. Acute tissue changes superimposed on chronic were regarded as AR. Acute tissue changes and % SC AG accumulation in the rejection range were graded as mild, moderate and marked. In AR there was 28/28 agreement of Bx and SC diagnosis; of which 7/28 were superimposed on CR. In Cr Bx and SC agreed in 3/7 instances, in 3/7 SC Dx was AR and in 1/7 SC exam was normal. Sensitivity and specificity of the SC diagnosis in this series was 100% and 63% for AR, 43% and 100% for CR and 97% and 100% in all instances of rejection. Bx and SC grading of AR agreed in 64%. In conclusion, temporal quantitation of SC demonstrated overall good correlation with AG Bx diagnosis in this series. The poor sensitivity of 43% of SC in Cr and only 64% correlation in grading AR may be due to inherent Bx sampling and SC data analysis error.

  11. The Development of a Recombinant scFv Monoclonal Antibody Targeting Canine CD20 for Use in Comparative Medicine.

    Directory of Open Access Journals (Sweden)

    Saurabh Jain

    Full Text Available Monoclonal antibodies are leading agents for therapeutic treatment of human diseases, but are limited in use by the paucity of clinically relevant models for validation. Sporadic canine tumours mimic the features of some human equivalents. Developing canine immunotherapeutics can be an approach for modeling human disease responses. Rituximab is a pioneering agent used to treat human hematological malignancies. Biologic mimics that target canine CD20 are just being developed by the biotechnology industry. Towards a comparative canine-human model system, we have developed a novel anti-CD20 monoclonal antibody (NCD1.2 that binds both human and canine CD20. NCD1.2 has a sub-nanomolar Kd as defined by an octet red binding assay. Using FACS, NCD1.2 binds to clinically derived canine cells including B-cells in peripheral blood and in different histotypes of B-cell lymphoma. Immunohistochemical staining of canine tissues indicates that the NCD1.2 binds to membrane localized cells in Diffuse Large B-cell lymphoma, Marginal Zone Lymphoma, and other canine B-cell lymphomas. We cloned the heavy and light chains of NCD1.2 from hybridomas to determine whether active scaffolds can be acquired as future biologics tools. The VH and VL genes from the hybridomas were cloned using degenerate primers and packaged as single chains (scFv into a phage-display library. Surprisingly, we identified two scFv (scFv-3 and scFv-7 isolated from the hybridoma with bioactivity towards CD20. The two scFv had identical VH genes but different VL genes and identical CDR3s, indicating that at least two light chain mRNAs are encoded by NCD1.2 hybridoma cells. Both scFv-3 and scFv-7 were cloned into mammalian vectors for secretion in CHO cells and the antibodies were bioactive towards recombinant CD20 protein or peptide. The scFv-3 and scFv-7 were cloned into an ADEPT-CPG2 bioconjugate vector where bioactivity was retained when expressed in bacterial systems. These data identify a

  12. The Development of a Recombinant scFv Monoclonal Antibody Targeting Canine CD20 for Use in Comparative Medicine.

    Science.gov (United States)

    Jain, Saurabh; Aresu, Luca; Comazzi, Stefano; Shi, Jianguo; Worrall, Erin; Clayton, John; Humphries, William; Hemmington, Sandra; Davis, Paul; Murray, Euan; Limeneh, Asmare A; Ball, Kathryn; Ruckova, Eva; Muller, Petr; Vojtesek, Borek; Fahraeus, Robin; Argyle, David; Hupp, Ted R

    2016-01-01

    Monoclonal antibodies are leading agents for therapeutic treatment of human diseases, but are limited in use by the paucity of clinically relevant models for validation. Sporadic canine tumours mimic the features of some human equivalents. Developing canine immunotherapeutics can be an approach for modeling human disease responses. Rituximab is a pioneering agent used to treat human hematological malignancies. Biologic mimics that target canine CD20 are just being developed by the biotechnology industry. Towards a comparative canine-human model system, we have developed a novel anti-CD20 monoclonal antibody (NCD1.2) that binds both human and canine CD20. NCD1.2 has a sub-nanomolar Kd as defined by an octet red binding assay. Using FACS, NCD1.2 binds to clinically derived canine cells including B-cells in peripheral blood and in different histotypes of B-cell lymphoma. Immunohistochemical staining of canine tissues indicates that the NCD1.2 binds to membrane localized cells in Diffuse Large B-cell lymphoma, Marginal Zone Lymphoma, and other canine B-cell lymphomas. We cloned the heavy and light chains of NCD1.2 from hybridomas to determine whether active scaffolds can be acquired as future biologics tools. The VH and VL genes from the hybridomas were cloned using degenerate primers and packaged as single chains (scFv) into a phage-display library. Surprisingly, we identified two scFv (scFv-3 and scFv-7) isolated from the hybridoma with bioactivity towards CD20. The two scFv had identical VH genes but different VL genes and identical CDR3s, indicating that at least two light chain mRNAs are encoded by NCD1.2 hybridoma cells. Both scFv-3 and scFv-7 were cloned into mammalian vectors for secretion in CHO cells and the antibodies were bioactive towards recombinant CD20 protein or peptide. The scFv-3 and scFv-7 were cloned into an ADEPT-CPG2 bioconjugate vector where bioactivity was retained when expressed in bacterial systems. These data identify a recombinant anti-CD20

  13. Single crystal CrN/ScN superlattice soft X-ray mirrors: Epitaxial growth, structure, and properties

    Energy Technology Data Exchange (ETDEWEB)

    Birch, J. [Department of Physics, IFM, Linkoeping University, SE-581 83 Linkoeping (Sweden); Joelsson, T. [Department of Physics, IFM, Linkoeping University, SE-581 83 Linkoeping (Sweden); Eriksson, F. [Department of Physics, IFM, Linkoeping University, SE-581 83 Linkoeping (Sweden)]. E-mail: freer@ifm.liu.se; Ghafoor, N. [Department of Physics, IFM, Linkoeping University, SE-581 83 Linkoeping (Sweden); Hultman, L. [Department of Physics, IFM, Linkoeping University, SE-581 83 Linkoeping (Sweden)

    2006-08-30

    Single crystal CrN/ScN superlattice films with modulation periods of 1.64 nm were grown on MgO(001) substrates. By utilizing a magnetically enhanced plasma in the vicinity of the substrate and a negative substrate bias, ion/metal nitride flux ratios of 45 and 144 were achieved during deposition of CrN and ScN, respectively. The effects of ion energies in the range [16-58 eV] and substrate temperatures in the range [535-853 deg. C] on the composition, interface width, crystal quality, and microstructure evolution were investigated using elastic recoil detection analysis, hard X-ray reflectivity, X-ray diffraction, and transmission electron microscopy (TEM). Minimal interface widths of 0.2 nm = 1/2 nitride unit cell were achieved at a growth temperature of 735 deg. C and ion energies of 24 and 28 eV for CrN and ScN, respectively. Under these conditions, also an optimum in the crystal quality was observed for near stoichiometric composition of CrN and ScN. TEM confirmed a cube-on-cube epitaxial relationship for the system with CrN(001) ScN(001) MgO(001) and CrN[100] ScN[100] MgO[100]. Also, the layers were coherently strained to each other with no misfit dislocations, threading dislocations, surface cusps, voids or gas bubbles present. Higher ion energies or lower deposition temperatures gave over-stoichiometric films with poor superlattice modulation while higher growth temperatures yielded a decreased crystal quality, due to loss of N. As-deposited superlattices with only 61 periods exhibited an absolute soft X-ray reflectance of 6.95% at an energy of 398.8 eV (Sc 2p-absorption edge) which is comparable to the performance of Cr/Sc. The compositional modulation and phase structure was stable during extended annealing at 850 deg. C, which is the highest thermal stability for an X-ray multilayer mirror. It is concluded that the ScN layers serve as effective diffusion barriers to hinder decomposition of the CrN layers and stabilize the pseudomorphic superlattice

  14. Issues associated with the metalorganic chemical vapor deposition of ScGaN and YGaN alloys.

    Energy Technology Data Exchange (ETDEWEB)

    Koleske, Daniel David; Knapp, James Arthur; Lee, Stephen Roger; Crawford, Mary Hagerott; Creighton, James Randall; Cross, Karen Charlene; Thaler, Gerald

    2009-07-01

    The most energy efficient solid state white light source will likely be a combination of individually efficient red, green, and blue LED. For any multi-color approach to be successful the efficiency of deep green LEDs must be significantly improved. While traditional approaches to improve InGaN materials have yielded incremental success, we proposed a novel approach using group IIIA and IIIB nitride semiconductors to produce efficient green and high wavelength LEDs. To obtain longer wavelength LEDs in the nitrides, we attempted to combine scandium (Sc) and yttrium (Y) with gallium (Ga) to produce ScGaN and YGaN for the quantum well (QW) active regions. Based on linear extrapolation of the proposed bandgaps of ScN (2.15 eV), YN (0.8 eV) and GaN (3.4 eV), we expected that LEDs could be fabricated from the UV (410 nm) to the IR (1600 nm), and therefore cover all visible wavelengths. The growth of these novel alloys potentially provided several advantages over the more traditional InGaN QW regions including: higher growth temperatures more compatible with GaN growth, closer lattice matching to GaN, and reduced phase separation than is commonly observed in InGaN growth. One drawback to using ScGaN and YGaN films as the active regions in LEDs is that little research has been conducted on their growth, specifically, are there metalorganic precursors that are suitable for growth, are the bandgaps direct or indirect, can the materials be grown directly on GaN with a minimal defect formation, as well as other issues related to growth. The major impediment to the growth of ScGaN and YGaN alloys was the low volatility of metalorganic precursors. Despite this impediment some progress was made in incorporation of Sc and Y into GaN which is detailed in this report. Primarily, we were able to incorporate up to 5 x 10{sup 18} cm{sup -3} Y atoms into a GaN film, which are far below the alloy concentrations needed to evaluate the YGaN optical properties. After a no-cost extension was

  15. Cloning and sequence analysis of promoter in sugarcane ethylene receptor gene (Sc-ERS)%甘蔗乙烯受体Sc-ERS启动子的克隆与序列分析

    Institute of Scientific and Technical Information of China (English)

    黄静丽; 牛俊奇; 朱惠; 杨丽涛; 李杨瑞; 王爱勤

    2013-01-01

    [目的]克隆甘蔗乙烯受体Sc-ERS基因启动子序列,分析Sc-ERS基因启动子序列的作用元件.[方法]采用基于热不对称交错式PCR原理的染色体步移技术,从甘蔗ROC22基因组DNA中克隆Sc-ERS基因启动子序列,利用启动子预测软件PlantCARE和PLACE在线工具对Sc-ERS启动子序列的作用元件进行预测.[结果]克隆获得Sc-ERS启动子序列1410 bp,该序列与玉米ERS25、ERS14核苷酸同源性分别为82%和80%.PlantCARE在线分析结果表明,该序列具有启动子基本作用元件TATA-BOX和CAAT-BOX,还含有参与光响应元件、干旱诱导MYB结合位点、茉莉酸甲酯响应元件、水杨酸响应元件、胚乳表达顺式调控元件、热胁迫响应元件等.[结论]从甘蔗基因组DNA中克隆获得乙烯受体Sc-ERS基因上游1410 bp的启动子序列,该序列含有多个特异性调控元件,推测Sc-ERS基因的表达可能受生理周期、激素、干旱、光照等因素调控.%[Objective]The present study was conducted to clone the promoter sequence of sugarcane ethylene receptor (Sc-ERS) and analyze its acting elements.[Method]Sc-ERS promoter sequence was cloned from the genomic DNA of sugarcane cultivar ROC22 with chromosome walking technology based on thermal asymmetric interlaced PCR principle,and the acting elements of Sc-ERS were analyzed with PlantCARE and PLACE online tools.[Result]The gene promoter sequence of Sc-ERS was cloned,and it was 1410 bp in size sharing 82% and 80% homology with the sequences of ERS25 and ERS14 of corn,respectively.PlantCARE online analysis results showed that the gene promoter sequence of Sc-ERS had promoter acting elements TATA-BOX and CAAT-BOX,light-responsive elements,drought-induced MYB binding sites,methyl jasmonateresponsive element,salicylic acid response element,endosperm expression cis-regulatory elements,heat stress responsive elements and so on.[Conclusion]A 1410 bp promoter sequence of Sc-ERS was cloned from sugarcane

  16. Development of single chain variable fragment (scFv) antibodies against surface proteins of 'Ca. Liberibacter asiaticus'.

    Science.gov (United States)

    Yuan, Qing; Jordan, Ramon; Brlansky, Ronald H; Minenkova, Olga; Hartung, John

    2016-03-01

    'Candidatus Liberibacter asiaticus' is the causal agent of citrus huanglongbing, the most serious disease of citrus worldwide. We have developed and applied immunization and affinity screening methods to develop a primary library of recombinant single chain variable fragment (scFv) antibodies in an M13 vector, pKM19. The antibody population is enriched for antibodies that bind antigens of 'Ca. Liberibacter asiaticus'. The primary library has more than 10(7) unique antibodies and the genes that encode them. We have screened this library for antibodies that bind to specifically-chosen proteins that are present on the surface of 'Ca. Liberibacter asiaticus'. These proteins were used as targets for affinity-based selection of scFvs that bind to the major outer membrane protein, OmpA; the polysaccharide capsule protein KpsF; a protein component of the type IV pilus (CapF); and, two flagellar proteins FlhA and FlgI. These scFvs have been used in ELISA and dot blot assays against purified protein antigens and 'Ca. Liberibacter asiaticus' infected plant extracts. We have also recloned many of these scFvs into a plasmid expression vector designed for the production of scFvs. Screening of these scFvs was more efficient when phage-bound, rather than soluble scFvs, were used. We have demonstrated a technology to produce antibodies at will and against any protein target encoded by 'Ca. Liberibacter asiaticus'. Applications could include advanced diagnostic methods for huanglongbing and the development of immune labeling reagents for in planta applications.

  17. Targeting cytokines: production and characterization of anti-TNF-α scFvs by phage display technology.

    Science.gov (United States)

    Abdolalizadeh, Jalal; Nouri, Mohammad; Zolbanin, Jafar Majidi; Barzegari, Abolfazl; Baradaran, Behzad; Barar, Jaleh; Coukos, George; Omidi, Yadollah

    2013-01-01

    The antibody display technology (ADT) such as phage display (PD) has substantially improved the production of monoclonal antibodies (mAbs) and Ab fragments through bypassing several limitations associated with the traditional approach of hybridoma technology. In the current study, we capitalized on the PD technology to produce high affinity single chain variable fragment (scFv) against tumor necrosis factor-alpha (TNF- α), which is a potent pro-inflammatory cytokine and plays important role in various inflammatory diseases and malignancies. To pursue production of scFv antibody fragments against human TNF- α, we performed five rounds of biopanning using stepwise decreased amount of TNF-α (1 to 0.1 μ g), a semi-synthetic phage antibody library (Tomlinson I + J) and TG1 cells. Antibody clones were isolated and selected through enzyme-linked immunosorbent assay (ELISA) screening. The selected scFv antibody fragments were further characterized by means of ELISA, PCR, restriction fragment length polymorphism (RFLP) and Western blot analyses as well as fluorescence microscopy and flow cytometry. Based upon binding affinity to TNF-α , 15 clones were selected out of 50 positive clones enriched from PD in vitro selection. The selected scFvs displayed high specificity and binding affinity with Kd values at nm range to human TNF-α . The immunofluorescence analysis revealed significant binding of the selected scFv antibody fragments to the Raji B lymphoblasts. The effectiveness of the selected scFv fragments was further validated by flow cytometry analysis in the lipopolysaccharide (LPS) treated mouse fibroblast L929 cells. Based upon these findings, we propose the selected fully human anti-TNF-α scFv antibody fragments as potential immunotherapy agents that may be translated into preclinical/clinical applications.

  18. The pure rotational spectrum of the ScO (X2Σ+) radical

    Science.gov (United States)

    Halfen, D. T.; Min, J.; Ziurys, L. M.

    2017-01-01

    The rotational spectrum of ScO (X2Σ+) has been measured in the gas phase in the frequency range 30-493 GHz using a combination of Fourier transform microwave/millimeter-wave (FTM/mmW) and submillimeter direct absorption methods. This work is the first pure rotational study of this radical. Both the ground vibrational and v = 1 states were observed. ScO was created from the reaction of metal vapor, produced either by a laser ablation source or a Broida-type oven, and N2O, in the former case heavily diluted in argon. Extensive hyperfine structure was observed in the FTM/mmW data, although the spin-rotation splitting was found to be small (∼3 MHz). In the mm-wave spectra, however, the fine and hyperfine structure was blended together, resulting in broad, single lines for a given transition N + 1 ← N. The data were analyzed in a combined fit using the very accurate hyperfine measurements of Childs and Steimle (1988), employing a Hund's case b Hamiltonian, and an improved set of rotational and centrifugal distortion constants were determined. These measurements improve the accuracy of predicted frequencies for astronomical searches by 14-18 MHz, or 16-20 km/s, in the 1 mm region - a difference of half to a full linewidth for certain interstellar sources. This work also demonstrates the capabilities of the FTM/mmW spectrometer at 61 GHz.

  19. Characterization of semi-solid processing of aluminium alloy 7075 with Sc and Zr additions

    Energy Technology Data Exchange (ETDEWEB)

    Rogal, Ł., E-mail: l.rogal@imim.pl [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Dutkiewicz, J. [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Atkinson, H.V. [The University of Leicester, Department of Engineering University Road, Leicester, LE1 7RH (United Kingdom); Lityńska-Dobrzyńska, L.; Czeppe, T. [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Modigell, M. [RWTH Aachen—Department of Mechanical Process Engineering, 55 Templergraben St., Aachen (Germany)

    2013-09-15

    For thixoforming (semi-solid processing) it is necessary to have a fine globular microstructure in a semi-solid range. Here this has been obtained for 7075 aluminium alloy by addition of modifying agents: 0.5 weight % of scandium and zirconium. The thixoforming process was carried out at 632 °C which gave about 23 volume % of liquid phase. The microstructure of the thixo-formed part (a rotor) consisted of globular grains surrounded by precipitates of secondary phase. The average hardness of thixo-formed parts was 105 HV{sub 5} and the tensile strength 300 MPa. T6 heat treatments were performed with solutionisation at 450 °C for 30 min and 10 h. In both cases the ageing time was set as 18 h at 120 °C. The heat treatments led to an increase in average tensile strength up to 495 MPa. Transmission Electron Microscopy (TEM) analysis enabled the identification of precipitates of the metastable dispersoids of L1{sub 2}–Al{sub 3} (Zr, Sc) and η′ (MgZn{sub 2}) phases in the alloy after the thixoforming and T6 treatment. The measurements of rheological properties of 7075Al alloy with Sc and Zr additions in the semi-solid range indicated an increase of particle size and spheroidization leading to an observable decrease of viscosity during isothermal shearing. A shear rate jump experiment showed that with increasing shear rate the viscosity rapidly falls.

