WorldWideScience

Sample records for ce em ferricretes

  1. Cério (Ce em ferricretes nodulares desenvolvidos em solos da formação adamantina Cerium (Ce in some nodular ferricretes developed in soils of the adamantina formation

    Directory of Open Access Journals (Sweden)

    Maurício Rizzato Coelho

    2000-06-01

    Full Text Available O estudo de concentrações anômalas de elementos traço em ferricretes, como cério (Ce e outros elementos das terras raras, tem apoiado discussões a respeito da gênese dessas feições em diferentes ambientes do planeta. No município de Pindorama (SP, no sopé de uma vertente com domínio de Argissolos Vermelho-Amarelos abrúpticos derivados do arenito cretácico da Formação Adamantina, Grupo Bauru (Ka, ocorrem horizontes ferricretes, cujas características e gênese são escassamente conhecidas, embora sejam de ocorrência comum na região norte do Estado de São Paulo. Procurou-se verificar a presença de concentrações de elementos terras raras nesses solos e assim poder fornecer subsídios para o conhecimento da gênese desses ferricretes, estudando-se um Argissolo Vermelho-Amarelo Eutrófico abrúptico plíntico dessa vertente. Após descrição morfológica do perfil, determinou-se a granulometria, bem como as concentrações de Fe e Mn totais (fluorescência de raios X, extraídos por ataque sulfúrico, ditionito-citrato e por oxalato dos horizontes e dos nódulos encontrados. Em glébulas selecionadas, realizou-se estudos submicroscópicos e microanálises pontuais. Acumulações localizadas de Ce na forma de cerianita (CeO2 foram encontradas apenas nos nódulos petroplínticos que apresentam revestimentos de óxidos de Mn, situados na base do horizonte petroplíntico, e cuja gênese está associada ao rebaixamento definitivo do lençol freático. Cobalto (Co também se concentra no interior dos nódulos ferro-manganíferos devido à ação co-precipitadora dos óxidos de manganês aí depositados.The observation of rare earth element (REE accumulations, especially Ce, has led to an open discussion about the genesis of lateritic weathering systems. In the landscape of the northern State of São Paulo (Brazil, lateritic covers predominantly nodular exist in different topographic levels and, although not documented, constitute a

  2. Macro e micromorfologia de ferricretes nodulares desenvolvidos de arenito do grupo Bauru, formação Adamantina

    Directory of Open Access Journals (Sweden)

    M. R. Coelho

    2001-06-01

    Full Text Available Nas paisagens do norte do estado de São Paulo, sob domínio do Planalto Ocidental, ferricretes ocorrem em diferentes níveis topográficos e, apesar de pouco documentados, constituem feições que se repetem com freqüência sobre os arenitos cretácicos do Grupo Bauru, Formação Adamantina. Realizou-se um estudo morfológico, em diferentes escalas de observação, a fim de elucidar a gênese desses ferricretes (plintita e petroplintita encontrados no terço inferior de uma vertente dominada por solos com B textural. A área estudada localiza-se na Estação Experimental de Agronomia de Pindorama, do Instituto Agronômico de Campinas (IAC, região norte do estado de São Paulo. Dois perfis foram selecionados para a descrição morfológica detalhada e para as observações micromorfológicas com lupa binocular e microscópio petrográfico. As evidências macro e micromorfológicas dos ferricretes revelam uma origem associada à lixiviação do ferro ferroso a montante da paisagem e reprecipitação na zona de vadosa. Esses ferricretes apresentaram diferentes fábricas internas, a maioria dos quais com estruturas de degradação, evidenciando o desmantelamento atual da couraça. As diferenças nas fábricas internas estão relacionadas com a distribuição do esqueleto e do plasma: alguns apresentam esqueleto bem selecionado, com predominância de areia muito fina, enquanto em outros predomina a areia média; outros, ainda, mostram esqueleto pouco selecionado, assemelhando-se ao fundo matricial interglebular; a maioria mostra alguns volumes ocupados apenas por plasma. Demonstra-se que fatores pedo-lito-biológicos estão envolvidos nessa diversidade entre ferricretes de um mesmo horizonte, formando in situ glébulas tão distintas em suas fábricas, que podem ser erroneamente interpretadas como provenientes de diferentes locais da paisagem, transportadas e depositadas nas baixas encostas durante a gênese dos ferricretes.

  3. Ferricrete, manganocrete, and bog iron occurrences with selected sedge bogs and active iron bogs and springs in the upper Animas River watershed, San Juan County, Colorado

    Science.gov (United States)

    Yager, Douglas B.; Church, Stanley E.; Verplanck, Philip L.; Wirt, Laurie

    2003-01-01

    During 1996 to 2000, the Bureau of Land Management, National Park Service, Environmental Protection Agency, United States Department of Agriculture (USDA) Forest Service, and the U.S. Geological Survey (USGS) developed a coordinated strategy to (1) study the environmental effects of historical mining on Federal lands, and (2) remediate contaminated sites that have the greatest impact on water quality and ecosystem health. This dataset provides information that contributes to these overall objectives and is part of the USGS Abandoned Mine Lands Initiative. Data presented here represent ferricrete occurrences and selected iron bogs and springs in the upper Animas River watershed in San Juan County near Silverton, Colorado. Ferricretes (stratified iron and manganese oxyhydroxide-cemented sedimentary deposits) are one indicator of the geochemical baseline conditions as well as the effect that weathering of mineralized rocks had on water quality in the Animas River watershed prior to mining. Logs and wood fragments preserved in several ferricretes in the upper Animas River watershed, collected primarily along streams, yield radiocarbon ages of modern to 9,580 years B.P. (P.L. Verplanck, D.B. Yager, and S.E. Church, work in progress). The presence of ferricrete deposits along the current stream courses indicates that climate and physiography of the Animas River watershed have been relatively constant throughout the Holocene and that weathering processes have been ongoing for thousands of years prior to historical mining activities. Thus, by knowing where ferricrete is preserved in the watershed today, land-management agencies have an indication of (1) where metal precipitation from weathering of altered rocks has occurred in the past, and (2) where this process is ongoing and may confound remediation efforts. These data are included as two coverages-a ferricrete coverage and a bogs and springs coverage. The coverages are included in ArcInfo shapefile and Arc

  4. Prática docente em educação sexual em uma escola pública de Juazeiro do Norte, CE, Brasil

    Directory of Open Access Journals (Sweden)

    Glauberto da Silva Quirino

    2013-01-01

    Full Text Available Estudo etnográfico com base na observação participante e entrevista semiestruturada, que objetivou descrever o trabalho de educação sexual dos/as professores/as, e apreender os valores e as atitudes destes/as em relação à sexualidade de adolescentes no espaço escolar. O trabalho de campo foi desenvolvido em uma escola de Ensino Fundamental e Médio estadual da cidade de Juazeiro do Norte-CE, no período de setembro de 2009 a fevereiro de 2010. Constatou-se que, mesmo sendo o assunto suscitado por parte dos/as estudantes, sempre os/as professores/as se omitiram em realizar qualquer intervenção. Observou-se a presença de valores morais e pessoais na condução das práticas educativas, atitudes de silenciamento em relação ao preconceito a homossexuais e a perda da virgindade, assim como manutenção das desigualdades de gênero. Os dados apontam as fragilidades das ações pedagógicas e a necessidade de mudança de paradigma do processo ensino/aprendizagem.

  5. An empirical method for estimating instream pre-mining pH and dissolved Cu concentration in catchments with acidic drainage and ferricrete

    Science.gov (United States)

    Nimick, D.A.; Gurrieri, J.T.; Furniss, G.

    2009-01-01

    Methods for assessing natural background water quality of streams affected by historical mining are vigorously debated. An empirical method is proposed in which stream-specific estimation equations are generated from relationships between either pH or dissolved Cu concentration in stream water and the Fe/Cu concentration ratio in Fe-precipitates presently forming in the stream. The equations and Fe/Cu ratios for pre-mining deposits of alluvial ferricrete then were used to reconstruct estimated pre-mining longitudinal profiles for pH and dissolved Cu in three acidic streams in Montana, USA. Primary assumptions underlying the proposed method are that alluvial ferricretes and modern Fe-precipitates share a common origin, that the Cu content of Fe-precipitates remains constant during and after conversion to ferricrete, and that geochemical factors other than pH and dissolved Cu concentration play a lesser role in determining Fe/Cu ratios in Fe-precipitates. The method was evaluated by applying it in a fourth, naturally acidic stream unaffected by mining, where estimated pre-mining pH and Cu concentrations were similar to present-day values, and by demonstrating that inflows, particularly from unmined areas, had consistent effects on both the pre-mining and measured profiles of pH and Cu concentration. Using this method, it was estimated that mining has affected about 480 m of Daisy Creek, 1.8 km of Fisher Creek, and at least 1 km of Swift Gulch. Mean values of pH decreased by about 0.6 pH units to about 3.2 in Daisy Creek and by 1-1.5 pH units to about 3.5 in Fisher Creek. In Swift Gulch, mining appears to have decreased pH from about 5.5 to as low as 3.6. Dissolved Cu concentrations increased due to mining almost 40% in Daisy Creek to a mean of 11.7 mg/L and as much as 230% in Fisher Creek to 0.690 mg/L. Uncertainty in the fate of Cu during the conversion of Fe-precipitates to ferricrete translates to potential errors in pre-mining estimates of as much as 0.25 units

  6. Loucura em liberdade: vivências e convivências em Crato-CE (1930-1970)

    OpenAIRE

    Cleide Correia de Oliveira; Francisca Bezerra de Oliveira; Maria Lucinete Fortunato; Antonia Oliveira Silva

    2003-01-01

    Este estudo teve como objetivos: identificar os personagens mais significativos no imaginário social e narrar as suas vivências e convivências. É um estudo sócio-histórico. As fontes documentais foram orais (entrevistas semi-estruturadas) e escritas. A interpretação dos achados apoiou-se nos estudos arqueológicos de Foucault sobre a história da loucura, e em autores que estudaram os temas: loucura psiquiatria e reforma psiquiátrica. A loucura narrada no cenário do Crato indica a existência de...

  7. Morbidade referida e seus condicionantes em crianças de 5 a 9 anos em Sobral, CE, Brasil Reported morbidity and its conditionings in children 5 to 9 years old in Sobral, CE, Brazil

    Directory of Open Access Journals (Sweden)

    Ivana Cristina de Holanda Cunha Barreto

    2010-03-01

    Full Text Available OBJETIVO: Descrever a morbidade referida em crianças de 5 a 9 anos e analisar seus possíveis condicionantes. METODOLOGIA: Corte de base populacional com amostra aleatória e representativa em crianças de 5 a 9 anos da zona urbana de Sobral - CE, Brasil. Entrevistas domiciliares com 3.276 crianças e exame clínico em 2.594. A morbidade referida foi classificada segundo a CID-10. O desfecho analisado foi morbidade referida nos últimos 15 dias, utilizando Stata 7.0. RESULTADOS: 43,9% das crianças apresentaram morbidade referida: Doenças do Aparelho Respiratório (DAR, 28,7%; doenças da pele, 3,4%; doenças infecciosas, 2,2%. Daquelas que adoeceram, 41,5% procuraram atendimento. Dessas, 77,4% em Unidades de Saúde Familiar. Apresentaram maiores chances de DAR as crianças com as seguintes características: residir no núcleo urbano principal do município, ter antecedente de desnutrição e frequentar escola, com um valor de ODDS Ratio, respectivamente de 1,48 (IC95%1,10-1,99, 1,30 (IC95%1,05-1,60 e 1,54 (IC95%1,02-2,32. DISCUSSÃO: Chamou a atenção a elevada prevalência de DAR em crianças do núcleo urbano principal, cerca de duas vezes maior que a observada em outros estudos de metodologia similar, levantando hipóteses de sobrerelato ou poluição ambiental. A maioria das crianças apresentou problemas de saúde de menor gravidade e teve acesso facilitado aos serviços de saúde, principalmente ao PSF. CONCLUSÕES: Serão necessários novos estudos para identificar possíveis causas da elevada prevalência de DAR em crianças do núcleo urbano principal do município. As ocasiões em que as crianças demandam os serviços de saúde da família por doenças de baixa gravidade podem ser aproveitadas para medidas de prevenção e promoção da saúde.INTRODUCTION: This study was based on a random sample of 3,276 children aged between 5 and 9 years from the urban region of Sobral - CE, Brazil. OBJECTIVE: The main goal was to describe

  8. Loucura em liberdade: vivências e convivências em Crato-CE (1930-1970

    Directory of Open Access Journals (Sweden)

    Cleide Correia de Oliveira

    2003-04-01

    Full Text Available Este estudo teve como objetivos: identificar os personagens mais significativos no imaginário social e narrar as suas vivências e convivências. É um estudo sócio-histórico. As fontes documentais foram orais (entrevistas semi-estruturadas e escritas. A interpretação dos achados apoiou-se nos estudos arqueológicos de Foucault sobre a história da loucura, e em autores que estudaram os temas: loucura psiquiatria e reforma psiquiátrica. A loucura narrada no cenário do Crato indica a existência de uma multiplicidade que revela a diversidade, transcendendo o paradigma psiquiátrico tradicional, cujo princípio é a idéia de que o louco deve ser isolado da sociedade. Espera-se que esta pesquisa contribua para o debate sobre a prática dos profissionais de enfermagem no campo da psiquiatria/saúde mental.

  9. Conhecimento de farmacêuticos sobre aleitamento materno: um estudo nas farmácias comerciais em FORTALEZA-CE

    Directory of Open Access Journals (Sweden)

    Luzia Izabel Mesquita Moreira da Silva

    2013-07-01

    Full Text Available Objetivo: Avaliar o conhecimento de farmacêuticos que atuam em farmácias comerciais de Fortaleza-CE, Brasil, sobre aleitamento materno. Métodos: Trata-se de um estudo observacional, descritivo e transversal. Foi utilizado um questionário abordando o perfil dos farmacêuticos e os conhecimentos gerais sobre aleitamento materno e Norma Brasileira de Comercialização de Alimentos para Lactentes e Crianças de Primeira Infância, Bicos, Chupetas e Mamadeiras (NBCAL. A coleta de dados ocorreu no período de janeiro a março de 2011. Através de sorteio, selecionaram-se 82 farmácias comerciais, correspondendo a 15,5% do total das farmácias de Fortaleza, quando realizou-se o contato com seus respectivos profissionais farmacêuticos. O questionário foi aplicado com 67 farmacêuticos. Os resultados foram submetidos à análise estatística através dos programas Epi Info v. 3.5.1 e SigmaPlot v. 10.0. Resultados: Entre os participantes da pesquisa, 72% (n=48 eram do sexo feminino; 35,8% (n=24 estão formados há mais de dez anos; 49,3% (n=33 trabalham em farmácia comercial há menos de cinco anos; e 52,2% (n=35 exercem atividade profissional em outros estabelecimentos. O nível de conhecimento foi avaliado como regular para 71,7 % (n=48 dos entrevistados; insuficiente para 17,9% (n=12; e bom para 10,4% (n= 07. Esse baixo desempenho, não atingindo o escore máximo, foi associado ao tempo de exercício na profissão, observando-se que os profissionais formados há mais de dez anos apresentaram menor nível de conhecimento. Conclusão: Os profissionais entrevistados reconhecem a importância do aleitamento materno tanto para a saúde do bebê quanto para a da mãe. Entretanto, faltam conhecimentos sobre informações relevantes referentes ao manejo correto da amamentação, principalmente entre aqueles que se graduaram há mais tempo.

  10. Metallic oxides supported in CeO{sub 2} and CeO{sub 2}-La{sub 2} O{sub 3} for low temperature shift reaction; Oxidos metalicos suportados em CeO{sub 2} e CeO{sub 2}-La{sub 2} O{sub 3} para reacao shift a baixa temperatura

    Energy Technology Data Exchange (ETDEWEB)

    Maluf, Silvia Salua; Assaf, Elisabete Moreira [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: sil_maluf@iqsc.usp.br

    2008-07-01

    This work studied copper and zinc oxides supported in CeO{sub 2} and CeO{sub 2}/La{sub 2}O{sub 3}. The catalytic tests for low temperature shift reaction, carried out for samples, showed the Cu-Ce catalyst presents the highest value of CO conversion (50%) and after the Cu-Ce-La catalysts (30%). The other catalysts showed CO conversion in range of 15%. This behavior is related with surface area, and also with the amount of Cu in the surface of samples (author)

  11. Uso de práticas integrativas e complementares por doulas em maternidades de Fortaleza (CE) e Campinas (SP)

    OpenAIRE

    Raimunda Magalhães da Silva; Herla Maria Furtado Jorge; Regina Yoshie Matsue; Antonio Rodrigues Ferreira Junior; Nelson Filice de Barros

    2016-01-01

    Resumo Objetivou-se analisar as Práticas Integrativas e Complementares (PICs) utilizadas por doulas nos municípios de Fortaleza (CE) e Campinas (SP). É um estudo de natureza qualitativa, com 15 doulas: nove de Fortaleza e seis de Campinas. Os dados foram coletados no segundo semestre de 2010, mediante a realização de entrevistas semiestruturadas, e organizados seguindo a técnica da Análise de Con teúdo na modalidade temática. A interpretação dos resultados baseou-se na noção de que a instituc...

  12. Condições higiênico-sanitárias na comercialização de pescados em Sobral − CE | Hygienic-sanitary conditions in fish trading in Sobral − CE

    Directory of Open Access Journals (Sweden)

    Mauro Vinicius Dutra Girão

    2015-11-01

    Full Text Available Este trabalho objetiva avaliar as condições higiênico-sanitárias dos comércios de pescado particulares do município de Sobral − CE, através da análise visual e utilização de um checklist, baseado na RDC no 216. As informações foram coletadas através da observação da rotina de trabalho dos estabelecimentos registrados na Vigilância Sanitária Municipal durante inspeções mensais em um período de três meses. Para cada critério contido no checklist, foi realizada uma média das conformidades e não conformidades e quantificação do percentual de acertos de cada. Os estabelecimentos inspecionados encontram-se em condições de funcionamento que oferecem riscos moderados de contaminação dos pescados. Dentre os fatores de risco de contaminação encontram-se a Edificação, devido à presença de insetos, que são potenciais vetores mecânicos de microorganismos, a Higienização de utensílios, devido as não conformidades quanto à disposição dos equipamentos para o adequado fluxo dos trabalhadores, infiltrações, telas, ralos sinfonados, caixas de gorduras, luminárias, instalações elétricas e sanitárias, e Manipuladores, que falavam sobre o alimento, manuseavam dinheiro, não utilizavam cabelos presos e utilizavam adornos. Mesmo observando um despreparo das pessoas envolvidas na atividade, observa-se uma tendência à adequação à legislação sanitária em prol da qualidade do alimento. =============================================== The aim of this study was to evaluate the sanitary conditions of the fish markets in the city of Sobral, CE, using visual analysis and a checklist based on the RDC 216. The information was collected over a period of three months during monthly inspections in fish market establishments registered with the Brazilian Health Surveillance town. We calculated the percentage of compliance/non-compliance for each checklist item. Each of the inspected establishments showed signs of moderate

  13. Estilo de vida de adolescentes das escolas públicas de ensino fundamental, em Fortaleza/CE, em relação ao risco de hipertensão

    Directory of Open Access Journals (Sweden)

    Thiago Brasileiro de Vasconcelos

    2013-01-01

    Full Text Available Objetivo: analisar o estilo de vida dos adolescentes das escolas públicas de ensino fundamental na cidade de Fortaleza/CE, em relação ao risco de Hipertensão Arterial Sistêmica (HAS. Métodos: estudo descritivo, exploratório, transversal e quantitativo, realizado com 120 alunos de seis escolas públicas do ensino fundamental na cidade de Fortaleza/CE. A coleta de dados foi realizada de fevereiro a abril de 2007. Para tanto, foi utilizado um questionário estruturado composto de perguntas e respostas objetivas a respeito da prática de atividade física, das horas de sono, do uso de cigarro, dos hábitos alimentares, dos antecedentes familiares com HAS, de quais fatores que causam a HAS, se fazem uso de bebidas alcoólicas e por fim como se deve prevenir a HAS. Resultados: a amostra do estudo foi composta de 120 alunos de ambos os sexos com média de idade de 13,88 anos ± 1,27 ano. Em relação aos fatores de risco, 37,5% (n=45 dos estudantes realizam atividade física mais de duas vezes por semana; em relação ao hábito de fumar 96,67% (n=116 não fumam; sobre a ingestão de alimentos, 50,8% (n=61 ingerem biscoitos com suco; 94,2% (n=113 não fazem uso de bebidas alcoólicas e foi detectado que 65% (n=78 estão abaixo do peso ideal. Outro fator identificado foi que 32,50% (n=39 da amostra apresentam antecedentes familiares de primeiro e/ou segundo graus com afecções cardiovasculares, prevalecendo a HAS em 30%. Conclusão: verificou-se que os alunos realizam pouca atividade física, alimentam-se de forma inadequada com alimentos ricos em gorduras e carboidratos e apresentam antecedentes familiares com afecções cardiovasculares.

  14. RELAÇÃO ENTRE IDADE E CAPACIDADE FUNCIONAL DE IDOSAS RESIDENTES EM INSTITUIÇÕES DE LONGA PERMANÊNCIA NA CIDADE DE FORTALEZA/CE

    Directory of Open Access Journals (Sweden)

    Darling Kescia Araújo Peixoto Braga

    2014-12-01

    Full Text Available Introdução: O envelhecimento gera desgastes fisiológicos próprios. O sistema de valores socioculturais ocidentais e a atual configuração dos arranjos familiares associados aumenta a institucionalização de idosos, que pela fragilidade podem ter déficits na execução das atividades básicas de vida diária (ABVD's e cognição. Objetivo: Avaliar o desempenho nas ABVD, considerando a faixa etária de mulheres idosas residentes em duas Instituições de Longa Permanência para Idosos (ILPI´s na cidade de Fortaleza/CE. Métodos: Estudo seccional, realizado no período de Outubro a Dezembro de 2013 através de um censo com 24 idosas residentes em duas ILPI's. A coleta de dados foi realizada em duas etapas: formulário com caracterização da amostra e o questionário de ABVD de Barthel. Resultados: A amostra possui idade média de 80,04 anos (± 7,91; mín, = 65,0 e máx. = 90,0, eram solteira (66,6%, com baixa escolaridade (33,3% analfabetas e 33,3% com primário completo, procedentes do interior do Estado (58,3% e residiam na instituição há menos de cinco anos (58,3%. O Índice de Barthel revelou que a maioria (75% eram independentes para a realização das ABVDs, sem influenciada da faixa etária. Conclusão: As idosas residentes nas ILPI apresentam independência funcional nas ABVD e sem influência da idade.

  15. Thermoelastic and structural properties of ionically conducting cerate perovskites: (I) BaCeO3 at low temperature in the <em>Pbnm> phase

    DEFF Research Database (Denmark)

    Knight, Kevin S.; Bonanos, Nikolaos

    2013-01-01

    parameter. Structural parameters are presented as the amplitudes of the seven symmetry-adapted basis-vectors of the aristotype phase, and a structural basis for the temperature-dependence of the bond lengths is outlined. The critical exponent associated with the temperature variation of the primary order......The thermoelastic and structural properties of BaCeO3 perovskite in the Pbnm phase field have been studied using high resolution neutron diffractometry at 37 temperatures between 2 K and 350 K. From a simultaneous fit of the isochoric heat capacity and unit cell volume, the vibrational density...... of states in the Pbnm phase is shown to be approximated by a two-term modified Debye model with characteristic temperatures 176(1) K and 543(2) K. Vibrational Debye temperatures, determined from the temperature-variation of the atomic displacement parameters, suggest the cations to be more associated...

  16. MORFODINÂMICA FLUVIAL EM ÁREAS SEMIÁRIDAS: DISCUTINDO O VALE DO RIO JAGUARIBE-CE-BRASIL

    Directory of Open Access Journals (Sweden)

    Andréa Almeida Cavalcante

    2012-08-01

    Full Text Available O trabalho discute o funcionamento dos ambientes fluviais em regiões semiáridas, trazendo, como estudo de caso, um recorte espacial para o vale do Jaguaribe, Estado do Ceará. Na discussão são apresentadas questões sobre o barramento de cursos d’água e suas repercussões na morfodinâmica de canais. Para a realização do trabalho, foram utilizados dados do monitoramento de 11 (onze estações distribuídas entre a barragem do Castanhão e a cidade de Jaguaruana, onde foram levantadas medições de vazão, concentração de sedimentos, largura e profundidade do canal. O perfil longitudinal foi feito a partir de dados de SRTM, utilizando o software ArcGis 9.3. Os resultados mostram que os processos fluviais são rápidos e intensos em regiões semiáridas, necessitando o aprofundamento de estudos diferenciados em relação àqueles realizados em regiões tropicais úmidas. No vale do Jaguaribe, os dados mostram que grandes barramentos mudam as condições morfológicas de jusante, entretanto, levam algum tempo para serem percebidas. Tais alterações são observadas à jusante das barragens de Orós, Várzea do Boi e Castanhão. A jusante da barragem do Castanhão as mudanças são menos perceptíveis, haja vista o tempo de construção da mesma (2002. Se morfologicamente as alterações provocadas por um barramento podem levar um tempo maior para serem visíveis, hidrológica e sedimentologicamente as variações podem ser vistas de modo mais rápido. Nesse sentido, altera-se principalmente as amplitudes de vazões que influenciam na redução de descarga sólida e, consequentemente, alteram padrões de canais a médio e longo prazo.

  17. ACIDENTES DE MOTOCICLETA: CARACTERÍSTICAS DAS VÍTIMAS E DOS ACIDENTES EM HOSPITAL DE FORTALEZA – CE, BRASIL

    Directory of Open Access Journals (Sweden)

    Luciene Miranda de Andrade

    2009-01-01

    Full Text Available Estudio retrospectivo, cuantitativo, desarrollado en una institución pública de porte referencial en la atención de emergencia a las víctimas del trauma. La finalidad de este estudio fue tratar de las características epidemiológicas de las víctimas de accidentes de motocicleta, enfocando las medidas de seguridad utilizadas por sus conductores. La muestra abarcó 306 víctimas en trauma, en la ciudad de Fortaleza-CE, en 2005. Los resultados mostraron que 301 son del sexo masculino, 138 se incluían en el grupo de edad de 18 a 29 años y 193 procedían del interior. Casi la mitad de los accidentes, 154, ocurrió los sábados y domingos, predominantemente en el horario entre 12 y 24 horas. La colisión fue el evento más frecuente, 211 casos, y 127 eran casos de politraumatismos. De ellos, 158 no tenían carnet de conducir, 160 no usaban casco y 186 no habían ingerido bebida alcohólica. Estos resultados advierten sobre la importancia de intensificar las campañas educativas sobre accidentes de tránsito, abarcando no sólo las capitales, sino también y principalmente, el interior del Estado.