  20. Theoretical Study on the Mechanism of the Gas-phase Reaction of Sc+ with Propargyl Alcohol

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yi-Ping; CHEN Hong-Yan; CHENG Wei-Xian; FENG Yu; YANG Li-Jun

    2008-01-01

    In order to elucidate the reaction mechanisms of reaction Sc+ with propargyl alcohol(PPA),the triplet potential energy surface for the reactions has been theoretically investigated using a DFT method.The geometries for the reactants,intermediates,transition states and products were completely optimized at B3LYP/DZVP level.The single point energy of each stationary point was calculated at MP4/(6-311+G** for C,H,O and Lanl2dz for Sc+)level.All the transition states were verified by the vibrational analysis and the internal reaction coordinate(IRC)calculations.The present results show that the reaction takes an insertion-elimination mechanism both along the O-H and C-O bond activation branches,but the C-O bond activation is much more favorable in energy than the O-H bond activation.All theoretical results not only support the existing conclusions inferred from early experiment,but also complement the pathway and mechanism for this reaction.

  1. Virtual microscopy in medical research: Open European Nephrology Science Center (OpEN.SC)

    Science.gov (United States)

    Schrader, Thomas; Beil, Michael; Schmidt, Danilo; Dietel, Manfred; Lindemann, Gabriela

    2007-03-01

    The amount and heterogeneity of data in biomedical research, notably in transnational research, requires new methods for the collection, presentation and analysis of information. Important data from laboratory experiments as well as patient trials are available as images. Thus, the integration and processing of image data represent a crucial component of information systems in biomedical research. The Charité Medical School in Berlin has established a new information service center for kidney diseases and transplantation (Open European Nephrology Science Centre - OpEN.SC) together with the German Research Agency (DFG). The aims of this project are (i) to improve the availability of raw data, (ii) to establish an infrastructure for clinical trials, (iii) to monitor the occurrence of rare disease patterns and (iv) to establish a quality assurance system. Major diagnostic procedures in medicine are based on the processing and analysis of image data. In diagnostic pathology, the availability of automated slide scanners provide the opportunity to digitize entire microscopic slides. The processing, presentation and analysis of these image data are called virtual microscopy. The integration of this new technology into the OpEN.SC system and the link to other heterogeneous data of individual patients represent a major technological challenge. Thus, new ways in communication between clinical and scientific partners have to be established and will be promoted by the project. The technological basis of the repository are web services for a scalable and adaptable system. HL7 and DICOM are considered the main medical standards of communication.

  2. PLANTAS HEPATOTÓXICAS PARA BOVINOS NO MUNICÍPIO DE ITAPIRANGA – SC

    Directory of Open Access Journals (Sweden)

    Caroline Hauser

    2012-12-01

    Full Text Available Because of suspected poisoning by phytotoxins in cattle of Itapiranga-SC region, it was observed the need of performing a detailed study on the prevalence of hepatotoxic plants in that town. These plants, or parts of them, are usually present in pastures, preserved forages and grains with which the animals are fed, that makes more likely the accidental intake. When we performed a study in the region, it was noticed the presence of some plants classified as hepatotoxic which were described in the present paper in order to reduce the recurrence of severe organic lesions and thus breeding lost.Em decorrência das suspeitas de intoxicações dos bovinos da região de Itapiranga - SC por fitotoxinas, observou-se a necessidade de realizar um estudo detalhado sobre a predominância de plantas hepatotóxicas neste município. Tais plantas, ou parte delas, estão geralmente presentes nas pastagens, forrageiras conservadas, grãos com os quais os animais são nutridos, o que torna seu consumo acidental ainda mais provável. Realizando um estudo da região constatou se a presença de algumas plantas classificadas como tóxicas, as quais foram descritas no presente trabalho com o intuito de minimizar a recorrência de lesões orgânicas graves e assim, prejuízo nas criações.

  3. Le Corps Performatif: les enjeux des scènes contemporaines

    Directory of Open Access Journals (Sweden)

    Sylvie Roques

    2017-01-01

    Full Text Available Cet article présente la mise en perspective d’une recherche d’une dizaine d’années, faisant croiser le regard sur le texte dramatique porteur de représentations corporelles, et l’examen de formes scéniques actuelles où la présence du corps est indéniable. S’il est impossible de limiter le théâtre au texte, notre position est qu’il est aussi impossible d’y échapper. La première partie met en perspective une analyse textuelle d’un corpus de textes contemporains européens révélant nombre de représentations corporelles. La seconde partie interroge la chair des mots car la parole est une matérialité tangible, porteuse d’une originalité particulière. La troisième partie est consacrée enfin aux formes performances émergeantes sur les scènes européennes où le corps acquiert toute sa densité et sa force.

  4. Synthetically Control of a Hybrid PV/FC/SC Power System for Stand-Alone Applications

    Directory of Open Access Journals (Sweden)

    Dakang Zhu

    2013-02-01

    Full Text Available In this study, a simple and practical control scheme for power assignment and load-following of a Hybrid Power System (HPS is proposed. The system consists of Photovoltaic (PV, Fuel Cell (FC, Super-Capacitor (SC, dc load, ac load and different kinds of converters. PV is chosen as a prior source, which normally operates in Maximum Power Point Tracking (MPPT mode. In order to achieve 24 h power supply under various natural conditions, FC is used as a backup source to provide the power deficit between solar generation and load demand. Taking the slow FC system dynamics into account, FC power slope has been limited to protect FC from fuel starvation, whereas SC is chosen to satisfy the requirement of the sudden load and solar radiation changes. Besides, a V/f controller is designed to meet ac load demand, while keeping the voltage and frequency within an acceptable range. All the details of this study, including system structure, control diagrams and MATLAB simulation results, are presented.

  5. Stellar neutron capture cross sections of 41K and 45Sc

    Science.gov (United States)

    Heil, M.; Plag, R.; Uberseder, E.; Bisterzo, S.; Käppeler, F.; Mengoni, A.; Pignatari, M.

    2016-05-01

    The neutron capture cross sections of light nuclei (A important for s -process scenarios since they act as neutron poisons. We report on measurements of the neutron capture cross sections of 41K and 45Sc, which were performed at the Karlsruhe 3.7 MV Van de Graaff accelerator via the activation method in a quasistellar neutron spectrum corresponding to a thermal energy of k T =25 keV. Systematic effects were controlled by repeated irradiations, resulting in overall uncertainties of less than 3%. The measured spectrum-averaged data have been used to normalize the energy-dependent (n ,γ ) cross sections from the main data libraries JEFF-3.2, JENDL-4.0, and ENDF/B-VII.1, and a set of Maxwellian averaged cross sections was calculated for improving the s -process nucleosynthesis yields in AGB stars and in massive stars. At k T =30 keV, the new Maxwellian averaged cross sections of 41K and 45Sc are 19.2 ±0.6 mb and 61.3 ±1.8 mb, respectively. Both values are 20% lower than previously recommended. The effect of neutron poisons is discussed for nuclei with A <56 in general and for the investigated isotopes in particular.

  6. A Novel Human scFv Library with Non-Combinatorial Synthetic CDR Diversity.

    Science.gov (United States)

    Bai, Xuelian; Kim, Jihye; Kang, Seungmin; Kim, Wankyu; Shim, Hyunbo

    2015-01-01

    The present work describes the construction and validation of a human scFv library with a novel design approach to synthetic complementarity determining region (CDR) diversification. The advantage of synthetic antibody libraries includes the possibility of exerting fine control over factors like framework sequences, amino acid and codon usage, and CDR diversity. However, random combinatorial synthesis of oligonucleotides for CDR sequence diversity also produces many clones with unnatural sequences and/or undesirable modification motifs. To alleviate these issues, we designed and constructed a novel semi-synthetic human scFv library with non-combinatorial, pre-designed CDR diversity and a single native human framework each for heavy, kappa, and lambda chain variable domains. Next-generation sequencing analysis indicated that the library consists of antibody clones with highly nature-like CDR sequences and the occurrence of the post-translational modification motifs is minimized. Multiple unique clones with nanomolar affinity could be isolated from the library against a number of target antigens, validating the library design strategy. The results demonstrate that it is possible to construct a functional antibody library using low, non-combinatorial synthetic CDR diversity, and provides a new strategy for the design of antibody libraries suitable for demanding applications.

  7. Origins of non-stoichiometry in compounds: vacancy-ordering in ScS

    Science.gov (United States)

    Hart, Gus L. W.; Zunger, Alex

    2001-03-01

    While most stable compounds have fixed Daltonian ratios of their constituents (e.g., 1:1 ratio in ZnS, NaCl, GaAs), some materials exhibit significant nonstoichiometry even at low temperatures. Examples include some NaCl-structure transition-metal monochalcogenides such as HfS, ZrSe, and YS. The prototype system ScS exhibits this peculiar property of preferring the presence of vacancies (up to 30%) over a purely stoichiometric structure. Moreover, these vacancies order spatially in unusual structures. We consider Sc_1-xBox _xS as a binary alloy (where Box denotes a vacancy) and express the energy E_MBCE(σ) of any of the 2^N configurations σ in a ``mixed-basis cluster expansion'' (MBCE) obtained from ab initio calculations of ~ 30 ordered structures. A ground state search of all possible configurations reveals that indeed an ordered array of vacancies has the lowest energy. We show systematic features in the electronic structure that help explain the preference for vacancies.

  8. Sc and neutron-capture abundances in Galactic low- and high-α field halo stars

    Science.gov (United States)

    Fishlock, C. K.; Yong, D.; Karakas, A. I.; Alves-Brito, A.; Meléndez, J.; Nissen, P. E.; Kobayashi, C.; Casey, A. R.

    2017-01-01

    We determine relative abundance ratios for the neutron-capture elements Zr, La, Ce, Nd, and Eu for a sample of 27 Galactic dwarf stars with -1.5 < [Fe/H] <-0.8. We also measure the iron-peak element Sc. These stars separate into three populations (low- and high-α halo and thick-disc stars) based on the [α/Fe] abundance ratio and their kinematics as discovered by Nissen & Schuster. We find differences between the low- and high-α groups in the abundance ratios of [Sc/Fe], [Zr/Fe], [La/Zr], [Y/Eu], and [Ba/Eu] when including Y and Ba from Nissen & Schuster. For all ratios except [La/Zr], the low-α stars have a lower abundance compared to the high-α stars. The low-α stars display the same abundance patterns of high [Ba/Y] and low [Y/Eu] as observed in present-day dwarf spheroidal galaxies, although with smaller abundance differences, when compared to the high-α stars. These distinct chemical patterns have been attributed to differences in the star formation rate between the two populations and the contribution of low-metallicity, low-mass asymptotic giant branch (AGB) stars to the low-α population. By comparing the low-α population with AGB stellar models, we place constraints on the mass range of the AGB stars.

  9. Biotypes and ScM types of isolates of Streptococcus canis from diseased and healthy cats.

    Science.gov (United States)

    Timoney, J F; Velineni, S; Ulrich, B; Blanchard, P

    2017-04-08

    Lancefield group G Streptococcus canis is a component of the normal urogenital and pharyngeal flora of the cat. It is also frequently implicated in epizootics of severe disease in closed cat colonies and animal shelters. Given the importance of S canis as a feline pathogen and relative lack of published information on characteristics potentially associated with virulence, the authors have compared isolates from healthy and diseased cats in New York and California using fermentation profiles (biotype) and ScM sequences. With few exceptions, isolates associated with disease were biotype 1. Four alleles of scm were identified of which type 1 dominated in diseased cats. Type 4 allelic variants were found only in healthy cats and all but one were biotype 2. Type 2 and 3 alleles showed extensive N-terminal variation suggesting a plasminogen-binding site as found on the type 1 allele was absent. Cat antisera to ScM were opsonobactericidal, and these potentially protective antibodies increased during convalescence.

  10. SC2IT: a cloud computing interface that makes computational science available to non-specialists

    Science.gov (United States)

    Jorissen, Kevin; Vila, Fernando; Rehr, John

    2012-10-01

    Computational work is a vital part of much scientific research. In materials science research in particular, theoretical models are usually needed to understand measurements. There is currently a double barrier that keeps a broad class of researchers from using state-of-the-art materials science (MS) codes: the software typically lacks user-friendliness, and the hardware requirements can demand a significant investment, e.g. the purchase of a Beowulf cluster. Scientific Cloud Computing (SCC) has the potential to breach this barrier and make computational science accessible to a wide class of non-specialists scientists. We present a platform, SC2IT, that enables seamless control of virtual compute clusters in the Amazon EC2 cloud and is designed to be embedded in user-friendly Java GUIs. Thus users can create powerful High-Performance Computing systems with preconfigured MS codes in the cloud with a single mouse click. We present applications of our SCC platform to the materials science codes FEFF9, WIEN2k, and MEEP-mpi. SC2IT and the paradigm described here are applicable to other fields of research beyond materials science, although the computational performance of Cloud Computing may vary with the characteristics of the calculations.

  11. Electronic band structure and optical properties of the cubic, Sc, Y and La hydride systems

    Energy Technology Data Exchange (ETDEWEB)

    Peterman, D.J.

    1980-01-01

    Electronic band structure calculations are used to interpret the optical spectra of the cubic Sc, Y and La hydride systems. Self-consistent band calculations of ScH/sub 2/ and YH/sub 2/ were carried out. The respective joint densities of states are computed and compared to the dielectric functions determined from the optical measurements. Additional calculations were performed in which the Fermi level or band gap energies are rigidly shifted by a small energy increment. These calculations are then used to simulate the derivative structure in thermomodulation spectra and relate the origin of experimental interband features to the calculated energy bands. While good systematic agreement is obtained for several spectral features, the origin of low-energy interband transitions in YH/sub 2/ cannot be explained by these calculated bands. A lattice-size-dependent premature occupation of octahedral sites by hydrogen atoms in the fcc metal lattice is suggested to account for this discrepancy. Various non-self-consistent calculations are used to examine the effect of such a premature occupation. Measurements of the optical absorptivity of LaH/sub x/ with 1.6 < x < 2.9 are presented which, as expected, indicate a more premature occupation of the octahedral sites in the larger LaH/sub 2/ lattice. These experimental results also suggest that, in contrast to recent calculations, LaH/sub 3/ is a small-band-gap semiconductor.

  12. Functional expression of an scFv on bacterial magnetic particles by in vitro docking

    Energy Technology Data Exchange (ETDEWEB)

    Sugamata, Yasuhiro; Tanaka, Tsuyoshi; Matsunaga, Tadashi; Yoshino, Tomoko, E-mail: y-tomoko@cc.tuat.ac.jp

    2014-02-28

    Highlights: • We present a novel expression system called “in vitro docking” on bacterial magnetic particles. • An scFv–Fc was functionally expressed on bacterial magnetic particles of magnetotactic bacteria. • Our novel expression system on BacMPs will be effective for disulfide-bonded proteins. - Abstract: A Gram-negative, magnetotactic bacterium, Magnetospirillum magneticum AMB-1 produces nano-sized magnetic particles (BacMPs) in the cytoplasm. Although various applications of genetically engineered BacMPs have been demonstrated, such as immunoassay, ligand–receptor interaction or cell separation, by expressing a target protein on BacMPs, it has been difficult to express disulfide-bonded proteins on BacMPs due to lack of disulfide-bond formation in the cytoplasm. Here, we propose a novel dual expression system, called in vitro docking, of a disulfide-bonded protein on BacMPs by directing an immunoglobulin Fc-fused target protein to the periplasm and its docking protein ZZ on BacMPs. By in vitro docking, an scFv–Fc fusion protein was functionally expressed on BacMPs in the dimeric or trimeric form. Our novel disulfide-bonded protein expression system on BacMPs will be useful for efficient screening of potential ligands or drugs, analyzing ligand–receptor interactions or as a magnetic carrier for affinity purification.

  13. Forsterite Carbonation in Wet-scCO2: Dependence on Adsorbed Water Concentration

    Science.gov (United States)

    Loring, J.; Benezeth, P.; Qafoku, O.; Thompson, C.; Schaef, T.; Bonneville, A.; McGrail, P.; Felmy, A.; Rosso, K.

    2013-12-01

    Capturing and storing CO2 in basaltic formations is one of the most promising options for mitigating atmospheric CO2 emissions resulting from the burning of fossil fuels. These geologic reservoirs have high reactive potential for CO2-mineral trapping due to an abundance of divalent-cation containing silicates, such as forsterite (Mg2SiO4). Recent studies have shown that carbonation of these silicates under wet scCO2 conditions, e. g. encountered near a CO2 injection well, proceeds along a different pathway and is more effective than in CO2-saturated aqueous fluids. The presence of an adsorbed water film on the forsterite surface seems to be key to reactivity towards carbonation. In this study, we employed in situ high pressure IR spectroscopy to investigate the dependence of adsorbed water film thickness on forsterite carbonation chemistry. Post reaction ex situ SEM, TEM, TGA, XRD, and NMR measurements will also be discussed. Several IR titrations were performed of forsterite with water at 50 °C and 90 bar scCO2. Aliquots of water were titrated at 4-hour reaction-time increments. Once a desired total water concentration was reached, data were collected for about another 30 hours. One titration involved 10 additions, which corresponds to 6.8 monolayers of adsorbed water. Clearly, a carbonate was precipitating, and its spectral signature matched magnesite. Another titration involved 8 aliquots, or up to 4.4 monolayers of water. The integrated absorbance under the CO stretching bands of carbonate as a function of time after reaching 4.4 monolayers showed an increase and then a plateau. We are currently unsure of the identity of the carbonate that precipitated, but it could be an amorphous anhydrous phase or magnesite crystals with dimensions of only several nanometers. A third titration only involved 3 additions, or up to 1.6 monolayers of water. The integrated absorbance under the CO stretching bands of carbonate as a function of time after reaching 1.6 monolayers

  14. Production of monoclonal anti-GP Ⅱ b/Ⅲa scFv antibodies from scFv phage libraries%从scFv噬菌体抗体库中筛选抗GPⅡ b/Ⅲa单链抗体

    Institute of Scientific and Technical Information of China (English)

    夏红利; 谭最; 陈德杰; 乔建国; 邱仁峰

    2011-01-01

    目的 从scFv噬菌体库中获取人源化特异性Anti-GPⅡb/Ⅲa单克隆scFv抗体.方法 对Tomlinson I+J scFv文库进行3次淘洗,富集特异性的抗GPⅡb/Ⅲa抗体.通过酶联免疫吸附试验(ELISA)和双脱氧终止法基因测序及同源性对比,检测出人源化的抗GPⅡb/Ⅲa单克隆抗体.结果 在3次淘洗后,得到了抗GPⅡb/Ⅲa单克隆噬菌体抗体,阳性克隆的获取率在95.6%以上;ELISA和基因测序筛选出25种不同的全长抗GPⅡb/Ⅲa噬菌体抗体,这些基因序列与人免疫球蛋白可变区基因同源性达到89%以上;分泌性抗体ELISA检测提示这些抗体顺利表达了蛋白并特异性结合GPⅡb/Ⅲa,其中15种scFv对GPⅡb/Ⅲa有更强的阳性反应.结论 人源化的特异性抗-GPⅡb/Ⅲa scFv能通过噬菌体展示技术快速有效地获得.%Objective To screen monoclonal anti-GP Ⅱ b/Ⅲ a antibodies from scFv phage libraries and obtain specific monoclonal anti-GP Ⅱ b/Ⅲ a scFv. Methods Specific anti-GP Ⅱ b/Ⅲ a scFv antibodies were enriched by three rounds of selection from Tomlinson Ⅰ + J libraries. By using polyclonal and monoclonal phage enzyme linked immunosorbent assay ( ELISA) and gene sequencing by bideoxy chain termination, full-length specific monoclonal anti-GP Ⅱ b/Ⅲ a antibodies were picked out and their gene sequences were obtained. Results Twenty-five different full-length monoclonal scFv phage fragments were obtained after three rounds of panning and their gene sequences were identified, and positive rate of monoclones was above 95.6%; homology comparison with variable regions of human immunoglobulin gene showed the similarity was above 89%; the result of soluble scFv ELISA showed that these specific scFv could be expressed smoothly, and 15 full-length monoclonal scFv antibodies were stronger positive than the other in these scFv. Conclusion Antibody phage display was a rapid and effective method to obtain Anti-GP Ⅱ b/Ⅲ a scFv fragements.