  18. IMPLANTAÇÃO DA AUDITORIA BASEADA EM RISCO EM UMA ENTIDADE DO "SISTEMA S": O CASO DO SEBRAE/CE

    OpenAIRE

    Ruth Carvalho de Santana Pinho; Leonardo Brandão Bezerra

    2015-01-01

    Com a crescente complexidade dos negócios, muitas entidades viram a necessidade de um controle maior sobre o risco para que seus objetivos pudessem ser atingidos. O presente trabalho discorre sobre a Auditoria Baseada em Risco (ABR), evidenciando suas principais características. O estudo apresenta-se relevante tanto para o meio empresarial, evidenciando as etapas de implantação dessa metodologia, como para o meio acadêmico, que possui poucos estudos relacionados ao tema, conforme observações ...

  19. PREVALÊNCIA DE ALEITAMENTO MATERNO EM MULHERES EGRESSAS DE UM HOSPITAL AMIGO DA CRIANÇA EM QUIXADÁ-CE

    Directory of Open Access Journals (Sweden)

    Patrícia Matias Pinheiro

    2010-01-01

    Full Text Available Estudio descriptivo- exploratorio, de enfoque cuantitativo, realizado en Quixadá, CE, entre mayo del 2007 a mayo del 2 008 con el fin de analizar la prevalencia de la lactancia materna en mujeres que les dieron el alta de un “Hospital Amigo del Niño”. Los agentes comunitarios de salud aplicaron un cuestionario a las mujeres que tuvieron hijos, que se llevó a cabo en su propio domicilio. Fueron entrevistadas 181 mujeres. Se comprobó un predominio de un 55,3% de amamantamiento materno exclusivo a los cuatro meses y un 46,2% a los seis meses. Se verificó que un 99,4% hicieron el prenatal y un 97,2% recibieron orientaciones sobre la lactancia materna. El estudio señala baja prevalencia de lactancia materna exclusiva, a pesar de la madre haber tenido el hijo en un “Hospital Amigo del Niño”, que institucionalmente apoya la lactancia materna en varias etapas. Se torna muy evidente la necesidad de un soporte más efectivo para esas mujeres, después del alta del hospital, para prevención del destete precoz.

  20. Uso de práticas integrativas e complementares por doulas em maternidades de Fortaleza (CE e Campinas (SP

    Directory of Open Access Journals (Sweden)

    Raimunda Magalhães da Silva

    2016-03-01

    Full Text Available Resumo Objetivou-se analisar as Práticas Integrativas e Complementares (PICs utilizadas por doulas nos municípios de Fortaleza (CE e Campinas (SP. É um estudo de natureza qualitativa, com 15 doulas: nove de Fortaleza e seis de Campinas. Os dados foram coletados no segundo semestre de 2010, mediante a realização de entrevistas semiestruturadas, e organizados seguindo a técnica da Análise de Con teúdo na modalidade temática. A interpretação dos resultados baseou-se na noção de que a institucio nalização dos saberes se dá pela conformação de núcleos e de campos. O núcleo demarca a identidade de uma área de saber e de práticas profissionais; e o campo, um espaço de limites imprecisos entre as disciplinas, mas que pode ser submetido a conflitos. Observou-se que o suporte das doulas permeia uma variedade de práticas emolduradas na Medicina Tradicional (MT e das PICs. Essas práticas contri buíram para a diminuição do tempo de trabalho de parto, melhor controle da dor, ajuda na tomada de decisões e empoderamento da mulher. Compreende -se que o espaço de atuação da doula e o uso de PICs convergem para a singularidade, respeito e autonomia da mulher e propõem um novo modelo de saberes e práticas centrado na importância do processo natural do parto.

  1. IMPLANTAÇÃO DA AUDITORIA BASEADA EM RISCO EM UMA ENTIDADE DO "SISTEMA S": O CASO DO SEBRAE/CE

    Directory of Open Access Journals (Sweden)

    Ruth Carvalho de Santana Pinho

    2015-12-01

    Full Text Available Com a crescente complexidade dos negócios, muitas entidades viram a necessidade de um controle maior sobre o risco para que seus objetivos pudessem ser atingidos. O presente trabalho discorre sobre a Auditoria Baseada em Risco (ABR, evidenciando suas principais características. O estudo apresenta-se relevante tanto para o meio empresarial, evidenciando as etapas de implantação dessa metodologia, como para o meio acadêmico, que possui poucos estudos relacionados ao tema, conforme observações empíricas. Assim, coube como pergunta de pesquisa: Quais fatores contribuem para a adequada implantação de uma Auditoria Baseada em Risco? Tem-se como objetivo geral deste estudo, identificar os fatores de sucesso na implantação da Auditoria Baseada em Risco (ABR. Escolheu-se como procedimento de pesquisa o estudo de caso. Os dados foram obtidos por intermédio da documentação oficial de implantação da ABR na entidade a qual descreve todas as etapas de implantação, além de aplicação de entrevista e questionário entre os auditores internos da empresa e gestores das áreas de Licitação, Contabilidade e Jurídico Concluiu-se que a ABR é uma ferramenta importante para empresas que desejam avaliação independente para a Gestão de Riscos, sendo necessário um plano bem estruturado de implantação para êxito desta. Destarte, uma Auditoria Interna Tradicional bem desenvolvida, ou seja, que mantém um controle interno eficaz, se torna uma característica facilitadora para a mudança de escopo, pois para a correta implantação da ABR é necessário um ambiente de gestão robusto e o efetivo envolvimento da equipe de auditoria.

  2. Avaliação farmacognostica e da rotulagem das drogas vegetais boldo-do-chile (Peumus boldus Molina e camomila (Matricaria recutita L. comercializadas em Fortaleza, CE

    Directory of Open Access Journals (Sweden)

    F.P. SOARES

    2015-09-01

    Full Text Available RESUMO Boldo-do-chile (Peumus boldus e camomila (Matricaria recutita são plantas empregadas na fitoterapia principalmente para o tratamento de desordens hepáticas e intestinais, atuando também como anti-inflamatório e antiespasmódico, respectivamente. Por isso, o presente trabalho objetivou avaliar a qualidade farmacognostica dessas drogas vegetais comercializadas em Fortaleza (CE, além das informações de suas rotulagens. Quarenta e duas amostras de boldo, e quarenta e cinco amostras de camomila, procedentes de farmácias, de lojas de produtos naturais e de bancas de raizeiros, foram analisadas quanto à autenticidade, à pureza e às informações contidas na rotulagem desses produtos conforme legislação vigente. Na verificação de impurezas, 35,7% das amostras de boldo e 57,7% das amostras de camomila excederam o teor máximo de matéria estranha; no teor de cinzas totais, 33,3% das amostras de boldo foram reprovadas; rotulagens das amostras de boldo (100% e de camomila (96,6% apresentaram erros ou ausência de informações. Os resultados das análises confirmam, portanto, a necessidade urgente de melhor fiscalização e intervenção na produção e venda dessas e de outras drogas vegetais para adequação às normas vigentes.

  3. Prevalência de asma em adolescentes na cidade de Fortaleza, CE Prevalence of asthma among adolescents in the city of Fortaleza, Brazil

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Gomes de Luna

    2009-11-01

    Full Text Available OBJETIVO: Avaliar a prevalência de asma em adolescentes (13-14 anos na cidade de Fortaleza, CE. MÉTODOS: Estudo transversal utilizando o questionário do International Study of Asthma and Allergies in Childhood e envolvendo 3.015 adolescentes de escolas públicas e privadas entre 2006 e 2007. RESULTADOS: As prevalências de "sibilos alguma vez na vida", "sibilos nos últimos doze meses" (asma ativa e "asma alguma vez na vida" (asma diagnosticada foram, respectivamente, 44,1%, 22,6% e 11,6%. As prevalências de "sibilos alguma vez na vida" (p = 0,001, "1-3 crises de sibilos nos últimos 12 meses" (p = 0,001; asma ativa (p = 0,002; "sono interrompido por sibilos menos que uma vez por semana" (p OBJECTIVE: To determine the prevalence of asthma among adolescents (13-14 years of age in the city of Fortaleza, Brazil. METHODS: This was a cross-sectional study involving 3,015 adolescents at public and private schools between 2006 and 2007. The participants completed the International Study of Asthma and Allergies in Childhood questionnaire. RESULTS: The prevalences of "wheezing ever", "wheezing within the last 12 months" (active asthma and "asthma ever" (physician-diagnosed asthma were 44.1%, 22.6% and 11.6%, respectively. The prevalences of "wheezing ever" (p = 0.001, "1-3 wheezing attacks within the last 12 months" (p = 0.001, active asthma (p = 0.002, "sleep disturbed due to wheezing less than one night per week" (p < 0.001 and "dry cough at night" (p < 0.001 were higher among girls. Private school students presented higher prevalences of "wheezing ever", active asthma, "1-3 wheezing attacks within the last 12 months", "4-12 wheezing attacks within the last 12 months" and physician-diagnosed asthma (p < 0.001 for all, as well as of "exercise-induced wheezing" (p = 0.032. CONCLUSIONS: The prevalence of asthma and asthma-related symptoms in students aged 13-14 years in the city of Fortaleza, Brazil, was high, predominantly among girls and private

  4. Largada pelo marido! O estigma vivido por mulheres em Tianguá-CE ¡Dejada por el marido! El estigma vivido por mujeres en Tianguá-Ce Abandoned by her husband! The stigma confronted by women in Tianguá-Ce

    Directory of Open Access Journals (Sweden)

    Virginia Moreira

    2007-04-01

    Full Text Available Este artigo descreve um estudo sobre a vivência de rompimento do casamento de mulheres deixadas por seus maridos. Teve como objetivo compreender como mulheres de Tianguá - CE - Brasil vivenciavam a ruptura da relação, descrevendo os fatores reconhecidos como agentes do rompimento da relação amorosa. A partir da experiência vivida morando em Tianguá, nossa hipótese era que essas mulheres vivenciavam o rompimento como uma experiência estigmatizada de desestruturação de sua vida pessoal. Utilizando a metodologia fenomenológica crítica com base na filosofia de Merleau-Ponty, realizamos entrevistas semi-estruturadas com 15 mulheres, com idade entre 25 e 35 anos, que haviam morado com o parceiro e com ele tinham filhos e cuja relação marital tinha se rompido havia pelo menos dois anos. Os resultados confirmaram nossas suspeitas: as mulheres colaboradoras deste estudo se sentiam estigmatizadas, encontrando no corpo um aparato para as emoções que expressavam sua dor e reconhecendo-se como incompetentes e discriminadas pela cultura patriarcal local.Este artículo describe un estudio sobre la vivencia de rompimiento del casamiento de mujeres dejadas por sus maridos. Tuvo como objetivo comprender cómo mujeres de Tianguá-Ce-Brasil vivenciaban la ruptura de la relación, describiendo los factores reconocidos como agentes del rompimiento de la relación amorosa. La partir de la experiencia vivida viviendo en Tianguá, nuestra hipótesis era la de que esas mujeres vivenciaban el rompimiento como una experiencia estigmatizada de desestructuración de su vida personal. Utilizando la metodología fenomenológica crítica, con base en la filosofía de Merleau-Ponty, realizamos encuestas semiestructuradas con 15 mujeres, con edad entre 25 y 35 años, que habían vivido con la pareja y con él tenían hijos y cuya relación matrimonial se había roto hacía por lo menos dos años. Los resultados confirmaron nuestras sospechas: las mujeres

  5. Sistemas interfaceados de análise por injeção em fluxo e eletroforese capilar (FIA - CE: desafios, aplicações e perspectivas

    Directory of Open Access Journals (Sweden)

    Miranda Carlos E. S.

    2002-01-01

    Full Text Available A review about the state-of-the-art of flow injection analysis (FIA -- capillary electrophoresis (CE systems is presented. The basic principles of flow injection and capillary electrophoresis are briefly revised. The main aspects of the FIA-CE hybridization, including advantages and shortcomings, are discussed. Some applications involving all different designs are also presented. This review covers the literature from 1997 up to 2000.

  6. Implantação do Programa Saúde na escola em Fortaleza-CE: atuação de equipe da Estratégia Saúde da Família Implantación del Programa de Salud Escolar en Fortaleza-CE: desempeño de equipo de la Estrategia Salud de la Familia School Health Program implementation in Fortaleza-CE: performance of the Family Health Strategy staff

    Directory of Open Access Journals (Sweden)

    Lindelvania Matias de Santiago

    2012-12-01

    Full Text Available Este trabalho relata a experiência da implantação do Programa Saúde na Escola (PSE por uma equipe da Estratégia Saúde da Família (ESF em uma escola pública em Fortaleza-CE. As atividades desenvolvidas incluíram seminário de implantação do PSE com os docentes e integrantes da ESF, oficinas com os estudantes, avaliação clinica e odontológica dos adolescentes e entrega de Cadernetas de Saúde do Adolescente. A implantação do PSE permitiu aos profissionais de saúde a percepção do seu papel social de educador e possibilitou aos adolescentes maior contato com a equipe da ESF. A aproximação entre escola e ESF é fundamental para ajudar os adolescentes a transformarem a informação científica em comportamentos saudáveis.Este artículo relata la experiencia de implementación del Programa de Salud Escolar (PSE por un equipo de la Estrategia de Salud de la Familia (ESF en una escuela pública en Fortaleza-CE, Brasil. Las actividades incluyeron seminario de despliegue del PSE con los maestros y los miembros de la ESF, talleres con los estudiantes, la evaluación clínica y dental de los adolescentes y la entrega de folletos de Salud del Adolescente. La aplicación del PSE permitió a los profesionales de salud a darse cuenta de su papel social como educadores y permitió a los adolescentes un mayor contacto con el personal de la ESF. El acercamiento entre la escuela y el FSE es crucial para ayudar a los adolescentes a transformar el conocimiento científico en comportamientos saludables.This work reports the experience of implementation of the School Health Program (PSE by a team from the Family Health Strategy (FHS in a public school in Fortaleza-CE , Brazil. The activities included conference about the deployment of the PSE with teachers and members of the FHS, workshops with students, clinical and dental assessment for adolescents and delivery of Booklets of Adolescent Health. The implementation of the PSE allowed health

  7. Implantação do Programa Saúde na escola em Fortaleza-CE: atuação de equipe da Estratégia Saúde da Família

    Directory of Open Access Journals (Sweden)

    Lindelvania Matias de Santiago

    2012-12-01

    Full Text Available Este trabalho relata a experiência da implantação do Programa Saúde na Escola (PSE por uma equipe da Estratégia Saúde da Família (ESF em uma escola pública em Fortaleza-CE. As atividades desenvolvidas incluíram seminário de implantação do PSE com os docentes e integrantes da ESF, oficinas com os estudantes, avaliação clinica e odontológica dos adolescentes e entrega de Cadernetas de Saúde do Adolescente. A implantação do PSE permitiu aos profissionais de saúde a percepção do seu papel social de educador e possibilitou aos adolescentes maior contato com a equipe da ESF. A aproximação entre escola e ESF é fundamental para ajudar os adolescentes a transformarem a informação científica em comportamentos saudáveis.

  8. Gravidez em adolescentes de uma unidade municipal de saúde em Fortaleza - Ceará Embarazo en adolescentes de una unidad municipal de salud en Fortaleza - Ceára (Brasil Pregnancy in adolescents of a city health unit in Fortaleza - Ceára (Brazil

    Directory of Open Access Journals (Sweden)

    Conceição de Maria Arcanjo

    2007-09-01

    Full Text Available Estudo quantitativo com objetivo de conhecer a gravidez na adolescência em unidade municipal de saúde, Fortaleza-CE. A amostra foi composta por 40 adolescentes. Como resultado, encontramos: 20% estavam entre 14 e 15 anos, 7,5% eram solteiras, 5%, casadas, 7,5% tinham união consensual; 60% tinham entre 16 e 17 anos, 5% eram solteiras, 7,5%, casadas, 47,5% tinham união consensual; 20% tinham entre 18 e 19 anos, 12,5% eram solteiras, 7,5%, casadas. E, ainda: 17,5% tiveram experiência do aborto, 50% deixaram de estudar por causa da gravidez, 25% não gostam de estudar, 20% não acham importante, 57,5% iniciaram pré-natal com três a quatro meses de gestação, 80% dos pais assumem a paternidade, 70% delas continuavam morando com a família, 70% receberam orientações sobre gravidez, 60% não utilizavam método contraceptivo, 37,5% desejam ser dona de casa, 27,5% não têm planos para o futuro. Concluímos que as adolescentes engravidam em faixa etária precoce, não percebem os riscos inerentes à gravidez e deixam de lado o estudo, lazer, vaidade ou mesmo perspectivas para o futuro. A nosso ver, o estudo pode contribuir para o redimensionamento do trabalho com adolescentes na unidade local do estudo.Estudio cuantitativo con el objetivo de conocer el embarazo en la adolescencia de una unidad municipal de salud, Fortaleza CE (Brasil. La muestra fue compuesta por 40 adolescentes. Como resultado encontramos: 20% estaban entre 14-15 años, 7,5% solteras, 5% casadas, 7,5% unión consensual; 60% entre 16 y 17años, 5% solteras, 7,5% casadas, 47,5% unión consensual; 20% entre 18-19 años, 12,5% solteras, 7,5% casadas. Y todavía 17,5% tuvieran experiencia del aborto, 50% dejaron de estudiar debido el embarazo, 25% no les gusta estudiar, 20% no encuentra importante, 57,5% empezaron prenatal con tres a cuatro meses de la gestación, 80% de los padres asumen la paternidad, 70% continúan viviendo con la familia, 70% recibieran las orientaciones en el

  9. Démantèlement des paysages cuirassés anciens en zones forestières tropicales d'Afrique centrale : formation d'accumulations ferrugineuses actuelles en bas de versantOld ferricrete landscape dismantling in Central Africa rain forest zone: formation of the present downslope iron accumulations

    Science.gov (United States)

    Temgoua, Émile; Bitom, Dieudonné; Bilong, Paul; Lucas, Yves; Pfeifer, Hans-Rudolf

    Present downslope iron accumulations were investigated in the rainforest zone in southern Cameroon. Six clay and Fe-hydroxide dominated patterns have been identified and occur on the lower part of hill slopes. They can be subdivided in three different sequences, related to gentle, moderate or steep slopes. They are discontinuous with respect to the dismantling zone of the old ferricrete cap formed at Cretaceous period. They show a gradual development from a soft Fe-crust (carapace) to a vesicular facies that will, with time, cover the whole landscape again. To cite this article: É. Temgoua et al., C. R. Geoscience 334 (2002) 537-543.

  10. O compartilhamento do cuidado em saúde mental: uma experiência de cogestão de um centro de atenção psicossocial em Fortaleza, CE, apoiada em abordagens psicossociais The partnership in the mental health care: an experience in psicossocial approaches and in the co-management of a mental health community service in Fortaleza/CE

    OpenAIRE

    Maria Gabriela Curubeto Godoy; Ana Paula Fernandes Viana; Kamilla Angélica G. de Vasconcelos; Otorino Bonvini

    2012-01-01

    Este artigo aborda a trajetória de uma experiência comunitária vinculada a uma organização não governamental, o Movimento de Saúde Mental Comunitária do Bom Jardim e a parceria celebrada entre essa entidade e a Secretaria Municipal de Saúde de Fortaleza. Tal parceria vem proporcionando a expansão de ações psicossociais, bem como a cogestão de um Centro de Atenção Psicossocial tipo II inaugurado em 2005 (CAPS Comunitário do Bom Jardim). Geograficamente situado na Regional V, área com os piores...

  11. Doenças respiratórias agudas em serviços de saúde entre 1996 e 2001, Fortaleza, CE

    Directory of Open Access Journals (Sweden)

    Façanha Mônica Cardoso

    2004-01-01

    Full Text Available OBJETIVO: As doenças respiratórias agudas, principalmente as pneumonias, são a causa mais importante de óbito em menores de cinco anos e são responsáveis por doença grave nos maiores de 60 anos. O estudo realizado tem como objetivo descrever as principais características epidemiológicas dos casos de doenças respiratórias agudas notificadas pelas unidades de saúde. MÉTODOS: Todos os registros de atendimentos de pacientes com doença respiratória aguda, no período entre 1996 e 2001, foram revistos semanalmente, em formulário específico, a partir dos boletins de atendimento médico preenchidos por 100 unidades públicas de saúde. Os dados foram classificados em não pneumonia e pneumonia por faixa etária. RESULTADOS: Foram informados 2.050.845 casos de doença respiratória aguda no período estudado. Os meses com maior número de casos foram maio e junho. A faixa etária mais acometida foi a de um a quatro anos, com cerca do dobro do número de casos das outras faixas etárias. Pneumonias representaram, aproximadamente, 7,7% dos casos. CONCLUSÕES: O acompanhamento das doenças respiratórias agudas serve para mostrar sua magnitude em termos numéricos, e estimular seu diagnóstico apropriado, tratamento precoce e prevenção, tanto das complicações, quanto de sua ocorrência.

  12. PERCEPÇÃO DAS MÃES SOBRE ALEITAMENTO EM PREMATUROS DA UNIDADE CANGURU DE UMA MATERNIDADE DE FORTALEZA - CE

    Directory of Open Access Journals (Sweden)

    KARLA MARIA CARNEIRO ROLIM

    2008-01-01

    Full Text Available El objetivo de este estudio fue saber cómo perciben las madres el proceso de lactancia materna en prematuros asistidos en la Unidad Madre Canguro. Estudio descriptivo, con planteo cualitativo, realizado en una maternidad pública, en Fortaleza-CE, en el período de enero a mayo de 2007. Los sujetos sondeados fueron 10 madres que se hallaban con bebés internados en la Unidad. Se utilizó entrevista estructurada en parte, de la cual surgieron las categorías: conocimiento materno sobre el bebé prematuro, percepción de las madres sobre el método madre canguro, apreciación de las madres en amamantar un bebé prematuro y satisfacción con el servicio. El vínculo afectivo del binomio madre e hijo quedó en evidencia y, a su vez, considerado factor significativo en la recuperación del bebé.

  13. O compartilhamento do cuidado em saúde mental: uma experiência de cogestão de um centro de atenção psicossocial em Fortaleza, CE, apoiada em abordagens psicossociais The partnership in the mental health care: an experience in psicossocial approaches and in the co-management of a mental health community service in Fortaleza/CE

    Directory of Open Access Journals (Sweden)

    Maria Gabriela Curubeto Godoy

    2012-05-01

    Full Text Available Este artigo aborda a trajetória de uma experiência comunitária vinculada a uma organização não governamental, o Movimento de Saúde Mental Comunitária do Bom Jardim e a parceria celebrada entre essa entidade e a Secretaria Municipal de Saúde de Fortaleza. Tal parceria vem proporcionando a expansão de ações psicossociais, bem como a cogestão de um Centro de Atenção Psicossocial tipo II inaugurado em 2005 (CAPS Comunitário do Bom Jardim. Geograficamente situado na Regional V, área com os piores indicadores sociais e sanitários de Fortaleza, o Movimento de Saúde Mental Comunitária do Bom Jardim oferta atividades como Terapia Comunitária, Biodança, Arteterapia, Grupos de autoestima, Massoterapia, Reiki, Shiatsu, Quiropraxia, Oficinas de arte, música e teatro, cursos profissionalizantes e atividades lúdicas e educativas para diversas faixas etárias da população do bairro. A articulação entre as ações implementadas pelo Movimento de Saúde Mental Comunitária do Bom Jardim e a parceria com a Secretaria Municipal de Saúde de Fortaleza apresenta desafios e possibilidades na tentativa de construção da integralidade no campo da atenção psicossocial. Neste artigo apresentamos a trajetória histórica da referida entidade, descrevemos algumas de suas principais atividades e realizamos uma breve análise da parceria com a Secretaria Municipal de Saúde e o processo de cogestão do Centro de Atenção Psicossocial, apontando também alguns desafios e possibilidades encontradas nessa tentativa de convergência entre uma concepção de trabalho comunitário e a lógica burocrático-normativa sobre a qual geralmente se sustenta a atuação de instituições estatais de saúde.This is the report of the partnership experience between a nongovernmental organization that works with Mental Health and the Health Municipal Commission of Fortaleza/Ceará. This partnership has expanded several psychosocial actions as Community Therapy

  14. Profile of yttrium segregation in BaCe{sub 0,9}Y{sub 0,1}O{sub 3-{delta}} as function of sintering temperature; Perfil da segregacao do itrio em BaCe{sub 0,9}Y{sub 0,1}O{sub 3-{delta}} em funcao da temperatura de sinterizacao

    Energy Technology Data Exchange (ETDEWEB)

    Hosken, C.M.; Souza, D.P.F. de, E-mail: camila.hosken@gmail.co [Universidade Federal de Sao Carlos (LAPCEC/UFSCar), SP (Brazil). Programa de Pos-Graduacao em Ciencia e Engenharia de Materiais. Lab. de Preparacao e Caracterizacao Eletrica em Ceramicas

    2010-07-01

    Researches on solid oxide fuel cells indicate barium cerate perovskite as a very attractive material for using as electrolyte due to its high protonic conductivity. The objective of this work is investigate the yttrium segregation during sintering of BaCe{sub 0,9}Y{sub 0,1}O{sub 3-{delta}} doped with Zn O as a sintering aid. The powders were prepared by citrate process. Powders were isostatic pressed into pellets and sintered in air at 1200, 1275, 1325 and 1400 deg C. The samples were characterized by scanning electron microscopy, X-ray diffraction and impedance spectroscopy. Secondary phase containing Yttrium and Cerium was detected as sintering temperature increased. Increase of the lattice parameter and activation energy for electrical conductivity were also detected on samples sintered at 1400 deg C. (author)

  15. Improving CE with PDM

    NARCIS (Netherlands)

    Wognum, P.M. (Nel); Bondarouk, T.V. (Tanya); Weber, F.; Pawar, K.S.; Thoben, K.D.