  15. Rapid Selection of Phage Se-scFv with GPX Activity via Combination of Phage Display Antibody Library with Chemical Modification

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Glutathione peroxidase (GPX) plays an important role in scavenging reactive oxygen species. A series of catalytic antibodies with GPX activity have been generated by the authors of this study. To obtain humanized catalytic antibodies, the phage-displayed human antibody library was used to select novel antibodies by repetitive screening. Phage antibodies, scFv-B8 and scFv-H6 with the GSH-binding site, were obtained from the library by enzyme-linked immunosorbent assay(ELISA) analysis with 4 rounds of selection against their respective haptens, S-2,4-dinitriphenyl t-butyl ester(GSH-s-DNP-Bu) and S-2,4-dinitriphenyl t-hexyl ester(GSH-s-DNP-He). Nevertheless, several studies need to be conducted to determine whether scFv-B8 and scFv-H6 possess GPX activity. To enhance the speed of the selection, selenocysteine(Sec, the catalytic group of GPX) was incorporated directly into the phages, scFv-B8 and scFv-H6, by chemical mutation to form the phages Se-scFv-B8 and Se-scFv-H6. The GPX activities were found to be 3012 units/μmol and 2102 units/μmol, respectively. To improve the GPX activity of the phage Se-scFv-B8, DNA shuffling was used to construct a secondary library and another positive phage antibody scFv-B9 was screened out by another panning against GSH-s-DNP-Bu. When Sec was incorporated via chemical mutation into the phage antibody scFv-B9, its GPX activity reached 3560 units/μmol, which is 1.17-fold higher than the phage antibody Se-scFv-B8and almost approached the order of magnitude of native GPX. The rapid selection is the prerequisite for generating humanized Se-scFv with GPX activity.

  16. Humoral immune responses induced by anti-idiotypic antibody fusion protein of 6B11scFv/hGM-CSF in BALB/c mice

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Background We have previously developed and characterized a monoclonal anti-idiotype antibody, designated 6B11, which mimics an ovarian carcinoma associated antigen OC166-9 and whose corresponding monoclonal antibody is COC166-9 (Ab1). In this study, we evaluate the humoral immune responses induced by the fusion protein 6B11 single-chain variable fragment (scFv)/human granulocyte macrophage colony-stimulating factor (hGM-CSF) and 6B11scFv in BALB/c mice. Methods The fusion protein 6B11scFv/hGM-CSF was constructed by fusing a recombinant single-chain variable fragment of 6B11scFv to GM-CSF. BALB/c mice were administrated by 6B11scFv/hGM-CSF and 6B11scFv, respectively. Results The fusion protein 6B11scFv/hGM-CSF retained binding to the anti-mouse F(ab)2' and was also biologically active as measured by proliferation of human GM-CSF dependent cell TF1 in vitro. After immunization with the 6B11scFv/hGM-CSF and 6B11ScFv, BALB/c mice showed significantly enhanced Ab3 antibody responses to 6B11scFv/hGM-CSF compared with the 6B11scFv alone. The level of Ab3 was the highest after the first week and maintained for five weeks after the last immunization. Another booster was given when the Ab3 titer descended, and it would reach to the high level in a week. Conclusion The fusion protein 6B11scFv/hGM-CSF can induce humoral immunity against ovarian carcinoma in vivo. We also provide the theoretical foundation for the application of the fusion protein 6B11scFv/hGM-CSF for active immunotherapy of ovarian cancer.

  17. Experimental, numerical, and analytical studies on the seismic response of steel-plate concrete (SC) composite shear walls

    Science.gov (United States)

    Epackachi, Siamak

    The seismic performance of rectangular steel-plate concrete (SC) composite shear walls is assessed for application to buildings and mission-critical infrastructure. The SC walls considered in this study were composed of two steel faceplates and infill concrete. The steel faceplates were connected together and to the infill concrete using tie rods and headed studs, respectively. The research focused on the in-plane behavior of flexure- and flexure-shear-critical SC walls. An experimental program was executed in the NEES laboratory at the University at Buffalo and was followed by numerical and analytical studies. In the experimental program, four large-size specimens were tested under displacement-controlled cyclic loading. The design variables considered in the testing program included wall thickness, reinforcement ratio, and slenderness ratio. The aspect ratio (height-to-length) of the four walls was 1.0. Each SC wall was installed on top of a re-usable foundation block. A bolted baseplate to RC foundation connection was used for all four walls. The walls were identified to be flexure- and flexure-shear critical. The progression of damage in the four walls was identical, namely, cracking and crushing of the infill concrete at the toes of the walls, outward buckling and yielding of the steel faceplates near the base of the wall, and tearing of the faceplates at their junctions with the baseplate. A robust finite element model was developed in LS-DYNA for nonlinear cyclic analysis of the flexure- and flexure-shear-critical SC walls. The DYNA model was validated using the results of the cyclic tests of the four SC walls. The validated and benchmarked models were then used to conduct a parametric study, which investigated the effects of wall aspect ratio, reinforcement ratio, wall thickness, and uniaxial concrete compressive strength on the in-plane response of SC walls. Simplified analytical models, suitable for preliminary analysis and design of SC walls, were

  18. scFv from Antibody That Mimics gp43 Modulates the Cellular and Humoral Immune Responses during Experimental Paracoccidioidomycosis.

    Science.gov (United States)

    Jannuzzi, Grasielle Pereira; Tavares, Aldo Henrique F P; Kaihami, Gilberto Hideo; de Almeida, José Roberto Fogaça; de Almeida, Sandro Rogério; Ferreira, Karen Spadari

    2015-01-01

    Paracoccidioidomycosis (PCM), caused by Paracoccidioides species is a prevalent systemic and progressive mycosis that occurs in Latin America. It is caused by Paracoccidioides species. Immunization with dendritic cells transfected with a plasmid encoding the scFv (pMAC/PS-scFv) that mimics the main antigen of P. brasiliensis (gp43) confers protection in experimental PCM. DCs link innate and adaptive immunity by recognizing invading pathogens and selecting the type of effector T cell to mediate the immune response. Here, we showed that DC-pMAC/PS-scFv induces the activation of CD4+ and CD8+ T cells. Moreover, our results demonstrated that BALB/c mice infected with P. brasiliensis and treated with DC-pMAC/PS-scFv showed the induction of specific IgG production against gp43 and IFN-γ, IL-12 and IL-4 cytokines. Analysis of regional lymph nodes revealed increases in the expression of clec7a, myd88, tlr2, gata3 and tbx21, which are involved in the immune response. Taken together, our results indicate that the scFv modulates the humoral and cellular immune responses and presents epitopes to CD4+ and CD8+ T cells.

  19. scFv from Antibody That Mimics gp43 Modulates the Cellular and Humoral Immune Responses during Experimental Paracoccidioidomycosis.

    Directory of Open Access Journals (Sweden)

    Grasielle Pereira Jannuzzi

    Full Text Available Paracoccidioidomycosis (PCM, caused by Paracoccidioides species is a prevalent systemic and progressive mycosis that occurs in Latin America. It is caused by Paracoccidioides species. Immunization with dendritic cells transfected with a plasmid encoding the scFv (pMAC/PS-scFv that mimics the main antigen of P. brasiliensis (gp43 confers protection in experimental PCM. DCs link innate and adaptive immunity by recognizing invading pathogens and selecting the type of effector T cell to mediate the immune response. Here, we showed that DC-pMAC/PS-scFv induces the activation of CD4+ and CD8+ T cells. Moreover, our results demonstrated that BALB/c mice infected with P. brasiliensis and treated with DC-pMAC/PS-scFv showed the induction of specific IgG production against gp43 and IFN-γ, IL-12 and IL-4 cytokines. Analysis of regional lymph nodes revealed increases in the expression of clec7a, myd88, tlr2, gata3 and tbx21, which are involved in the immune response. Taken together, our results indicate that the scFv modulates the humoral and cellular immune responses and presents epitopes to CD4+ and CD8+ T cells.

  20. Selection of scFvs specific for the HepG2 cell line using ribosome display

    Indian Academy of Sciences (India)

    Lei Zhou; Wei-Ping Mao; Juan Fen; Hong-Yun Liu; Chuan-Jing Wei; Wen-Xiu Li; Feng-Yun Zhou

    2009-06-01

    The aim of this study was to construct a ribosome display library of single chain variable fragments (scFvs) associated with hepatocarcinoma and screen such a library for hepatocarcinoma-binding scFvs. mRNA was isolated from the spleens of mice immunized with hepatocellular carcinoma cell line HepG2. Heavy and k chain genes (VH and k) were amplified separately by RT-PCR, and an anti-HepG2 VH/k chain ribosome display library was constructed by assembling VH and k into the VH/k chain with a specially constructed linker by SOE-PCR. The VH/k chain library was transcribed and translated in vitro using a rabbit reticulocyte lysate system. In order to isolate specific scFvs, recognizing HepG2 negative selection on a normal hepatocyte line WRL-68 was carried out before three rounds of positive selection on HepG2. After three rounds of panning, cell enzyme-linked immunosorbent assay (ELISA) showed that one of the scFvs had high affinity for the HepG2 cell and lower affinity for the WRL-68 cell. In this study, we successfully constructed a native ribosome display library. Such a library would prove useful for direct intact cell panning using ribosome display technology. The selected scFv had a potential value for hepatocarcinoma treatment.

  1. Cell Penetrable Human scFv Specific to Middle Domain of Matrix Protein-1 Protects Mice from Lethal Influenza

    Directory of Open Access Journals (Sweden)

    Fonthip Dong-din-on

    2015-01-01

    Full Text Available A new anti-influenza remedy that can tolerate the virus antigenic variation is needed. Influenza virus matrix protein-1 (M1 is highly conserved and pivotal for the virus replication cycle: virus uncoating, assembly and budding. An agent that blocks the M1 functions should be an effective anti-influenza agent. In this study, human scFv that bound to recombinant M1 middle domain (MD and native M1 of A/H5N1 was produced. Phage mimotope search and computerized molecular docking revealed that the scFv bound to the MD conformational epitope formed by juxtaposed helices 7 and 9 of the M1. The scFv was linked molecularly to a cell penetrable peptide, penetratin (PEN. The PEN-scFv (transbody, when used to treat the cells pre-infected with the heterologous clade/subclade A/H5N1 reduced the viral mRNA intracellularly and in the cell culture fluids. The transbody mitigated symptom severity and lung histopathology of the H5N1 infected mice and caused reduction of virus antigen in the tissues as well as extricated the animals from the lethal challenge in a dose dependent manner. The transbody specific to the M1 MD, either alone or in combination with the cognate human scFvs specific to other influenza virus proteins, should be an effective, safe and mutation tolerable anti-influenza agent.

  2. K2SC: Flexible systematics correction and detrending of K2 light curves using Gaussian Process regression

    CERN Document Server

    Aigrain, Suzanne; Pope, Benjamin

    2016-01-01

    We present K2SC (K2 Systematics Correction), a Python pipeline to model instrumental systematics and astrophysical variability in light curves from the K2 mission. K2SC uses Gaussian process regression to model position-dependent systematics and time-dependent variability simultaneously, enabling the user to remove both (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). For periodic variables, K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability. We apply K2SC to publicly available K2 data from campaigns 3--5, showing that we obtain photometric precision approaching that of the original Kepler mission. We compare our results to other publicly available K2 pipelines, showing that we obtain similar or better results, on average. We use transit injection and recovery tests to evaluate the impact of K2SC on planetary transit searches in K2 PDC (Pre-search Data Conditioning) data, for planet-to-star radi...

  3. ALERTES-SC3 Early Warning System prototype for South Iberian Peninsula: on-site approach.

    Science.gov (United States)

    Pazos, Antonio; Lopez de Mesa, Mireya; Gallego Carrasco, Javier; Martín Davila, José; Rioja del Rio, Carlos; Morgado, Arturo; Vera, Angel; Ciberia, Angel; Cabieces, Roberto; Strollo, Angelo; Hanka, Winfried; Carranza, Marta

    2016-04-01

    In recent years several Earthquake Early Warning Systems (EEWS) have been developed for different parts of the world. The area between SW Cape St. Vicente and the Strait of Gibraltar is one of the most seismically active zones in the Ibero-Maghrebian region, with predominantly moderate and superficial seismicity, but also big events with associated tsunamis are well documented in the area, like the 1755 Lisbon earthquake. In the frame of the ALERT-ES (2011-2013) and ALERTES-RIM (2014-2016) Spanish projects, the ALERTES-SC3 EEWS, regional approach, prototype has been developed at the Royal Spanish Navy Observatory (ROA) and is being tested in near real time for south Iberia. This prototype, based on the SeisComP3 software package, is largely based on algorithms derived from the analysis of the first seconds of the P wave records. Calculation of several parameters are carried out, mainly the characteristic period (τc) and the displacement peak (Pd), but also the velocity peak (Pv), the maximum period (τPmáx), among others. In order to warm the areas closest to the hypocentre, places located inside the "blind zone", a on-site EEWS has also been developed by ROA and integrated in the ALERTES-SC3 prototype. From the on-site approach, a warm level is declared from one station as a function of the estimated characteristic period (τc) and the displacement Peak (Pd), although the earthquake location and therefore the lead time available remains unknown. This on-site EEWS is being tested in several Western Mediterranean net (WM) stations as ARNO (Arenosillo, Huelva,Spain) or CHAS (Chafarinas island, North Africa, Spain). Also an on-site low cost station is being developed based in low cost accelerometers. In this work the current state of the on-site EEWS developed, its integration in the ALERTES-SC3 EEWS system and the low cost seismic stations are shown.

  4. Synthesis of Sc{sub 2}O{sub 3} powders for preparation of transparent ceramics; Synthese de poudres de Sc{sub 2}O{sub 3} destinees a l'elaboration d'une ceramique transparente

    Energy Technology Data Exchange (ETDEWEB)

    Bravo, A.C.; Longuet, L.; Autissier, D. [CEA Centre d' Etudes du Ripault, 37 - Tours (France); Baumard, J.F. [Laboratoire Science des Procedes Ceramiques et de Traitements de Surfaces, SPCTS, UMR CNRS 6638, 87 - Limoges (France)

    2007-07-01

    Different precursors have been prepared by precipitation from scandium nitrates salts using ammonium hydrogeno-carbonate as precipitating agent. The influence of the precipitation technique, of the preparation temperature and of the 'precipitating agent/Sc{sup 3+}' molar ratio on the characteristics (nature, grain size...) of the synthesized precursors has been observed. A heat treatment at 700 C of these precursors has allowed to obtain thin and homogeneous Sc{sub 2}O{sub 3} powders well adapted for transparent ceramics preparation. (O.M.)

  5. Carbon Dioxide Activation by Scandium Atoms and Scandium Monoxide Molecules: Formation and Spectroscopic Characterization of ScCO3 and OCScCO3 in Solid Neon.

    Science.gov (United States)

    Zhang, Qingnan; Qu, Hui; Chen, Mohua; Zhou, Mingfei

    2016-01-28

    The reactions of carbon dioxide with scandium monoxide molecules and scandium atoms are investigated using matrix isolation infrared spectroscopy in solid neon. The species formed are identified by the effects of isotopic substitution on their infrared spectra as well as density functional calculations. The results show that the ground state ScO molecule reacts with carbon dioxide to form the carbonate complex ScCO3 spontaneously on annealing. The ground state Sc atom reacts with two carbon dioxide molecules to give the carbonate carbonyl complex OCScCO3 via the previously reported OScCO insertion intermediate on annealing. The observation of these spontaneous reactions is consistent with theoretical predictions that both the Sc + 2CO2 → OCScCO3 and ScO + CO2 → ScCO3 reactions are thermodynamically exothermic and are kinetically facile, requiring little or no activation energy.

  6. SC2: a System to Secure Off-Card Contract-Policy Matching in Security-by-Contract for Open Multi-Application Smart Cards

    DEFF Research Database (Denmark)

    Dragoni, Nicola; Lostal, Eduardo; Papini, Davide

    2011-01-01

    of the smart card hosting the application. In this demonstration we show (SC)2 (Secure Communication over Smart Cards), a system developed to address a key issue of the SC framework, namely the secure outsourcing of the SC contract-policy matching service to a Trusted Third Party (TTP). (SC)2 secures......The Security-by-Contract (SC) framework has recently been proposed to support software evolution in open multi-application smart cards. The key idea lies in the notion of contract, a specification of the security behavior of an application that must be compliant with the security policy...... the communication between a smart card and the TTP that provides the SC matching service....

  7. Zero lattice mismatch and twin-free single crystalline ScN buffer layers for GaN growth on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Lupina, L.; Zoellner, M. H.; Dietrich, B.; Capellini, G. [IHP, Im Technologiepark 25, 15236 Frankfurt, Oder (Germany); Niermann, T.; Lehmann, M. [Technische Universität Berlin, Institut für Optik und Atomare Physik, Straße des 17. Juni 135, 10623 Berlin (Germany); Thapa, S. B.; Haeberlen, M.; Storck, P. [SILTRONIC AG, Hanns-Seidel-Platz 4, 81737 München (Germany); Schroeder, T. [IHP, Im Technologiepark 25, 15236 Frankfurt, Oder (Germany); BTU Cottbus, Konrad-Zuse-Str. 1, 03046 Cottbus (Germany)

    2015-11-16

    We report the growth of thin ScN layers deposited by plasma-assisted molecular beam epitaxy on Sc{sub 2}O{sub 3}/Y{sub 2}O{sub 3}/Si(111) substrates. Using x-ray diffraction, Raman spectroscopy, and transmission electron microscopy, we find that ScN films grown at 600 °C are single crystalline, twin-free with rock-salt crystal structure, and exhibit a direct optical band gap of 2.2 eV. A high degree of crystalline perfection and a very good lattice matching between ScN and GaN (misfit < 0.1%) makes the ScN/Sc{sub 2}O{sub 3}/Y{sub 2}O{sub 3} buffer system a very promising template for the growth of high quality GaN layers on silicon.

  8. IS0/TC20/SC14第17届全会概况

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    2007年5月24日至25日,继ISO/TC20/SC14第17届年会工作组(WG)会之后,SC14召开了全体会议,本次全会由SC14新任主席、美国NASA肯尼迪航天中心的舒尔茨先生主持,秘书长是美国航天航空协会(AIAA)的海伦女士。中国、美国、英国、法国、俄罗斯、意大利、德国、日本、巴西、加拿大、乌克兰等11个国家以及欧空局的代表参加了会议.

  9. Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

    DEFF Research Database (Denmark)

    Waskowska, A.; Gerward, L.; Staun Olsen, J.

    2011-01-01

    High-pressure X-ray diffraction in ScB2, TiB2, YB4 and HoB4 powders and single crystals has been studied using synchrotron radiation as well as conventional X-rays. The experimental results are supported by calculations using density functional theory. ScB2, YB4 and HoB4 are hard materials (bulk...... modulus 180-200GPa), while TiB2 may be classified as superhard (bulk modulus about 260GPa). We report here first experimental and theoretical determinations of the bulk modulus for HoB4 (195(5) and 198.2GPa, respectively), and first experimental values of the bulk modulus for ScB2 (196(2)GPa) and YB4 (185...