    2003-01-01

    The concept of Concurrent Engineering (CE) centers around the management of information so that the right information will be at the right place at the right time and in the right format. Product Data Management (PDM) aims to support a CE way of working in product development processes. In specific

  16. Acesso ao serviço de emergência pelos usuários com crise hipertensiva em um hospital de Fortaleza, CE, Brasil Aceso al servicio de urgencia por clientes con crisis de presión alta en un hospital de Fortaleza, CE, Brasil Access to the emergency service by clients with hipertensive crisis in a hospital in Fortaleza, CE, Brazil

    Directory of Open Access Journals (Sweden)

    Ana Célia Caetano de Souza

    2009-08-01

    Full Text Available A crise hipertensiva é uma elevação abrupta e sintomática da pressão arterial com risco de deterioração aguda de órgãos-alvo. Embora na literatura a prevalência do agravo seja de 1%, os riscos de complicações e de morte associadas ao problema de saúde nos serviços de emergência têm revelado a necessidade de aprofundar questões relacionadas ao acesso ao serviço de saúde. Trata-se de uma pesquisa de natureza quantitativa, descritiva, realizada em um hospital público do município de Fortaleza, no período de abril a julho de 2006, com 118 pacientes. Os resultados demonstram que a população com crise hipertensiva tem procurado os serviços de saúde, principalmente os de emergência, a fim de obter atendimento. O estudo indica o acesso como um elemento essencial para satisfação das necessidades dos usuários que procuram os serviços de saúde, sendo o tempo de espera, a resolubilidade e o acolhimento parâmetros importantes na qualidade do atendimento.La crisis hipertensiva es una elevación abrupta y sintomática de la presión arterial con riesgo de deterioro agudo de órganos-blanco. Aunque en las publicaciones la prevalencia del agravamiento sea de 1%, los riesgos de complicaciones y de muerte asociadas al problema de salud en los servicios de emergencia han revelado la necesidad de profundizar en las cuestiones relacionadas al acceso al servicio de salud. Se trata de una investigación de naturaleza cuantitativa, descriptiva, realizada en un hospital público del municipio de Fortaleza, en el periodo de abril a julio de 2006, con 118 pacientes. Los resultados demuestran que la población con crisis hipertensiva ha buscado los servicios de salud, principalmente los de emergencia, para obtener atención. El estudio indica el acceso como un elemento esencial para la satisfacción de las necesidades de los usuarios que buscan los servicios de salud, siendo el tiempo de espera, la resolutividad y la acogida, los par

  17. Avaliação de Programas de Gestão por Competências: um Estudo em Organizações da Região Metropolitana de Fortaleza - CE

    Directory of Open Access Journals (Sweden)

    Bianca Patrícia Lopes Rocha

    2012-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} A avaliação de programas e a gestão por competências têm sido adotados por grandes empresas no Brasil e são estudados aqui segundo diversas abordagens, passando pelos campos epistemológico, teórico, morfológico e técnico da metodologia quadripolar. No pólo epistemológico são apresentados os aspectos gerais da epistemologia de Bachelard, a epistemologia da gestão por competências e da avaliação de programas. O pólo teórico congrega uma revisão conceitual de algumas abordagens teóricas da gestão por competências: teoria da psicometria, teoria baseada nos recursos (VBR, teoria do capital humano, abordagem americana, abordagem francesa, pós-qualificação taylorismo-fordismo e dialética da competência. No pólo morfológico descrevem-se alguns modelos de gestão por competências e de avaliação de programas educacionais. No pólo técnico buscou-se a confirmação dos pressupostos com base nos pólos anteriores. Através de um survey com aplicação de questionários aos gestores de pessoas e áreas envolvidas no desenvolvimento e/ou implantação dos programas de gestão por competências na região metropolitana de Fortaleza-CE, pode-se concluir que as

  18. Trabalhadores de um hospital escola em Fortaleza-CE: exposição cotidiana à hepatite B | Workers in a teaching hospital in Fortaleza, Ceará, Brazil: daily exposure to hepatitis B

    OpenAIRE

    Ana Gleice da Silveira Mota; Julianna de Freitas Siqueira; Francisco Gilberto Fernandes Pereira; Marta Maria Costa Freitas; Jorge Luíz Nobre Rodrigues; Joselany Áfio Caetano

    2015-01-01

    Estudo transversal, descritivo, quantitativo, que objetivou analisar os acidentes ocupacionais ocorridos entre os profissionais de saúde envolvendo risco para hepatite B, em um hospital escola, em 2013. Analisaram-se 95 notificações, a maioria (73,7%) mulheres, 39 (41,1%) técnico/auxiliar de enfermagem. A faixa etária prevalente foi 20 a 39 anos, com 62 (65,3%) profissionais. A exposição percutânea ocorreu em 77 (81,1%) casos, sendo a agulha com lúmen o principal objeto causador com 35 (36,8%...

  19. Investigation of local magnetism in RZn (R = Ce, Gd, Tb, Dy) and GdCu intermetallic compounds using perturbed angular correlation gamma-gamma spectroscopy; Investigacao do magnetismo local em compostos intermetalicos do tipo RZn (R = Ce, Gd, Tb, Dy) e GdCu pela espectroscopia de correlacao angular gama-gama perturbada

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Brianna Bosch dos

    2010-07-01

    This work presents, from a microscopic point of view, a systematic study of the local magnetism in RZn (R = Ce, Gd, Tb, Dy) and GdCu intermetallic compounds through measurements of hyperfine interactions using the Perturbed Angular Correlation Gamma- Gamma Spectroscopy technique with {sup 111}In {yields} {sup 111}Cd and {sup 140}La {yields} {sup 140}Ce as probe nuclei. As the magnetism in these compounds originates from the 4f electrons of the rare-earth elements it is interesting to observe in a systematic study of RZn compounds the behavior of the magnetic hyperfine field with the variation of the number of 4f electrons in the R element. The use of probe nuclei {sup 140}La {yields} {sup 140}Ce is interesting because Ce{sup +3} ion posses one 4f electron which may contribute to the total hyperfine field, and the results showed anomalous behavior. The results for {sup 111}Cd probe showed that the temperature dependence of the magnetic hyperfine field follows the Brillouin function, and the magnetic hyperfine field decreases linearly with increase of the atomic number of rare earth when plotted as a function of the rare-earth J spin projection, showing that the main contribution to the magnetic hyperfine field in RZn compounds comes from the polarization of the conduction electrons. The results for the electric field gradient measured with {sup 111}Cd for all compounds showed a strong decrease with the atomic number of the rare-earth element. We have therefore assumed that the major contribution to the electric field gradient originates from the 4f electrons of the rare-earths. The measurements of the electric field gradient for GdCu with {sup 111}Cd, after temperature decreases and increases again showed that two different structures, CsCl-type cubic and FeB-type orthorhombic structures co-exist. Finally, it is the first time that measurements of hyperfine parameters have been carried out with theses two probe nuclei in the studied RZn. (author)

  20. Epitaxial Cubic Ce2O3 Films via Ce-CeO2 Interfacial Reaction.

    Science.gov (United States)

    Stetsovych, Vitalii; Pagliuca, Federico; Dvořák, Filip; Duchoň, Tomáš; Vorokhta, Mykhailo; Aulická, Marie; Lachnitt, Jan; Schernich, Stefan; Matolínová, Iva; Veltruská, Kateřina; Skála, Tomáš; Mazur, Daniel; Mysliveček, Josef; Libuda, Jörg; Matolín, Vladimír

    2013-03-21

    Thin films of reduced ceria supported on metals are often applied as substrates in model studies of the chemical reactivity of ceria based catalysts. Of special interest are the properties of oxygen vacancies in ceria. However, thin films of ceria prepared by established methods become increasingly disordered as the concentration of vacancies increases. Here, we propose an alternative method for preparing ordered reduced ceria films based on the physical vapor deposition and interfacial reaction of Ce with CeO2 films. The method yields bulk-truncated layers of cubic c-Ce2O3. Compared to CeO2 these layers contain 25% of perfectly ordered vacancies in the surface and subsurface allowing well-defined measurements of the properties of ceria in the limit of extreme reduction. Experimentally, c-Ce2O3(111) layers are easily identified by a characteristic 4 × 4 surface reconstruction with respect to CeO2(111). In addition, c-Ce2O3 layers represent an experimental realization of a normally unstable polymorph of Ce2O3. During interfacial reaction, c-Ce2O3 nucleates on the interface between CeO2 buffer and Ce overlayer and is further stabilized most likely by the tetragonal distortion of the ceria layers on Cu. The characteristic kinetics of the metal-oxide interfacial reactions may represent a vehicle for making other metastable oxide structures experimentally available.

  1. CE-BEMS

    DEFF Research Database (Denmark)

    Mohamed, Nader; Lazarova-Molnar, Sanja; Al-Jaroodi, Jameela

    2016-01-01

    and costs savings in smart buildings significantly depend on the monitoring and control methods used in the installed BEMS. This paper proposes a Cloud-Enabled BEMS (CE-BEMS) for Smart Buildings. This system can utilize cloud computing to provide enhanced management mechanisms and features for energy...... savings in smart buildings. This system is connected to the cloud to have access to a number of advanced cloud-based services to enhance energy management in smart buildings. In this paper, we discuss the current limitations of BEMS, the conceptual design of the proposed system, and the advantages...

  2. Qualitative evaluation of environmental radiological impact in a phosphate associated uranium conventional mine: Santa Quiteria Project, CE, Brazil; Avaliacao qualitativa do impacto radiologico ambiental em uma mineracao convencional de fosfato com uranio associado: o Projeto Santa Quiteria

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Rocio G. dos; Santo, Aline Sa E., E-mail: rocio@ird.gov.br, E-mail: alinesah@ird.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    The aim of this study is to identify and evaluate qualitatively the main potential sources of mineral and installation terms of Santa Quiteria, CE, Brazil, evaluating their possible impacts on the environment. The key terms sources in the production of phosphoric acid are usually: the dig of the mines, tailings dams and phospho plaster stack. Thus, this work intends to inform the academic community about this issue, as well as the population in general and also, acting proactively in order to warn about the possible environmental impacts, so that actions to compensate, minimize or avoid these radiological impacts on the environment, can be included in the planning of the industrial mineral project of Santa Quiteria (author)

  3. Biomassa microbiana e matéria orgânica leve em solos sob sistemas agrícolas orgânico e convencional na Chapada da Ibiapaba - CE Microbial biomass and light organic matter in soils under organic and conventional systems in the Chapada da Ibiapaba - CE, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Alisson da Silva Xavier

    2006-04-01

    Full Text Available Em muitos casos, a substituição da vegetação nativa por sistemas agrícolas resulta em decréscimo nos conteúdos de C e N nos diferentes compartimentos da matéria orgânica do solo. Para testar se as práticas de manejo que priorizam o aporte de resíduos orgânicos promovem aumento dos compartimentos da matéria orgânica mais sensíveis ao manejo, este estudo se propôs estudar áreas de uma propriedade que utiliza um sistema de produção de acerola em larga escala, sob manejo orgânico, e uma área sob cultivo convencional de cenoura e beterraba em rotação com milho, pertencentes à Fazenda Amway Nutrilite do Brasil e à Associação de Horticultores do Pivot Central, respectivamente, ambas localizadas na região da Chapada da Ibiapaba, Ceará. Selecionou-se, também, uma área de pastagem localizada no interior da primeira propriedade amostrada, bem como áreas sob mata nativa, próximas às áreas de cultivo. Amostras de um Neossolo Quartzarênico foram coletadas nas profundidades de 0-5 e 5-15 cm e foram determinados os teores de C orgânico total, de C e N microbiano (Cmic e Nmic e da matéria orgânica leve (Cmol e Nmol, além do C mineralizável obtido por respirometria. O acúmulo médio nos estoques de Nmic nas áreas sob manejo orgânico em relação à mata nativa foi de 11,7 kg ha-1, o que representou um incremento de 585 % de Nmic nas áreas de cultivo. Já na pastagem, ocorreu acúmulo de 211 kg ha-1 no estoque de Cmic em relação à mata nativa em subsuperfície, representando um incremento de 514,6 %. Por outro lado, os estoques de Cmic no cultivo convencional sofreram reduções de 59 e 53 %, nas camadas de 0-5 e de 5-15 cm, respectivamente, em relação à mata nativa. Os estoques de Cmol obtidos nas linhas de cultivo nos sistemas orgânicos apresentaram incremento de 106 %, na camada de 0-5 cm, em relação à mata; no sistema convencional, porém, constatou-se uma redução em 31 % no estoque de Cmol na camada

  4. Nioboaeschynite-(Ce, Ce(NbTiO6

    Directory of Open Access Journals (Sweden)

    Shaunna M. Morrison

    2012-08-01

    Full Text Available Nioboaeschynite-(Ce, ideally Ce(NbTiO6 [cerium(III niobium(V titanium(IV hexaoxide; refined formula of the natural sample is Ca0.25Ce0.79(Nb1.14Ti0.86O6], belongs to the aeschynite mineral group which is characterized by the general formula AB2(O,OH6, where eight-coordinated A is a rare earth element, Ca, Th or Fe, and six-coordinated B is Ti, Nb, Ta or W. The general structural feature of nioboaeschynite-(Ce resembles that of the other members of the aeschynite group. It is characterized by edge-sharing dimers of [(Nb,TiO6] octahedra which share corners to form a three-dimensional framework, with the A sites located in channels parallel to the b axis. The average A—O and B—O bond lengths in nioboaeschynite-(Ce are 2.471 and 1.993 Å, respectively. Moreover, another eight-coordinated site, designated as the C site, is also located in the channels and is partially occupied by A-type cations. Additionally, the refinement revealed a splitting of the A site, with Ca displaced slightly from Ce (0.266 Å apart, presumably resulting from the crystal-chemical differences between the Ce3+ and Ca2+ cations.

  5. EM BUSCA DE UM VIVER SAUDÁVEL: RELATO DE EXPERIÊNCIA COM UM GRUPO DE IDOSOS CADASTRADOS NA ESTRATÉGIA SAÚDE DA FAMÍLIA DE PACATUBA - CE

    Directory of Open Access Journals (Sweden)

    PATRÍCIA MARIA TAVARES CAVALCANTE

    2007-01-01

    Full Text Available El estudio objetivó relatar la experiencia de trabajar con un grupo de ancianos con catastro en la estrategia Salud de la Família de Pacatuba-CE; en las actividades de recreación y conocimiento. Se recortaron doce meses de actividades para este relato. El grupo llamado” Stamaqui” se inició en mayo de 2003, con 28 personas mayores. Los asuntos discutidos tratan de la salud, el estatuto del anciano, la jubilacion, etc. Además de la realización de estas actividades, se les sirvió el desayuno, se hicieron paseos y cambios de experiencias entre los participantes y los profesionales. Se deseó, con todo esto, despertar en los profesionales de la salud y en los gestores el interés sobre el envejecimiento y la vejez, así como la posibilidad de ampliar conceptos y sensibilizar inversiones dirigidas hacia este porcentaje de la población para mantener una vida sana, a pesar de algunas enfermedades crónicas.

  6. Caracterização de crianças e adolescentes atendidos por maus tratos em um hospital de emergência no município de Fortaleza-CE Characterization of maltreated children and adolescents taken into a paediatric emergency health care service in Fortaleza-CE-Brazil

    OpenAIRE

    Arcelina Maria da Silva; Luiza Jane Eyre de Souza Vieira

    2001-01-01

    O estudo teve como objetivo caracterizar o perfil da criança e adolescente maltratados e atendidos em um hospital de emergência, no Município de Fortaleza, Ceará. Utilizou-se a pesquisa documental retrospectiva com análise dos formulários da Comissão de Maus Tratos à Infância e Adolescência. Os resultados revelaram que o sexo masculino e a faixa etária de 1 a 5 anos foram os mais atingidos; o principal agressor é o pai biológico e os tipos de violência mais freqüentes foram o hematoma, o abus...

  7. Caracterização de crianças e adolescentes atendidos por maus tratos em um hospital de emergência no município de Fortaleza-CE Characterization of maltreated children and adolescents taken into a paediatric emergency health care service in Fortaleza-CE-Brazil

    Directory of Open Access Journals (Sweden)

    Arcelina Maria da Silva

    2001-03-01

    Full Text Available O estudo teve como objetivo caracterizar o perfil da criança e adolescente maltratados e atendidos em um hospital de emergência, no Município de Fortaleza, Ceará. Utilizou-se a pesquisa documental retrospectiva com análise dos formulários da Comissão de Maus Tratos à Infância e Adolescência. Os resultados revelaram que o sexo masculino e a faixa etária de 1 a 5 anos foram os mais atingidos; o principal agressor é o pai biológico e os tipos de violência mais freqüentes foram o hematoma, o abuso sexual e as lesões por objetos cortantes. Conclui-se que o tema requer estudos aprofundados que modifiquem o ambiente em que a criança, adolescente e famílias estão inseridos.This study aimed to characterise the profile of the child and the adolescent who were maltreated and taken into paediatric emergency care in a hospital, in Fortaleza, Ceará. It was used a documented retrospective evaluation. The results showed that the children in the age group of 1-5 years were the most victimised as well as the children of the male sex. The main perpetrator was a biological father and the most frequent kind of violence were hematomas, sexual abuse and wounds by slashing objects. In conclusion, this subject needs to be more investigated for providing changes within the' environment where a child, adolescent and families were inserted.

  8. Study of the oxygen reduction reaction using Pt-Rare earths (La, Ce, Er) electrocatalysts for application of PEM fuel cells; Estudo da reacao de reducao do oxigenio utilizando eletrocatalisadores a base de Pt-terras raras (La, Ce, Er) para aplicacao em celulas a combustivel tipo PEM

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Thiago Bueno

    2013-07-01

    The complexity of the oxygen reduction reaction (ORR) and its potential losses make it responsible for the most part of efficiency losses at the Fuel Cells. For this reaction the electrocatalyst witch is most appropriated and shows better performance is platinum, a noble metal that elevates the cost, raising barriers for Fuel Cells technology to enter the market. First this work focuses on reducing the amount of platinum used in the cathode, by being replaced by rare earths. The most common methods of synthesis involves a large amount of steps and this work proposed to prepare the electrocatalyst through a simpler way that would not take so many steps and time to be done. Using an ultrasound mixer the electrocatalyst was prepared mixing platinum supported on carbon black and the rare earths lanthanum, cerium and erbium oxides to be applied in a half-cell study of the ORR. The Koutecky-Levich plots shows that among the electrocatalysts prepared the Pt80Ce20/C had the catalytic activity close to the commercial BASF platinum on carbon black, suggesting that the reaction was taken by the 4-electron path. As found in some works in literature, among the rare earth used to study the ORR, cerium is the one witch shows the better performance because it is able to store and provide oxygen. This feature is of great interest for the ORR because this reaction is first order to the oxygen concentration. Results show that is possible to reduce the amount of platinum maintaining the same electrocatalyst activity. (author)

  9. Direct Synthesis and Spectrum Analysis of CeO2 Nanoparticles Deposited on Carbon Nanotubes

    Institute of Scientific and Technical Information of China (English)

    ZHANG Zuwei; HU Chenguo; XIONG Yufeng; XIA Chuanhui; LI Feiyun; WANG Xue

    2009-01-01

    A novel method of direct synthesis of CeO2 nanoparticles onto multi-walled carbon nanotubes (MWNTs) was developed with advantages of simplicity, ease of scale-up, and low costs.The size of CeO2 particles deposited on the MWNTs was less than 6 nm. SEM and TEM were em-ployed to analysis the CeO2 coated MWNTs, and the properties of FTIR spectrum and UV-vis ab-sorption spectrum were investigated. The functional groups on the MWNTs obtained by nitric acid treatment play an important role on the deposition of the CeO2 particles. The carbon nanotubes possess broadened UV absorption function after being coated with CeO2 nanopartilces.

  10. Gestão do desempenho humano: um estudo de caso em um Hospital Geral de Fortaleza (CE Administration of the human acting: a case study in a General Hospital of Fortaleza, Ceará State

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Marrocos Fontenele

    2010-06-01

    Full Text Available A temática deste trabalho apresenta questões sobre a prática da avaliação de desempenho funcional em uma organização pública de saúde. Este eixo de análise ganha destaque a partir das dificuldades de desenvolvimento de sistemas de avaliação com alianças entre políticas de concessão de incentivos financeiros, em um contexto cultural peculiar. Nesse sentido, é necessário admitir os limites dessa ferramenta gerencial. A partir de uma pesquisa qualitativa, utilizou-se um roteiro semiestruturado de perguntas aplicado aos servidores de um hospital geral público do Estado do Ceará. Obteve-se a caracterização do sistema de avaliação de desempenho utilizado pela instituição, podendo-se verificar sua adequação aos modelos propostos na literatura e a pertinência de seus propósitos com as percepções e expectativas dos servidores pesquisados.The thematic of this work presents questions on the practice of the Evaluation of functional performance in an organization of public health. This axle of analysis gains importance from the difficulties of developing evaluation systems with alliances between policies of concession of financial incentives, in a specific cultural context. In this direction, it is necessary to admit the limits of this management tool. From a qualitative research, a semi-structured questionnaire was applied to the staff (public servers of a public general hospital of Ceará State. It was observed the characterization of the performance evaluation system used in the institution, being able to verify its adequacy to the models proposed in the literature and the relevancy of its intentions with the perceptions and expectations of the searched servers.

  11. Ce que soigner veut dire

    OpenAIRE

    Mol, Annemarie

    2013-01-01

    Qu'est-ce que bien soigner? Dans ce livre provoquant et original, Annemarie Mol montre que ce n'est pas, comme on l'a beaucoup dit, laisser les patients choisir. À partir de l'exemple des personnes atteintes de diabète, l'auteur propose une nouvelle manière de prendre soin des personnes, qui ne les transforme pas en citoyens ou en consommateurs, mais qui les reconnaît comme corps et âmes souffrants, comme individus investis dans leur propre prise en charge, comme membres de collectifs multipl...

  12. Hanseníase no município de Fortaleza, CE, Brasil: aspectos epidemiológicos e operacionais em menores de 15 anos (1995-2006 La Lepra en el municipio de Fortaleza, CE, Brasil: aspectos epidemiológicos y operacionales en menores de 15 años (1995-2006 Hansen's Disease in the municipality of Fortaleza, CE, Brazil: epidemiological and operational aspects in children under 15-years-old (1995-2006

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Morais de Alencar

    2008-11-01

    Full Text Available Estudo transversal que objetiva analisar a ocorrência de casos de hanseníase em menores de 15 anos de idade residentes no Município de Fortaleza e notificados no SINAN. Os indicadores epidemiológicos nesta população mostram hiperendemicidade. Operacionalmente observa-se a manutenção da concentração de atendimento em algumas unidades de referência, apesar de alguns avanços. Diagnóstico tardio, elevado grau de incapacidade no diagnóstico e baixo grau de avaliação de contatos registrados revelam a fragilidade das ações de controle. Ressalta-se a possibilidade de erro diagnóstico frente às características da infecção nesta população. A ocorrência de casos de hanseníase nesta população representa um indicador epidemiológico de grande relevância e sua análise amplia a discussão sobre problemas operacionais na rede de serviços de saúde.Estudio transversal con el objetivo de analizar las ocurrencias de los casos de lepra en menores de 15 años de edad sitiados en la ciudad de Fortaleza y enterados en el SINAN. Los indicadores epidémicos en ésta población se presentaron hiperendémicos. En la operacinalización, se observa el mantenimiento de la concentración de atención en algunas unidades recomendables, a pesar de algunos avances. Diagnósticos muy tardes, gran grado de incapacidad en el diagnóstico y bajo grado de evaluación de contactos registrados, muestran la fragilidad de las acciones de control. Se resalta así la posibilidad de error de diagnóstico delante de las características de la infección en ésta población. La ocurrencia de casos de lepra en ésta población representa un indicador epidémico de gran importancia y su análisis amplia la discusión sobre los problemas operacionales en la red de servicios públicos.This is a sectional study that aims to analyze the occurrence of Hansen's disease cases in 15 year-old minors in the Municipality of Fortaleza and notified in SINAN. The

  13. Inovação educacional em pequeno município: o caso Fundação Casa Grande (Nova Olinda, CE, Brasil Educational innovation in small towns: the case of 'Fundação Casa Grande' (Nova Olinda, CE, Brazil

    Directory of Open Access Journals (Sweden)

    Elie Ghanem

    2012-09-01

    Full Text Available Este artigo apresenta os resultados de um estudo de caso de inovação educacional na atuação da Organização Não Governamental Fundação Casa Grande - Memorial do Homem Kariri junto a crianças e jovens do município de Nova Olinda, CE, Brasil. O principal problema da pesquisa que este artigo visa apresentar é: que fatores se conjugam na geração de ações de inovação educacional? A hipótese examinada pela pesquisa foi a de que fatores salientes que se conjugam na geração de ações de inovação são o tempo de experiência profissional de educadores(as, a estabilidade de sua equipe, o nível de qualificação e a atuação mobilizadora de líderes da Organização. São descritos os objetivos e características da atuação da Organização e são apontadas as características de líderes, agentes e equipes. Conclui que a hipótese levantada foi confirmada.This article presents the results of an educational innovation case study on the 'Fundação Casa Grande - Memorial do Homem Kariri' Non-governmental Organization's operation with children and youngsters in Nova Olinda, State of Ceara, Brazil. The main matter of this research is: What factors are conjugated at the genesis of educacional innovation actions? The study examines the hypothesis that the proeminent factors conjugated in educational innovation generation are: length of educator's professional experience, team's stability, NGO leaders' qualification level, and mobilizing action. The NGO's objectives and operation characteristics are described. Characteristics of leaders, education agents and teams are presented. It was possible to conclude that the proposed hypothesis was confirmed.

  14. Signature splitting in 129Ce

    Institute of Scientific and Technical Information of China (English)

    LIU Ying; WU Xiao-Guang; ZHU Li-Hua; LI Guang-Sheng; HE Chuang-Ye; LI Xue-Qin; PAN Bo; HAO Xin; LI Li-Hua; WANG Zhi-Min; LI Zhong-Yu; XU Qiang

    2009-01-01

    The high spin states of 129Ce have been populated via heavy-ion fusion evaporation reaction 96Mo (37C1, 1p3n) 129Ce. The γ-γ coincidence and intensity balance used to measure the B(M1; I→I-1)/B(E2; I→I-2) (the probability ratio of the dipole and quadrupole transition) in v7/2[523] rotational band of 129Ce. And the energy splitting (Δe') has been got through the experimental Routhians. The lifetimes and quadrupole moments Qt have been extracted from the lineshape analyses using DSAM. The deformation of the v7/2[523] rotational band of 129Ce was extracted from the Qt and moment of inertia JRR.