  10. Magnetism in Sc-doped ZnO with zinc vacancies: A hybrid density functional and GGA + U approaches

    KAUST Repository

    Kanoun, Mohammed

    2012-04-01

    We investigate the zinc vacancy effects on the electronic structures and magnetic properties of Sc-doped ZnO, by performing first-principles calculations within both GGA + U and Heyd-Scuseria-Ernzerhof hybrid functional methods. We find that Sc impurities stabilize considerably Zn vacancies. The electronic and magnetic analysis shows a half metallic ferromagnetic character with a total magnetic moment of 2.01 μ B. The magnetism mainly stems from the O 2p states around the Zn vacancies. Calculations with the hybrid density functional agree with the GGA + U results but give an accurate description of the electronic structure for pure ZnO and Sc-doped ZnO with Zn vacancies. © 2012 Elsevier B.V. All rights reserved.

  11. Study of Microbiologically Induced Corrosion Action on Al-6Mg-Zr and Al-6Mg-Zr-Sc

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The corrosion behaviors of Al-6Mg-Zr and Al-6Mg-Zr-Sc in the sulfate-reducing bacteria (SRB) solution in anaerobic environment were studied using electrochemical, microbiological, and surface analysis methods. It was found that the oxide film was more compact owing to the addition of Sc resulting in the open circuit potential shifting by about 100mV positively. On the other hand, it was seen that the pitting sensitivity of Al-6Mg-Zr-Sc alloy in SRB solution decreased and its microbiologically influenced corrosion resistance was improved. Pitting corrosion occurring on the surface of the two alloys under the comprehensive action of the metabolism of SRB was observed by SEM. It was obtained by EDS that the corrosion degree increased with time and corrosion was furthered by deposition of the product.

  12. MANAGEMENT ASPECTS IN THE PERSONNEL REMUNERATION AND STIMULATION ACTIVITIES AT S.C. TASMANIA S.R.L.

    Directory of Open Access Journals (Sweden)

    Marin IONICĂ

    2012-12-01

    Full Text Available Through this scientific research report “MANAGEMENT ASPECTS IN THE PERSONNEL REMUNERATION AND STIMULATION ACTIVITIES AT S.C. TASMANIA S.R.L.” we plan to investigate the remuneration and stimulation method from the human resources department within S.C. Tasmania. Studying in detail the personnel’s remuneration and stimulation we have tried to present the main policy aspects at S.C. Tasmania in human resources domain: integration of the human resource management in the overall management of the company, creating a favorable climate for conducting the activities,professional development, evaluation and motivation, employee involvement in the decision making process.We conclude that the development of management theory and practice in personnel remuneration and stimulation in an open field for performance and professionalism of the managerial team of Tasmania S.R.L.

  13. Construction of a human functional single-chain variable fragment (scFv) antibody recognizing the malaria parasite Plasmodium falciparum.

    Science.gov (United States)

    Wajanarogana, Sumet; Prasomrothanakul, Teerawat; Udomsangpetch, Rachanee; Tungpradabkul, Sumalee

    2006-04-01

    Falciparum malaria is one of the most deadly and profound human health problems around the tropical world. Antimalarial drugs are now considered to be a powerful treatment; however, there are drugs currently being used that are resistant to Plasmodium falciparum parasites spreading in different parts of the world. Although the protective immune response against intraerythrocytic stages of the falciparum malaria parasite is still not fully understood, immune antibodies have been shown to be associated with reduced parasite prevalence. Therefore antibodies of the right specificity present in adequate concentrations and affinity are reasonably effective in providing protection. In the present study, VH (variable domain of heavy chain) and VL (variable domain of light chain) were isolated from human blood lymphocytes of P. falciparum in one person who had high serum titre to RESA (ring-infected erythrocyte surface antigen). Equal amounts of VH and VL were assembled together with universal linker (G4S)3 to generate scFvs (single-chain variable fragments). The scFv antibodies were expressed with a phage system for the selection process. Exclusively, an expressed scFv against asynchronous culture of P. falciparum-infected erythrocytes was selected and characterized. Sequence analysis of selected scFv revealed that this clone could be classified into a VH family-derived germline gene (VH1) and Vkappa family segment (Vkappa1). Using an indirect immunofluorescence assay, we could show that soluble expressed scFv reacted with falciparum-infected erythrocytes. The results encourage the further study of scFvs for development as a potential immunotherapeutic agent.

  14. Functional characterization of an scFv-Fc antibody that immunotherapeutically targets the common cancer cell surface proteoglycan CSPG4.

    Science.gov (United States)

    Wang, Xinhui; Katayama, Akihiro; Wang, Yangyang; Yu, Ling; Favoino, Elvira; Sakakura, Koichi; Favole, Alessandra; Tsuchikawa, Takahiro; Silver, Susan; Watkins, Simon C; Kageshita, Toshiro; Ferrone, Soldano

    2011-12-15

    Cell surface chondroitin sulfate proteoglycan 4 (CSPG4) is an attractive target for antibody-based cancer immunotherapy because of its role in tumor cell biology, its high expression on malignant cells including cancer-initiating cells, and its restricted distribution in normal tissues. The clinical use of CSPG4 has been hampered by the lack of a CSPG4-specific chimeric, humanized, or fully human monoclonal antibody. To overcome this limitation, we generated a CSPG4-specific fully human single-chain antibody termed scFv-FcC21 and characterized its specificity and antitumor activity. Viable CSPG4(+) melanoma cells were used in a screen of a human scFv phage display library that included CDR3 engineered to optimize antibody binding sites. The scFv antibody isolated was then recombinantly engineered with a human immunoglobulin G1 Fc region to construct the fully human antibody scFv-FcC21, which recognized tumors of neuroectodermal origin, various types of carcinomas, mesotheliomas, and sarcomas as well as myeloid leukemias. scFv-FcC21 inhibited in vitro growth and migration of tumor cells and in vivo growth of human tumor xenografts. These effects were mediated by inhibition of the activation of extracellular signal-regulated kinase and focal adhesion kinase signaling pathways that are critical for tumor cell growth and migration, respectively. Our findings define the CSPG4-specific fully human scFv-FcC21 antibody as a candidate therapeutic agent to target the many types of tumors that express CSPG4.

  15. Generation of functional scFv intrabody to abate the expression of CD147 surface molecule of 293A cells

    Directory of Open Access Journals (Sweden)

    Mai Sabine

    2008-01-01

    Full Text Available Abstract Background Expression of intracellular antibodies (intrabodies has become a broadly applicable technology for generation of phenotypic knockouts in vivo. The method uses surface depletion of cellular membrane proteins to examine their biological function. In this study, we used this strategy to block the transport of cell surface molecule CD147 to the cell membrane. Phage display technology was introduced to generate the functional antibody fragment to CD147, and we subsequently constructed a CD147-specific scFv that was expressed intracellularly and retained in the endoplasmic reticulum by adenoviral gene transfer. Results The recombinant antibody fragments, Fab and scFv, of the murine monoclonal antibody (clone M6-1B9 reacted specifically to CD147 by indirect enzyme-linked immunosorbent assays (ELISA using a recombinant CD147-BCCP as a target. This indicated that the Fab- and scFv-M6-1B9 displaying on phage surfaces were correctly folded and functionally active. We subsequently constructed a CD147-specific scFv, scFv-M6-1B9-intrabody, in 293A cells. The expression of CD147 on 293A cell surface was monitored at 36 h after transduction by flow cytometry and demonstrated remarkable reduction. Colocalization of scFv-M6-1B9 intrabody with CD147 in the ER network was depicted using a 3D deconvolution microscopy system. Conclusion The results suggest that our approach can generate antibody fragments suitable for decreasing the expression of CD147 on 293A cells. This study represents a step toward understanding the role of the cell surface protein, CD147.

  16. Structure and Dynamics of Forsterite-scCO2/H2O Interfaces as a Function of Water Content

    Energy Technology Data Exchange (ETDEWEB)

    Kerisit, Sebastien N.; Weare, John H.; Felmy, Andrew R.

    2012-05-01

    Molecular dynamics (MD) simulations of forsterite surfaces in contact with supercritical carbon dioxide (scCO2) fluids of varying water content were performed to determine the partition of water between the scCO2 fluid and the mineral surface, the nature of CO2 and H2O bonding at the interface, and the regions of the interface that may be conducive to HxCO3(2-x)- formation. Calculations of the free energy of the associative adsorption of water onto the (010) forsterite surface from the scCO2 phase indicated that the formation of a water film up to three-monolayer thick can be exothermic even for water contents below the water saturation concentration of the scCO2 fluid. In MD simulations of scCO2/H2O mixtures in contact with the (010) forsterite surface, H2O was found to readily displace CO2 at the surface and, therefore, CO2 directly contacted the surface only for water coverages below two monolayers. For thicker water films, a two-monolayer hydration layer formed that CO2 could not penetrate. Simulations of the hydroxylated (010) surface and of the (011) surface suggested that this conclusion can be extended to forsterite surfaces with different surface structures and/or compositions. The density, diffusion, and degree of hydration of CO2 as well as the extent of CO2/H2O mixing at the interface were all predicted to depend strongly on the thickness of the water-rich film, i.e., on the water content of the scCO2 fluid.

  17. Structure and dynamics of forsterite-scCO2/H2O interfaces as a function of water content

    Science.gov (United States)

    Kerisit, Sebastien; Weare, John H.; Felmy, Andrew R.

    2012-05-01

    Molecular dynamics (MD) simulations of forsterite surfaces in contact with supercritical carbon dioxide (scCO2) fluids of varying water content were performed to determine the partition of water between the scCO2 fluid and the mineral surface, the nature of CO2 and H2O bonding at the interface, and the regions of the interface that may be conducive to HCO3(2-x)- formation. Calculations of the free energy of the associative adsorption of water onto the (0 1 0) forsterite surface from the scCO2 phase indicated that the formation of a water film up to three-monolayer thick can be exothermic even for water contents below the water saturation concentration of the scCO2 fluid. In MD simulations of scCO2/H2O mixtures in contact with the (0 1 0) forsterite surface, H2O was found to readily displace CO2 at the surface and, therefore, CO2 directly contacted the surface only for water coverages below two monolayers. For thicker water films, a two-monolayer hydration layer formed that CO2 could not penetrate. The MD simulations thus suggest that, in the presence of sufficient water, HCO3(2-x)- formation occurs in the water films and not via direct reaction of CO2 with the forsterite surface. Simulations of the hydroxylated (0 1 0) surface and of the (0 1 1) surface suggested that this conclusion can be extended to forsterite surfaces with different surface structures and/or compositions. The density, diffusion, and degree of hydration of CO2 as well as the extent of CO2/H2O mixing at the interface were all predicted to depend strongly on the thickness of the water-rich film, i.e., on the water content of the scCO2 fluid.

  18. Effects of zirconium element on the microstructure and deuterium retention of W-Zr/Sc2O3 composites.

    Science.gov (United States)

    Chen, Hongyu; Luo, Laima; Chen, Jingbo; Zan, Xiang; Zhu, Xiaoyong; Xu, Qiu; Luo, Guangnan; Chen, Junling; Wu, Yucheng

    2016-09-06

    Dense W and W-Zr composites reinforced with Sc2O3 particles were produced through powder metallurgy and subsequent spark plasma sintering (SPS) at 1700 °C and 58 MPa. Results showed that the W-1vol.%Zr/2vol.%Sc2O3 composites exhibited optimal performance with the best relative density of up to 98.93% and high Vickers microhardness of approximately 583 Hv. The thermal conductivity of W-Zr/Sc2O3 composites decreased initially and then increased as the Zr content increased. The moderate Zr alloying element could combine well with Sc2O3 particles and W grains and form a solid solution. However, excess Zr element leads to agglomeration in the grain boundaries. W-1vol.%Zr/2vol.%Sc2O3 composite had a good deuterium irradiation resistance very closing to pure tungsten compared with the other Zr element contents of composites. Under 500 K, D2 retention and release of them were similar to those of commercial tungsten, even lower between 400 K to 450 K. Pre-irradiation with 5 keV-He(+) ions to a fluence of 1 × 10(21) He(+)/m(2) resulted in an increase in deuterium retention (deuterium was implanted after He(+) irradiation), thereby shifting the desorption peak to a high temperature from 550 K to 650 K for the W-1vol.%Zr/2vol.%Sc2O3 composite.

  19. Subnuclear compartmentalization of transiently expressed polyadenylated pri-microRNAs: processing at transcription sites or accumulation in SC35 foci.

    Science.gov (United States)

    Pawlicki, Jan M; Steitz, Joan A

    2009-02-01

    MicroRNAs (miRNAs) are small, noncoding RNAs that post-transcriptionally regulate expression of their target messenger RNAs. We recently demonstrated that primary miRNA transcripts (pri-miRNAs) retained at transcription sites are processed with enhanced efficiency, suggesting that pri-miRNA processing is coupled to transcription in mammalian cells. We also observed that transiently expressed pri-miRNAs accumulate in nuclear foci with splicing factor SC35 and Microprocessor components, Drosha and DGCR8. Here, we show that pri-miRNAs containing a self-cleaving hepatitis delta ribozyme accumulate in the nucleoplasm after release from their transcription sites, but are not efficiently processed. Pri-miRNAs with ribozyme-generated 3' ends do not localize to SC35-containing foci, whereas cleaved and polyadenylated pri-miRNA transcripts with or without the pre-miRNA hairpin do. Pri-miRNA/SC35 foci contain a number of proteins normally associated with SC35 domains, including ASF/SF2, PABII, and the prolyl isomerase, Pin1. In contrast, RNA polymerase II and PM/Scl-100 do not strongly colocalize with pri-miRNAs in SC35-containing foci. These data argue that pri-miRNA/SC35-containing foci are not major sites of pri-miRNA processing and that pri-miRNA processing is coupled to transcription. We discuss the implications of our findings relative to recent insights into miRNA biogenesis, mRNA metabolism, and the nuclear organization of gene expression.

  20. A molecular dynamics study of chloride binding by the cryptand SC24

    Science.gov (United States)

    Owenson, B.; MacElroy, R. D.; Pohorille, A.

    1988-01-01

    The capture of chloride from water by the tetraprotonated form of the spherical macrotricyclic molecule SC24 was studied using molecular dynamics simulation methods. This model ionophore represents a broad class of molecules which remove ions from water. Two binding sites for the chloride were found, one inside and one outside the ligand. These sites are separated by a potential energy barrier of approximately 20 kcal mol-1. The major contribution to this barrier comes from dehydration of the chloride. The large, unfavorable dehydration effect is compensated for by an increase in electrostatic attraction between the oppositely charged chloride and cryptand, and by energetically favorable rearrangements of water structure. Additional assistance in crossing the barrier and completing the dehydration of the ion is provided by the shift of three positively charged hydrogen atoms of the cryptand towards the chloride. This structural rigidity is partially responsible for its selectivity.

  1. Redesigning Introductory Science Courses to Teach Sustainability: Introducing the L(SC)2 Paradigm

    Science.gov (United States)

    Myers, J. D.; Campbell-Stone, E.; Massey, G.

    2008-12-01

    Modern societies consume vast quantities of Earth resources at unsustainable levels; at the same time, resource extraction, processing, production, use and disposal have resulted in environmental damage severe enough to threaten the life-support systems of our planet. These threats are produced by multiple, integrative and cumulative environmental stresses, i.e. syndromes, which result from human physical, ecological and social interactions with the environment in specific geographic places. In recent decades, recognition of this growing threat has lead to the concept of sustainability. The science needed to provide the knowledge and know-how for a successful sustainability transition differs markedly from the science that built our modern world. Sustainability science must balanced basic and applied research, promote integrative research focused on specific problems and devise a means of merging fundamental, general scientific principles with understanding of specific places. At the same time, it must use a variety of knowledge areas, i.e. biological systems, Earth systems, technological systems and social systems, to devise solutions to the many complex and difficult problems humankind faces. Clearly, sustainability science is far removed from the discipline-based science taught in most U.S. colleges. Many introductory science courses focus on content, lack context and do not integrate scientific disciplines. To prepare the citizens who will confront future sustainability issues as well as the scientists needed to devise future sustainability strategies, educators and scientists must redesign the typical college science course. A new course paradigm, Literacies and Scientific Content in Social Context (L(SC)2), is ideally suited to teach sustainability science. It offers an alternative approach to liberal science education by redefining and expanding the concept of the interdisciplinary course and merging it with the integrated science course. In addition to

  2. The ASCI Network for SC '98: Dense Wave Division Multiplexing for Distributed and Distance Computing

    Energy Technology Data Exchange (ETDEWEB)

    Adams, R.L.; Butman, W.; Martinez, L.G.; Pratt, T.J.; Vahle, M.O.

    1999-06-01

    This document highlights the DISCOM's Distance computing and communication team activities at the 1998 Supercomputing conference in Orlando, Florida. This conference is sponsored by the IEEE and ACM. Sandia National Laboratories, Lawrence Livermore National Laboratory, and Los Alamos National Laboratory have participated in this conference for ten years. For the last three years, the three laboratories have a joint booth at the conference under the DOE's ASCI, Accelerated Strategic Computing Initiatives. The DISCOM communication team uses the forum to demonstrate and focus communications and networking developments. At SC '98, DISCOM demonstrated the capabilities of Dense Wave Division Multiplexing. We exhibited an OC48 ATM encryptor. We also coordinated the other networking activities within the booth. This paper documents those accomplishments, discusses the details of their implementation, and describes how these demonstrations support overall strategies in ATM networking.

  3. Optical and electronic properties of double perovskite Ba2ScSbO6

    Science.gov (United States)

    Ray, Rajyavardhan; Himanshu, A. K.; Lahiri, J.; Kumar, Uday; Sen, Pintu; Bandyopadhyay, S. K.; Sinha, T. P.

    2016-05-01

    The ordered double perovskite Ba2ScSbO6 (BSS) has been synthesized in polycrystalline form by solid state reaction at 1400 C for 72 Hrs. Structural characterization of the compound was done through X-ray diffraction (XRD) followed by Rietveld analysis. The crystal structure is cubic, with space group Fm-3m (No. 225) and lattice parameter, a = 8.20 Ǻ. Optical band-gap has been calculated using UV-Vis Spectroscopy and Kubelka-Munk (KM) function, yielding 4.23 eV. A detailed Ab-initio Density Functional Theory (DFT) study of the electronic properties has been carried out using the Full-Potential Linear Augmented Plane Wave (FP-LAPW) as implemented in WIEN2k. BSS is found to be a large band-gap insulator with potential technological applications.

  4. X-class flares released during the decline phase of The SC- 24

    Science.gov (United States)

    Hady, A. A., II; Hassan, M. M., II

    2015-12-01

    During the decline phase of Solar Cycle 24(Sc-24), releases of X-class flare possessing high energetic particles. This flare event was more intense than that occurred during the main peak of this cycle. Additional eruptive X-class flares were later released during the year 2014and 2015. The aim of this work is to forecast the release of eruptive events a few days before taking place, and to follow the changes of the active region recorded before, during, and after the production of X-class flares. The analysis is performed on the solar and geomagnetic data of the most eruptive events in 2014and 2015 during the double peak of solar cycle 24. The effects of the eruptive X -flares clearly appeared in the accumulation curve only on three parameters: X -ray Background Flux, Optical Flares intensity and X-ray Flares intensity. The changes started, at least, one day before the release of X-class flares.

  5. Three New .β-Resorcylic Acid Lactones from Paecflomyces sp. SC0924

    Institute of Scientific and Technical Information of China (English)

    徐良雄; 薛琮花; 邹永; 何树杰; 魏孝义

    2012-01-01

    Three new β-resorcylic acid lactones (RALs), paecilomycins G-I (1--3), and eight known compounds, aigia- lomycins B--D (4--6), 1',2'-epoxy aigialomycin D (7), zearalenone (8), 7'-dehydrozearalenone (9), and trans-7',8'-dehydrozearalenol (10), antibiotic LL-Z1640-1 (11), were isolated from the mycelial solid culture of Paecilomyces sp. SC0924. Their structures were established by spectroscopic methods and chemical means. In an assessment of antifungal activity by the well plate diffusion method, five known RALs, 4-7 and 11 showed weak activities against Peronophythora litchii.

  6. Multiuser subcarriers and bit allocation combining adaptive mapping for SC-FDMA system

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yu-mei; XIN Yu; YANG Da-cheng

    2008-01-01

    In this article, a multiuser single carrier frequency division multiple access (SC-FDMA) system is considered, based on which an adaptive subcarrier and bit allocation algorithm is investigated. The algorithm has been used to achieve a subcarrier mapping mode in this system, which combines the advantages of single- and multi-carrier transmissions, such as, low peak to average power ratio, orthogonality of signals of different users, and low complexity. Simulation results show that it has a similar performance as that of the adaptive allocation algorithm in the orthogonal frequency division multiple (OFDM) system and the proposed mapping mode has a performance gain over the two existing mapping modes at the link level.

  7. A theoretical study of the elastic and thermal properties of ScRu compound under pressure

    Science.gov (United States)

    Huang, Shuo; Li, Rui-Zi; Qi, San-Tao; Chen, Bao; Shen, Jiang

    2014-06-01

    The elastic and thermal properties of ScRu under pressure are studied using a first-principles pseudopotential method within the generalized gradient approximation. The calculated lattice parameter and formation enthalpy are in good agreement with the previous experimental and theoretical results. From the static finite strain technique, we obtained three independent elastic constants (C 11, C 12 and C 44) and various secondary elasticity parameters such as shear modulus, Young’s modulus and elastic anisotropy, as functions of pressure. This study also provided the pressure and temperature variations of the bulk modulus, Debye temperature, thermal expansion coefficient and heat capacity in wide pressure (0-60 GPa) and temperature (0-1800 K) ranges.

  8. Thermodynamic assessments of the Fe-Y and Ni-Sc systems

    Directory of Open Access Journals (Sweden)

    Kardellass S.

    2013-07-01

    Full Text Available The present study concerns the optimization of the Fe-Y and Ni-Sc systems by the help of the CALPHAD (CALculation of Phase Diagram method, taking into account the available experimental results about phase equilibria and thermodynamic properties. The excess terms of the Gibbs energy of the solution phases (liquid, b.c.c., f.c.c. and h.c.p. were assessed with the recent exponential temperature dependence of the interaction energies by Kaptay and compared with the linear dependence by Redlich-Kister. Furthermore, the computer program Thermo-Calc allows to obtain estimated data for experimentally undetermined thermodynamic properties and to compare the computed phase diagrams with those already published.

  9. Theoretical determination of lifetimes of metastable states in Sc III and Y III

    CERN Document Server

    Sahoo, B K; Das, B P; Chaudhuri, R K; Mukherjee, D

    2007-01-01

    Lifetimes of the first two metastable states in Sc^{2+} and Y^{2+} are determined using the relativistic coupled-cluster theory. There is a considerable interest in studying the electron correlation effects in these ions as though their electronic configurations are similar to the neutral alkali atoms, their structures are very different from the latter. We have made a comparative study of the correlation trends between the above doubly ionized systems with their corresponding neutral and singly ionized iso-electronic systems. The lifetimes of the excited states of these ions are very important in the field of astrophysics, especially for the study of post-main sequence evolution of the cool giant stars.

  10. Systematics in back-angle alpha-particle scattering: Sc, Ti, V, and Cr isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Eberhard, K.A.; Wit, M.; Schiele, J.; Trombik, W.; Zipper, W.; Schiffer, J.P.

    1976-12-01

    Elastic ..cap alpha..-scattering cross sections from /sup 45/Sc, /sup 49/,/sup 50/Ti, /sup 50/,/sup 52/,/sup 53/Cr and /sup 50/,/sup 51/V have been measured between 140degree and 180degree at a bombarding energy of E/sub b/(lab) = 25 MeV. All angular distributions are similar and show no evidence of an anomalous backward enhancement. No evidence for a spin dependence of the cross section within experimental uncertainties, is found for these nuclei, where the spins range from I = 0 (/sup 50/Ti, /sup 50/Cr) to I = 6 (/sup 50/V). Back-angle integrated cross sections (140degree--180degree) are compared with neighbor target nuclei between A approx. = 40 and A approx. = 60. (AIP)

  11. INTERVIEW WITH MRS. SIMONA CAROBENE, ADMINISTRATOR OF SC PROIECT MOZAIC SRL

    Directory of Open Access Journals (Sweden)

    Gheorghe Pascaru

    2013-12-01

    Full Text Available The mosaic factory, recorded at the Registry of Commerce Office in the month of April 2012 was created within a non-reimbursable European financed project and currently has the status of authorized protected unit. There are ten young people who were institutionalized and who have difficulties to become integrated in the social and professional life. The social enterprise SC Proiect Mozaic SRL is the result of a meeting between the social sector, the non-profit sector and the business sector because it has at its basis a partnership with an important group of companies from the field of constructions and interior design from Bucharest. In parallel with the activity of producing mosaic, the Mosaic project provides occasionally to its clients also services of products packaging and assembly.

  12. Sum rates of asynchronous GFDMA and SC-FDMA for 5G uplink

    Directory of Open Access Journals (Sweden)

    Woojin Park

    2015-12-01

    Full Text Available The fifth generation (5G of mobile communication envisions ultralow latency less than 1 ms for radio interface. To this end, frameless asynchronous multiple access may be needed to allow users to transmit instantly without waiting for the next frame start. In this paper, generalized frequency division multiple-access (GFDMA, one of the promising multiple-access candidates for 5G mobile, is compared with the conventional single-carrier FDMA (SC-FDMA in terms of the uplink sum rate when both techniques are adapted for the asynchronous scenario. In particular, a waveform windowing technique is applied to both schemes to mitigate the inter-user interference due to non-zero out-of-band emission.

  13. Microstructure and Mechanical Properties of an Al-Li-Mg-Sc-Zr Alloy Subjected to ECAP

    Directory of Open Access Journals (Sweden)

    Anna Mogucheva

    2016-10-01

    Full Text Available The effect of post-deformation solution treatment followed by water quenching and artificial aging on microstructure and mechanical properties of an Al-Li-Mg-Sc-Zr alloy subjected to equal-channel angular pressing (ECAP was examined. It was shown that the deformed microstructure produced by ECAP remains essentially unchanged under solution treatment. However, extensive grain refinement owing to ECAP processing significantly affects the precipitation sequence during aging. In the aluminum-lithium alloy with ultrafine-grained (UFG microstructure, the coarse particles of the S1-phase (Al2LiMg precipitate on high-angle boundaries; no formation of nanoscale coherent dispersoids of the δ′-phase (Al3Li occurs within grain interiors. Increasing the number of high-angle boundaries leads to an increasing portion of the S1-phase. As a result, no significant increase in strength occurs despite extensive grain refinement by ECAP.

  14. MAPEAMENTO DA SUSCEPTIBILIDADE A DESLIZAMENTOS NA BACIA HIDROGRÁFICA DO CAETÉ, ALFREDO WAGNER/SC

    Directory of Open Access Journals (Sweden)

    Leandro Redin Vestena

    2010-01-01

    Full Text Available Este artículo tiene como objetivo identifi car y mapear la susceptibilidad de deslizamientos de tierra en la cuenca hidrográfi ca del municipio de Caeté Alfredo Wagner/SC, región montañosa del Estado de Santa Catarina. Se utilizó el modelo SINMAP (Stability Index Mapping para determinar el indice de estabilidad de taludes por medio de la combinación de un modelo hidrológico con un de estabilidad de taludes. Los resultados obtenidos mostran la presencia de zonas con elevado grado de inestabilidad de las laderas y con grado de estabilidad intermedia, que pueden ser fácilmente alteradas por actividades humanas, principalmente por la eliminación de la cubertura vegetal. El conocimiento previo de las zonas susceptibles a deslizamientos y resbalos subvencionan acciones de prevención y mitigación.

  15. AB INITIO CALCULATION OF THE ELASTIC AND OPTICAL PROPERTIES OF AL3SC COMPOUND

    Institute of Scientific and Technical Information of China (English)

    M. Song; D.H. Xiao

    2007-01-01

    The ab initio method has been performed to explore the elastic and optical properties of Al3Sccompound, based on a plane wave pseudopotential method. It can be seen that the calculatedequilibrium lattice parameter and elastic constants are in reasonable agreement with the previousexperimental data. The elastic constants satisfy the requirement for mechanical stability in the cubicstructure of the Al3Sc compound. The optical property calculations show that a strong absorptivepeak exists from 0-15eV and a relative small absorptive peak exists around 30eV. The form iscaused by the optical transitions between high s, p, and d bands, and the latter results from theoptical transitions from high s, p, and d bands to the low 2p band.

  16. Final Scientific/Technical Report from Hofstra University on DE-SC0001985

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, E. Christa [Hofstra Univ., Hempstead, NY (United States)

    2016-12-20

    The U.S. Department of Energy award DE-SC0001985 funded the Hofstra University Center for Climate Study (HUCCS) from 29 September 2009 through 1 October 2016. This support enabled several activities over the period of the grant, including 1) the pursuit of several research projects, including sediment coring of coastal marshes, analysis of habitat impact due to climate change, and effects of raindrops of CO2 transfer; 2) support for multiple graduate and undergraduate students, and sponsorship of research projects that involved high school students; 3) fostering mentoring relationships and networking; 4) the design, creation, and installation of an exhibit on climate change at the Cradle of Aviation Museum in Garden City, NY as an effort of public outreach. A total of 11 presentations at conferences, one book, and one peer-reviewed journal article resulted from these activities.

  17. Chevaliers de la scène à l’écran

    Directory of Open Access Journals (Sweden)

    Sandra Gorgievski

    2012-08-01

    Full Text Available Le metteur en scène et acteur français Denis Llorca a dirigé le Centre dramatique national de Franche-Comté (1982-1991, avec lequel il a monté d’audacieux spectacles au texte dense, à la durée inhabituelle pour le spectateur moderne : Kings (1978 d’après Shakespeare [dix heures] ; Eux, les possédés (1982 d’après Dostoïevski [huit heures], ou encore Quatre Saisons pour les Chevaliers de la Table Ronde (1989 d’après la légende arthurienne [12 heures]. Avec sa propre compagnie, il a ensuite porté à la scène un projet de sept spectacles s’inspirant des mystères médiévaux, avec des textes empruntés à la Torah, aux Évangiles et au Coran, où le sublime se mêle au grotesque. Dans cet entretien, le réalisateur revient sur ses multiples visions du Moyen Âge dans sa recréation du mythe arthurien au théâtre, mais aussi à l’écran, dans le film qu’il a tiré de la pièce: Les Chevaliers de la Table Ronde (1990 avec Maria Casarès, Alain Cuny et Michel Vitold.

  18. Relationship Between Net Photosynthetic Rate of Cassava SC205 and Its Physio-ecological Factors

    Institute of Scientific and Technical Information of China (English)

    Yong SONG; Xuan LIN; Jinhui YANG; Yuping DENG; Xingyao XIONG

    2014-01-01

    [Objective]The aim was to measure photosynthetic characters of SC 205, a cassava cultivar, and explore the relationships of the net photosynthetic rate (Pn) with physiological and ecological factors. [Method] The diurnal variations of photosyn-thesis in leaves of SC205 were studied by LICOR-6400 portable photosynthesis system, and the relationships of the net photosynthetic rate (Pn) with physiological and ecological factors were studied by simple correlation analysis and path analysis. [Result] The curve of diurnal variation of Pn showed single peak at 10:00 am at 24.07 μ mol CO2 m2/s, without showing midday depression; the diurnal changes of stomatal conductance (Gs), transpiration rate (Tr), leaf temperature (Tl), air tempera-ture (Ta) and photosynthetic active radiation (PAR) al showed single peak curves, and there were positive relationships of Pn with Gs, Tr, Tl, Ta and PAR. The diur-nal variations of intercellular CO2 concentration (Ci), atmospheric CO2 concentration (Ca), relative humidity (RH) showed in a U-shape curve. There were highly signifi-cant positive correlation of Pn with Gs and PAR; the diurnal variation of Pn had highly significant negative correlations with Ci and Ca. The direct impact of physio-logical factors on Pn was as fol ows: Ci>Gs>Tl>Tr, and the direct impact of ecologi-cal factors was RH>PAR>Ca>Ta. [Conclusion] The research showed that Ci, Gs and Tr play very important roles in the changes of Pn among the physiological fac-tors, and PAR and Ca affect the changes of Pn among the ecological factors.

  19. Electronic structure of the [MNH2]+ (M = Sc-Cu) complexes.

    Science.gov (United States)

    Hendrickx, Marc F A; Clima, Sergiu

    2006-11-23

    B3LYP geometry optimizations for the [MNH2]+ complexes of the first-row transition metal cations (Sc+-Cu+) were performed. Without any exception the ground states of these unsaturated amide complexes were calculated to possess planar geometries. CASPT2 binding energies that were corrected for zero-point energies and including relativistic effects show a qualitative trend across the series that closely resembles the experimental observations. The electronic structures for the complexes of the early and middle transition metal cations (Sc+-Co+) differ from the electronic structures derived for the complexes of the late transition metal cations (Ni+ and Cu+). For the former complexes the relative higher position of the 3d orbitals above the singly occupied 2p(pi) HOMO of the uncoordinated NH2 induces an electron transfer from the 3d shell to 2p(pi). The stabilization of the 3d orbitals from the left to the right along the first-row transition metal series causes these orbitals to become situated below the HOMO of the NH2 ligand for Ni+ and Cu+, preventing a transfer from occurring in the [MNH2]+ complexes of these metal cations. Analysis of the low-lying states of the amide complexes revealed a rather unique characteristic of their electronic structures that was found across the entire series. Rather exceptionally for the whole of chemistry, pi-type interactions were calculated to be stronger than the corresponding sigma-type interactions. The origin of this extraordinary behavior can be ascribed to the low-lying sp2 lone pair orbital of the NH2 ligand with respect to the 3d level.

  20. Thermal-hydraulic analysis of SWAMUP facility using ATHLET-SC code

    Directory of Open Access Journals (Sweden)

    Zidi eWang

    2015-03-01

    Full Text Available During the loss of coolant accident (LOCA of supercritical water cooled reactor (SCWR, the pressure in the reactor system will undergo a rapid decrease from the supercritical pressure to the subcritical condition. This process is called trans-critical transients, which is of crucial importance for the LOCA analysis of SCWR. In order to simulate the trans-critical transient, a number of system codes for SCWR have been developed up to date. However, the validation work for the trans-critical models in these codes is still missing. The test facility Supercritical WAter MUltiPurpose loop (SWAMUP with 2×2 rod bundle in Shanghai Jiao Tong University (SJTU will be applied to provide test data for code validation. Some pre-test calculations are important and necessary to show the feasibility of the experiment. In this study, trans-critical transient analysis is performed for the SWAMUP facility with the system code ATHLET-SC, which is modified in SJTU, for supercritical water system. This paper presents the system behavior e.g. system pressure, coolant mass flow, cladding temperature during the depressurization. The effects of some important parameters such as heating power, depressurization rate on the system characteristics are also investigated in this paper. Additionally, some sensitivities study of the code models, e.g. heat transfer coefficient, CHF correlation, are analyzed and discussed. The results indicate that the revised system code ATHLET-SC is capable of simulating thermal hydraulic behavior during the trans-critical transient. According to the results, the cladding temperature during the transient is kept at a low value. However, the pressure difference of the heat exchanger after depressurization could reach 6 MPa, which should be considered in the experiment.

  1. The ST ScI Digitized Sky Surveys and the Second Guide Star Catalog

    Science.gov (United States)

    Lasker, Barry M.; STSCI Sky-Survey Team

    1998-05-01

    The new modern sky surveys from the Palomar Oschin Schmidt and the UK Schmidt are nearly complete. The predominant community applications of these surveys, for both research directly dependent on the images and that using catalogues produced from them, is based on digitizations of the photographic material. The ST ScI Second Digitized Sky Survey (DSS-II) samples these plates at 1" interval, resulting in 4 Tbyte collection of 1.1 Gbyte plate-images. Raw images are archived on opical media at ST ScI, are distributed to a small number of international sites that provide community access, and are used to produce the second Guide Star Catalog (GSC-II). In order to preserve generality in the exploitation of these data, we maintain the connection between the images (plate scans) and the GSC-II catalog objects by associating the plate-calibration data (astrometry, photometry, classification) in FITS-like header structures pertinent to each plate. GSC-II plate processing, with a goal of producing positions, proper motions, magnitudes, and colors to the plate limit, is organized in the COMPASS database. COMPASS, an object-oriented system with an estimated size at completion of 4 Tbytes, is structured for optimizing calibrations and is organized on the sky with the hierarchical triangulated mesh developed by the SDSS Archive team. COMPASS is also used to support consistent object naming between plates, as well as cross-matching with other optical surveys and with data from other wavebands. A much smaller ``export" catalogue, in ESO SkyCat format, will also be produced.

  2. The use of scFv-displaying yeast in mammalian cell surface selections.

    Science.gov (United States)

    Wang, Xin Xiang; Shusta, Eric V

    2005-09-01

    Yeast surface display has proven to be a powerful tool for the directed evolution of immunological proteins when soluble ligands are available (Cho, B.K., Kieke, M.C., Boder, E.T., Wittrup, K.D., Kranz, D.M., 1998. A yeast surface display system for the discovery of ligands that trigger cell activation. J. Immunol. Methods 220, 179; Boder, E.T., Midelfort, K.S., Wittrup, K.D., 2000. Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity. Proc. Natl. Acad. Sci. U. S. A. 97, 10701; Shusta, E.V., Holler, P.D., Kieke, M.C., Kranz, D.M., Wittrup, K.D., 2000. Directed evolution of a stable scaffold for T-cell receptor engineering. Nat. Biotechnol. 18, 754; Esteban, O., Zhao, H., 2004. Directed evolution of soluble single-chain human class II MHC molecules. J. Mol. Biol. 340, 81). This investigation extends the utility of this display platform by demonstrating its capacity for use in cell panning selections. This was accomplished by employing a model single-chain antibody (scFv)-hapten system that allowed for detailed investigation of the factors governing panning success. Yeast displaying anti-fluorescein scFv (4-4-20) exhibited specific interactions with the fluoresceinated endothelial cells and could be recovered from large backgrounds of irrelevant yeast in just three rounds. Successful selections required as few as 1700 fluorescein ligands per cell, and a three-round enrichment ratio of 10(6) was possible. These results indicate that yeast surface display is a viable option for use in cell or tissue-based selections.

  3. The pseudogap and anisotropic thermal expansion in RMn(4)Al(8) (R = La,Y,Lu and Sc).

    Science.gov (United States)

    Muro, Y; Nakamura, H; Kohara, T

    2006-04-26

    The temperature dependence of the magnetic susceptibility shows a broad maximum at ∼550 and 630 K for LuMn(4)Al(8) and ScMn(4)Al(8), respectively, which can be interpreted as due to the presence of a pseudogap in the effective bands as in LaMn(4)Al(8) and YMn(4)Al(8). The anisotropic thermal expansion observed for RMn(4)Al(8) (R = La, Y, Lu and Sc) and the sensitive volume dependence of the gap width throughout the RMn(4)Al(8) system suggest dominant magnetic coupling in Mn spin chains along the c axis.