  15. PADRONIZAÇÃO DE EXCIPIENTES PARA MANIPULAÇÃO DE CÁPSULAS GELATINOSAS DURAS CONTENDO EXTRATO SECO DE VALERIANA (Valeriana officinalis, PRODUZIDAS NO PROJETO FARMÁCIA VIVA EM SOBRAL-CE

    Directory of Open Access Journals (Sweden)

    Antônio Neudimar Bastos Costa

    2016-07-01

    Full Text Available O Projeto Farmácia Viva é o primeiro projeto de assistência social farmacêutica desenvolvido no Brasil baseado no emprego científico de plantas medicinais. Dentre as formulações padronizadas a partir de cápsulas gelatinosas duras, destacam-se as cápsulas contendo Extrato Seco de Valeriana. Para manipulação dessas cápsulas, é necessária uma quantidade adicional de excipientes, que possuem papel importante na qualidade, segurança e no desempenho do medicamento. O objetivo deste estudo é padronizar excipientes para formulação fitoterápica em cápsulas manipuladas no Projeto Farmácia Viva. A metodologia seguida foi por meio de análise bibliográfica sobre os variados excipientes e fitoterápicos e análise de bulas de medicamentos para posterior sugestão de padronização. Foram manipuladas 30 cápsulas e submetidas ao controle da qualidade, onde foram avaliados o peso médio, limite de variação, coeficiente de variação, desvio padrão e variação do conteúdo teórico das cápsulas. A formulação de Valeriana proposta teve como excipientes escolhidos o estearato de magnésio (0,5 % como lubrificante, o dióxido de silício coloidal (1,0 % como deslizante, o talco farmacêutico (1,0 % como adsorvente, o amido farmacêutico (73,0 % como um diluente hidrofóbico, lactose monohidratada (24,5 % como um diluente hidrofílico. Todos os resultados do controle da qualidade obtidos atenderam as especificações farmacopeicas.

  16. Qualidade da atenção ao pré-natal na Estratégia Saúde da Família em Sobral, Ceará Calidad de la atención en el pre-natal en la Estrategia Salud de Familia en Sobral, CE, Brasil Quality of pre-natal care in Family Health Strategy in Sobral, CE, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Rosemiro Guimarães Ximenes Neto

    2008-10-01

    Full Text Available Diante das políticas públicas que envolvem a qualidade da atenção ao pré-natal, este estudo teve como objetivo avaliar a qualidade da atenção ao pré-natal nos territórios da Estratégia Saúde da Família, do município de Sobral, à luz do referencial teórico de Avedis Donabedian. Trata-se de um estudo de caráter descritivo-exploratório, desenvolvido em Centros de Saúde da Família de Sobral, Ceará. Dos quatorze Centros de Saúde investigados, quatro se mostraram com indicadores adequados para o pré-natal. Porém, ainda que existam inadequações na estrutura física, não existem impedimentos para que se ofereça um atendimento de qualidade haja vista que o processo e os resultados também interferem na qualidade da assistência.Frente a las políticas públicas que impliquen la calidad de la atención a la salud prenatal, el estudio tiene como objetivo: evaluar la calidad de la atención prenatal a los territorios en la Estrategia de Salud de la Familia de la ciudad de Sobral, a la luz del referencial teórico de AVEDIS Donabedian. Se trata de un estudio exploratorio de carácter descriptivo, desarrollado por los Centros de Salud Familiar de Sobral - Ceará. De los catorce Centros de Salud investigaron, cuatro fueron con los indicadores apropiados para la atención prenatal. Pero a pesar de que hay deficiencias en la estructura física, no hay impedimentos a fin de proporcionar una calidad de la atención hay una opinión de que el proceso y los resultados también interferir con la calidad de la atención.Face to public policies involving the quality of care for prenatal, the study aims to: assess the quality of prenatal care to the territories in the Family Health Strategy of the city of Sobral in the light of theoretical reference of Avedis Donabedian. This is a descriptive- exploratory study, developed by Family Health Units of Sobral, CE, Brazil. Of the fourteen Centers Health investigated, four were with appropriate

  17. Identification of levels in neutron-rich 145Ce and 147Ce nuclei

    International Nuclear Information System (INIS)

    High-spin structures in the neutron-rich nuclei 145Ce and 147Ce produced in the spontaneous fission of 252Cf have been investigated by prompt γ-ray spectroscopy. A collective band structure in 145Ce is identified. Several sidebands along with the new high-spin states in 147Ce are also identified. Particle-plus-rotor model calculations indicate that the yrast bands in 145Ce and 147Ce most probably originate from coupling of the νi13/2 orbital to the ground states of 144Ce and 146Ce. The ground state configurations of 145,147Ce are (νh9/2+νf7/2) and νh9/2, respectively. (c) 1999 The American Physical Society

  18. Energy levels of the Ce activator relative to the YAP(Ce) scintillator host

    International Nuclear Information System (INIS)

    The electronic structure of the cerium-activated yttrium aluminum perovskite [YAP(Ce)] scintillator has been studied by core level x-ray spectroscopy and first-principles calculations. X-ray absorption and emission spectra at the oxygen K-edge of YAP(Ce) and CeO2 have been measured and compared with the calculated partial density of states. With the known band gap of CeO2, the measured oxygen K-edge absorption and emission spectra are used to construct a fixed relation between the valence and conduction bands of YAP and CeO2. This allows us to determine the fundamental band gap of YAP to be 8.1 ± 0.3 eV. A comparison between the cerium M4,5-edges x-ray absorption spectra of the YAP(Ce) and Ce model compounds (CeO2, CeF3, and Ce foils) then shows that the Ce activator is in the desired Ce3+, with a small fraction of Ce4+ due to oxidization at the surface. Finally, we determine that the ground state 4f1 energy level of the Ce3+ activator lies 1.8 ± 0.5 eV above the top of the valence band of the host YAP. (paper)

  19. A Study of the Kinetics of the Electrochemical Deposition of Ce3+/Ce4+ Oxides

    Science.gov (United States)

    Valov, I.; Guergova, Desislava; Stoychev, D.

    The kinetics of cathodic electrodeposition of Ce3+ and/or Ce4+ oxides from alcoholic electrolytes on gold substrates has been studied. It was found that, depending on the oxygen content in the CeCl3-based electrolyte, Ce2O3 (in oxygen atmosphere) or CeO2 (in an inert atmosphere), respectively, were obtained. XPS studies clearly separated the two valence states of Ce ions in the oxide layers. The microstructure of the coatings was analyzed by atomic force microscopy (AFM).

  20. Photoelectron spectra of CeO{sup −} and Ce(OH){sub 2}{sup −}

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Manisha; Felton, Jeremy A.; Kafader, Jared O.; Topolski, Josey E.; Jarrold, Caroline Chick, E-mail: cjarrold@indiana.edu [Department of Chemistry, Indiana University, 800 East Kirkwood Avenue, Bloomington, Indiana 47405 (United States)

    2015-02-14

    The photoelectron spectrum of CeO{sup −} exhibits what appears to be a single predominant electronic transition over an energy range in which numerous close-lying electronic states of CeO neutral are well known. The photoelectron spectrum of Ce(OH){sub 2}{sup −}, a molecule in which the Ce atom shares the same formal oxidation state as the Ce atom in CeO{sup −}, also exhibits what appears to be a single transition. From the spectra, the adiabatic electron affinities of CeO and Ce(OH){sub 2} are determined to be 0.936 ± 0.007 eV and 0.69 ± 0.03 eV, respectively. From the electron affinity of CeO, the CeO{sup −} bond dissociation energy was determined to be 7.7 eV, 0.5 eV lower than the neutral bond dissociation energy. The ground state orbital occupancies of both CeO{sup −} and Ce(OH){sub 2}{sup −} are calculated to have 4f 6s{sup 2} Ce{sup +} superconfigurations, with open-shell states having 4f5d6s superconfiguration predicted to be over 1 eV higher in energy. Low-intensity transitions observed at higher electron binding energies in the spectrum of CeO{sup −} are tentatively assigned to the {sup 1}Σ{sup +} (Ω = 0) state of CeO with the Ce{sup +2}⍰6s{sup 2} superconfiguration.

  1. Local structure of the Ce3+ ion the yellow emitting phosphor YAG:Ce

    NARCIS (Netherlands)

    Ghigna, P.; Pin, S.; Ronda, C.; Speghini, A.; Piccinelli, F.; Bettinelli, M.

    2011-01-01

    The local structure of the Ce3+ ion in the yellow emitting YAG:Ce phosphor has been studied by Extended X-ray Absorption Fine Structurespectroscopy in the 300−20 K temperature range. It has evidenced that the dopant Ce3+ replaces Y3+ in the garnet structure, giving rise to a significant expan

  2. The role of Ce(III) in BZ oscillating reactions

    Science.gov (United States)

    Nogueira, Paulo A.; Varela, Hamilton; Faria, Roberto B.

    2012-03-01

    Herein we present results on the oscillatory dynamics in the bromate-oxalic acid-acetone-Ce(III)/Ce(IV) system in batch and also in a CSTR. We show that Ce(III) is the necessary reactant to allow the emergence of oscillations. In batch, oscillations occur with Ce(III) and also with Ce(IV), but no induction period is observed with Ce(III). In a CSTR, no oscillations were found using a freshly prepared Ce(IV), but only when the cerium-containing solution was aged, allowing partial conversion of Ce(IV) to Ce(III) by reaction with acetone.

  3. On Chinglish in C-E Interpretation

    Institute of Scientific and Technical Information of China (English)

    XIAO Gui-fang; LIU Jian-zhu; GUI Ren-na

    2005-01-01

    Based on the author's survey into the different interpretations of some terms from Chinese into English, the paper points out Chinglish exists universally in C-E interpretation.The author also puts forward some proposals on how to avoid and reduce Chinglish in the process of C-E interpretation after exploring its features and causes of Chinglish.

  4. Lifetimes of Excited Levels in 131Ce

    Institute of Scientific and Technical Information of China (English)

    LI Guang-Sheng; LI Xian-Feng; WEN Li-Jun; ZHENG Yong-Nan; ZHENG Yong; LIU Yun-Zuo; YUAN Guan-Jun; YANG Chun-Xiang; MENG Rui; ZHU Li-Hua; ZHANG Zhen-Long; WANG Yue; WANG Zhi-Min; WEN Shu-Xian; LU Jing-Bin; ZHAO Guang-Yi

    2004-01-01

    @@ The fusion-evaporation reaction 116Sn (1gF, p3n) 131 Ce at projectile energy of 95 MeV is used to populate high spin states in 131 Ce. The de-exciting γ-rays are detected in γ-γ coincidence measurement with Compton-suppressed BGO-HPGe detectors. Level lifetimes of 131 Ce were determined by using the Doppler shift attenuation method.The experimental results indicate that collectivity of 131 Ce is reduced relative to that of 130 Ce and it follows that deformation decreases with increase of the neutron number on the basis of systematic comparison of transition quadrupole moments for the light cerium isotopes.

  5. Temperature dependence of the scintillation properties of Ce:GSO and Ce:GSOZ

    Energy Technology Data Exchange (ETDEWEB)

    Kurosawa, Shunsuke, E-mail: kurosawa@imr.tohoku.ac.jp [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Sugiyama, Makoto [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yanagida, Takayuki [New Industry Creation Hatchery Center (NICHe), 6-6-10 Aoba Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Yokota, Yuui [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yoshikawa, Akira [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); New Industry Creation Hatchery Center (NICHe), 6-6-10 Aoba Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan)

    2012-10-21

    The light output and decay times of Ce:GSO and Ce:GSOZ scintillators depend on Ce concentration and temperature. We investigated the temperature dependence of the light output and the decay time for Ce:GSO and Ce:GSOZ doped with 0.3 (only GSO), 0.5, 1.0, and 1.5 mol% Ce. These samples were measured with a ruggedized photomultiplier (PMT) (Hamamatsu R6877A) at 175 Degree-Sign C (in the thermostat chamber). Up to 100 Degree-Sign C, the relative light output of all of the samples remained within 10% after correcting the PMT gain, which depends on the temperature. The decay times of the GSO and GSOZ samples with the identical Ce concentrations were equal. Moreover, the quenching energy values for all the samples were equivalent.

  6. Cost objective PLM and CE

    CERN Document Server

    Perry, Nicolas

    2010-01-01

    Concurrent engineering taking into account product life-cycle factors seems to be one of the industrial challenges of the next years. Cost estimation and management are two main strategic tasks that imply the possibility of managing costs at the earliest stages of product development. This is why it is indispensable to let people from economics and from industrial engineering collaborates in order to find the best solution for enterprise progress for economical factors mastering. The objective of this paper is to present who we try to adapt costing methods in a PLM and CE point of view to the new industrial context and configuration in order to give pertinent decision aid for product and process choices. A very important factor is related to cost management problems when developing new products. A case study is introduced that presents how product development actors have referenced elements to product life-cycle costs and impacts, how they have an idea bout economical indicators when taking decisions during t...

  7. White and colored marbles from the “G. Carreca” and “Ce.Ri.co” barraks at Rome I marmi bianchi e colorati dalle caserme “G. Carreca” e “Ce.Ri.co” a Roma

    Directory of Open Access Journals (Sweden)

    Marco Viglietti

    2011-03-01

    Full Text Available

    Questo lavoro si inserisce nell’ambito delle indagini archeologiche compiute tra il 2002 e il 2008 nell’area delle caserme “G. Carreca” e “Ce.Ri.co.”, in via Labicana a Roma. Ad una prima strutturazione dell’area di età domizianea, seguono fasi di vita di età antonina e severiana, prima dell’ultima, grande fase edificatoria riferibile alla seconda metà del IV - V secolo. La nostra indagine si appunta sul consistente deposito di marmi da <em>opus sectileem> pavimentale e parietale. Specchio di un’elevata committenza, costituisce un campionario delle forme decorative in uso a Roma tra il I e il IV - V secolo. 

    This work develops from the archaeological researches carried out between 2002 and 2008 in Rome, via Labicana, in the area of “G. Carreca” and “Ce.Ri.co.” barracks. These the phases recognized: late Flavian, Antonine and Severiane, before the latest in the second half of IV/V cent. A.D. The survey focus on a considerable marble’s deposit in the kind of pavimental and parietal <em>opus> <em>sectile>. It’s a mark of an elevated customer and it represents a decorative shapes set of samples in use at Rome between I and IV-V cent. A.D.

  8. Structural and magnetic properties of Ce/Fe and Ce/FeCoV multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Tixier, S.; Boeni, P. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Mannix, D.; Stirling, W.G. [Liverpool Univ. (United Kingdom); Lander, G.H.

    1997-09-01

    Ce/Fe and Ce/FeCoV multilayers have been grown by magnetron sputtering. The interfaces are well defined and the layers are crystalline down to an individual layer thickness of 20 A. Ce/FeCoV multilayers show sharper interfaces than Ce/Fe but some loss of crystallinity is observed. Hysteresis loops obtained by SQUID show different behaviour of the bulk magnetisation as a function of the layer thickness. Fe moments are found by Moessbauer spectroscopy to be perpendicular to the interfaces for multilayers with small periodicity. (author) 2 figs., 2 refs.

  9. Preceptoria de território, novas práticas e saberes na estratégia de educação permanente em saúde da família: o estudo do caso de Sobral, CE Preceptorship of territory, new practices and knowledge in the strategy of continuing education in family health strategy: the case study of Sobral, Ceara, Brazil

    Directory of Open Access Journals (Sweden)

    Rosani Pagani

    2012-05-01

    Full Text Available O presente trabalho pretende apresentar um novo ator no Sistema Único de Saúde - o preceptor de território - bem como discutir sua atuação. Com a implantação da Estratégia Saúde da Família, bastante se tem discutido sobre o desafio de formar profissionais para atuarem neste modelo através de educação permanente em saúde. Nesse processo, o município de Sobral, CE, criou em 1999 a residência multiprofissional e a preceptoria de território; em 2001, a Escola de Formação em Saúde da Família Visconde de Sabóia. Este estudo teve como objetivos analisar a implantação e a atuação da preceptoria de território, descrevendo o processo de trabalho dos preceptores e identificando suas competências; além disso, descreveu-se o processo de educação permanente desenvolvido na Estratégia de Saúde da Família em Sobral. Utilizou-se uma abordagem qualitativa do tipo estudo de caso, com os seguintes instrumentos: entrevistas, questionários e grupo focal. Para a organização os dados foram analisados através da técnica do Discurso do Sujeito Coletivo (DSC. Entre os achados do estudo, identifica-se o preceptor de território como um profissional que atua diretamente com os residentes nos territórios das equipes da estratégia de saúde da família, destacando-se por suas amplas competências. Entre estas, podem ser mencionados conhecimentos conceituais nos campos da saúde coletiva e das relações humanas, bem como conhecimento e desenvoltura na utilização de métodos de ensino (problematização, educação permanente em saúde e educação popular. Deve também ser capaz de desenvolver relações harmônicas e de participação. O debate vem auxiliando o preceptor de território de Sobral a estabelecer seu papel e consolidar sua função de educador na construção do SUS.This paper aims to present a new actor in the Health's Unique System of Brazil (SUS, the preceptor of territory, and discuss his performance. The

  10. Mercury speciation by CE: an update.

    Science.gov (United States)

    Kubán, Petr; Pelcová, Pavlína; Margetínová, Jana; Kubán, Vlastimil

    2009-01-01

    This review provides an update on mercury speciation by CE. It includes a brief discussion on physicochemical properties, toxicity and transformation pathways of mercury species (i.e. methyl-, ethyl-, phenyl- and inorganic mercury) and outlines recent trends in Hg speciation by CE. CE is presented as a complementary technique to chromatographic separation techniques, especially in cases when speed, high efficiency and low sample volumes are required. The development of suitable sample preconcentration/isolation (sample stacking, ion exchange, liquid-liquid-liquid extraction, dual-cloud point extraction) to achieve low LODs for analysis of trace concentrations of mercury species in real samples is emphasized. Hyphenation of CE to element specific detectors (i.e. electrothermal atomic absorption spectrometry, atomic fluorescence spectrometry, inductively coupled plasma-optical emission spectrometry, inductively coupled plasma-mass spectrometry) is discussed as well as a potential of CE in interaction studies that may provide useful information on interaction of various Hg species with selected bio-macromolecules.

  11. Variation of education continuation. What you need to know about CE classes.

    Science.gov (United States)

    Friese, Greg

    2013-11-01

    Finally, always let training objectives drive the training methodology. An objective to review a pain management protocol is easily accomplished by acknowledging receipt and reading of an electronic document. An objective to assess and appropriately treat a pediatric patient with pain secondary to musculoskeletal trauma is better accomplished through case review and simulation. Opportunities for online CE are continuing to expand. Smartphones and tablets are encouraging educators to develop training content that has increasing interactivity and immediate feedback. Massive Online Open Courses are the newest frontier on the online CE landscape. Keep an open mind about how, when, and where EMT and paramedic continuing education can be delivered and completed. The EMS classroom is no longer bounded by brick-and-mortar walls and the weekday availability of instructors. PMID:24475622

  12. New approaches in sensitive chiral CE.

    Science.gov (United States)

    Sánchez-Hernández, Laura; Guijarro-Diez, Miguel; Marina, María Luisa; Crego, Antonio L

    2014-01-01

    CE has shown to have a big potential for chiral separations, with advantages such as high efficiency, high resolution, and low sample and reagents consumption. Nevertheless, when UV detection is employed, CE has some drawbacks, especially the low sensitivity obtained due to the short optical path length. Notwithstanding, sensitivity improvements can be achieved when different approaches are employed, such as sample treatment strategies (off-line or on-line), in-capillary sample preconcentration techniques, and/or alternative detection systems to UV-Vis (such as fluorescence, conductimetry, electrochemiluminiscence, MS, etc.). This article reviews the most recent methodological and instrumental advances reported from June 2011 to May 2013 for enhancing the sensitivity in chiral analysis by CE. The sensitivity achieved for the enantioseparated analytes and the applications carried out using the developed methodologies are also summarized.

  13. Superconductivity in CeCo2 nanoparticles

    International Nuclear Information System (INIS)

    Both Ce and Co are essentially nonmagnetic in Pauli-paramagnetic CeCo2, which undergoes a superconducting transition near 1K. When made into 58-A nanoparticles, the compound becomes paramagnetic. Meanwhile, based on heat capacity measurements, the nanoparticles remain to be nonsuperconducting down to 0.4K but exhibit a low-temperature Kondo anomaly with C/T∼ 350mJ/molK2 at 0.4K. Such intriguing effects are consequences of the competition between superconducting gap and electronic spectrum's mean level spacing

  14. Laser altimeter of CE-1 payloads system

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The design and operation of the Laser Altimeter of CE-1 Payloads System are presented in this paper.The paper includes the design of the system and spacecraft-level laser,the description of the emitting-system and receiving system,and the testing of the laser altimeter.The CE-1 laser altimeter is the first Chinese deep-space probe using a laser.It has one beam and operates at 1 Hz,with a nominal accuracy of 5 m.The laser altimeter has operated successfully in lunar orbit since November 28,2007.It has obtained 9120 thousand data values about the lunar altitude.

  15. Metamagnetism in Ce(Ga,Al)2

    Indian Academy of Sciences (India)

    K G Suresh; S Radha; A K Nigam

    2002-05-01

    Effect of Al substitution on the magnetic properties of Ce(Ga1-Al)2 ( = 0, 0.1 and 0.5) system has been studied. The magnetic state of CeGa2 is found to be FM with a C of 8 K, whereas the compounds with =0.1 and 0.5 are AFM and possess N of about 9 K. These two compounds undergo metamagnetic transition and the critical fields are about 1.2 T and 0.5 T, respectively at 2 K. These variations are explained on the basis of helical spin structure in these compounds.

  16. Neutron scattering from -Ce at epithermal neutron energies

    Indian Academy of Sciences (India)

    A P Murani

    2008-10-01

    Neutron scattering data, using neutrons of incident energies as high as 2 eV, on -Ce and -Ce-like systems such as CeRh2, CeNi2, CeFe24, CeRu2, and many others that point clearly to the substantially localized 4f electronic state in these systems are reviewed. The present interpretation is contrary to the widely held view that the 4f electrons in these systems form a narrow itinerant electron 4f band.

  17. Resistividade do filme depositado via sol-gel e estado de oxidação do dopante Ce na matriz SnO2 Resistivity of the film deposited via sol-gel and oxidation state of Ce doping in SnO2 matrix

    Directory of Open Access Journals (Sweden)

    L. V. A. Scalvi

    2011-06-01

    Full Text Available Incorporação de Ce3+ ou Ce4+ em filmes finos de SnO2 depositados via sol-gel-dip-coating aumenta drasticamente a resistividade elétrica. No primeiro caso, temos comportamento aceitador do dopante, levando a matriz à alta compensação de carga. Por outro lado, para Ce4+, verifica-se aumento na largura da região de depleção do contorno de grão, resultando em maior espalhamento de elétrons. Medidas de caracterização elétrica sob pressão ambiente levam à barreiras de potencial mais altas do que as medidas sob vácuo, devido a adsorção de oxigênio na superfície das partículas. A presença de Ce3+ aumenta a transmitância no infravermelho, o que significa menor quantidade de elétrons livres. Dados de XANES confirmam que o tratamento térmico a 550 ºC dos filmes, ainda que promova oxidação parcial para Ce4+, preserva uma quantidade significativa (em torno de 60% no estado Ce3+. Espectroscopia Raman mostra a evolução dos modos de vibração intra-grãos de SnO2 com o aumento da temperatura de tratamento térmico.Incorporation of Ce3+ or Ce4+ in sol-gel dip-coating SnO2 thin films increases drastically its electrical resistivity. In the first case, it is due the acceptor-like nature of the doping ion, leading the matrix to high charge compensation. On the other hand, for Ce+4 doped samples, it is verified a broadening of the grain boundary depletion layer. Measurements under room pressure leads to higher intergrain potential barriers when compared to measurements carried out under vacuum conditions, due to oxygen adsorption at particles surface. The presence of Ce3+ increases the infrared transmittance, which means a lower free electron concentration. XANES data confirms that the thermal annealing at 550 ºC of thin films, although promotes oxidation to Ce4+, still keeps a significantly amount (about 60% of ions in the oxidation state Ce3+. Raman spectroscopy data show the evolution of the SnO2 bulk vibration modes with

  18. Search for pressure-induced superconductivity in CeFeAsO and CeFePO iron pnictides

    Energy Technology Data Exchange (ETDEWEB)

    Zocco, D. A. [University of California, San Diego; Baumbach, R. E. [University of California, San Diego; Hamlin, J. J. [University of California, San Diego; Janoschek, M. [University of California, San Diego; Lum, I. K. [University of California, San Diego; McGuire, Michael A [ORNL; Safa-Sefat, Athena [ORNL; Sales, Brian C [ORNL; Jin, Rongying [ORNL; Mandrus, David [ORNL; Jeffries, J. R. [Lawrence Livermore National Laboratory (LLNL); Weir, S. T. [Lawrence Livermore National Laboratory (LLNL); Vohra, Y. K. [University of Alabama, Birmingham; Maple, M. B. [University of California, San Diego

    2011-01-01

    The CeFeAsO and CeFePO iron pnictide compounds were studied via electrical transport measurements under high pressure. In CeFeAsO polycrystals, the magnetic phases involving the Fe and Ce ions coexist for hydrostatically applied pressures up to 15 GPa, and with no signs of pressure-induced superconductivity up to 50 GPa for the less hydrostatic pressure techniques. For the CeFePO single crystals, pressure further stabilizes the Kondo screening of the Ce 4f-electron magnetic moments.

  19. Proton induced activation of LaBr3:Ce and LaCl3:Ce

    International Nuclear Information System (INIS)

    In the framework of an assessment of lanthanum halide scintillators, such as LaBr3:Ce and LaCl3:Ce on their suitability for space based gamma-ray spectroscopy, proton induced activation of the materials has been studied. One inch scintillators were subjected to proton irradiations in the range of 60-184 MeV, where after the activation was measured. The activation was analyzed by identifying the decaying isotopes by means of gamma-ray spectroscopy and lifetime measurements using both a germanium detector and the activated scintillator itself. It was found that the dominant source of activation in the scintillators originates from the lighter elements in the materials: bromide and chloride, respectively. The activation of LaBr3:Ce manifest itself through gamma-decay, which partly leaves the volume. Activation of LaCl3:Ce originates mainly from beta decay, which is confined to the volume itself

  20. cDNA library Table: ce-- [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ce-- NA ce-- C202 x J201 compound eyes mixture of fifth instar larval stage to pupa...l stage mixed pBluescript SK- EcoR1 for 5' Xho1for 3' sequenced from T3 primer (5' -> 3') BP117205-BP118782 ce--[number] ...

  1. Effect of La,Ce,Tb Concentration on Luminescence Properties of (La,Ce,Tb)BO3%La,Ce,Tb含量对(La,Ce,Tb)BO3发光性能的影响

    Institute of Scientific and Technical Information of China (English)

    王林生; 黄可龙; 周智; 文小强; 周健; 赖华生

    2012-01-01

    采用高温固相法合成(La,Ce,Tb)BO3荧光粉,并对该荧光粉进行XRD和SEM分析.结果表明:(La,Ce,Tb)BO3的晶体结构和LaBO3相同,Ce3+,Tb3+的掺入没有改变晶体的结构,发光粉颗粒大小均匀,形貌规则,粒度在5 μm左右.研究了(La,Ce,Tb)BO3的光谱性质,在(La,Ce,Tb)BO3的发射和激发光谱中除了有Tb3+的特征发射和激发峰外,还有Ce3+的特征发射和激发峰.%The phosphors of (La,Ce,Tb)BO3 were synthesized by high temperature solid state reaction. X-ray diffractometry (XRD) patterns indicate that the crystal structures of (La,Ce,Tb)BO3 and LaBO3 are the same. The crystal structure has not been changed by Ce3+ and Tb3+ doping. Emission scanning electron microscopy (SEM) images show that the particle sizes of phosphors are more uniform, the morphology is more regular, and the granularity is about 5 μm. The content of TbBO3 phase in (La,Ce,Tb)BO3 increases with increasing of Tb content in (La,Ce,Tb)BO3. When Tb concentration reaches 15% and above, the content of TbBO3 phase in (La,Ce,Tb)BO3 increases more rapidly. The luminescence properties of (La,Ce,Tb)BO3 and the sensitization of Ce to Tb were studied. In the excitation spectrum of Ce there are three peaks at 244, 268 and 330 nm, respectively. And in the emission spectrum of Ce , there are two peaks at 365 and 380 nm, respectively. All of them have the large overlap. The Maximum emission wavelength of Tb3+ is 541 nm, and its excitation peaks is 230 nm. Both the Tb characteristic emission and excitation peaks and the Ce characteristic emission and excitation peaks were observed in the emission and excitation spectrum of (La,Ce,Tb)BO3. Comparing the excitation spectrum of (La,Ce)BO3 with the emission spectrum of (La,Tb)BO3, it is found that they have the large overlap. It is indicated that there is a remarkable energy transfer from Ce to Tb in (La,Ce,Tb)BO3. When the concentration of Ce or Tb in (La,Ce,Tb)BO3 is fixed, because of concentration self

  2. Reference Gene Selection in the Desert Plant <em>Eremosparton songoricuem>m>

    Directory of Open Access Journals (Sweden)

    Dao-Yuan Zhang

    2012-06-01

    Full Text Available <em>Eremosparton songoricum em>(Litv. Vass. (<em>E. songoricumem> is a rare and extremely drought-tolerant desert plant that holds promise as a model organism for the identification of genes associated with water deficit stress. Here, we cloned and evaluated the expression of eight candidate reference genes using quantitative real-time reverse transcriptase polymerase chain reactions. The expression of these candidate reference genes was analyzed in a diverse set of 20 samples including various <em>E. songoricumem> plant tissues exposed to multiple environmental stresses. GeNorm analysis indicated that expression stability varied between the reference genes in the different experimental conditions, but the two most stable reference genes were sufficient for normalization in most conditions.<em> EsEFem> and <em>Esα-TUB> were sufficient for various stress conditions, <em>EsEF> and <em>EsACT> were suitable for samples of differing germination stages, and <em>EsGAPDH>and <em>Es>UBQ em>were most stable across multiple adult tissue samples. The <em>Es18Sem> gene was unsuitable as a reference gene in our analysis. In addition, the expression level of the drought-stress related transcription factor <em>EsDREB2em>> em>verified the utility of<em> E. songoricumem> reference genes and indicated that no single gene was adequate for normalization on its own. This is the first systematic report on the selection of reference genes in <em>E. songoricumem>, and these data will facilitate future work on gene expression in this species.

  3. Convenient synthesis of CeO2 nanotubes

    International Nuclear Information System (INIS)

    A simple and facile route was used in the fabrication of CeO2 nanotubes within anodic alumina membrane. A piece of membrane was first immersed into Ce(NO3)3 aqueous solution under ambient conditions. After dried at 50 deg. C and thermally calcined at 150 deg. C and 550 deg. C, CeO2 nanotubes can be easily synthesized. The characterization with electron microscopy and X-ray diffraction indicated that CeO2 nanotubes were composed of tiny well-crystalline CeO2 nanoparticles

  4. Laser properties of yag: Nd, Cr, Ce

    Science.gov (United States)

    Kvapil, J.; Kvapil, Jos; Perner, B.; Kubelka, J.; Mánek, B.; Kubeček, V.

    1984-06-01

    Transient absorption of a long lifetime (≧ 20 s) of YAG: Nd is typical of pure material. It is the main reason of thermal deformation of the laser rods accompanied with power decreases at higher CW input. It may be prevented by an admixture of Fe, Ti or Cr. Using a small admixture (≦ 10-3 wt.%) of Ti or Cr the energy transfer among Nd ions and the gain coefficient may be increased. Cr in a higher concentration absorbs the pumping light and serves as earlier described coactivator (sensitizer) only. Fe impurity fully prevents any increase of the gain of YAG: Nd containing Ti or Cr and causes slow but irreversible degradation of the active parameters. Ce favourably modifies properties of YAG: Nd, Cr. YAG: Nd, Cr, Ce free of iron impurity is advisable active material for powerfull CW lasers.

  5. Maanhonka hirsitalot CE-merkintä

    OpenAIRE

    Nieminen, Ville

    2012-01-01

    Tämän insinöörityön tarkoitus oli saada päivitettyä Maanhonka hirsitalojen ETA, joka oli mennyt vanhaksi marraskuussa 2010. ETA-hyväksynnän ja vaatimuksen-mukaisuustodistuksen myötä on tarkoitus hakea yritykselle CE-merkintäoikeus. CE-merkintä tulee pakolliseksi talotehtaille ja kaikille rakennustuotteille 1.7.2013 alkaen. Prosessi kestää yrityksestä riippuen vähintään puolesta vuodesta vuoteen. Riippuen siitä, mitä ETAan sisällytetään ja mitä testejä yrityksellä on jo ennestään tehtynä. VTT:...

  6. Cerium intermetallics CeTX. Review III

    Energy Technology Data Exchange (ETDEWEB)

    Poettgen, Rainer; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ., Pessac (France). Inst. de Chimie de la Matiere Condensee de Bordeaux

    2016-05-01

    The structure-property relationships of CeTX intermetallics with structures other than the ZrNiAl and TiNiSi type are systematically reviewed. These CeTX phases form with electron-poor and electron-rich transition metals (T) and X = Mg, Zn, Cd, Hg, Al, Ga, In, Tl, Si, Ge, Sn, Pb, P, As, Sb, and Bi. The review focusses on the crystal chemistry, the chemical bonding peculiarities, and the magnetic and transport properties. Furthermore {sup 119}Sn Moessbauer spectroscopic data, high-pressure studies, hydrogenation reactions and the formation of solid solutions are reviewed. This paper is the third of a series of four reviews on equiatomic intermetallic cerium compound [Part I: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 289; Part II: R. Poettgen, B. Chevalier, Z. Naturforsch. 2015, 70b, 695].

  7. The CeDRES data portal

    Science.gov (United States)

    Albert-Aguilar, Alexandre; Delmotte, Pauline; André, François; Brissebrat, Guillaume; Canonici, Jean-Christophe; Piguet, Bruno

    2016-04-01

    SAFIRE is the French facility dedicated to airborne measurement for environmental research. The SAFIRE steering committee decided that access to its archives should be improved. If certain data, including recent campaigns, are available online, access to them is difficult for users because these data are dispersed in as many data portals as campaigns. Most of projects are not able to keep medium to long term online access to their database. Therefore, many airborne data, particularly the oldest, are not available online, stored on media whose sustainability is not guaranteed. SAFIRE also decided to identify old data stored in Meudon (France) on paper and hard media and to rescue with the help of an archivist. At the same time, the development of a centralized digital archive - containing data collected with the Fokker - 27 " ARAT " and Merlin IV aircraft - associated to a web portal was given to SEDOO. The first part of the project consisted in modelling the database. The second part, still in progess, was the development of the CeDRES (Centre de Données aéRoportées & SAFIRE) portal (http://cedres.sedoo.fr) which is responsive and bilingual (French and English) ; and metadata standardization (iso 19115). The main objectives of this project are data preservation and open data access. A first test version of CeDRES portal will be release in mid-February 2016. And operational version is planned for summer 2016. In the future, CeDRES portal will be able to receive and to distribute metadata and data of aircraft currently in service (FALCON-20, ATR-42 and PiperAztec-23). The interoperability implementation and data homogenization are planned in the medium term. The CeDRES portal is part of the French atmospheric chemistry data center AERIS (http://www.aeris-data.fr). Every scientist is invited to browse the catalog and use CEDRES data. Feel free to contact cedres-contact@sedoo.fr for any question.

  8. The 144Ce source for SOX

    Science.gov (United States)

    Durero, M.; Vivier, M.; Agostini, M.; Altenmüller, K.; Appel, S.; Bellini, G.; Benziger, J.; Berton, N.; Bick, D.; Bonfini, G.; Bravo, D.; Caccianiga, B.; Calaprice, F.; Caminata, A.; Cavalcante, P.; Chepurnov, A.; Choi, K.; Cribier, M.; D'Angelo, D.; Davini, S.; Derbin, A.; Di Noto, L.; Drachnev, I.; Etenko, A.; Farinon, S.; Fischer, V.; Fomenko, K.; Franco, D.; Gabriele, F.; Gaffiot, J.; Galbiati, C.; Ghiano, C.; Giammarchi, M.; Goeger-Neff, M.; Goretti, A.; Gromov, M.; Hagner, C.; Houdy, T.; Hungerford, E.; Ianni, Aldo; Ianni, Andrea; Jonqueres, N.; Jedrzejczak, K.; Kaiser, M.; Kobychev, V.; Korablev, D.; Korga, G.; Kornoukhov; Kryn, D.; Lachenmaier, T.; Lasserre, T.; Laubenstein, M.; Lehnert, B.; Link, J.; Litvinovich, E.; Lombardi, F.; Lombardi, P.; Ludhova, L.; Lukyanchenko, G.; Machulin, I.; Manecki, S.; Maneschg, W.; Marcocci, S.; Maricic, J.; Mention, G.; Meroni, E.; Meyer, M.; Miramonti, L.; Misiaszek, M.; Montuschi, M.; Muratova, V.; Musenich, R.; Neumair, B.; Oberauer, L.; Obolensky, M.; Ortica, F.; Pallavicini, M.; Papp, L.; Perasso, L.; Pocar, A.; Ranucci, G.; Razeto, A.; Re, A.; Romani, A.; Roncin, R.; Rossi, N.; Schönert, S.; Scola, L.; Semenov, D.; Simgen, H.; Skorokhvatov, M.; Smirnov, O.; Sotnikov, A.; Sukhotin, S.; Suvorov; Tartaglia, R.; Testera, G.; Thurn, J.; Toropova, M.; Veyssiére, C.; Unzhakov, E.; Vogelaar, R. B.; von Feilitzsch, F.; Wang, H.; Weinz, S.; Winter, J.; Wojcik, M.; Wurm, M.; Yokley, Z.; Zaimidoroga, O.; Zavatarelli, S.; Zuber, K.; Zuzel, G.

    2016-02-01

    The SOX (Short distance neutrino Oscillations with BoreXino) project aims at testing the light sterile neutrino hypothesis. To do so, two artificials sources of antineutrinos and neutrinos respectively will be consecutively deployed at the Laboratori Nazionali del Gran Sasso (LNGS) in close vicinity to Borexino, a large liquid scintillator detector. This document reports on the source production and transportation. The source should exhibit a long lifetime and a high decay energy, a requirement fullfilled by the 144Ce-144Pr pair at secular equilibrium. It will be produced at FSUE “Mayak” PA using spent nuclear fuel. It will then be shielded and packed according to international regulation and shipped to LNGS across Europe. Knowledge of the Cerium antineutrino generator (CeANG) parameters is crucial for SOX as it can strongly impact the experiment sensitivity. Several apparatuses are being used or designed to characterize CeANG activity, radioactive emission and content. An overview of the measurements performed so far is presented here.

  9. [Effects of Arbuscular Mycorrhizal Fungi on the Growth and Ce Uptake of Maize Grown in Ce-contaminated Soils].

    Science.gov (United States)

    Wang, Fang; Guo, Weil; Ma, Peng-kun; Pan, Liang; Zhang, Jun

    2016-01-15

    A greenhouse pot experiment was conducted to investigate the effects of arbuscular mycorrhizal (AM) fungi Glomus aggregatum (GA) and Funneliformis mosseae (FM) on AM colonization rate, biomass, nutrient uptake, C: N: P stoichiometric and Ce uptake and transport by maize (Zea mays L.) grown in soils with different levels of Ce-contaminated (100, 500 and 1000 mg x kg(-1)). The aim was to provide basic data and technical support for the treatment of soils contaminated by rare earth elements. The results indicated that symbiotic associations were successfully established between the two isolates and maize, and the average AM colonization rate ranged from 7. 12% to 74.47%. The increasing concentration of Ce in soils significantly decreased the mycorrhizal colonization rate, biomass, nutrition contents and transport rate of Ce from root to shoot of maize, and significantly increased C: P and N: P ratios and Ce contents in shoot and root of maize. Both AM fungi inoculations promoted the growth of maize, but the promoting role of FM was more significant than that of GA in severe Ce-contaminated soils. There were no significant differences in the growth of maize between two AM fungi in mild and moderate Ce-contaminated soils. Inoculation with AM fungi significantly improved nutritional status of maize by increasing nutrient uptake and decreasing C: N: P ratios. GA was more efficient than FM in enhancing nutrient uptake in mild and moderate Ce-contaminated soils, while FM was more efficient in severe Ce-contaminated soils. Moreover, inoculation with AM fungi significantly increased Ce contents of shoot and root in mild Ce-contaminated soils, but had no significant effect on Ce contents of maize in moderate and severe Ce-contaminated soils, and promoted the transport of Ce from root to shoot. The experiment demonstrates that AM fungi can alleviate toxic effects of Ce on plants and have a potential role in the phytoremediation of soils contaminated by rare earth elements. PMID

  10. [Effects of Arbuscular Mycorrhizal Fungi on the Growth and Ce Uptake of Maize Grown in Ce-contaminated Soils].

    Science.gov (United States)

    Wang, Fang; Guo, Weil; Ma, Peng-kun; Pan, Liang; Zhang, Jun

    2016-01-15

    A greenhouse pot experiment was conducted to investigate the effects of arbuscular mycorrhizal (AM) fungi Glomus aggregatum (GA) and Funneliformis mosseae (FM) on AM colonization rate, biomass, nutrient uptake, C: N: P stoichiometric and Ce uptake and transport by maize (Zea mays L.) grown in soils with different levels of Ce-contaminated (100, 500 and 1000 mg x kg(-1)). The aim was to provide basic data and technical support for the treatment of soils contaminated by rare earth elements. The results indicated that symbiotic associations were successfully established between the two isolates and maize, and the average AM colonization rate ranged from 7. 12% to 74.47%. The increasing concentration of Ce in soils significantly decreased the mycorrhizal colonization rate, biomass, nutrition contents and transport rate of Ce from root to shoot of maize, and significantly increased C: P and N: P ratios and Ce contents in shoot and root of maize. Both AM fungi inoculations promoted the growth of maize, but the promoting role of FM was more significant than that of GA in severe Ce-contaminated soils. There were no significant differences in the growth of maize between two AM fungi in mild and moderate Ce-contaminated soils. Inoculation with AM fungi significantly improved nutritional status of maize by increasing nutrient uptake and decreasing C: N: P ratios. GA was more efficient than FM in enhancing nutrient uptake in mild and moderate Ce-contaminated soils, while FM was more efficient in severe Ce-contaminated soils. Moreover, inoculation with AM fungi significantly increased Ce contents of shoot and root in mild Ce-contaminated soils, but had no significant effect on Ce contents of maize in moderate and severe Ce-contaminated soils, and promoted the transport of Ce from root to shoot. The experiment demonstrates that AM fungi can alleviate toxic effects of Ce on plants and have a potential role in the phytoremediation of soils contaminated by rare earth elements.

  11. Moessbauer studies of nano phase Ce-Fe oxide composites

    International Nuclear Information System (INIS)

    Chemical co-precipitation method was used to synthesize nano-structured α-Fe2O3-CeO2 composite by calcination of the goethite-cerium hydroxide precursor. It was observed that the precursor contained goethite matrix doped with cerium. Calcination of the precursor at 400oC showed the formation of nanosize hematite. Moessbauer spectra show the presence of a paramagnetic component in the precursor but not in the samples calcined at 400oC to 800oC temperatures. Our study shows that Ce precipitated as CeO2 and stuck on the surface of hematite particles. The precipitation of Ce as CeO2 is independent of the concentration of Ce in the Ce-Fe-O composite.

  12. Water Dissociation on CeO2(100) and CeO2(111) Thin Films

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, David R [ORNL; Albrecht, Peter M [ORNL; Chen, Tsung-Liang [ORNL; Calaza, Florencia C [ORNL; Biegalski, Micahel [Oak Ridge National Laboratory (ORNL); Christen, Hans [Oak Ridge National Laboratory (ORNL); Overbury, Steven {Steve} H [ORNL

    2012-01-01

    This study reports and compares the adsorption and dissociation of water on oxidized and reduced CeO{sub 2}(100) and CeO{sub 2}(111) thin films. Water adsorbs dissociatively on both surfaces. On fully oxidized CeO{sub 2}(100) the resulting surface hydroxyls are relatively stable and recombine and desorb as water over a range from 200 to 600 K. The hydroxyls are much less stable on oxidized CeO{sub 2}(111), recombining and desorbing between 200 and 300 K. Water produces 30% more hydroxyls on reduced CeO{sub 1.7}(100) than on oxidized CeO{sub 2}(100). The hydroxyl concentration increases by 160% on reduced CeO{sub 1.7}(111) compared to oxidized CeO{sub 2}(111). On reduced CeO{sub 1.7}(100) most of the hydroxyls still recombine and desorb as water between 200 and 750 K. Most of the hydroxyls on reduced CeO{sub 1.7}(111) react to produce H{sub 2} at 560 K, leaving O on the surface. A relatively small amount of H{sub 2} is produced from reduced CeO{sub 1.7}(100) between 450 and 730 K. The differences in the adsorption and reaction of water on CeO{sub X}(100) and CeO{sub X}(111) are attributed to different adsorption sites on the two surfaces. The adsorption site on CeO{sub 2}(100) is a bridging site between two Ce cations. This adsorption site does not change when the ceria is reduced. The adsorption site on CeO{sub 2}(111) is atop a single Ce cation, and the proton is transferred to a surface O in a site between three Ce cations. When the CeO{sub X}(111) is reduced, vacancy sites are produced which allows the water to adsorb and dissociate on the 3-fold Ce cation sites.

  13. Constituição de sujeitos na gestão em saúde: avanços e desafios da experiência de Fortaleza (CE) The strengthening of subjects in health management: advances and challenges in the experience of Fortaleza, state of Ceará

    OpenAIRE

    Carmem Emmanuely Leitão Araújo; Ricardo José Soares Pontes

    2012-01-01

    Trata-se de uma pesquisa sobre possibilidades e limites da constituição de sujeitos na gestão em saúde, a partir da experiência de Fortaleza no período de 2005 a 2008. Aborda-se o sujeito a partir de um referencial histórico-cultural, o qual considera a interação dialética entre o individual e o coletivo no aprofundamento da consciência humana sobre si e o mundo. Foram realizados grupos focais com gestores vinculados à Atenção Primária à Saúde e utilizados dados secundários. Por meio de uma a...

  14. Synthesis, Crystal Structure and Luminescent Property of Cd (II Complex with <em>N-Benzenesulphonyl-L>-leucine

    Directory of Open Access Journals (Sweden)

    Xishi Tai

    2012-09-01

    Full Text Available A new trinuclear Cd (II complex [Cd3(L6(2,2-bipyridine3] [L =<em> Nem>-phenylsulfonyl-L>-leucinato] has been synthesized and characterized by elemental analysis, IR and X-ray single crystal diffraction analysis. The results show that the complex belongs to the orthorhombic, space group<em> Pem>212121 with<em> aem> = 16.877(3 Å, <em>b> em>= 22.875(5 Å, <em>c em>= 29.495(6 Å, <em>α> em>= <emem>= <emem>= 90°, <em>V> em>= 11387(4 Å3, <em>Z> em>= 4, <em>Dc>= 1.416 μg·m−3, <emem>= 0.737 mm−1, <em>F> em>(000 = 4992, and final <em>R>1 = 0.0390, <em>ωR>2 = 0.0989. The complex comprises two seven-coordinated Cd (II atoms, with a N2O5 distorted pengonal bipyramidal coordination environment and a six-coordinated Cd (II atom, with a N2O4 distorted octahedral coordination environment. The molecules form one dimensional chain structure by the interaction of bridged carboxylato groups, hydrogen bonds and p-p interaction of 2,2-bipyridine. The luminescent properties of the Cd (II complex and <em>N-Benzenesulphonyl-L>-leucine in solid and in CH3OH solution also have been investigated.

  15. A comparison between Ce(III) and Ce(IV) ions in photocatalytic degradation of organic pollutants

    Institute of Scientific and Technical Information of China (English)

    程强; 施薇; 段炼; 孙彬哲; 李晓霞; 徐爱华

    2015-01-01

    Nano cerium oxides are efficient photocatalysts for pollutants degradation with highly dispersed Ce(III) ions as the sug-gested active species to promote the reaction, while Ce(IV) species do not behave as a catalyst. In this paper, to understand the mechanism of Ce-based photocatalysts, we studied the comparison of simple cerium ions, Ce(III) and Ce(IV) in aqueous solution for organic pollutants degradation under UV irradiation. Orange II (AOII), methyl orange, andp-nitrophenol were selected as the target pollutants. The formation and contribution of reactive oxygen species, the kinetics of Ce(IV) photoreduction and Ce(III) photooxida-tion, and the influence of solution pH were investigated in detail. It was found that at low pH Ce(IV) ions showed a higher activity for hydroxyl radicals production and AOII degradation than Ce(III) ions, which could be attributed to its fast reduction rate to Ce(III). However, its activity dramatically decreased when solution pH increased, and was also strongly influenced by the type of pollutants; while Ce(III) exhibited high degradation efficiency of all the tested pollutants over a wide pH range.

  16. Role of the Ce valence in the coexistence of superconductivity and ferromagnetism of CeO$_{1-x}$F$_{x}$BiS$_{2}$ revealed by Ce $L_3$-edge x-ray absorption spectroscopy

    OpenAIRE

    Sugimoto, Takuya; Joseph, Boby; Paris, Eugenio; Iadecola, Antenolla; Mizokawa, Takashi; Demura, Satoshi; Mizuguchi, Yoshikazu; Takano, Yoshihiko; Saini, Naurang L.

    2014-01-01

    We have performed Ce $L_3$-edge x-ray absorption spectroscopy (XAS) measurements on CeO$_{1-x}$F$_x$BiS$_2$, in which the superconductivity of the BiS$_2$ layer and the ferromagnetism of the CeO$_{1-x}$F$_x$ layer are induced by the F-doping, in order to investigate the impact of the F-doping on the local electronic and lattice structures. The Ce $L_3$-edge XAS spectrum of CeOBiS$_2$ exhibits coexistence of $4f^1$ (Ce$^{3+}$) and $4f^0$ (Ce$^{4+}$) state transitions revealing Ce mixed valency...

  17. Preparation and electrical characterization of electrolytes obtained from solid solution (Zr{sub 0.84}Y{sub 0.16O1.90}) x (Ce{sub 0.80}Gd{sub 0.20}O{sub 1.90}){sub 1-x} for fuel cells application; Preparacao e caracterizacao eletrica de eletrolitos obtidos a partir da solucao solida (Zr{sub 0.84}Y{sub 0.16O1.90}) x (Ce{sub 0.80}Gd{sub 0.20}O{sub 1.90}){sub 1-x} para aplicacao em pilhas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Tonelli, Bruno C.; Antunes, Fabio C.; Souza, Dulcina P.F. de, E-mail: fcaufscar@yahoo.com.b [Universidade Federal de Sao Carlos (LAPCEC/UFSCar), SP (Brazil). Programa de Pos-Graduacao em Ciencia e Engenharia de Materiais. Lab. de Preparacao e Caracterizacao Eletrica em Ceramicas

    2010-07-01

    Oxide fuel cells based on yttria stabilized zirconia (YSZ) operates near 1000 deg C. This high temperature results in physical and chemical degradation of the device. Rare earths doped ceria (REC) based systems can operate at low temperatures due to higher ionic conductivity. However, at low oxygen partial pressure, doped ceria shows n-type electronic conductivity due to reduction of Ce{sup +4} to Ce{sup +3}. Trying to put together the zirconia and ceria advantage, YSZ-REC composites have been investigated. In this work, YSZ-GdDC powders mixtures were prepared and pellets were isostatically pressed. Pellets were sintered 1100-1500 deg C temperature range. Sintered pellets were characterized by density measurements, X-ray diffraction, impedance spectroscopy and scanning electron microscopy. The experimental procedure adopted in this work generated solid solutions instead of composite samples. Nevertheless, the composition containing {approx}76 vol.% of YSZ, in spite of the high porosity, showed electrical conductivity similar to pure YSZ. (author)

  18. Study of Ce-modified antibacterial 316L stainless steel

    Directory of Open Access Journals (Sweden)

    Yuan Junping

    2012-11-01

    Full Text Available 316L stainless steel is widely used for fashion jewelry, but it can carry a large number of bacteria and bring the risk of infection since the steel has no antimicrobial performance. In this paper, the effects of Ce on the antibacterial property, corrosion resistance and processability of 316L were studied by microscopic observation, thin-film adhering quantitative bacteriostasis, and electrochemical and mechanical tests. The results show that a trace of Ce can distribute uniformly in the matrix of 316L and slightly improve its corrosion resistance in artificial sweat. With an increase in Ce content, the Ce is prone to form clustering, which degrades the corrosion resistance and the processability. The Ce-containing 316L exhibits Hormesis effect against S. aureus. A small Ce addition stimulates the growth of S. aureus. As the Ce content increases, the modified 316L exhibits an improved antibacterial efficacy. The more Ce is added, the better antibacterial capability is achieved. Overall, if the 316L is modified with Ce alone, it is difficult to obtain the optimal combination of corrosion resistance, antibacterial performance and processability. In spite of that, 0.15 wt.%-0.20 wt.% Ce around is inferred to be the best trade-off.