  4. Upper Boundary of the Pacific Plate Subducting Under Hokkaido,Japan,Estimated from ScSp Phase

    OpenAIRE

    長田, 絹絵; 吉澤, 和範; 蓬田, 清

    2006-01-01

    Geometry of the upper boundary of the subducting Pacific plate or slab was estimated in the Hokkaido region, Japan, using the ScSp phase: the converted phase to P wave at the boundary from the S wave reflected at the core-mantle boundary and propagating nearly vertically (i.e., ScS phase). Taking the advantage of a dense seismic network named “Hi-net” recently deployed across the Japanese islands, we applied several seismic array analyses to the recorded waveform data for a large nearby deep ...

  5. Effect of radiochemical modification on biodistribution of scFvD2B antibody fragment recognising prostate specific membrane antigen.

    Science.gov (United States)

    Frigerio, Barbara; Benigni, Fabio; Luison, Elena; Seregni, Ettore; Pascali, Claudio; Fracasso, Giulio; Morlino, Sara; Valdagni, Riccardo; Mezzanzanica, Delia; Canevari, Silvana; Figini, Mariangela

    2015-11-01

    Antibody-based reagents represent a promising strategy as clinical diagnostic tools. Prostate cancer (PCa) is the second-leading cause of death in males in the Western population. There is a presently unmet need for accurate diagnostic tool to localize and define the extent of both primary PCa and occult recurrent disease. One of the most suitable targets for PCa is the prostate-specific membrane antigen (PSMA) recognised by the monoclonal antibody D2B that we re-shaped into the single chain Fv (scFv format). Aim of this study was to evaluate in preclinical in vivo models the target specificity of scFvD2B after labelling with different radionuclides. (111)In radiolabelling was performed via the chelator Bz-NOTA, and (131)I radioiodination was performed using iodogen. The potential for molecular imaging and the biological behaviour of the radiolabelled scFvD2B were evaluated in mice bearing two subcutaneous PCa isogenic cell lines that differed only in PSMA expression. Biodistribution studies were performed at 3, 9, 15 and 24h after injection to determine the optimal imaging time point. A significant kidney accumulation, as percentage of injected dose of tissue (%ID/g), was observed for (111)In-scFvD2B at 3h after injection (45%ID/g) and it was maintained up to 24h (26%ID/g). By contrast, kidney accumulation of (131)I-scFvD2B was only marginally (0.3%ID/g at 24h). At the optimal time point defined between 15h and 24h, regardless of the radionuclide used, the scFvD2B was able to localize significantly better in the PSMA expressing tumours compared to the negative control; with (131)I-scFvD2B yielding a significantly better target/background ratio compared to (111)In-scFvD2B. These data suggest that, besides antigen specificity, chemical modification may affect antibody fragment biodistribution.

  6. Crystal Growth and Properties of Co2+ doped Y3Sc2Ga3O12 Single Crystal

    Institute of Scientific and Technical Information of China (English)

    Guo Shiyi; Yuan Duorong; Shi Xuzhong; Cheng Xiufeng; Zhang Xiqing; Yu Fapeng

    2007-01-01

    Single crystal of cobalt (Co)-doped Y3Sc2Ga3O12 (YSGG) with the dimensions up to φ20×40mm3 and undoped YSGG crystal with the dimensions up to φ28×60mm3 have been grown using the Czochralski technique. The structure of the crystal was characterized by the X-ray powder diffraction (XRPD) method. The absorbance spectra of the crystal shows that it has strong absorption bands at 606 and 1540nm. The results indicate that the crystal Y3Sc2Ga3O12 may be a kind of good Q-switch material.

  7. Crystallographic information of intermediate phases in binary Mg–X (X=Sn, Y, Sc, Ag alloys

    Directory of Open Access Journals (Sweden)

    Dongyan Liu

    2015-09-01

    Full Text Available The compositions and structures of thermodynamically stable or metastable precipitations in binary Mg-X (X=Sn, Y, Sc, Ag alloys are predicted using ab-initio evolutionary algorithm. The geometry optimizations of the predicted intermetallic compounds are carried out in the framework of density functional theory (DFT [1]. A complete list of the optimized crystallographic information (in cif format of the predicted intermetallic phases is presented here. The data is related to “Predictions on the compositions, structures, and mechanical properties of intermediate phases in binary Mg–X (X=Sn, Y, Sc, Ag alloys” by Liu et al. [2].

  8. Sorafenib analogue SC-60 induces apoptosis through the SHP-1/STAT3 pathway and enhances docetaxel cytotoxicity in triple-negative breast cancer cells.

    Science.gov (United States)

    Liu, Chun-Yu; Su, Jung-Chen; Huang, Tzu-Ting; Chu, Pei-Yi; Huang, Chun-Teng; Wang, Wan-Lun; Lee, Chia-Han; Lau, Ka-Yi; Tsai, Wen-Chun; Yang, Hsiu-Ping; Shiau, Chung-Wai; Tseng, Ling-Ming; Chen, Kuen-Feng

    2017-03-01

    Recurrent triple-negative breast cancer (TNBC) needs new therapeutic targets. Src homology region 2 domain-containing phosphatase-1 (SHP-1) can act as a tumor suppressor by dephosphorylating oncogenic kinases. One major target of SHP-1 is STAT3, which is highly activated in TNBC. In this study, we tested a sorafenib analogue SC-60, which lacks angiokinase inhibition activity, but acts as a SHP-1 agonist, in TNBC cells. SC-60 inhibited proliferation and induced apoptosis by dephosphorylating STAT3 in both a dose- and time-dependent manner in TNBC cells (MDA-MB-231, MDA-MB-468, and HCC1937). By contrast, ectopic expression of STAT3 rescued the anticancer effect induced by SC-60. SC-60 also increased the SHP-1 activity, but this effect was inhibited when the N-SH2 domain (DN1) was deleted or with SHP-1 point mutation (D61A), implying that SHP-1 is the major target of SC-60 in TNBC. The use of SC-60 in combination with docetaxel synergized the anticancer effect induced by SC-60 through the SHP-1/STAT3 pathway in TNBC cells. Importantly, SC-60 also displayed a significant antitumor effect in an MDA-MB-468 xenograft model by modulating the SHP-1/STAT3 axis, indicating the anticancer potential of SC-60 in TNBC treatment. Targeting SHP-1/p-STAT3 and the potential combination of SHP-1 agonist with chemotherapeutic docetaxel is a feasible therapeutic strategy for TNBC.

  9. 钙钛矿型ScRh3X(X=B,C,N)的第一性原理研究%First-principles calculations on perovskite-type ScRh3X(X=B, C and N)

    Institute of Scientific and Technical Information of China (English)

    王志斌; 周艳萍; 张志超; 郝险峰

    2009-01-01

    利用第一性原理研究了钙钛矿型的ScRh3X(X=B,C,N)及其固溶体的结构、弹性、电子性质等.研究结果表明,对于平衡状态下的ScRh3BxC1-x(OScRh3C结构相比,在0ScRh3BxC1-x的体积弹性模量和弹性常数C44随着价电子浓度的增加增大,而剪切模最却表现出单调下降的趋势.本文根据计算得到的电子结构信息对这些现象进行了分析,发现剪切模量比体积弹性模量或C44能更好的预测该体系的硬度.

  10. f184sc.m77t - MGD77 data file for Geophysical data from field activity F-1-84-SC in Southern California from 04/26/1984 to 05/21/1984

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and magnetic data along with DGPS navigation data was collected as part of field activity F-1-84-SC in Southern California from 04/26/1984 to...

  11. l2b78sc.m77t - MGD77 data file for Geophysical data from field activity L-2B-78-SC in Southern California from 05/25/1978 to 05/29/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and magnetics data along with DGPS navigation data was collected as part of field activity L-2B-78-SC in Southern California from 05/25/1978...

  12. Novel permeability characteristics of red blood cells from sickle cell patients heterozygous for HbS and HbC (HbSC genotype).

    Science.gov (United States)

    Dalibalta, S; Ellory, J C; Browning, J A; Wilkins, R J; Rees, D C; Gibson, J S

    2010-06-15

    Individuals heterozygous for HbS and HbC (HbSC) represent about 1/3(rd) of sickle cell disease (SCD) patients. Whilst HbSC disease is generally milder, there is considerable overlap in symptoms with HbSS disease. HbSC patients, as well as HbSS ones, present with the chronic anaemia and panoply of acute vaso-occlusive complications that characterize SCD. However, there are important clinical and haematological differences. Certain complications occur with greater frequency in HbSC patients (like proliferative retinopathy and osteonecrosis) whilst intravascular haemolysis is reduced. Patients with HbSC disease can be considered as a discrete subset of SCD cases. Although much work has been carried out on understanding the pathogenesis of SCD in HbSS homozygotes, including the contribution of altered red blood cell permeability, relatively little pertains directly to HbSC individuals. Results reported in the literature suggest that HbSC cells, and particularly certain subpopulations, present with similar permeability to HbSS cells but there are also important differences - these have not been well characterized. We hypothesise that their unique cell transport properties accounts for the different pattern of disease in HbSC patients and represents a potential chemotherapeutic target not shared in red blood cells from HbSS patients. The distinct pattern of clinical haematology in HbSC disease is emphasised here. We analyse some of the electrophysiological properties of single red blood cells from HbSC patients, comparing them with those from HbSS patients and normal HbAA individuals. We also use the isosmotic haemolysis technique to investigate the behaviour of total red blood cell populations. Whilst both HbSS and HbSC cells show increased monovalent and divalent (Ca(2+)) cation conductance further elevated upon deoxygenation, the distribution of current magnitudes differs, and outward rectification is greatest for HbSC cells. In addition, although Gd(3+) largely

  13. Effects of cysteine proteinase inhibitors scN and E-64 on southern corn rootworm larval development

    Science.gov (United States)

    The southern corn rootworm (SCRW) can be a serious pest of peanut pods. A laboratory bioassay was developed to test feeding cysteine proteinase inhibitors soyacystatin N (scN) and E-64 against southern corn rootworm reared on artificial diet to determine the effects on larvae development and mortal...

  14. Optical Simulation for Multi-Striped Orthogonal Photon-Photocarrier-Propagation Solar Cell (MOP3SC) with Redirection Waveguide

    Science.gov (United States)

    Ishibashi, Akira; Kobayashi, H.; Taniguchi, T.; Kondo, K.; Kasai, T.

    2016-12-01

    We have calculated optical fields for waveguide-coupled orthogonal photon-photocarrier propagation solar cell (MOP3SC)in which the photons propagate in the direction orthogonal to that of the photocarriers'. By exploiting the degree of freedom along the photon propagation and using multi-semiconductor stripes in which the incoming photons first encounter the widest gap semiconductor, and the narrowest at last, we can convert virtually the whole spectrum of solar spectrum into electricity resulting in high conversion efficiency. The waveguide-coupled MOP3SC can not only optimize the absorption of light and the photocarrier collection independently converting virtually the whole spectrum of sunlight into electricity, but also can serve as a highly efficient concentration solar-cell system with low temperature rise thanks to its minimal thermal dissipation and the diffusive-light-convertibility when used with the parabola cross-section structure on top of the waveguide. The waveguide-coupled MOP3SC is also of potential interest as a high reliability system, because the high energy photons that can damage bonding of the materials, being converted into electricity already at upstream, never go into the medium or narrow gap semiconductors, resulting in low degradation of materials used in the MOP3SC.

  15. Evaluation of Alternative Peel Ply Surface Preparation Methods of SC-15 Epoxy / Fiberglass Composite Surfaces for Secondary Bonding

    Science.gov (United States)

    2014-01-01

    surface preparation, secondary bonding, peel ply, film adhesive, toughened epoxy, VARTM 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...for the VARTM process. .......................6 Figure 2. Vacuum-bagged laminate during the debulk process...processing temperature. .........................3 Table 2. ARL cure schedule for VARTM processing of SC-15

  16. A novel microtubule inhibitor 4SC-207 with anti-proliferative activity in taxane-resistant cells.

    Directory of Open Access Journals (Sweden)

    Elena Bausch

    Full Text Available Microtubule inhibitors are invaluable tools in cancer chemotherapy: taxanes and vinca alkaloids have been successfully used in the clinic over the past thirty years against a broad range of tumors. However, two factors have limited the effectiveness of microtubule inhibitors: toxicity and resistance. In particular, the latter is highly unpredictable, variable from patient to patient and is believed to be the cause of treatment failure in most cases of metastatic cancers. For these reasons, there is an increasing demand for new microtubule inhibitors that can overcome resistance mechanisms and that, at the same time, have reduced side effects. Here we present a novel microtubule inhibitor, 4SC-207, which shows strong anti-proliferative activity in a large panel of tumor cell lines with an average GI50 of 11 nM. In particular, 4SC-207 is active in multi-drug resistant cell lines, such as HCT-15 and ACHN, suggesting that it is a poor substrate for drug efflux pumps. 4SC-207 inhibits microtubule growth in vitro and in vivo and promotes, in a dose dependent manner, a mitotic delay/arrest, followed by apoptosis or aberrant divisions due to chromosome alignment defects and formation of multi-polar spindles. Furthermore, preliminary data from preclinical studies suggest low propensity towards bone marrow toxicities at concentrations that inhibit tumor growth in paclitaxel-resistant xenograft models. In summary, our results suggest that 4SC-207 may be a potential anti-cancer agent.

  17. Expression, production, and renaturation of a functional single-chain variable antibody fragment (scFv against human ICAM-1

    Directory of Open Access Journals (Sweden)

    H. Sun

    2014-07-01

    Full Text Available Intercellular adhesion molecule-1 (ICAM-1 is an important factor in the progression of inflammatory responses in vivo. To develop a new anti-inflammatory drug to block the biological activity of ICAM-1, we produced a monoclonal antibody (Ka=4.19×10−8 M against human ICAM-1. The anti-ICAM-1 single-chain variable antibody fragment (scFv was expressed at a high level as inclusion bodies in Escherichia coli. We refolded the scFv (Ka=2.35×10−7 M by ion-exchange chromatography, dialysis, and dilution. The results showed that column chromatography refolding by high-performance Q Sepharose had remarkable advantages over conventional dilution and dialysis methods. Furthermore, the anti-ICAM-1 scFv yield of about 60 mg/L was higher with this method. The purity of the final product was greater than 90%, as shown by denaturing gel electrophoresis. Enzyme-linked immunosorbent assay, cell culture, and animal experiments were used to assess the immunological properties and biological activities of the renatured scFv.

  18. A general and efficient synthesis of pyrazoles catalyzed by Sc(OTf)3 under solvent-free conditions

    OpenAIRE

    Xiong, Wei; Chen,Jiu-Xi; Liu,Miao-Chang; Ding,Jin-Chang; Wu,Hua-Yue; Su,Wei-Ke

    2009-01-01

    Pyrazoles were prepared in excellent yields via solventless condensation of various 1,3-diketones (R¹COCHXCOCH3, R¹ = Me, Ph; X = H, Me, Cl) and hydrazines, acylhydrazines or sulfonyl hydrazines in the presence of a catalytic amount of Sc(OTf)3 at room temperature. Additionally, the catalyst could be recovered easily after the reactions and reused without evident loss in activity.

  19. 75 FR 55613 - Dupont Teijin Films Including On-Site Leased Workers From Schenkers Logistics, Inc., Florence, SC...

    Science.gov (United States)

    2010-09-13

    ... Logistics, Inc., Florence, SC; Amended Certification Regarding Eligibility To Apply for Worker Adjustment... Schenkers Logistics, Inc., Florence, South Carolina (subject firm). The Department's notice was published in... Logistics, Inc., Florence, South Carolina, who became totally or partially separated from employment on...

  20. Recombinant scFv Antibodies against E Protein and N Protein of Severe Acute Respiratory Syndrome Virus

    Institute of Scientific and Technical Information of China (English)

    Hui LIU; Yan-Li DING; Wei HAN; Mei-Yun LIU; Rui-Yang TIAN; Sheng-Li YANG; Yi GONG

    2004-01-01

    Three single chain antibodies(scFv)against the proteins of severe acute respiratory syndrome coronavirus(SARS-CoV)were isolated by phage display from an scFv antibody library.Bio-panning was carried out against immobilized purified envelope(E)and nucleocapsid(N)proteins of SARS-CoV.Their binding activity and specificity to E or N protein of SARS-CoV were characterized by phage-ELISA.Two of them,B 10 and C20,could recognize non-overlapping epitopes of the E protein according to the two-site binding test result.Clone A 17 could recognize N protein.The sequence of the epitope or overlapping epitope of scFv antibody A17 was PTDSTDNNQNGGRNGARPKQRRPQ.The affinity(equilibrium dissociation constant,Kd)of SARS-CoV E protein was 5.7×10-8 M for B10 and 8.9×10-8 M for C20.The affinity of A17for N protein was 2.1 x 10-6 M.All three scFv antibodies were purified with affinity chromatography and determined by Western blot.

  1. Piezoelectric non-linearity in PbSc0.5Ta0.5O3 thin films

    NARCIS (Netherlands)

    Chopra, A.; Kim, Y.; Alexe, M.; Hesse, D.

    2014-01-01

    Epitaxial (001)-oriented PbSc0.5Ta0.5O3 (PST) thin films were deposited by pulsed laser deposition. Local piezoelectric investigations performed by piezoelectric force microscopy show a dual slope for the piezoelectric coefficient. A piezoelectric coefficient of 3 pm/V was observed at voltages up to

  2. 77 FR 1483 - Commissioners of Public Works of the City of Spartanburg, SC; Notice of Availability of...

    Science.gov (United States)

    2012-01-10

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Commissioners of Public Works of the City of Spartanburg, SC; Notice of... Commission in the Public Reference Room or may be viewed on the Commission's Web site at...

  3. Effects of trace elements at the Ni/ScYSZ interface in a model solid oxide fuel cell anode

    DEFF Research Database (Denmark)

    Schmidt, Michael Stenbæk; Hansen, Karin Vels; Norrman, Kion

    2008-01-01

    Two ScYSZ electrolytes with different impurity levels were evaluated by electrochemical impedance spectroscopy using a nickel point electrode setup. The nickel electrodes showed lower electrode polarization resistances on the pure electrolyte than on the impure electrolyte. Time-of-flight seconda...

  4. Accumulation of PrP-Sc in hemal nodes of naturally and experimentally scrapie-infected sheep

    Science.gov (United States)

    Classical scrapie is a naturally occurring fatal disease of sheep and goats which is caused by prions, a novel class of infectious agent. Infection is accompanied by accumulation of abnormal isoforms of the prion protein (PrP-Sc) in certain neural and lymphoid tissues. Hemal nodes, which are unique ...

  5. Preperation and biological functions of anti-hγδTCR-ScFv%抗人γδ TCR单链抗体G5-4ScFv的制备及生物学功能分析

    Institute of Scientific and Technical Information of China (English)

    郑静; 崔莲仙; 何维

    2012-01-01

    Objective To construct and express the single chain variable fragment (Fv) of a monoclonal antibody against human γδ TCR which can stimulate proliferation of human γδ T cells. Methods The genes of the heavy (VH) and light chains (VL) of antibody were cloned by RT-PCR from a hybfidoma cell line G5-4,which secreted the monoclonal antibody (mAb) against human γδ TCR. Overlapping extension PCR was used to connect the VH and VL genes with a short linker encoding (Gly4Ser)3 to construct the anti-hγδ TCR-ScFv gene G5-4ScFv. Recom-binant plasmid pET22b( + )-G5-4ScFv was constructed by inserting G5-4ScFv fragment into the prokaryotic expression vector pET22b( + ). The anti-hγδTCR-SeFv (G5-4ScFv) was expressed in E. coli TransB(DE3) by induction with IPTG and purified with Nickel-affinity chromatography column. Then G5-4ScFv was analyzed by SDS-PAGE and Western-blot assay. Its binding ability to human γδ T cells was measured by flow cytometry. The purity and biological characteristics including cytokine secretion and cytotoxicity of γδ T cells expanded by G5-4ScFv stimulation, were detected by flow cytometry and LDH methods. Results G5-4ScFv showed a molecular weight of 30 ku in SDS-PAGE. G5-4ScFv binded to 78 T cells and greatly inhibited the binding of a pan-γδTCR antibody with γδ T cells. The purity of γδ T cells expanded by G5-4ScFv stimulation was up to 90% after culture of 2 weeks. These γδ T cells exhibited IFN-γ and TNF-α secretion ability and strong cytotoxicity against Daudi cells. Conclusions anti-h-y&TCR-ScFv with biological functions has been successfully constructed and expressed in prokaryotic expression system, which provides a concrete base for further studying on its potential application in tumor immunotherapy.%目的 构建并应用原核表达体系表达能体外刺激人γδ T细胞增殖的抗人γδ TCR单链抗体.方法 在成功建立稳定分泌鼠抗人γδTCR单克隆抗体杂交瘤细胞系G5-4的基础上,通过RT-PCR

  6. Genome analysis coupled with physiological studies reveals a diverse nitrogen metabolism in Methylocystis sp. strain SC2.

    Directory of Open Access Journals (Sweden)

    Bomba Dam

    Full Text Available BACKGROUND: Methylocystis sp. strain SC2 can adapt to a wide range of methane concentrations. This is due to the presence of two isozymes of particulate methane monooxygenase exhibiting different methane oxidation kinetics. To gain insight into the underlying genetic information, its genome was sequenced and found to comprise a 3.77 Mb chromosome and two large plasmids. PRINCIPAL FINDINGS: We report important features of the strain SC2 genome. Its sequence is compared with those of seven other methanotroph genomes, comprising members of the Alphaproteobacteria, Gammaproteobacteria, and Verrucomicrobia. While the pan-genome of all eight methanotroph genomes totals 19,358 CDS, only 154 CDS are shared. The number of core genes increased with phylogenetic relatedness: 328 CDS for proteobacterial methanotrophs and 1,853 CDS for the three alphaproteobacterial Methylocystaceae members, Methylocystis sp. strain SC2 and strain Rockwell, and Methylosinus trichosporium OB3b. The comparative study was coupled with physiological experiments to verify that strain SC2 has diverse nitrogen metabolism capabilities. In correspondence to a full complement of 34 genes involved in N2 fixation, strain SC2 was found to grow with atmospheric N2 as the sole nitrogen source, preferably at low oxygen concentrations. Denitrification-mediated accumulation of 0.7 nmol (30N2/hr/mg dry weight of cells under anoxic conditions was detected by tracer analysis. N2 production is related to the activities of plasmid-borne nitric oxide and nitrous oxide reductases. CONCLUSIONS/PERSPECTIVES: Presence of a complete denitrification pathway in strain SC2, including the plasmid-encoded nosRZDFYX operon, is unique among known methanotrophs. However, the exact ecophysiological role of this pathway still needs to be elucidated. Detoxification of toxic nitrogen compounds and energy conservation under oxygen-limiting conditions are among the possible roles. Relevant features that may stimulate

  7. ALERTES-SC3: an EEWS prototype for south Iberia peninsula.

    Science.gov (United States)

    Pazos, Antonio; Lopez de Mesa, Mireya; Martín Davila, José; Gallego Carrasco, Javier; Rioja del Rio, Carlos; Morgado, Arturo; Hanka, Winfried; Strollo, Angelo; Cibeira, Angel; Cabieces, Roberto; Carranza, Marta

    2016-04-01

    Since several decades Earthquake Early Warning Systems (EEWS) have been developed for different parts of the world based on the hypothesis of the earthquake characteristics can be derived from the analysis of the low energy P-wave prior to the arrival of more energetic S-waves and later phases. Thereby a time ("lead time") is available to evaluate a warning and perform automatic or semi -automatic actions on certain systems and deliver and alert to the authorities involved in emergency. The South Iberia peninsula area, between SW San Vicente Cape to the East of the Alboran sea, is one of the most seismically active zones in the Ibero-Maghrebian region, with predominantly moderate and superficial seismicity, but also big events with associated tsunamis are well documented in the area, like the 1755 Lisbon earthquake. The main goal of the ALERT-ES (2011-2013) and ALERTES-RIM (2014-2016) Spanish projects has been to develop an EEWS for South Iberia region (ALERTES-SC3 EEWS) from a regional and also an on-site approach, and the study of the scaling laws for this area to estimate the moment magnitude (Mw) and predict the expected PGV (peak ground velocity) and Pd (peak displacement) among other parameters. The ALERTES-SC3 EEWS, regional approach, prototype has been developed at the Royal Spanish Navy Observatory (ROA) and is being tested in near real time for South Iberia area. This prototype, based on the SeisComP3 software package, is largely based on algorithms derived from the analysis of the first seconds of the P wave records. Calculation of several parameters are carried out, mainly the characteristic period (τc), Peak displacement and velocity (Pd, Pv) and maximum period (τPmáx), among others, from which correlations with corresponding earthquake magnitude, peak ground velocities , etc. are derived. Decision tables have been developed in order to deliver warnings (Buforn et al, 2012). The algorithms have been implemented by ROA in the seismic data system Seis

  8. Development of single-chain variable fragments (scFv) against influenza virus targeting hemagglutinin subunit 2 (HA2).

    Science.gov (United States)

    Li, Tai-Wei; Cheng, Shu-Fang; Tseng, Yen-Tzu; Yang, Yu-Chih; Liu, Wen-Chun; Wang, Sheng-Cyuan; Chou, Mei-Ju; Lin, Yu-Jen; Wang, Yueh; Hsiao, Pei-Wen; Wu, Suh-Chin; Chang, Ding-Kwo

    2016-01-01

    Influenza A viruses (IAV) are widespread in birds and domestic poultry, occasionally causing severe epidemics in humans and posing health threats. Hence, the need to develop a strategy for prophylaxis or therapy, such as a broadly neutralizing antibody against IAV, is urgent. In this study, single-chain variable fragment (scFv) phage display technology was used to select scFv fragments recognizing influenza envelope proteins. The Tomlinson I and J scFv phage display libraries were screened against the recombinant HA2 protein (rHA2) for three rounds. Only the third-round elution sample of the Tomlinson J library showed high binding affinity to rHA2, from which three clones (3JA18, 3JA62, and 3JA78) were chosen for preparative-scale production as soluble antibody by E. coli. The clone 3JA18 was selected for further tests due to its broad affinity for influenza H1N1, H3N2 and H5N1. Simulations of the scFv 3JA18-HA trimer complex revealed that the complementarity-determining region of the variable heavy chain (VH-CDR2) bound the stem region of HA. Neutralization assays using a peptide derived from VH-CDR2 also supported the simulation model. Both the selected antibody and its derived peptide were shown to suppress infection with H5N1 and H1N1 viruses, but not H3N2 viruses. The results also suggested that the scFvs selected from rHA2 could have neutralizing activity by interfering with the function of the HA stem region during virus entry into target cells.

  9. Detection of PrP(Sc) in peripheral tissues of clinically affected cattle after oral challenge with bovine spongiform encephalopathy.

    Science.gov (United States)

    Franz, Martin; Eiden, Martin; Balkema-Buschmann, Anne; Greenlee, Justin; Schatzl, Hermann; Fast, Christine; Richt, Jürgen; Hildebrandt, Jan-Peter; Groschup, Martin H

    2012-12-01

    Bovine spongiform encephalopathy (BSE) is a fatal neurodegenerative prion disease that mainly affects cattle. Transmission of BSE to humans caused a variant form of Creutzfeldt-Jakob disease. Following infection, the protease-resistant, disease-associated isoform of prion protein (PrP(Sc)) accumulates in the central nervous system and in other tissues. Many countries have defined bovine tissues that may contain prions as specified risk materials, which must not enter the human or animal food chains and therefore must be discarded. Ultrasensitive techniques such as protein misfolding cyclic amplification (PMCA) have been developed to detect PrP(Sc) when present in minuscule amounts that are not readily detected by other diagnostic methods such as immunohistochemistry or Western blotting. This study was conducted to determine when and where PrP(Sc) can be found by PMCA in cattle orally challenged with BSE. A total of 48 different tissue samples from four cattle infected orally with BSE at various clinical stages of disease were examined using a standardized PMCA protocol. The protocol used brain homogenate from bovine PrP transgenic mice (Tgbov XV) as substrate and three consecutive rounds of PMCA. Using this protocol, PrP(Sc) was found in the brain, spinal cord, nerve ganglia, optic nerve and Peyer's patches. The presence of PrP(Sc) was confirmed in adrenal glands, as well as in mesenteric lymph nodes - a finding that was reported recently by another group. Interestingly, additional positive results were obtained for the first time in the oesophagus, abomasum, rumen and rectum of clinically affected cattle.

  10. Wavelengths, energy levels and hyperfine structure of Mn II and Sc II.

    Science.gov (United States)

    Nave, Gillian; Pickering, Juliet C.; Townley-Smith, Keeley I. M.; Hala, .

    2015-08-01

    For many decades, the Atomic Spectroscopy Groups at the National Institute of Standards and Technology (NIST) and Imperial College London (ICL) have measured atomic data of astronomical interest. Our spectrometers include Fourier transform (FT) spectrometers at NIST and ICL covering the region 1350 Å to 5.5 μm and a 10.7-m grating spectrometer at NIST covering wavelengths from 300 - 5000 Å. Sources for these spectra include high-current continuous and pulsed hollow cathode (HCL) lamps, Penning discharges, and sliding spark discharges. Recent work has focused on the measurement and analysis of wavelengths, energy levels, and hyperfine structure (HFS) constants for iron-group elements. The analysis of FT spectra of Cr I, Mn I, and Mn II is being led by ICL and is described in a companion poster [1]. Current work being led by NIST includes the analysis of HFS in Mn II, analysis of Mn II in the vacuum ultraviolet, and a comprehensive analysis of Sc II.Comprehensive HFS constants for Mn II are needed for the interpretation of stellar spectra and incorrect abundances may be obtained when HFS is omitted. Holt et al. [2] have measured HFS constants for 59 levels of Mn II using laser spectroscopy. We used FT spectra of Mn/Ni and Mn/Cu HCLs covering wavelength ranges from 1350 Å to 5.4 μm to confirm 26 of the A constants of Holt et al. and obtain values for roughly 40 additional levels. We aim to obtain HFS constants for the majority of lines showing significant HFS that are observed in chemically-peculiar stars.Spectra of Sc HCLs have been recorded from 1800 - 6700 Å using a vacuum ultraviolet FT spectrometer at NIST. Additional measurements to cover wavelengths above 6700 Å and below 1800 Å are in progress. The spectra are being analyzed by NIST and Alighar Muslim University, India in order to derive improved wavelengths, energy levels, and hyperfine structure parameters.This work was partially supported by NASA, the STFC and PPARC (UK), the Royal Society of the UK

  11. Epidemiologia dos cânceres espinocelulares - Blumenau (SC - Brasil, de 1980 a 1999 Epidemiology of squamous cell cancers in Blumenau -SC-Brazil, from 1980 to 1999

    Directory of Open Access Journals (Sweden)

    Nilton Nasser

    2004-12-01

    Full Text Available FUNDAMENTOS: A morbidade dos carcinomas espinocelulares da pele vem aumentando no mundo. No Brasil não existem dados sobre coeficientes de morbidade desses cânceres. OBJETIVOS: Detectar a morbidade, analisar e classificar os cânceres espinocelulares da pele e semimucosa do lábio em Blumenau, de 1980 a 1999, segundo as principais características clínicas e histológicas. MÉTODOS: Foram utilizados exames histopatológicos oriundos dos laboratórios de Blumenau, revisados quanto às variáveis sexo, idade, localização primária e tipo histológico. Os coeficientes de morbidade anuais foram calculados utilizando o número de casos de neoplasias encontradas e a população anual estimada entre 1980 e 1999. RESULTADOS: Identificaram-se 2.195 tumores, com maior freqüência em homens e na faixa etária acima de 60 anos. A localização primária em áreas expostas foi predominante. Os coeficientes de morbidade encontrados variaram entre 31,1 casos por 100.000 habitantes em 1980 e 86,3 casos por 100.000 habitantes em 1989. CONCLUSÃO: Os cânceres espinocelulares da pele e semimucosa do lábio encontrados em Blumenau, de acordo com a idade, localização anatômica e tipos histológicos, têm semelhança com os da literatura, e os coeficientes de morbidade são os únicos encontrados na literatura brasileira pesquisada.BACKGROUND: The morbidity from skin squamous cell cancers is increasing worldwide. In Brazil there are no studies on the morbidity coefficients for this type of cancer. OBJECTIVES: To determine the morbidity coefficients, analyze and classify the squamous cell cancers diagnosed in the city of Blumenau-SC-Brazil, from 1980 to 1999, according to their most important clinical and histologic features. METHODS: The author reviewed the histopathological exams at two laboratories in the city of Blumenau, with respect to sex, age, anatomical site and histologic type. The morbidity coefficients were calculated using the number of squamous

  12. Prevalência de hiperidrose em uma amostra populacional de Blumenau - SC, Brasil Prevalence of hyperhidrosis in the adult population of Blumenau-SC, Brazil

    Directory of Open Access Journals (Sweden)

    Romero Felini

    2009-08-01

    Full Text Available FUNDAMENTOS: A hiperidrose é um distúrbio pouco conhecido, caracterizado pela produção excessiva de suor. Manifesta-se sob várias formas, afetando áreas como axilas, mãos, pés e face. Seus sintomas trazem prejuízos para o paciente, desde limitações no trabalho até constrangimento social e transtornos psicológicos. OBJETIVOS: O objetivo deste trabalho é estimar a prevalência de hiperidrose na cidade de Blumenau. MÉTODOS: A pesquisa foi realizada entre 21 de agosto e 1o de setembro de 2006, nos terminais urbanos de Blumenau: SC, entrevistando-se 500 pessoas abordadas de forma aleatória. RESULTADOS: Dentre os entrevistados, 45 deles, que correspondem a 9% do total, preencheram os requisitos mínimos para serem classificados como portadores de hiperidrose. A faixa etária mais acometida foi entre 18 e 30 anos (11,8%. O número de portadores de hiperidrose do sexo masculino foi maior em números tanto absolutos quanto relativos. A característica mais prevalente foi frequência de hiperidrose ao menos uma vez por semana, encontrada em 91,11% dos afetados; a menos prevalente foi cessação de suor durante o sono, presente em 37,77%. CONCLUSÕES: Observa-se que a prevalência de hiperidrose em Blumenau é maior que a encontrada em outras pesquisas semelhantes, não evidenciando raridade na presente amostra.BACKGROUND: Hyperhidrosis is a little known disorder, characterized by excessive production of sweat. Hyperhidrosis may occur under several circumstances and appears in body parts like armpits, hands, feet, and face, consequently causing problems to the patient like job limitation, social embarrassment, and psychological damage. OBJECTIVES: Using these theoretical views as a starting point, the study aimed to evaluate the prevalence of hyperhidrosis in Blumenau. METHODOLOGY: Utilizing interviews, the research was conducted with 500 subjects randomly approached, in the period ranging from August 21 to September 1st, 2006. RESULTS: 45

  13. The change of the scFv into the Fab format improves the stability and in vivo toxin neutralization capacity of recombinant antibodies.

    Science.gov (United States)

    Quintero-Hernández, Veronica; Juárez-González, Victor R; Ortíz-León, Mauricio; Sánchez, Rosalba; Possani, Lourival D; Becerril, Baltazar

    2007-02-01

    The antigen-binding fragment (Fab) has been considered a more functionally stable version of recombinant antibodies than single chain antibody fragments (scFvs), however this intuitive consideration has not been sufficiently proven in vivo. This communication shows that three out of four specific scFvs against a scorpion toxin, with different affinities and stabilities, become neutralizing in vivo when expressed as Fabs, despite the fact that they are not neutralizing in the scFv format. A scFv fragment previously obtained from a neutralizing mouse antibody (BCF2) was used to produce three derived scFvs by directed evolution. Only one of them was neutralizing, however when expressed as Fab, all of them became neutralizing fragments in vivo. The initial scFvBCF2 (earlier used for directed evolution) was not neutralizing in the scFv format. After expressing it as Fab did not become a neutralizing fragment, but did reduce the intoxication symptoms of experimental mice. The stability of the four Fabs derived from their respective scFvs was improved when tested in the presence of guanidinium chloride. The in vitro stability of the Fab format has been shown earlier, but the physiological consequences of this stability are shown in this communication. The present results indicate that improved functional stability conferred by the Fab format can replace additional maturation steps, when the affinity and stability are close to the minimum necessary to be neutralizing.

  14. Application of phage display in selecting Tomato spotted wilt virus - specific single-chain antibodies (scFvs) for sensitive diagnosis in ELISA

    NARCIS (Netherlands)

    Griep, R.A.; Prins, M.; Twisk, van C.; Keller, H.J.H.G.; Kerschbaumer, R.J.; Kormelink, R.; Goldbach, R.W.; Schots, A.

    2000-01-01

    A panel of recombinant single-chain antibodies (scFvs) against structural proteins of Tomato spotted wilt virus (TSWV) was retrieved from a human combinatorial scFv antibody library using the novel phage display technique. After subcloning the encoding DNA sequences in the expression vector pSKAP/S,

  15. A novel scandium fluoride, [C2N2H10]0.5[ScF4], with an unprecedented tungsten bronze-related layer structure.

    Science.gov (United States)

    Stephens, Nicholas F; Slawin, Alexandra M Z; Lightfoot, Philip

    2004-03-07

    [C(2)N(2)H(10)](0.5)[ScF(4)] exhibits isolated anionic layers of corner-linked ScF(6) octahedra enclosing 3-, 4-, 5- and 6-membered rings, with features reminiscent of both hexagonal and tetragonal tungsten bronze-type structures.

  16. 41 CFR 102-38.365 - Is a holding agency required to report property in “scrap” condition to its selected SC?

    Science.gov (United States)

    2010-07-01

    ... Sales Program § 102-38.365 Is a holding agency required to report property in “scrap” condition to its selected SC? No. Property which has no value except for its basic material content (scrap material) may be... agency should consult the SC(s) selected by the holding agency as to the feasibility of selling the...

  17. Melt growth, structure and properties of (ZrO2)1-x(Sc2O3)x solid solution crystals (x=0.035-0.11)

    Science.gov (United States)

    Borik, M. A.; Bredikhin, S. I.; Kulebyakin, A. V.; Kuritsyna, I. E.; Lomonova, E. E.; Milovich, F. O.; Myzina, V. A.; Osiko, V. V.; Panov, V. A.; Ryabochkina, P. A.; Seryakov, S. V.; Tabachkova, N. Yu.