  19. Search for double beta decay of $^{136}$Ce and $^{138}$Ce with HPGe gamma detector

    CERN Document Server

    Belli, P; Boiko, R S; Cappella, F; Cerulli, R; Danevich, F A; Incicchitti, A; Kropivyansky, B N; Laubenstein, M; Poda, D V; Polischuk, O G; Tretyak, V I

    2014-01-01

    Search for double $\\beta$ decay of $^{136}$Ce and $^{138}$Ce was realized with 732 g of deeply purified cerium oxide sample measured over 1900 h with the help of an ultra-low background HPGe $\\gamma$ detector with a volume of 465 cm$^3$ at the STELLA facility of the Gran Sasso National Laboratories of the INFN (Italy). New improved half-life limits on double beta processes in the cerium isotopes were set at the level of $\\lim T_{1/2}\\sim 10^{17}-10^{18}$~yr; many of them are even two orders of magnitude larger than the best previous results.

  20. ÍNDÍCE DE RECUPERAÇÃO DE OÓCITOS BOVINOS OBTIDOS DE OVÁRIOS ADQUIRIDOS EM ABATEDOURO COMO CONTRIBUIÇÃO PARA OS ESTUDOS DE FECUNDAÇÃO E PRODUÇÃO DE EMBRIÕES IN VITRO

    Directory of Open Access Journals (Sweden)

    AGOSTINHO. Maria Avanci

    2009-05-01

    Full Text Available The production of embryos in vitro is a biotechnology used, alternatively, to accelerate theproduction of genetically superior animals in addition to the deepening of knowledge concerning physiologicalprocesses, biochemical and biotechnological interest of the animal. The development of techniques in vitro toproduce embryos of domestic animals has great potential both for basic research and for applications in the fieldand has been widely used and distributed in Brazil and abroad. This study aimed to classify bovine oocytes obtainedfrom ovaries acquired in a slaughterhouse, determining the rate of recovery of these structures and identifying themost viable for the procedure for in vitro fertilization. Through follicular aspiration, oocytes were ranked in scalefrom 1 to 4, according to the amount of layers of cells in the complex cumulus oophorus involving the oocyte.There was 15.22% of high-quality oocytes 1; 25.88% of quality 2; 35.53% from 23.35% quality 3 and quality 4,setting higher rates of oocytes recovered classified as 2 and 3, which are physiologically viable and able to enterinto a program of in vitro fertilization.A produção in vitro de embriões é uma biotécnica utilizada, alternativamente, para acelerar aprodução de animais geneticamente superiores além de permitir o aprofundamento dos conhecimentos relativosaos processos fisiológicos, bioquímicos e biotecnológicos da espécie animal de interesse. O desenvolvimento detécnicas in vitro para a produção de embriões de animais domésticos tem grande potencial tanto para pesquisabásica quanto para aplicações a campo e tem sido muito utilizadas e difundidas no Brasil e no mundo. O presentetrabalho objetivou classificar oócitos bovinos obtidos de ovários adquiridos em abatedouro, determinando o índicede recuperação dessas estruturas e identificando os de maior viabilidade para o procedimento de fertilização invitro. Através da aspiração folicular, foram obtidos o

  1. Evaluation of Antioxidant and Antiproliferative Properties of Three <em>Actinidia> (<em>Actinidia> <em>kolomikta>, <em>Actinidia argutaem>, <em>Actinidia> <em>chinensis> Extracts <em>in Vitroem>

    Directory of Open Access Journals (Sweden)

    Jia-Ren Liu

    2012-05-01

    Full Text Available The total phenolic content, total flavonoid content, vitamin C content, and antioxidant activities of ethanol extracts from different kiwifruit varieties (<em>Actinidia> <em>kolomikta>, <em>Actinidia argutaem>, <em>Actinidia> <em>chinensis> were determined in this study. Multiple scavenging activity assays including the hydroxyl radical, O2·radical, DPPH, and the ABTS+ radical scavenging activity assays were used to identify the antioxidant activities of <em>Actinidia> extracts. The cell viability of HepG2 and HT-29 cells was also examined in this study. The results demonstrated that the <em>Actinidia kolomiktaem> extract had a higher antioxidant activity than the other two <em>Actinidia> extracts. There is a positive correlation between antioxidant activity and the polyphenols and vitamin C content in all three extracts (<em>R>2 ≥ 0.712, <em>p> em>< 0.05. The <em>Actinidia argutaem> extract had the highest inhibitory effect on HepG2 and HT-29 cell growth. These results provide new insight into the health functions of fruit and demonstrate that <em>Actinidia> extracts can potentially have health benefits.

  2. Electrical resistivity of CeFe2

    International Nuclear Information System (INIS)

    Electrical and magneitc properties of CeFe2 were investigated from the temperature dependence of electrical resistivity in the range of 1,5 to 3000K. The critical temperature, determined from the maximum of dp/dT, gives T sub(c) = 2200K and the temperature independent magnetic resistivity is 87μωcm. This value is compared with the corresponding in YFe2. At low temperature the resistivity shows a fairly large variation proportional to AT2 up to about 320K with A = 1,2x10-2 μωcm/0K2. (Author)

  3. Internal bremsstrahlung spectrum of 139Ce

    International Nuclear Information System (INIS)

    The internal bremsstrahlung spectrum which accompanies the electron capture decay of 139Ce to the first excited state of 139La has been measured in coincidence with the nuclear gamma ray which deexcites that state. The measured intensity above 42 keV is found to be (1.070±0.024) times that predicted by the recent calculations of Suriacute c et al. The QEC value is found to be 264.6±2.0 keV. copyright 1996 The American Physical Society

  4. 放眼CeBIT 2010

    Institute of Scientific and Technical Information of China (English)

    李璐

    2010-01-01

    @@ 来自国际展览业巨头汉诺威公司的消息,作为全球规模最大的ICT产业盛会,2010年在德国举行的汉诺威消费电子,信息及通信博览会(CeBIT),将吸引更多中国企业参展,在这个高端舞台上,放眼国际市场寻找商机.

  5. <em>α>-Glucosidase Inhibitory Constituents from <em>Acanthopanax senticosusem> Harm Leaves

    Directory of Open Access Journals (Sweden)

    Hai-Xue Kuang

    2012-05-01

    Full Text Available A new triterpene glycoside, 3-<em>O-[(α>-L-rhamnopyranosyl(1→2]-[<em>β>-D-glucuronopyranosyl-6-<em>O>-methyl ester]-olean-12-ene-28-olic acid (1 and a new indole alkaloid, 5-methoxy-2-oxoindolin-3-acetic acid methyl ester (5 were isolated from the leaves of <em>Acanthopanax senticosusem> Harms along with six known compounds. The structures of the new compounds were determined by means of 2D-NMR experiments and chemical methods. All the isolated compounds were evaluated for their glycosidase inhibition activities and compound 6 showed significant <em>α>-glucosidase inhibition activity.

  6. Facile hydrothermal synthesis of CeO2 nanopebbles

    Indian Academy of Sciences (India)

    N Sabari Arul; D Mangalaraj; Jeong In Han

    2015-09-01

    Cerium oxide (CeO2) nanopebbles have been synthesized using a facile hydrothermal method. X-ray diffraction pattern (XRD) and transmission electron microscopy analyses confirm the presence of CeO2 nanopebbles. XRD shows the formation of cubic fluorite CeO2 and the average particle size estimated from the Scherrer formula was found to be 6.69 nm. X-ray absorption spectrum of CeO2 nanopebbles exhibits two main sharp white lines at 880 and 898 eV due to the spin orbital splitting of 4 and 5. Optical absorption for the synthesized CeO2 nanopebbles exhibited a blue shift (g = 3.35 eV) with respect to the bulk CeO2 (g = 3.19 eV), indicating the existence of quantum confinement effects.

  7. A thermodynamic assessment of Ce-Al system

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The optimized descriptions of the phase diagram and thermodynamic properties for Ce-Al system have been obtained from experimental thermodynamic and phase diagram data by means of the computer program THERMO-CALC based on the least squares method, using models for the Gibbs energy of individual phases. The system contains five intermetallic compounds. The calculated standard enthalpies of Ce3Al, CeAl, CeAl2, CeAl3 and Ce3Al11 are -26.7, -48.9, -48.4, -44.0 and -41.7 kJ/mol, respectively. A consistent set of thermodynamic parameters was derived. The optimized and experimental data are in good agreement.

  8. Windows CE自定制Shell%Customizing Windows CE Shell

    Institute of Scientific and Technical Information of China (English)

    覃朗; 雷跃明

    2010-01-01

    Shell是用户访问操作系统的接口.Shell开发在Windows CE操作系统开发中占据一定的重要性.对Windows CE Shell进行了概述,并通过建立Shell模型,讲述如何自定制Windows CE Shell和定制Shell必须注意的问题,对Windows CE Shell的定制进行深入研究.

  9. Radiation resistant multicomponent inorganic materials for homogeneous EM-calorimeters

    International Nuclear Information System (INIS)

    With the development of a new generation of particle accelerators the interest for radiation resistant materials using for EM-calorimeters capable of withstanding a high radiation environment (107 rad/yr) has been increasing. The radiation resistance of fluoride solid solutions and heavy crystal oxides is investigated. A series of multicomponent crystals, solid solutions on the base of CeF2 and CdF2 with the radiation resistance above 109 rad is presented. 24 refs.; 4 figs

  10. Inverted opal luminescent Ce-doped silica glasses

    Directory of Open Access Journals (Sweden)

    R. Scotti

    2006-01-01

    Full Text Available Inverted opal Ce-doped silica glasses (Ce : Si molar ratio 1 ⋅ 10−3 were prepared by a sol-gel method using opals of latex microspheres as templates. The rare earth is homogeneously dispersed in silica host matrix, as evidenced by the absence of segregated CeO2, instead present in monolithic Ce-doped SG with the same cerium content. This suggests that the nanometric dimensions of bridges and junctions of the host matrix in the inverted opal structures favor the RE distribution avoiding the possible segregation of CeO2.

  11. Constituição de sujeitos na gestão em saúde: avanços e desafios da experiência de Fortaleza (CE The strengthening of subjects in health management: advances and challenges in the experience of Fortaleza, state of Ceará

    Directory of Open Access Journals (Sweden)

    Carmem Emmanuely Leitão Araújo

    2012-09-01

    Full Text Available Trata-se de uma pesquisa sobre possibilidades e limites da constituição de sujeitos na gestão em saúde, a partir da experiência de Fortaleza no período de 2005 a 2008. Aborda-se o sujeito a partir de um referencial histórico-cultural, o qual considera a interação dialética entre o individual e o coletivo no aprofundamento da consciência humana sobre si e o mundo. Foram realizados grupos focais com gestores vinculados à Atenção Primária à Saúde e utilizados dados secundários. Por meio de uma abordagem hermenêutica dialética procurou-se compreender o sentido das narrativas construídas. Identificaram-se categorias empíricas que foram analisadas: cointencionalidade de mudança, direcionalidade política e conceitual, gestão humana, diminuição da hierarquia, fragmentação do processo de trabalho, concentração do poder de decisão. Sobressaíram-se reflexões sobre três políticas estratégicas: cogestão, humanização e educação permanente em saúde. Concluiu-se que, apesar da persistência de obstáculos, para a melhoria da qualidade dos sistemas e serviços de saúde é imprescindível instituir uma gestão democrática por meio de arranjos organizacionais e métodos participativos que potencializem a inserção e o comprometimento dos atores do Sistema Único de Saúde (SUS.This research deals with the potential and limitations of the strengthening of subjects in health management, based on the experience in Fortaleza in the period from 2005 to 2008. The subject is approached from a historical-cultural standpoint, which considers the dialectical interaction between the individual and the collective in deepening human consciousness on the self and the world. Focus groups were conducted with managers linked to Primary Healthcare and secondary data were utilized. An attempt was made to understand the meaning of the narratives constructed using a hermeneutic dialectic approach. Empirical categories were identified and

  12. Preparation,Characterization of CuO/CeO2 and Cu/CeO2 Catalysts and Their Applications in Low-Temperature CO Oxidation

    Institute of Scientific and Technical Information of China (English)

    Zheng Xiucheng; Han Dongzhan; Wang Shuping; Zhang Shoumin; Wang Shurong; Huang Weiping; Wu Shihua

    2005-01-01

    CeO2 was synthesized via sol-gel process and used as supporter to prepare CuO/CeO2, Cu/CeO2 catalysts by impregnation method. The catalytic properties and characterization of CeO2, CuO/CeO2 and Cu/CeO2 catalysts were examined by means of a microreactor-GC system, HRTEM, XRD, TPR and XPS techniques. The results show that CuO has not catalytic activity and the activity of CeO2 is quite low for CO oxidation. However, the catalytic activity of CuO/CeO2 and Cu/CeO2 catalysts increases significantly. Furthermore, the activity of CuO/CeO2 is higher than that of Cu/CeO2 catalysts.

  13. Three New Myrsinol Diterpenes from <em>Euphorbia proliferaem> and Their Neuroprotective Activities

    Directory of Open Access Journals (Sweden)

    Yuanqiang Guo

    2012-08-01

    Full Text Available Three new myrsinol diterpenes were isolated from the roots of<em> em>>Euphorbia proliferaem>. Their structures were elucidated as 2<em>α-O>-isobutyryl-3<em>β>,5<em>α>,7<em>β>,10,15<em>β-penta-O>-acetyl-14<em>α-O>-benzoyl-10,18-dihydromyrsinol (1, 2<em>α-O>-isobutyryl-3<em>β-O>-propion-yl-5<em>α>,7<em>β>,10,15<em>β-tetra-O>-acetyl-10,18-dihydromyrsinol (2, and 2<em>α>,14<em>α-di-O>-benzoyl-3<em>β>,5<em>α>,7<em>β>,10,15<em>β-penta-O>-acetyl-10,18-dihydromyrsinol (3 on the basis of spectroscopic data analyses (IR, ESI-MS, HR-ESI-MS, and 1D and 2D NMR. Their neuroprotective activities were evaluated and compounds 1 and 2 showed neuroprotective effects against MPP+-induced neuronal cell death in SH-SY5Y cells.

  14. β-Cyclodextrin-assisted preparation of hierarchical walnut-like CeOHCO3 and CeO2 mesocrystals

    International Nuclear Information System (INIS)

    The hierarchical walnut-like CeOHCO3 mesocrystals were prepared by a facile hydrothermal method under low temperature with β-cyclodextrin (β-CD) as assistant agent. The hierarchical walnut-like CeO2 mesocrystals were obtained by thermal decomposition of CeOHCO3 mesocrystals. The crystal phase, morphology, and structure of CeOHCO3 and CeO2 mesocrystals were characterized by X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), transmission electron microscopy (TEM), and selected area electron diffraction (SAED). The time-dependent experimental results indicated that the morphology transformation from shuttle-like to walnut-like and the crystal phase transformation from orthorhombic to hexagonal simultaneously occurred in the formation processes of CeOHCO3 mesocrystals. On the basis of the morphological and crystal phase evolution processes, the formation mechanism of hierarchical walnut-like CeOHCO3 mesocrystals, including dissolution-recrystallization processes, was discussed. β-CD was believed to play an important role in the formation of the hierarchical walnut-like CeOHCO3 mesocrystals. The effects of reaction temperature, β-CD amount, and concentration of reactants on the morphologies of the products were systematically studied. CeO2 mesocrystals exhibited the distinct red-shift phenomenon in UV-vis absorption spectra.

  15. Sn-CeO2 thin films prepared by rf magnetron sputtering: XPS and SIMS study

    International Nuclear Information System (INIS)

    Sn addition in the CeO2 thin film by simultaneous Sn metal and cerium oxide magnetron sputtering causes growth of Ce3+ rich films whilst pure cerium oxide sputtering provides stoichiometric CeO2 layers. Ce4+ → Ce3+ conversion is explained by a charge transfer from Sn atoms to unoccupied orbital Ce 4f0 of cerium oxide by forming Ce 4f1 state. XPS and SIMS revealed a formation of a new chemical Ce(Sn)+ state, which belongs to SnCeO2 species.

  16. Contributo da directiva-quadro da água 2000/60/CE para a melhoria do controlo de qualidade da água de consumo humano

    OpenAIRE

    Pimentel, Cristina Maria Costa

    2011-01-01

    Dissertação de mestrado, Tecnologia dos Alimentos, Instituto Superior de Engenharia, Universidade do Algarve, 2011 Neste trabalho pretendeu-se verificar a contribuição da Directiva-Quadro da Água 2000/60/CE para a melhoria do controlo analítico da água para consumo humano em Portugal. O Laboratório de Engenharia Sanitária da Universidade do Algarve foi analisado em particular, i.e. como um caso de estudo de um laboratório de ensaios de águas acreditado. Para atingir o objectivo geral pr...

  17. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... publication any advertising of the following types: (1) paid political advertisements for a candidate, party... publication. CE publishers sell advertising to cover costs and secure earnings, print the publications, and... staff who produce the non-advertising content of the CE publication may perform certain...

  18. Biofunctionalization of CeF(3):Tb(3+) nanoparticles.

    Science.gov (United States)

    Kong, D Y; Wang, Z L; Lin, C K; Quan, Z W; Li, Y Y; Li, C X; Lin, J

    2007-02-21

    CeF(3):Tb(3+) nanoparticles (short pillar-like morphology with an average length and width of 11 and 5 nm, respectively) were successfully prepared by a polyol process using diethyleneglycol (DEG) as solvent. After being functionalized with a SiO(2)-NH(2) layer, these CeF(3):Tb(3+) nanoparticles can be conjugated with biotin molecules (activated by thionyl chloride) and further with avidin. The as-formed CeF(3):Tb(3+) nanoparticles, CeF(3):Tb(3+) nanoparticles functionalized with amino groups, biotin conjugated amino-functionalized CeF(3):Tb(3+) nanoparticles and biotinylated CeF(3):Tb(3+) nanoparticles bonded with avidin were characterized by x-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FT-IR), UV/vis absorption spectra and luminescence spectra, respectively. The biofunctionalization of the CeF(3):Tb(3+) nanoparticles has less effect on their luminescence properties, i.e. they still show strong green emission (from Tb(3+), with (5)D(4)-(7)F(5) at 543 nm as the most prominent group), indicative of the great potential for these CeF(3):Tb(3+) nanoparticles to be used as biological fluorescence probes. PMID:21730503

  19. Biofunctionalization of CeF3:Tb3+ nanoparticles

    Science.gov (United States)

    Kong, D. Y.; Wang, Z. L.; Lin, C. K.; Quan, Z. W.; Li, Y. Y.; Li, C. X.; Lin, J.

    2007-02-01

    CeF3:Tb3+ nanoparticles (short pillar-like morphology with an average length and width of 11 and 5 nm, respectively) were successfully prepared by a polyol process using diethyleneglycol (DEG) as solvent. After being functionalized with a SiO2-NH2 layer, these CeF3:Tb3+ nanoparticles can be conjugated with biotin molecules (activated by thionyl chloride) and further with avidin. The as-formed CeF3:Tb3+ nanoparticles, CeF3:Tb3+ nanoparticles functionalized with amino groups, biotin conjugated amino-functionalized CeF3:Tb3+ nanoparticles and biotinylated CeF3:Tb3+ nanoparticles bonded with avidin were characterized by x-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FT-IR), UV/vis absorption spectra and luminescence spectra, respectively. The biofunctionalization of the CeF3:Tb3+ nanoparticles has less effect on their luminescence properties, i.e. they still show strong green emission (from Tb3+, with 5D4-7F5 at 543 nm as the most prominent group), indicative of the great potential for these CeF3:Tb3+ nanoparticles to be used as biological fluorescence probes.

  20. Photodynamic Processes in Fluoride Crystals Doped with Ce3+

    Directory of Open Access Journals (Sweden)

    Pavlov V.V.

    2015-01-01

    Full Text Available Integrated studies of photoelectric phenomena and their associated photodynamic processes in LiCaAlF6, LiLuF4, LiYF4, LiY0,5Lu0,5F4, SrAlF5 crystals doped with Ce3+ ions have been carried out using the combination of the methods of optical and dielectric spectroscopy. The numerical values of the basic parameters of photodynamic processes and their spectral dependence in 240 – 310 nm spectral range are evaluated. It has been shown that the most probable process, which leads to the photoionization of Ce3+ ions in LiYxLu1-xF4:Ce3+ (x=0; 0,5; 1 and LiCaAlF6:Ce3+ crystals, is excited-state absorption to the states of mixed configurations of Ce3+ ions localized near/in the conduction band of crystal.

  1. CE APPROVAL IN ELECTRICAL HOUSEHOLD APPLIANCES AND A CASE STUDY

    Directory of Open Access Journals (Sweden)

    Nazmi EKREN

    2009-01-01

    Full Text Available Due to the reason for rapidly developing technology, increasing competition medium, and awareness of the consumers, nowadays, the exigency of production with good quality has gained more and more significance. Certification of the quality and safety of the products to the consumers is compulsory in terms of producers. There are some documents to certify safety of the products. One of them is CE certificate. In this paper, basic information about CE mark is given and CE standards and tests required for electrical household appliances are mentioned. As an application, one of an electrical household appliance, toaster grill is treated and examined. To obtain CE certificate for toaster grill, required tests are made according to EN60335-2-9 and CE certificate is obtained.

  2. Multimedia Experience on Web-Connected CE Devices

    Science.gov (United States)

    Tretter, Dan; Liu, Jerry; Zhang, Xuemei; Gao, Yuli; Atkins, Brian; Chao, Hui; Xiao, Jun; Wu, Peng; Lin, Qian

    Consumer electronics (CE) are changing from stand-alone single-function devices to products with increasing connectivity, convergence of functionality, and a focus on customer experience. We discuss the features that characterize the new generation of CE and illustrate this new paradigm through an examination of how web services can be integrated with CE products to deliver an improved user experience. In particular, we focus on one aspect of the CE segment, digital photography. We introduce AutoPhotobook, an automatic photobook creation service and provide a detailed look at how it addresses the complexity of photobook authoring through a portfolio of automatic photo analysis and composition technologies. We then show how this collection of technologies is integrated into a larger ecosystem with other web services and web-connected CE devices to deliver an enhanced user experience.

  3. First-Principles Phase Diagram for Ce-Th System

    Energy Technology Data Exchange (ETDEWEB)

    Landa, A; Soderlind, P; Ruban, A; Vitos, L; Pourovskii, L

    2004-05-11

    Ab initio total energy calculations based on the exact muffin-tin orbitals (EMTO) theory are used to determine the high pressure and low temperature phase diagram of Ce and Th metals as well as the Ce{sub 43}Th{sub 57} disordered alloy. The compositional disorder for the alloy is treated in the framework of the coherent potential approximation (CPA). Equation of state for Ce, Th and Ce{sub 43}Th{sub 57} has been calculated up to 1 Mbar in good comparison with experimental data: upon compression the Ce-Th system undergoes crystallographic phase transformation from an fcc to a bct structure and the transition pressure increases with Th content in the alloy.

  4. Epitaxial Ce and the magnetism of single-crystal Ce/Nd superlattices

    OpenAIRE

    Clegg, P. S.; Goff, J.P.; McIntyre, G. J.; Ward, R.C.C.; Wells, M. R .

    2003-01-01

    The chemical structure of epitaxial gamma cerium and the chemical and magnetic structures of cerium/neodymium superlattices have been studied using x-ray and neutron diffraction techniques. The samples were grown using molecular-beam epitaxy, optimized to yield the desired Ce allotropes. The x-ray measurements show that, in the superlattices, both constituents adopt the dhcp structure and that the stacking sequence remains intact down to Tsimilar to2 K; these are the first measurements of mag...

  5. Neonatal Phosphate Nutrition Alters <em>in em>Vivo> and <em>in em>Vitro> Satellite Cell Activity in Pigs

    Directory of Open Access Journals (Sweden)

    Chad H. Stahl

    2012-05-01

    Full Text Available Satellite cell activity is necessary for postnatal skeletal muscle growth. Severe phosphate (PO4 deficiency can alter satellite cell activity, however the role of neonatal PO4 nutrition on satellite cell biology remains obscure. Twenty-one piglets (1 day of age, 1.8 ± 0.2 kg BW were pair-fed liquid diets that were either PO4 adequate (0.9% total P, supra-adequate (1.2% total P in PO4 requirement or deficient (0.7% total P in PO4 content for 12 days. Body weight was recorded daily and blood samples collected every 6 days. At day 12, pigs were orally dosed with BrdU and 12 h later, satellite cells were isolated. Satellite cells were also cultured <em>in vitroem> for 7 days to determine if PO4 nutrition alters their ability to proceed through their myogenic lineage. Dietary PO4 deficiency resulted in reduced (<em>P> < 0.05 sera PO4 and parathyroid hormone (PTH concentrations, while supra-adequate dietary PO4 improved (<em>P> < 0.05 feed conversion efficiency as compared to the PO4 adequate group. <em>In vivoem> satellite cell proliferation was reduced (<em>P> < 0.05 among the PO4 deficient pigs, and these cells had altered <em>in vitroem> expression of markers of myogenic progression. Further work to better understand early nutritional programming of satellite cells and the potential benefits of emphasizing early PO4 nutrition for future lean growth potential is warranted.

  6. Enthalpies of mixing in binary Fe-Sb, Ce-Fe and ternary Ce-Fe-Sb liquid alloys

    Energy Technology Data Exchange (ETDEWEB)

    Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry; Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science

    2016-01-15

    The enthalpies of mixing in liquid alloys in the binary Fe-Sb, Ce-Fe and ternary Ce-Fe-Sb systems were determined over a wide range of composition by means of isoperibolic calorimetry in the temperature range 1600-1830 K. The minimum values of the integral enthalpy of mixing (ΔH{sub min}) were determined to be (-2.32 ± 0.22) kJ . mol{sup -1} at x{sub Sb} = 0.5 in the Fe-Sb system, and (-0.97 ± 0.19) kJ . mol{sup -1} at x{sub Ce} = 0.35 in the Ce-Fe system. The enthalpies of mixing in liquid ternary Ce-Fe-Sb alloys were found to increase smoothly from the binary boundary systems Ce-Fe and Fe-Sb towards the Ce-Sb system, reaching the minimum value of (-107.5 ± 3.6) kJ . mol{sup -1} in the vicinity of the phase CeSb.