    2016-06-01

    Crystals of (ZrO2)1-x(Sc2O3)x solid solutions with x=0.035, 0.06, 0.09 and 0.11 have been grown for the first time using the directional crystallization technique. Analysis of the scandium distribution along the crystal showed that the composition of all specimens is homogeneous, and the Sc2O3 concentration is almost identical to its content in the charge. All specimens exhibit a little decline in the scandium concentration along the crystal, this indicating that the effective distribution coefficient Sc is slightly greater than 1. The structure of as-grown crystals has been studied as a function of the Sc2O3 stabilising oxide concentration by X-ray diffraction, transmission electron microscopy and Raman spectroscopy. Crystals containing 3.5 mol% Sc2O3 are a mixture of the monoclinic and tetragonal phases, the crystals containing 6 mol% Sc2O3 have a tetragonal structure, those with 9 mol% Sc2O3 have the tetragonal phase with inclusions of the rhombohedral one and the specimens with 11 mol% Sc2O3 represent the rhombohedral phase with inclusions of the cubic phase. The electrical conductivity was measured as a function of temperature by electrochemical impedance spectroscopy. The conductivity of the scandia stabilized crystals, in spite of their inhomogeneity, presence of stresses and low fracture toughness, is comparable with that of the yttria stabilized zirconia crystals.

  18. THE FUNGAL HYDROPHOBIN SC3P SELF-ASSEMBLES AT THE SURFACE OF AERIAL HYPHAE AS A PROTEIN MEMBRANE CONSTITUTING THE HYDROPHOBIC RODLET LAYER

    NARCIS (Netherlands)

    WOSTEN, HAB; ASGEIRSDOTTIR, SA; KROOK, JH; DRENTH, JHH; WESSELS, JGH

    1994-01-01

    The Schizophyllum commune hydrophobin Sc3p is a small, hydrophobic, cysteine-rich protein involved in the formation of aerial hyphae. Using an antibody against purified Sc3p we found that the hydrophobin is secreted into the medium at the spices of growing submerged hyphae but in emerging aerial hyp

  19. o100sc.m77t and o100sc.h77t: MGD77T data and header file for single-beam bathymetry for field activity O-1-00-SC in San Pedro Bay, Santa Monica, California from 04/09/2000 to 04/14/2000

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise O-1-00-SC. The cruise was conducted in San...

  20. p192sc.m77t and p192sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-92-SC in Santa Monica Basin, Southern California from 01/30/1992 to 02/04/1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with Loran-C and GPS navigation data was collected as part of the U.S. Geological Survey cruise P-1-92-SC. The cruise was...

  1. p192sc.m77t and p192sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-92-SC in Santa Monica Basin, Southern California from 01/30/1992 to 02/04/1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with Loran-C and GPS navigation data was collected as part of the U.S. Geological Survey cruise P-1-92-SC. The cruise was conducted...

  2. o199sc.m77t and o199sc.h77t: MGD77T data and header file for single-beam bathymetry for field activity O-1-99-SC in Southern California from 06/05/1999 to 06/17/1999

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise O-1-99-SC. The cruise was conducted in...

  3. a100sc.m77t and a100sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity A-1-00-SC in Southern California from Port Hueneme to Mexican Border from 06/05/2000 to 06/29/2000

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-00-SC. The cruise was conducted from Port...

  4. a298sc.m77t and a298sc.h77t: MGD77T data and header file for single-beam bathymetry for field activity A-2-98-SC in Santa Monica Bay from 08/23/1998 to 08/31/1998

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-2-98-SC. The cruise was conducted in Santa...

  5. f389sc.m77t and f389sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity F-3-89-SC in Monterey Bay, California from 02/02/1989 to 02/15/1989

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with Loran-C RHO-RHO and GPS navigation data was collected as part of the U.S. Geological Survey cruise F-3-89-SC. The cruise was...

  6. f690sc.m77t and f690sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity F-6-90-SC in Southern California, Monterey Canyon from 06/19/1990 to 07/12/1990

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with Loran-C RHO-RHO and GPS navigation data was collected as part of the U.S. Geological Survey cruise F-6-90-SC. The cruise was...

  7. f392sc.m77t and f392sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity F-3-92-SC in in Southern California from 04/22/1992 to 05/15/1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise F-3-92-SC. The cruise was conducted in Southern...

  8. Construction of bifunctional molecules specific to antigen and antibody’s Fc-fragment by fusion of scFv-antibodies with staphylococcal protein A

    Directory of Open Access Journals (Sweden)

    Kolibo D. V.

    2009-06-01

    Full Text Available Aim. To develop approach for detection of scFv and their complexes with antigens. Methods. The fusion proteins, which include sequences of scFv and staphylococcal protein A, were constructed and the obtained bifunctional molecules were immunochemically analysed. Results. It was shown, that scFv fused with protein A and their complexes with antigens are effectively recognized by labelled immunoglobulins with unrestricted antigenic specificity. Conclusions. The fusion of scFv with protein A fragment is a perspective approach to increase the efficiency of application in ELISA. The obtained scFv, fused with protein A, could be used for development of test-systems for the detection of diphtheria toxin.

  9. Local minima conformations of the Sc3N @C80 endohedral complex: Ab initio quantum chemical study and suggestions for experimental verification

    Science.gov (United States)

    Yanov, Ilya; Kholod, Yana; Simeon, Tomekia; Kaczmarek, Anna; Leszczynski, Jerzy

    The results of an ab initio quantum chemical study of the Sc3N@C80 endohedral complex are reported. The Hartree-Fock (HF) and B3LYP levels of theory were employed in conjunction with STO-3G and 6-31G(d) basis sets to determine the geometry and properties of the local minima conformations of Sc3N cluster inside the C80 cage. Weak bonding between the Sc3N and C80 molecule and a number of very close geometry and nearly identical by energy local minima structures can explain the large mobility of the endohedral cluster, but complicate determination of the global minimum structure. The effect of the endohedral cluster on the vibrational spectrum of Sc3N@C80 is revealed. Based on the theoretical infrared (IR) spectra, the experimental method to distinguish local minima structures of Sc3N@C80 is proposed.

  10. Structural and bonding properties of ScSi-n(n=2~6)clusters:photoelectron spectroscopy and density functional calculations

    Institute of Scientific and Technical Information of China (English)

    Xu Hong-Guang; Wu Miao-Miao; Zhang Zeng-Guang; Sun Qiang; Zheng Wei-Jun

    2011-01-01

    Anion ion photoelectron spectroscopy and density functional theory(DFT)are used to investigate the electronicand structural properties of ScSi-n(n=2~6)clusters and their neutrals. We find that the structures of ScSin are similar to those of Si-n+1. The most stable isomers of ScSin cluster anions and their neutrals are similar for n=2, 3and 5 but different for n=4 and 6, indicating that the charge effect on geometry is size dependent for small scandiumsilicon clusters. The low electron binding energy(EBE)tails observed in the spectra of ScSi-4,6 can be explained by the existence of less stable isomers. A comparison between ScSi-n and VSi-n clusters shows the effects of metal size and electron configuration on cluster geometries.

  11. Tellurite suspended nanowire surrounded with large holes for single-mode SC and THG generations

    Science.gov (United States)

    Liao, Meisong; Qin, Guanshi; Yan, Xin; Chaudhari, Chitrarekha; Suzuki, Takenobu; Ohishi, Yasutake

    2011-05-01

    For a suspended nanowire, the holes surrounding the core are expected to be as large as possible to propagate the light at wavelengths as long as possible. However, the fabrication of nanowire surrounded with large holes is still a challenge so far. In this paper, a method which involves pumping positive pressure of nitrogen gas in both the cane fabrication and fiber-drawing processes, is proposed. A suspended nanowire, with a core diameter of 480 nm and an unprecedented large diameter ratio of holey region to core (DRHC) of at least 62, is fabricated in the length of several hundred meters. Owing to the large holes, the confinement loss of the suspended nanowire is insignificant when the wavelength of light propagated in it is 1700 nm. Additionally, the tube-shaped glass cladding of the suspended nanowire shifts the singlemode cutoff wavelength to 810 nm, which is much shorter than the cutoff wavelength, 1070 nm, of a naked nanowire with the same diameter. A single-mode supercontinuum (SC) generation covering a wavelength range of 900-1600 nm is obtained under 1064 nm pump pulse with the peak power as low as 24 W. A single-mode third harmonic generation (THG) is observed by this nanowire under the pump of a 1557 nm femtosecond fiber laser. This work indicates that the suspended nanowire with large holes can provide high nonlinearity together with single-mode propagation, which leads to interesting applications in compact nonlinear devices.

  12. Blockade of leukocyte haptokinesis and haptotaxis by ketoprofen, diclofenac and SC-560

    Directory of Open Access Journals (Sweden)

    Paskauskas Saulius

    2011-11-01

    Full Text Available Abstract Background Nonsteroidal anti-inflammatory drugs (NSAID represent a one of the most widely used anti-inflammatory substances. Their anti-inflammatory effects are mainly based on inhibition of cyclooxygenase. The potential direct effect of NSAID on leukocyte migration was poorly investigated. Using time-lapse microscopy and 96-well fluorescence-based assay, we studied the effect of three different NSAID, ketoprofen, diclofenac and SC-560, on leukocyte haptokinesis and haptotaxis in vivo and in vitro. Results NSAID induced an immediate inhibiting effect on leukocyte migration both in vitro and in vivo. This effect was dose-dependent and was not restricted to a specific type of leukocytes. The inhibition of leukocyte migration by NSAID was partially re-stored after removal of inhibiting agent. Only complete blockade of leukocyte migration was accompanied by a strong reduction of [Ca2+]i. Conclusions NSAID strongly supress leukocyte migration. The results of the present study may have important clinical implications since blockade of leukocyte migration can be achieved after topical application of NSAID.

  13. Cruise report for A1-02-SC southern California CABRILLO project, Earthquake Hazards Task

    Science.gov (United States)

    Normark, William R.; Fisher, Michael A.; Gutmacher, Christina E.; Sliter, Ray; Hibbeler, Lori; Feingold, Beth; Reid, Jane A.

    2003-01-01

    A two-week marine geophysical survey obtained sidescan-sonar images and multiple sets of high-resolution seismic-reflection profiles in the southern California offshore area between Point Arguello and Point Dume. The data were obtained to support two project activities of the United States Geological Survey (USGS) Coastal and Marine Geology (CMG) Program: (1) the evaluation of the geologic hazards posed by earthquake faults and landslides in the offshore areas of Santa Barbara Channel and western Santa Monica Basin and (2) determine the location of active hydrocarbon seeps in the vicinity of Point Conception as part of a collaborative study with the Minerals Management Service (MMS). The 2002 cruise, A1-02- SC, is the fourth major data-collection effort in support of the first objective (Normark et al., 1999a, b; Gutmacher et al., 2000). A cruise to obtain sediment cores to constrain the timing of deformation interpreted from the geophysical records is planned for the summer of 2003.

  14. Paramagnetic atom number and paramagnetic critical pressure of the sc, bcc and fcc Ising nanolattices

    Science.gov (United States)

    Şarlı, Numan

    2015-01-01

    The effects of the magnetic atom number in the unit volume on the magnetic properties are investigated by using sc (n=8), bcc (n=9) and fcc (n=14) Ising NLs within the effective field theory with correlations. We find that the magnetic properties expand as the magnetic atom number increases in the unit volume and this expanding constitutes an elliptical path at TC. The effect of the magnetic atom number (n) in the unit volume on the magnetic properties (mp) appear as nscconstant is directly proportional with the atom number in the unit volume (C α n). Hence, by using the slopes of the paramagnetic hysteresis curves of any nanosystem, it can be predicted that the number of particles in its unit volume. Moreover, the magnetic atoms in the paramagnetic region can be considered as particles in the gas. Because of the absence of an external magnetic field, the spin orientations of these atoms are random and free to rotate. Hence, they act on individually with no mutual interaction between two nearest-neighbor magnetic atoms. Therefore, we use the statistical mechanics form of the ideal gas law in the paramagnetic region and we obtain the critical paramagnetic pressure (PC=npkBTC) of the Ising NLs at TC. We define the paramagnetic magnetic atom number in the unit volume as np=n(1-M(T)).

  15. BEP Enhancement for Semi-Femtocell MIMO Systems Employing SC-QICs and OSTBCs

    Directory of Open Access Journals (Sweden)

    Ardavan Rahimian

    2013-01-01

    Full Text Available In mobile cellular networks, it is estimated that more than 60% of voice and data services occur indoors. Therefore, cellular network operators have shown an unprecedented interest in research on femtocell systems from various aspects to extend the indoor wireless coverage for providing high-quality and high data-rate wireless multimedia services contents. In an effort for reducing the bit-error probabilities (BEPs and also increasing bit/symbol capacity of bandwidth limited error-prone wireless channels in femtocell propagation areas, this paper presents the performance of a promising candidate technology designed based on the state-of-the-art techniques. The performance of powerful space-time turbo codes (STTCs based on serial concatenation of quadratic interleaved codes (SC-QICs with the optimal and also suboptimal decoding algorithms, in conjunction with orthogonal space-time block codes (OSTBCs have been presented in this contribution for wireless multiple-input single-output (MISO, and multiple-input multiple-output (MIMO semi-femtocells.

  16. CERN Technical Training 2005: New Short Course (SC) Sessions on Office Software - July 2005

    CERN Multimedia

    Davide Vitè

    2005-01-01

    The following new course sessions are currently scheduled in the framework of the CERN Technical Training Programme 2005, within the Office Software curriculum: OUTLOOK 2003 (Short Course I) - E-mail : 6.7.2005 (morning) OUTLOOK 2003 (Short Course II) - Calendar, Tasks and Notes : 7.7.2005 (morning) OUTLOOK 2003 (Short Course III) - Meetings and Delegation : 8.7.2005 (morning) WORD 2003 (Short Course I) - HowTo... Work with repetitive tasks: 4.7.2005 (afternoon) WORD 2003 (Short Course II) - HowTo... Mail merge : 5.7.2005 (afternoon) WORD 2003 (Short Course III) - HowTo... Work with long documents : 6.7.2005 (afternoon) EXCEL 2003 (Short Course I) - HowTo... Work with formulae : 7.7.2005 (afternoon) EXCEL 2003 (Short Course II) - HowTo... Format your worksheet for printing : 8.7.2005 (afternoon) All the above sessions are organised in the new format of Short Courses (SC): 3 hour sessions (9h30-12h30 or 14h30-17h30), at a nominal cost of 75.- CHF per person per course. Any course can be followed independe...

  17. The quantum interference effects in the Sc II 4247 $\\AA$ line of the Second Solar Spectrum

    CERN Document Server

    Smitha, H N; Stenflo, J O; Bianda, M; Ramelli, R

    2014-01-01

    The Sc II 4247 $\\AA$ line formed in the chromosphere is one of the lines well known, like the Na I D$_2$ and Ba II D$_2$, for its prominent triple peak structure in $Q/I$ and the underlying quantum interference effects governing it. In this paper, we try to study the nature of this triple peak structure using the theory of $F$-state interference including the effects of partial frequency redistribution (PRD) and radiative transfer (RT). We compare our results with the observations taken in a quiet region near the solar limb. In spite of accounting for PRD and RT effects it has not been possible to reproduce the observed triple peak structure in $Q/I$. While the two wing PRD peaks (on either side of central peak) and the near wing continuum can be reproduced, the central peak is completely suppressed by the enhanced depolarization resulting from the hyperfine structure splitting. This suppression remains for all the tested widely different 1D model atmospheres or for any multi-component combinations of them. W...

  18. Human scFvs That Counteract Bioactivities of Staphylococcus aureus TSST-1

    Science.gov (United States)

    Rukkawattanakul, Thunchanok; Sookrung, Nitat; Seesuay, Watee; Onlamoon, Nattawat; Diraphat, Pornphan; Chaicumpa, Wanpen; Indrawattana, Nitaya

    2017-01-01

    Some Staphylococcus aureus isolates produced toxic shock syndrome toxin-1 (TSST-1) which is a pyrogenic toxin superantigen (PTSAg). The toxin activates a large fraction of peripheral blood T lymphocytes causing the cells to proliferate and release massive amounts of pro-inflammatory cytokines leading to a life-threatening multisystem disorder: toxic shock syndrome (TSS). PTSAg-mediated-T cell stimulation circumvents the conventional antigenic peptide presentation to T cell receptor (TCR) by the antigen-presenting cell (APC). Instead, intact PTSAg binds directly to MHC-II molecule outside peptide binding cleft and simultaneously cross-links TCR-Vβ region. Currently, there is neither specific TSS treatment nor drug that directly inactivates TSST-1. In this study, human single chain antibodies (HuscFvs) that bound to and neutralized bioactivities of the TSST-1 were generated using phage display technology. Three E. coli clones transfected with TSST-1-bound phages fished-out from the human scFv library using recombinant TSST-1 as bait expressed TSST-1-bound-HuscFvs that inhibited the TSST-1-mediated T cell activation and pro-inflammatory cytokine gene expressions and productions.Computerized simulation, verified by mutations of the residues of HuscFv complementarity determining regions (CDRs),predicted to involve in target binding indicated that the HuscFvs formed interface contact with the toxin residues important for immunopathogenesis. The HuscFvs have high potential for future therapeutic application. PMID:28218671

  19. Pesquisa de clima organizacional em empresas de desenvolvimento de software de Blumenau – SC

    Directory of Open Access Journals (Sweden)

    Simone Cristina Aléssio

    2010-08-01

    Full Text Available O objetivo deste trabalho é estudar a influência das variáveis que compõem o Clima Organizacional em ambientes de desenvolvimento de software do município de Blumenau, SC, com o propósito de analisar as relações existentes nestes ambientes de trabalho. Parte-se do pressuposto de que as pessoas são as figuras mais importantes em uma organização, e o modo como se sente é fundamental para o equilíbrio de todos. Por isso, enfoca-se bastante a questão da cultura organizacional, que influencia diretamente o comportamento individual e coletivo dos colaboradores, sendo determinante no Clima Organizacional. Para isso, foi realizada uma pesquisa, levando-se em consideração fatores internos e externos que podem ter influência sobre o Clima Organizacional. Utilizou-se um questionário com 55 perguntas, retiradas do modelo de Carlos Alberto Ferreira Bispo (2006, aplicado em 12 empresas, das 20 selecionadas.

  20. Supercritical carbon dioxide (SC-CO2) extraction of essential oil from Swietenia mahagoni seeds

    Science.gov (United States)

    Norodin, N. S. M.; Salleh, L. M.; Hartati; Mustafa, N. M.

    2016-11-01

    Swietenia mahagoni (Mahogany) is a traditional plant that is rich with bioactive compounds. In this study, process parameters such as particle size, extraction time, solvent flowrate, temperature and pressure were studied on the extraction of essential oil from Swietenia mahagoni seeds by using supercritical carbon dioxide (SC-CO2) extraction. Swietenia mahagoni seeds was extracted at a pressure of 20-30 MPa and a temperature of 40-60°C. The effect of particle size on overall extraction of essential oil was done at 30 MPa and 50°C while the extraction time of essential oil at various temperatures and at a constant pressure of 30 MPa was studied. Meanwhile, the effect of flowrate CO2 was determined at the flowrate of 2, 3 and 4 ml/min. From the experimental data, the extraction time of 120 minutes, particle size of 0.5 mm, the flowrate of CO2 of 4 ml/min, at a pressure of 30 MPa and the temperature of 60°C were the best conditions to obtain the highest yield of essential oil.