  7. Ce4+/Ce3+-V2+/V3+氧化还原流动电池的可行性研究(Ⅱ)--旋转圆盘(RDE)与旋转环盘(RRDE)法对Ce4+/Ce3+氧化还原体系的研究%Studies on Feasibility of Ce4+/Ce3+ - V2+/V3+ Redox Flow Cell ( Ⅱ ) --Investigation of Ce4 +/Ce3 + Redox System by RDE and RRDE

    Institute of Scientific and Technical Information of China (English)

    夏熙; 刘洋; 刘洪涛

    2001-01-01

    用RDE与REDE法研究了Ce4+/Ce3+-V2+/V3+氧化还原流动电池中Ce4+/Ce3+体系的电化学动力学参数,以说明组成该新型氧化还原流动电池的可能性.用RDE法得出在铂电极表面与玻碳电极上均会生成一层氧化膜,对Ce3+的氧化反应产生阻碍作用.但在铂上的氧化膜对Ce4+的还原反应却有催化作用.用Rrde法得出Ce3+在玻碳电极上的氧化与析氧之间存在着竞争,为得到较高的Ce3+氧化效率,应控制氧化电流在2~8 mA@cm-2之间.

  8. The mixed-valence state of Ce in the hexagonal CeNi sub 4 B compound

    CERN Document Server

    Tolinski, T; Pugaczowa-Michalska, M; Chelkowska, G

    2003-01-01

    Measurements of the magnetic susceptibility chi, x-ray photoemission spectra (XPS), electrical resistivity rho and electronic structure calculations for CeNi sub 4 B are reported. In the paramagnetic region, CeNi sub 4 B follows the Curie-Weiss law with mu sub e sub f sub f = 0.52 mu sub B /fu and theta -10.7 K. The effective magnetic moment is lower than the free Ce sup 3 sup + -ion value. The Ce(3d) XPS spectra have confirmed the mixed-valence state of Ce ions in CeNi sub 4 B. The f occupancy, n sub f , and the coupling DELTA between the f level and the conduction states were derived to be about 0.83 and 85 meV, respectively. Both susceptibility data and XPS spectra show that Ce ions in CeNi sub 4 B are in the intermediate-valence state. At low temperatures (below 12 K), the magnetic contribution to the electrical resistivity reveals a logarithmic slope characteristic of Kondo-like systems.

  9. Constituents from <em>Vigna em>vexillata> and Their Anti-Inflammatory Activity

    Directory of Open Access Journals (Sweden)

    Guo-Feng Chen

    2012-08-01

    Full Text Available The seeds of <em>Vigna em>genus are important food resources and there have already been many reports regarding their bioactivities. In our preliminary bioassay, the chloroform layer of methanol extracts of<em> V. vexillata em>demonstrated significant anti-inflammatory bioactivity. Therefore, the present research is aimed to purify and identify the anti-inflammatory principles of <em>V. vexillataem>. One new sterol (1 and two new isoflavones (2,3 were reported from the natural sources for the first time and their chemical structures were determined by the spectroscopic and mass spectrometric analyses. In addition, 37 known compounds were identified by comparison of their physical and spectroscopic data with those reported in the literature. Among the isolates, daidzein (23, abscisic acid (25, and quercetin (40 displayed the most significant inhibition of superoxide anion generation and elastase release.

  10. The formation of intermetallic compounds during interdiffusion of Mg–Al/Mg–Ce diffusion couples

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Jiahong [College of Materials Science and Engineering, National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Jiang, Bin, E-mail: jiangbinrong@cqu.edu.cn [College of Materials Science and Engineering, National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Chongqing Academy of Science and Technology, Chongqing 401123 (China); Li, Xin [College of Materials Science and Engineering, National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Yang, Qingshan [College of Materials Science and Engineering, National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Chongqing Academy of Science and Technology, Chongqing 401123 (China); Dong, Hanwu [Chongqing Academy of Science and Technology, Chongqing 401123 (China); Xia, Xiangsheng [No. 59 Institute of China Ordnance Industry, Chongqing 400039 (China); Pan, Fusheng [College of Materials Science and Engineering, National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Chongqing Academy of Science and Technology, Chongqing 401123 (China)

    2015-01-15

    Graphical abstract: Al–Ce intermetallic compounds (IMCs) formed in Mg–Al/Mg–Ce diffusion couples. During the whole diffusion process, Al was the dominant diffusing species, and it substituted for Mg atoms of the Mg–Ce substrate. Five Al–Ce IMCs of Al{sub 4}Ce, Al{sub 11}Ce{sub 3}, Al{sub 3}Ce, Al{sub 2}Ce, and AlCe were formed via the reaction of Al and Ce. - Highlights: • Al–Ce IMCs formation in the Mg–Al/Mg–Ce diffusion couples was studied. • Formation of Al{sub 4}Ce as the first phase was rationalized using the Gibbs free energy. • The activation energy for the growth of the diffusion reaction zones was 36.6 kJ/mol. - Abstract: The formation of Al–Ce intermetallic compounds (IMCs) during interdiffusion of Mg–Al/Mg–Ce diffusion couples prepared by solid–liquid contact method was investigated at 623 K, 648 K and 673 K for 24 h, 48 h and 72 h, respectively. During the whole diffusion process, Al was the dominant diffusing species, and it substituted for Mg of the Mg–Ce substrate. Five Al–Ce IMCs of Al{sub 4}Ce, Al{sub 11}Ce{sub 3}, Al{sub 3}Ce, Al{sub 2}Ce and AlCe were formed via the reaction of Al and Ce. The formation of Al{sub 4}Ce as the first kind of IMC was rationalized on the basis of an effective Gibbs free energy model. The activation energy for the growth of the total diffusion reaction layer was 36.6 kJ/mol.

  11. Groundwater fluctuations and footslope ferricrete soils in the humid tropical zone of southern Cameroon

    Science.gov (United States)

    Temgoua, Emile; Djeuda Tchapnga, Henri-Bosko; Tanawa, Emile; Guenat, Claire; Pfeifer, Hans-Rudolf

    2005-10-01

    This paper discusses the relationship between the differentiation of ferruginous accumulations and the variable water saturation of footslope soil patterns. An analysis of the slope morphology of a typical hill in the forest zone of southern Cameroon and a seasonal survey of the levels of groundwaters, springs and rivers were considered in relation to the petrology of different soil patterns. The study site is a tabular hillock whose slopes present a progressive development from steep to gentle slopes. The variable residence time of water within the soil, creating an alternation of reducing and oxidizing conditions, affects soil chemistry, structure and lateral extension of the soil patterns. The ferruginous soil patterns, being formed on the footslopes, gradually increase in extent with decreasing slope angle and the relative rise of the groundwater level. The steep footslopes, where groundwater has a shorter residence time, show a soft mottled clay pattern, restricted to the bottom part of the slope. The moderate footslopes exhibit a deep permanent and a temporary perched groundwater table. The latter, with its regular capillary fringe, contributes to more reducing conditions within isolated domains in the soil patterns, and thus to the alternation with oxidizing conditions, generating a continuous hard soil pattern (massive carapace). The more gently dipping footslopes exhibit groundwater levels near the surface and also a significant amplitude of groundwater fluctuation. Iron, previously accumulated in moderate footslope patterns, is reduced, remobilized, and leached. The soil patterns formed develop into a variegated carapace, more extended along the slope, containing less iron, but nevertheless more hardened, due to the important fluctuations of the groundwater table. These patterns are limited to the zone of groundwater fluctuation and deteriorate as the water fluctuation zone recedes.

  12. The Antimicrobial Efficacy of <em>Elaeis guineensisem>: Characterization, <em>in Vitroem> and <em>in Vivoem> Studies

    Directory of Open Access Journals (Sweden)

    Sreenivasan Sasidharan

    2012-04-01

    Full Text Available The urgent need to treat multi-drug resistant pathogenic microorganisms in chronically infected patients has given rise to the development of new antimicrobials from natural resources. We have tested <em>Elaeis guineensis em>Jacq> em>(Arecaceae methanol extract against a variety of bacterial, fungal and yeast strains associated with infections. Our studies have demonstrated that <em>E. guineensisem> exhibits excellent antimicrobial activity <em>in vitroem> and <em>in vivoem> against the bacterial and fungal strains tested. A marked inhibitory effect of the <em>E. guineensisem> extracts was observed against <em>C. albicansem> whereby <em>E. guineensisem> extract at ½, 1, or 2 times the MIC significantly inhibited <em>C. albicansem> growth with a noticeable drop in optical density (OD of the bacterial culture. This finding confirmed the anticandidal activity of the extract on <em>C. albicansem>. Imaging using scanning (SEM and transmission (TEM electron microscopy was done to determine the major alterations in the microstructure of the extract-treated <em>C. albicansem>. The main abnormalities noted via SEM and TEM studies were the alteration in morphology of the yeast cells. <em>In vivoem> antimicrobial activity was studies in mice that had been inoculated with <em>C. albicansem> and exhibited good anticandidal activity. The authors conclude that the extract may be used as a candidate for the development of anticandidal agent.<em> em>

  13. Ce4+/Ce3+缓冲溶液流动注射电势检测法测定维生素C%Determining Vitamin C with Flow Injection Potentiometry in Ce4+/Ce3+ Redox Buffer

    Institute of Scientific and Technical Information of China (English)

    孔祥伟

    2003-01-01

    Ce4+/Ce3+氧化还原体系作缓冲溶液,用流动注射电势检测法测定了维生素C,将样品注射于以0.1mol/L K2SO4作支持电解质的Ce4+/Ce3+缓冲溶液试剂流, 以流通型氧化还原电势检测电极检测维生素C与Ce4+反应引起的氧化还原电对的电势变化,对3.0×10-4mol/L Ce4+/3.0×10-4mol/L Ce3+缓冲溶液,测定维生素C的线性范围为1.0×10-4~6.0×10-4mol/L,检出限为1.3×10-5mol/L,相对标准偏差为0.36%(n=4),分析频率为120次/小时.

  14. Low-temperature NMR studies of Ce-Al compounds

    Energy Technology Data Exchange (ETDEWEB)

    Gavilano, J.L. (Laboratorium fuer Festkoerperphysik, ETH-Hoenggerberg, CH-8093 Zuerich (Switzerland)); Hunziker, J. (Laboratorium fuer Festkoerperphysik, ETH-Hoenggerberg, CH-8093 Zuerich (Switzerland)); Vonlanthen, P. (Laboratorium fuer Festkoerperphysik, ETH-Hoenggerberg, CH-8093 Zuerich (Switzerland)); Ott, H.R. (Laboratorium fuer Festkoerperphysik, ETH-Hoenggerberg, CH-8093 Zuerich (Switzerland))

    1994-04-01

    Ce-Al compounds display a variety of unconventional magnetic properties at low temperatures. This is particularly well demonstrated by the results of our low-frequency NMR studies on CeAl[sub 2], CeAl[sub 3] and Ce[sub 3]Al[sub 11]. Although CeAl[sub 2] orders antiferromagnetically below 3.4 K, the temperature dependence of the spin-lattice relaxation rate follows a Korringa law below 1 K. For CeAl[sub 3], we observe an increase of the line width below 0.9 K, but no indication of a phase transition is discernible from the temperature dependence of the spin-lattice relaxation rate. Ce[sub 3]Al[sub 11] is ferromagnetic below 6.2 K, but develops an antiferromagnetic and modulated structure below 3.3 K. A field of the order of 3 kG, however, appears to stabilize the ferromagnetic phase. Our spectroscopic data are important in view of some of the unusual thermal properties of these materials. ((orig.))

  15. On the luminescence properties of CaSO4:Ce.

    Science.gov (United States)

    Lapraz, D; Prevost, H; Iacconi, P; Guigues, C; Benabdesselam, M; Briand, D

    2002-01-01

    The luminescent properties of cerium doped calcium sulphate are studied: fluorescence and excitation spectra, optical absorption and thermoluminescence (TSL). It is known that, in rare earth doped CaSO4, only cerium induces a strong 400 degrees C TSL peak. In CaSO4:0.2%Ce samples synthesised under oxidising conditions, the recovery step of Ce3+ fluorescence is correlated with the 400 degrees C TSL peak readout, as mentioned by Nair er al. Our results indicate that an oxidation of Ce3+ ion does occur under X-irradiation (Ce3+ --> Ce4+), followed by a complete return to the trivalent state after thermal annealing at about 500 degrees C; our results confirm the hypothesis of Nair et al that Ce3+ ions are oxidised by ionising irradiation. So, a pure redox reaction seems the most probable for the 400 degrees C TSL peak of CaSO4:Ce. Moreover, the use of the 400 degrees C TSL peak for high temperature dosimetry applications is discussed.

  16. Evaluation of Pseudopteroxazole and Pseudopterosin Derivatives against <em>Mycobacterium> <em>tuberculosis> and Other Pathogens

    Directory of Open Access Journals (Sweden)

    Malcolm W. B. McCulloch

    2012-08-01

    Full Text Available Pseudopterosins and pseudopteroxazole are intriguing marine natural products that possess notable antimicrobial activity with a commensurate lack of cytotoxicity. New semi-synthetic pseudopteroxazoles, pseudopteroquinoxalines and pseudopterosin congeners along with simple synthetic mimics of the terpene skeleton were synthesized. In order to build structure-activity relationships, a set of 29 new and previously reported compounds was assessed for <em>in> <em>vitro> antimicrobial and cytotoxic activities. A number of congeners exhibited antimicrobial activity against a range of Gram-positive bacteria including <em>Mycobacterium> <em>tuberculosis> H37Rv, with four displaying notable antitubercular activity against both replicating and non-replicating persistent forms of <em>M.> <em>tuberculosis>. One new semi-synthetic compound, 21-((1<em>H>-imidazol-5-ylmethyl-pseudopteroxazole (7a, was more potent than the natural products pseudopterosin and pseudopteroxazole and exhibited equipotent activity against both replicating and non-replicating persistent forms of <em>M.> <em>tuberculosis> with a near absence of <em>in> <em>vitro> cytotoxicity. Pseudopteroxazole also exhibited activity against strains of <em>M.> <em>tuberculosis> H37Rv resistant to six clinically used antibiotics.

  17. CE-merkityn murskeen tuottaminen rakennusurakan sivutuottena - kannattavuusselvitys

    OpenAIRE

    Komulainen, Ville

    2014-01-01

    Työssä tutkittiin murskatun kiviaineksen CE-merkintäperusteita sekä mitä tuotannollisia sekä laadullisia vaatimuksia kiviainestuotannolle CE-merkintä edellyttää. Lisäksi tutkittiin, onko mahdollista saada CE-merkityn kiviaineksen tuotanto ISO 9001 -standardin sisältävän laadunhallintajärjestelmän alle ja voiko tuotanto olla osa kyseistä laadunhallintajärjestelmää. Työ tehdään Graniittirakennus Kallio Oy:lle. Tuotannon kannattavuusselvityksen osalta tutkittiin eri tuotantomalleja, mikä on ...

  18. Properties and practical application of thin CeOx films

    Directory of Open Access Journals (Sweden)

    Maksimchuk N. V.

    2010-10-01

    Full Text Available The properties of CeOx films produced by various methods have been investigated. According to the comparative analisys “metallic mirror oxidation” method allows to produce films with significantly better characteristics than the «explosive evaporation» method. Though the latter method yields higher photosensitivity of CeOx films and structures on their base. In the process the optimal value of the substrate temperature was determined. Obtained data expand the CeOx application potential in microelectronic sensor sphere.

  19. Non-Fermi Liquid Scaling in CeRhSn

    International Nuclear Information System (INIS)

    We have recently shown that CeRhSn exhibits non-Fermi liquid temperature dependences in its low-temperature physical properties. Here we suggest that the non-Fermi liquid behavior observed in CeRhSn may be due to the existence of a Griffiths phase in the vicinity of a quantum critical point, based on electrical resistivity, magnetic susceptibility , and specific heat measurements. For CeRhSn, the low-temperature scaling of bulk properties (C/T ∝ χ ∝ T-1+λ, where λ<1) is masked by an anomaly at about 6 K, which is of magnetic origin. (author)

  20. Relativeca Dopplera efekto ^ce unuforme akcelata movo -- II

    CERN Document Server

    Paiva, F M

    2007-01-01

    Extending physics/0701092, a light source of monochromatic radiation, in rectilinear motion under constant proper acceleration, passes near an observer at rest. In the context of special relativity, we describe the observed Doppler effect. We describe also the interesting discontinuous effect when riding through occurs. An English version of this article is available. - - - - - - - - - - - \\\\ Da^urigante physics/0701092, luma fonto de unukolora radiado ^ce rekta movo ^ce konstanta propra akcelo pasas preter restanta observanto. ^Ce la special-relativeco, ni priskribas la observatan Doppleran efikon. Ni anka^u priskribas la interesan nekontinuan efikon se trapaso okazas.

  1. Efficient Heterologous Transformation of <em>Chlamydomonas> reinhardtiiem> <em>npq2em> Mutant with the Zeaxanthin Epoxidase Gene Isolated and Characterized from<em> Chlorella zofingiensisem>

    Directory of Open Access Journals (Sweden)

    Herminia Rodríguez

    2012-09-01

    Full Text Available In the violaxanthin cycle, the violaxanthin de-epoxidase and zeaxanthin epoxidase catalyze the inter-conversion between violaxanthin and zeaxanthin in both plants and green algae. The zeaxanthin epoxidase gene from the green microalga <em>Chlorella zofingiensisem> (<em>Czzep> has been isolated<em>. em>This gene encodes a polypeptide of 596 amino acids. A single copy of <em>Czzep> has been found in the <em>C. zofingiensisem> genome by Southern blot analysis. qPCR analysis has shown that transcript levels of <em>Czzep> were increased after zeaxanthin formation under high light conditions. The functionality of <em>Czzep> gene by heterologous genetic complementation in the <em>Chlamydomonas> mutant <em>npq2em>, which lacks zeaxanthin epoxidase (ZEP activity and accumulates zeaxanthin in all conditions, was analyzed. The <em>Czzep> gene was adequately inserted in the pSI105 vector and expressed in <em>npq2em>. The positive transformants were able to efficiently convert zeaxanthin into violaxanthin, as well as to restore their maximum quantum efficiency of the PSII (Fv/Fm. These results show that <em>Chlamydomonas> can be an efficient tool for heterologous expression and metabolic engineering for biotechnological applications.

  2. HumanViCe: Host ceRNA network in virus infected cells in human

    Directory of Open Access Journals (Sweden)

    Suman eGhosal

    2014-07-01

    Full Text Available Host-virus interaction via host cellular components has been an important field of research in recent times. RNA interference mediated by short interfering RNAs and microRNAs (miRNA, is a widespread anti-viral defence strategy. Importantly, viruses also encode their own miRNAs. In recent times miRNAs were identified as key players in host-virus interaction. Furthermore, viruses were shown to exploit the host miRNA networks to suite their own need. The complex cross-talk between host and viral miRNAs and their cellular and viral targets forms the environment for viral pathogenesis. Apart from protein-coding mRNAs, non-coding RNAs may also be targeted by host or viral miRNAs in virus infected cells, and viruses can exploit the host miRNA mediated gene regulatory network via the competing endogenous RNA effect. A recent report showed that viral U-rich non-coding RNAs called HSUR, expressed in primate virus herpesvirus saimiri (HVS infected T cells, were able to bind to three host miRNAs, causing significant alteration in cellular level for one of the miRNAs. We have predicted protein coding and non protein-coding targets for viral and human miRNAs in virus infected cells. We identified viral miRNA targets within host non-coding RNA loci from AGO interacting regions in three different virus infected cells. Gene ontology (GO and pathway enrichment analysis of the genes comprising the ceRNA networks in the virus infected cells revealed enrichment of key cellular signalling pathways related to cell fate decisions and gene transcription, like Notch and Wnt signalling pathways, as well as pathways related to viral entry, replication and virulence. We identified a vast number of non-coding transcripts playing as potential ceRNAs to the immune response associated genes; e.g. APOBEC family genes, in some virus infected cells. All these information are compiled in HumanViCe, a comprehensive database that provides the potential ceRNA networks in virus

  3. Dermatoses em renais cronicos em terapia dialitica

    Directory of Open Access Journals (Sweden)

    Luis Alberto Batista Peres

    2014-03-01

    Full Text Available Objetivo: As desordens cutâneas e das mucosas são comuns em pacientes em hemodiálise a longo prazo. A diálise prolonga a expectativa de vida, dando tempo para a manifestação destas anormalidades. Os objetivos deste estudo foram avaliar a prevalência de problemas dermatológicos em pacientes com doença renal crônica (DRC em hemodiálise. Métodos: Cento e quarenta e cinco pacientes com doença renal crônica em hemodiálise foram estudados. Todos os pacientes foram completamente analisados para as alterações cutâneas, de cabelos, mucosas e unhas por um único examinador e foram coletados dados de exames laboratoriais. Os dados foram armazenados em um banco de dados do Microsolft Excel e analisados por estatística descritiva. As variáveis contínuas foram comparadas pelo teste t de Student e as variáveis categóricas utilizando o teste do qui-quadrado ou o teste Exato de Fischer, conforme adequado. Resultados: O estudo incluiu 145 pacientes, com idade média de 53,6 ± 14,7 anos, predominantemente do sexo masculino (64,1% e caucasianos (90,0%. O tempo médio de diálise foi de 43,3 ± 42,3 meses. As principais doenças subjacentes foram: hipertensão arterial em 33,8%, diabetes mellitus em 29,6% e glomerulonefrite crônica em 13,1%. As principais manifestações dermatológicas observadas foram: xerose em 109 (75,2%, equimose em 87 (60,0%, prurido em 78 (53,8% e lentigo em 33 (22,8% pacientes. Conclusão: O nosso estudo mostrou a presença de mais do que uma dermatose por paciente. As alterações cutâneas são frequentes em pacientes em diálise. Mais estudos são necessários para melhor caracterização e manejo destas dermatoses.

  4. Highly Enhanced Concentration and Stability of Reactive Ce^3+ on Doped CeO_2 Surface Revealed In Operando

    OpenAIRE

    Chueh, William C.; McDaniel, Anthony H.; Grass, Michael E.; Hao, Yong; Jabeen, Naila; Liu, Zhi; Haile, Sossina M.; McCarty, Kevin F.; Bluhm, Hendrik; El Gabaly, Farid

    2012-01-01

    Trivalent cerium ions in CeO_2 are the key active species in a wide range of catalytic and electro-catalytic reactions. We employed ambient pressure X-ray photoelectron spectroscopy and electrochemical impedance spectroscopy to quantify simultaneously the concentration of the reactive Ce^3+ species on the surface and in the bulk of Sm-doped CeO_2(100) in hundreds of millitorr of H2–H2O gas mixtures. Under relatively oxidizing conditions, when the bulk cerium is almost entirely in the 4+ oxida...

  5. Optical properties of CeNi{sub 5} and CeNi{sub 4}M (M = Al, Cu) compounds

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, Yu. V., E-mail: knyazev@imp.uran.ru [Institute of Metal Physics, Ural Division, RAS, 18 Kovalevskaya St., 620990 Ekaterinburg (Russian Federation); Kuz' min, Yu. I.; Kuchin, A.G. [Institute of Metal Physics, Ural Division, RAS, 18 Kovalevskaya St., 620990 Ekaterinburg (Russian Federation)

    2011-01-21

    The experimental study of the optical properties of CeNi{sub 5}, CeNi{sub 4}Cu and CeNi{sub 4}Al compounds was carried out in the 0.083-5.64 eV energy range using the ellipsometry method. The optical constants, dielectric functions and electronic parameters (plasma and relaxation frequencies) were determined. The energy dependencies of the optical interband conductivities are discussed by using the available information on the electronic band structure of these compounds. In the ternary alloys the optical spectra show the presence of peculiarities related to effect of Cu or Al substitution at Ni sites.

  6. Optical properties of CeNi5 and CeNi4M (M = Al, Cu) compounds

    International Nuclear Information System (INIS)

    The experimental study of the optical properties of CeNi5, CeNi4Cu and CeNi4Al compounds was carried out in the 0.083-5.64 eV energy range using the ellipsometry method. The optical constants, dielectric functions and electronic parameters (plasma and relaxation frequencies) were determined. The energy dependencies of the optical interband conductivities are discussed by using the available information on the electronic band structure of these compounds. In the ternary alloys the optical spectra show the presence of peculiarities related to effect of Cu or Al substitution at Ni sites.

  7. Bioassay-Guided Isolation and Identification of Cytotoxic Compounds from <em>Gymnosperma> <em>glutinosum> Leaves

    Directory of Open Access Journals (Sweden)

    Cristina Rodríguez-Padilla

    2012-09-01

    Full Text Available Bioassay-guided fractionation of hexane extracts of<em> Gymnosperma glutinosumem> (Asteraceae leaves, collected in North Mexico, afforded the known compounds hentriacontane (1 and (+-13<em>S>,14<em>R>,15-trihydroxy-<em>ent>-labd-7-ene (2, as well as the new <em>ent>-labdane diterpene (−-13<em>S>,14<em>R>,15-trihydroxy-7-oxo-<em>ent>-labd-8(9-ene (3. In addition, D-glycero-D-galactoheptitol (4 was isolated from the methanolic extract of this plant. Their structures were established on the basis of high-field 1D- and 2D NMR methods supported by HR-MS data. The cytotoxic activity was determined by using the <em>in vitroem> L5178Y-R lymphoma murine model. Hentriacontane (1 and the new <em>ent>-labdane 3 showed weak cytotoxicity, whereas the <em>ent>-labdane 2 showed significant (<em>p> < 0.05 and concentration dependent cytotoxicity (up to 78% against L5178Y-R cells at concentrations ranging from 7.8 to 250 µg/mL.

  8. Thermoelectric Properties of Nanostructured CeAl3

    Science.gov (United States)

    Pokharel, Mani; Dahal, Tulashi; Ren, Zhifeng; Opeil, Cyril; Opeil Group Team; Ren Group Team

    2014-03-01

    Past investigations into the heavy fermion compound CeAl3 reveal a complex low-temperature physics resulting from the strong hybridization of localized 4f states with delocalized conduction electrons. This phenomenon gives rise to unusual electronic, thermal, and magnetic properties. We investigate the low-temperature thermoelectric properties of this strongly correlated system for its potential application as a p-type Peltier cooling element. In our work, nanostructured samples of CeAl3 have been prepared using dc hot-press method and evaluated for their thermoelectric properties. Effects of different hot-pressing temperatures on the nanostructure and the thermoelectric properties will be discussed. Our results on CeAl3 will be compared with our previous work on CeCu6. Funding for this work was provided by the DOD, USAF-OSR, MURI Program under Contract FA9550-10-1-0533.

  9. Three-Dimensional Structure of CeO2 Nanocrystals

    DEFF Research Database (Denmark)

    Tan, Joyce Pei Ying; Tan, Hui Ru; Boothroyd, Chris;

    2011-01-01

    Visualization of three-dimensional (3D) structures of materials at the nanometer scale can shed important information on the performance of their applications and provide insight into the growth mechanism of shape-controlled nanomaterials. In this paper, the 3D structures and growth pathway of CeO2...... samples synthesized under different conditions. The homogeneous growth environment in solution with polyvinylpyrrolidone (PVP) molecules led to the formation of regular octahedral CeO2 nanocrystals with small {001} facet truncations. When the PVP surfactant was removed, the aggregation of regular...... truncated octahedral CeO2 particles through a lattice matched interface generated irregular compressed truncated octahedral CeO2 nanoparticles. The formation of this irregular shape is attributed to the lower surface diffusion and slow incorporation of atoms on surfaces by step attachment of the fused...

  10. Cerocene Revisited: The Electronic Structure of and Interconversion Between Ce2(C8H8)3 and Ce(C8H8)2

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Marc D.; Booth, Corwin H.; Lukens, Wayne W.; Andersen, Richard A.

    2009-02-02

    New synthetic procedures for the preparation of Ce(cot)2, cerocene, from [Li(thf)4][Ce(cot)2], and Ce2(cot)3 in high yield and purity are reported. Heating solid Ce(cot)2 yields Ce2(cot)3 and COT while heating Ce2(cot)3 with an excess of COT in C6D6 to 65oC over four months yields Ce(cot)2. The solid state magnetic susceptibility of these three organocerium compounds shows that Ce(cot)2 behaves as a TIP (temperature independent paramagnet) over the temperature range of 5-300 K, while that of Ce2(cot)3 shows that the spin carriers are antiferromagnetically coupled below 10 K; above 10 K, the individual spins are uncorrelated, and [Ce(cot)2]- behaves as an isolated f1 paramagnet. The EPR at 1.5K for Ce2(cot)3 and [Ce(cot)2]- have ground state of MJ= +- 1/2. The LIII edge XANES of Ce(cot)2 (Booth, C.H.; Walter, M.D.; Daniel, M.; Lukens, W.W., Andersen, R.A., Phys. Rev. Lett. 2005, 95, 267202) and 2Ce2(cot)3 over 30-500 K are reported; the Ce(cot)2 XANES spectra show Ce(III) and Ce(IV) signatures up to a temperature of approximately 500 K, whereupon the Ce(IV) signature disappears, consistent with the thermal behavior observed in the melting experiment. The EXAFS of Ce(cot)2 and Ce2(cot)3 are reported at 30 K; the agreement between the molecular parameters for Ce(cot)2 derived from EXAFS and single crystal X-ray diffraction data are excellent. In the case of Ce2(cot)3 no X-ray diffraction data are known to exist, but the EXAFS are consistent with a"triple-decker" sandwich structure. A molecular rationalization is presented for the electronic structure of cerocene having a multiconfiguration ground state that is an admixture of the two configurations Ce(III, 4f1)(cot1.5-)2 and Ce(IV, 4f0)(cot2-)2; the multiconfigurational ground state has profound effects on the magnetic properties and on the nature of the chemical bond in cerocene and, perhaps, other molecules.

  11. Reference Gene Selection in the Desert Plant <em>Eremosparton songoricuem>m>

    OpenAIRE

    Dao-Yuan Zhang; Yuan-Ming Zhang; Wood, Andrew J.; Xiao-Shuang Li; Hong-Lan Yang

    2012-01-01

    <em>Eremosparton songoricum em>(Litv.) Vass. (<em>E. songoricumem>) is a rare and extremely drought-tolerant desert plant that holds promise as a model organism for the identification of genes associated with water deficit stress. Here, we cloned and evaluated the expression of eight candidate reference genes using quantitative real-time reverse transcriptase polymerase chain reactions. The expression of these candidate reference genes was analyzed in a diverse set...

  12. CeDeC, materiales educativos al alcance de todos

    OpenAIRE

    González, Agala

    2013-01-01

    El Centro Nacional de Desarrollo Curricular en Sistemas no Propietarios (CeDeC) tiene como finalidad el diseño, la promoción y el desarrollo de materiales educativos digitales a través de software libre. CeDeC pone a disposición de toda la comunidad educativa materiales y recursos educativos en su portal web

  13. Antimicrobial Activity of Geranium Oil against Clinical Strains<em> em>of <em>Staphylococcus aureusem>

    Directory of Open Access Journals (Sweden)

    Monika Sienkiewicz

    2012-08-01

    Full Text Available The aim of this work was to investigate the antibacterial properties of geranium oil obtained from <em>Pelargonium graveolensem> Ait. (family <em>Geraniaceae>, against one standard <em>S. aureus em>strain ATCC 433000 and seventy clinical <em>S. aureusem> strains. The agar dilution method was used for assessment of bacterial growth inhibition at various concentrations of geranium oil. Susceptibility testing of the clinical strains to antibiotics was carried out using the disk-diffusion and E-test methods. The results of our experiment showed that the oil from <em>P. graveolensem> has strong activity against all of the clinical <em>S. aureusem> isolates—including multidrug resistant strains, MRSA strains and MLSB-positive strains—exhibiting MIC values of 0.25–2.50 μL/mL.

  14. Risco de salinização das terras do baixo Acaraú (CE

    Directory of Open Access Journals (Sweden)

    Lydia Helena da Silva de Oliveira Mota

    2012-08-01

    Full Text Available Em determinadas condições de relevo, do clima e de uso, com certa frequência pode acontecer acúmulo de sais nos solos, dando lugar à formação dos solos salinos e sódicos - também denominados de solos afetados por sais. A fim de orientar as práticas de manejo e uso das terras da região do Baixo Acaraú, CE, objetivou-se com o presente trabalho gerar um mapa de risco de salinização. Para obtenção das classes de vulnerabilidade, foram avaliados os temas pedologia, geologia, geomorfologia e uso e cobertura das terras e informações de declividade e altimetria, tratados em ambiente SIG com o método multicritério aditivo. Foram definidas quatro classes de risco de salinização: baixo, moderado, alto e altíssimo ou solos naturalmente salinos/sódicos. Foi constatado que 35,47 % da área corresponde à classe de baixo risco de salinização; 26,22 %, à de risco moderado; 8,23 %, à de risco alto; e 19,65 %, à de risco altíssimo.

  15. International EMS Systems

    DEFF Research Database (Denmark)

    Langhelle, Audun; Lossius, Hans Morten; Silfvast, Tom;

    2004-01-01

    is the only country that has emergency medicine (EM) as a recognised speciality but there is a need for more fully trained specialists in EM; (4) Norway: the ordinary ground ambulance is pointed out as the weakest link in the EM chain and a health reform demands extensive co-operation between the new health...

  16. CeO2 nanoparticles for high performance supercapacitor electrode

    International Nuclear Information System (INIS)

    Cerium Oxide plays a vital role in rising technologies for energy-related applications. In this study, CeO2 nanoparticles have been successfully synthesized by microwave irradiation method and its capacitance performance is further investigated. Prepared nanoparticles were analysed by X-Ray Powder Diffraction (XRD), Fourier Transform Infrared Spectroscopy (FTIR) and Scanning Electron Microscopy (SEM). X-ray diffraction analysis confirms that CeO2 Nanoparticles in cubic phase and the grain size was calculated to be 15 nm using Debye-Scherrer formula. The FTIR spectrum of the CeO2 exhibits the stretching vibration of Ce-O at about 601 cm-1. The SEM analysis shows the irregular spherical morphology with some of the particles agglomerated. Electrochemical characterization of the sample was performed using a standard three electrode cell configuration. Cyclic Voltammogram (CV) and galvanostatic (GV) charge-discharge measurements demonstrated that the CeO2 electrode exhibited superior capacitive properties in 1 M Na2SO4 aqueous solution within the potential range -0.2V to 1.5V The discharge curves are linear in the total range of potential with constant slopes at a constant current of 0.9 A/g showing perfect capacitive behavior. These findings can open up new opportunities for CeO2 nanoparticles in constructing the high-performance electrochemical supercapacitors as well as other energy storage devices. (author)

  17. Spectroscopic properties of the Ce-doped borate glasses

    Science.gov (United States)

    Kindrat, I. I.; Padlyak, B. V.; Mahlik, S.; Kukliński, B.; Kulyk, Y. O.

    2016-09-01

    The EPR, optical absorption and photoluminescence (emission and excitation) spectra as well as decay kinetics of a series of the Ce-doped glasses with Li2B4O7, LiKB4O7, CaB4O7, and LiCaBO3 compositions have been investigated and analysed. The borate glasses were obtained from the corresponding polycrystalline compounds in the air atmosphere, using standard glass technology. The EPR signals of the isolated Ce3+ and pair Ce3+-Ce3+ centres, coupled by magnetic dipolar and exchange interactions were registered at liquid helium temperatures. The characteristic for glass host broad bands corresponding to the 4f → 5d transitions of the Ce3+centres have been observed in the optical absorption and photoluminescence (emission and excitation) spectra. The obtained luminescence decay curves can be satisfactory described by exponential function with lifetimes in the 19.8-26.1 ns range, which depend on the basic glass composition. The local structure of Ce3+ centres in the investigated glasses has been considered and discussed.

  18. Ca2+-Doped CeBr3 Scintillating Materials

    Energy Technology Data Exchange (ETDEWEB)

    Guss, Paul [NSTec; Foster, Michael E. [SNL; Wong, Bryan M. [SNL; Doty, F. Patrick [SNL; Shah, Kanai [RMD; Squillante, Michael R. [RMD; Shirwadkar, Urmila [RMD; Hawrami, Rastgo [RMD; Tower, Josh [RMD; Yuan, Ding [NSTec

    2014-01-01

    Despite the outstanding scintillation performance characteristics of cerium tribromide (CeBr3) and cerium-activated lanthanum tribromide, their commercial availability and application are limited due to the difficulties of growing large, crack-free single crystals from these fragile materials. This investigation employed aliovalent doping to increase crystal strength while maintaining the optical properties of the crystal. One divalent dopant (Ca2+) was used as a dopant to strengthen CeBr3 without negatively impacting scintillation performance. Ingots containing nominal concentrations of 1.9% of the Ca2+ dopant were grown. Preliminary scintillation measurements are presented for this aliovalently doped scintillator. Ca2+-doped CeBr3 exhibited little or no change in the peak fluorescence emission for 371 nm optical excitation for CeBr3. The structural, electronic, and optical properties of CeBr3 crystals were studied using the density functional theory within the generalized gradient approximation. The calculated lattice parameters are in good agreement with the experimental data. The energy band structures and density of states were obtained. The optical properties of CeBr3, including the dielectric function, were calculated.

  19. Structural and optical study of Ce segregation in Ce-doped SiO{sub 1.5} thin films

    Energy Technology Data Exchange (ETDEWEB)

    Beainy, G.; Castro, C.; Pareige, P.; Talbot, E., E-mail: etienne.talbot@univ-rouen.fr [Groupe de Physique des Matériaux, Université et INSA de Rouen, UMR CNRS 6634, Normandie Université, Avenue de l' Université, BP 12, 76801 St Etienne du Rouvray (France); Weimmerskirch-Aubatin, J.; Stoffel, M.; Vergnat, M.; Rinnert, H. [Université de Lorraine, UMR CNRS 7198, Institut Jean Lamour, BP 70239, 54506 Vandoeuvre-lès-Nancy (France)

    2015-12-21

    Cerium doped SiO{sub 1.5} thin films fabricated by evaporation and containing silicon nanocrystals were investigated by atom probe tomography. The effect of post-growth annealing treatment has been systematically studied to correlate the structural properties obtained by atom probe tomography to the optical properties measured by photoluminescence spectroscopy. The atom probe results demonstrated the formation of Ce-Si rich clusters upon annealing at 900 °C which leads to a drastic decrease of the Ce-related luminescence. At 1100 °C, pure Si nanocrystals and optically active cerium silicate compounds are formed. Consequently, the Ce-related luminescence is found to re-appear at this temperature while no Si-nanocrystal related luminescence is observed for films containing more than 3% Ce.

  20. Ce-doped nanoparticles of TiO{sub 2}: Rutile-to-brookite phase transition and evolution of Ce local-structure studied with XRD and XANES

    Energy Technology Data Exchange (ETDEWEB)

    Kityakarn, Sutasinee [Department of Chemistry, Faculty of Science, Kasetsart University, Bangkok 10903 (Thailand); Center for Advanced Studies of Tropical Natural Resources, Kasetsart University, Bangkok 10903 (Thailand); Worayingyong, Attera [Department of Chemistry, Faculty of Science, Kasetsart University, Bangkok 10903 (Thailand); Suramitr, Anwaraporn [Faculty of Science at Siracha, Kasetsart University, Siracha Campus, Chonburi 20230 (Thailand); Smith, M.F., E-mail: mfsmith@g.sut.ac.th [School of Physics, Suranaree University of Technology, Nakhon Ratchasima 30000 (Thailand); Thailand Center of Excellence in Physics (ThEP), Commission of Higher Education, Ministry of Education, Bangkok 10400 (Thailand)

    2013-05-15

    The crystal and electronic structural changes undergone by TiO{sub 2} nanoparticles when Ce is introduced were studied using X-ray diffraction (XRD) and X-ray absorption near-edge spectroscopy (XANES). A small amount of Ce (less than 1% molar concentration) resulted in i/a significant reduction of the average size of the TiO{sub 2} nanoparticles and ii/a phase transition in which brookite replaced rutile as the minority phase component (anatase was the majority phase component at all Ce concentrations studied up to 10% molar concentration). The Ce L3 edge XANES revealed changes in the local environment of Ce impurities. As Ce concentration was increased the fraction of Ce that have formal valence of +3 decreased and, for the remaining Ce with valence +4, the 4f orbitals became less-strongly hybridized with the p-orbitals of oxygen neighbors. The results have implications for photocatalytic and gas sensing properties of Ce-doped TiO{sub 2}. - Highlights: ► Ce-doping: TiO{sub 2} nanoparticles shrink and minority phase changes rutile-> brookite. ► XANES reveals phase change for arbitrarily small particles (while XRD fails). ► As Ce added: fraction of Ce{sup +3} dopants falls, hybridization of Ce{sup +4} with O weakens.

  1. Non-Stoichiometry of UO2-CeO2: The System UO2-CeO2-CeO1.5 at 900 to 1200°C

    International Nuclear Information System (INIS)

    This investigation covers the substoichiometric fluorite (UO2-CeO2) phase, that is, the behaviour of the system U1-yCe1-yO2+x. Though UO2 and CeO2 are completely miscible, and in the CeO2-CeO1-5 system the fluorite phase extends to CeO1.72 , the UO2-CeO2-CeO1.5 system is characterized by a large two-phase region, where two fluorite- type structures, one CeO2-rich, the other UO2-rich, coexist. Only in the UO2-rich corner of the ternary system is a noticeable single-phase region present. This is in contrast to the CeO2-UO2-UO267 system where a large single-phase region exists. The oxygen activity as a function of composition x was measured in U1-yCe1-yO2+x (y = 0.15 and 0.35) at 900°C, using H2/H2O and metal/metal oxide equilibria. In all cases the oxygen activity increases extremely rapidly with decreasing x; the behaviour of the system resembles that of dilute solutions of UO2+X in ThO2. Both systems can be explained by assuming defect complexes: a vacancy bound to two Ce3+, an interstitial oxygen bound to two U5+. (author)

  2. The CE3R Network: current status and future perspectives

    Science.gov (United States)

    Lenhardt, Wolfgang; Pesaresi, Damiano; Živčić, Mladen; Costa, Giovanni; Kuk, Kresimir; Bondár, István; Duni, Llambro; Spacek, Petr

    2016-04-01

    In order to improve the monitoring of seismic activities in the border regions and to enhance the collaboration between countries and seismological institutions in Central Europe, the Environment Agency of the Slovenian Republic (ARSO), the Italian National Institute for Oceanography and Experimental Geophysics (OGS), the University of Trieste (UniTS) and the Austrian Central Institute for Meteorology and Geodynamics (ZAMG) established in 2001 the "South Eastern Alps Transfrontier Seismological Network". In May 2014 ARSO, OGS, UniTS and ZAMG agreed to formalize the transfrontier network, to name it "Central and East European Earthquake Research Network", (CE3RN or CE3R Network) in order to locate it geographically since cross-border networks can be established in other areas of the world and to expand their cooperation, including institutions in other countries. The University of Zagreb (UniZG) joined CE3RN in October 2014. The Kövesligethy Radó Seismological Observatory (KRSZO) of the Hungarian Academy of Sciences joined CE3RN in October 2015. The Institute of Geosciences, Energy, Water and Environment (IGEWE) of the Polytechnic University of Tirana joined CE3RN in November 2015. The Institute of Physics of the Earth (IPE) of the Masaryk University in Brno joined CE3RN in November 2015. CE3RN Parties intend to formalize and possibly extend their ongoing cooperation in the field of seismological data acquisition, exchange and use for seismological and earthquake engineering and civil protection purposes. The purpose of this cooperation is to retain and expand the existing cross-border network, specify the rules of conduct in the network management, improvements, extensions and enlargements, enhance seismological research in the region, and support civil protection activities. Since the formal establishment of CE3RN, several common projects have been completed, like the SeismoSAT project for the seismic data center connection over satellite funded by the Interreg

  3. Electroless ternary NiCeP coatings: Preparation and characterisation

    Energy Technology Data Exchange (ETDEWEB)

    Balaraju, J.N., E-mail: jnbalraj@nal.res.in [Surface Engineering Division, CSIR National Aerospace Laboratories, Post Bag No. 1779 Bangalore 560017, Karnataka (India); Chembath, Manju [Surface Engineering Division, CSIR National Aerospace Laboratories, Post Bag No. 1779 Bangalore 560017, Karnataka (India)

    2012-10-01

    Highlights: Black-Right-Pointing-Pointer Rare earth element (Ce) has been successfully codeposited in NiP matrix. Black-Right-Pointing-Pointer Surface analysis carried out by XPS showed that the Ce is present in +3 and +4 oxidation state. Black-Right-Pointing-Pointer Palladium stability test indicated that the Ce salts in electroless nickel bath has reduced the stability. Black-Right-Pointing-Pointer Cerium codeposition in NiP matrix has increased the microhardness both in as-plated and annealed conditions. Black-Right-Pointing-Pointer Higher thermal stability has been obtained by Ce incorporation. - Abstract: Electroless ternary NiCeP deposits were prepared from alkaline citrate bath containing nickel sulphate, cerium chloride and sodium hypophosphite. Concentration of rare earth cerium was varied from 1 to 2 g/L to obtain ternary deposits containing variable Ce and P contents. The influence of cerium on the deposit properties was analysed. The deposit exhibited a maximum cerium content of 6.2 {+-} 0.1 wt.% when the cerium chloride concentration was 2 g/L. The result of the Pd stability test showed that the stability of the bath was reduced due to Ce salt addition. The microhardness measurements made on both as-plated and heat treated samples exhibited a peak hardness of 1006 {+-} 11 VHN for cerium concentration of 1.5 g/L. The concept of kinetic strength analysis was proved to be applicable only for binary and not for ternary alloys due to multistep deposition mechanism with different kinetic energies. X-ray diffraction (XRD) patterns of as-plated and heat treated samples revealed peaks corresponding to Ni (1 1 1) and nickel phosphide (Ni{sub 3}P). Higher amount of Ce incorporation in NiP matrix increased the crystallisation temperature of the deposit which could be due to the suppression of nickel crystallisation prior to Ni{sub 3}P compound formation and thus increasing the activation energy for the formation of stable phases. Surface compositional analysis

  4. EM International. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-07-01

    It is the intent of EM International to describe the Office of Environmental Restoration and Waste Management`s (EM`s) various roles and responsibilities within the international community. Cooperative agreements and programs, descriptions of projects and technologies, and synopses of visits to international sites are all highlighted in this semiannual journal. Focus on EM programs in this issue is on international collaboration in vitrification projects. Technology highlights covers: in situ sealing for contaminated sites; and remote sensors for toxic pollutants. Section on profiles of countries includes: Arctic contamination by the former Soviet Union, and EM activities with Germany--cooperative arrangements.

  5. Role of surface Ni and Ce species of Ni/CeO2 catalyst in CO2 methanation

    Science.gov (United States)

    Zhou, Guilin; Liu, Huiran; Cui, Kaikai; Jia, Aiping; Hu, Gengshen; Jiao, Zhaojie; Liu, Yunqi; Zhang, Xianming

    2016-10-01

    CeO2, which was used as support to prepare mesoporous Ni/CeO2 catalyst, was prepared by the hard-template method. The prepared NiO/CeO2 precursor and Ni/CeO2 catalyst were studied by H2-TPR, in-situ XPS, and in-situ FT-IR. The catalytic properties of the prepared Ni/CeO2 catalyst were also investigated by CO2 catalytic hydrogenation methanation. H2-TPR and in-situ XPS results showed that metal Ni species and surface oxygen vacancies could be formed by H2 reduction. In-situ FT-IR and in-situ XPS results indicated that CO2 molecules could be reduced by active metal Ni species and surface oxygen vacancies to generate active CO species and promote CO2 methanation. The Ni/CeO2 catalyst presented the high CO2 methanation activity, and CO2 conversion and CH4 selectivity reached 91.1% and 100% at 340 °C and atmospheric pressure.

  6. Effects of CeO2 Support Facets on VOx/CeO2 Catalysts in Oxidative Dehydrogenation of Methanol

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yan; Wei, Zhehao; Gao, Feng; Kovarik, Libor; Peden, Charles HF; Wang, Yong

    2014-05-13

    CeO2 supports with dominating facets, i.e., low index (100), (110) and (111) facets, are prepared. The facet effects on the structure and catalytic performance of supported vanadium oxide catalysts are investigated using oxidative dehydrogenation of methanol as a model reaction. In the presence of mixed facets, Infrared and Raman characterizations demonstrate that surface vanadia species preferentially deposit on CeO2 (100) facets, presumably because of its higher surface energy. At the same surface vanadium densities, VOx species on (100) facets show better dispersion, followed by (110) and (111) facets. The VOx species on CeO2 nanorods with (110) and (100) facets display higher activity and lower apparent activation energies compared to that on CeO2 nanopolyhedras with dominating (111) facets and CeO2 nanocubes with dominating (100) facets. The higher activity for VOx/CeO2(110) might be related to the more abundant oxygen vacancies present on the (110) facets, evidenced from Raman spectroscopic measurements.

  7. SYNTHESIS OF CeAPO- 5 MOLECULAR SIEVE%CeAPO-5分子筛的合成

    Institute of Scientific and Technical Information of China (English)

    张岩; 秦海莉; 高平强

    2010-01-01

    以三乙胺为模板剂、利用水热晶化法合成CeAPO-5分子筛,系统考察了铝源、水量以及晶化条件对CeAPO-5分子筛合成的影响.研究结果表明:铝源是决定CeAPO-5分子筛合成及结构的关键组分之一,拟薄水铝石AlO(OH)是合成CeAPO-5分子筛的比较合适的铝源;在n(P2O5)∶n(Al2O3)∶n(Et3N)∶n(H2O)∶n(Ce2O3)=1∶0.8∶0.26∶60∶0.5;晶化温度150℃;晶化72小时的条件下,可合成CeAPO-5分子筛.

  8. Características agronômicas do amendoinzeiro sob irrigação com águas salinas em solo com biofertilizantes.

    OpenAIRE

    Sousa, Geocleber Gomes de; de Azevedo, Benito Moreira; Albuquerque, André Henrique Pinheiro; Mesquita, José Bruno Rego de; Viana, Thales Vinicius de Araújo

    2012-01-01

    Objetivou-se com esse trabalho avaliar o efeito da salinidade da água de irrigação nas características agronômicas do amendoinzeiro (Arachis hypogaea L.) cultivado em solo sem e com biofertilizantes. O experimento foi conduzido em estufa telada na Estação Agrometereológica, Campus do Pici, Fortaleza, CE. A semeadura foi feita em vasos utilizando-se, como substrato, um Argissolo Vermelho-Amarelo, com uma planta por vaso. O experimento obedeceu a um delineamento inteiramente casualizado, em esq...

  9. Precariedade do trabalho e da vida de catadores de recicláveis em Fortaleza, CE

    Directory of Open Access Journals (Sweden)

    Regina Heloisa Maciel

    2011-10-01

    Full Text Available The article discusses life and work conditions of young, middle-aged and elderly street pickers, focusing on experiences of childhood, adolescence and actual job. Eight workers, between 20 and 85 years of age, men and women, were interviewed. The data indicates that: all had a childhood and adolescence marked by lack of resources and emotional support, early insertion in precarious work and low education; the current work maintains the previous experiences of precarious living and working conditions and lack of prospects of inclusion in the formal work market; young workers express feelings of hopelessness and failure; middle-aged and older workers managed to build a safety net through associations of recyclable collectors; all participants reported they have to deal with bigotry revealed in the eyes "of others" for whom a collector is "garbage", "beggar, vulture", a possible "thief". Finally, all believe the work is critical to their and their families' survival and is a "right" job.

  10. Testes de capacidade de expansão em programas de melhoramento de milho pipoca Popping expansion tests in popcorn breeding programs

    OpenAIRE

    Frederico de Pina Matta; José Marcelo Soriano Viana

    2001-01-01

    No desenvolvimento de populações melhoradas de milho pipoca é fundamental selecionar com base em qualidade, normalmente expressa pela relação volume de pipoca/peso de grãos, denominada capacidade de expansão (CE). Na seleção de indivíduos e progênies diversos sistemas de avaliação de qualidade devem ser considerados, por serem utilizados pelos consumidores. O propósito deste trabalho foi avaliar dois sistemas de determinação de CE em programas de melhoramento, sendo o primeiro uma pipoqueira ...

  11. Pressure and temperature dependence of the Ce valence and c -f hybridization gap in Ce T2In5(T =Co ,Rh ,Ir ) heavy-fermion superconductors

    Science.gov (United States)

    Yamaoka, H.; Yamamoto, Y.; Schwier, E. F.; Honda, F.; Zekko, Y.; Ohta, Y.; Lin, J.-F.; Nakatake, M.; Iwasawa, H.; Arita, M.; Shimada, K.; Hiraoka, N.; Ishii, H.; Tsuei, K.-D.; Mizuki, J.

    2015-12-01

    Pressure- and temperature-induced changes in the Ce valence and c -f hybridization of the Ce115 superconductors have been studied systematically. Resonant x-ray-emission spectroscopy indicated that the increase of the Ce valence with pressure was significant for CeCoIn5, and moderate for CeIr (In0.925Cd0.075)5 . We found no abrupt change of the Ce valence in the Kondo regime for CeIr (In0.925Cd0.075)5 , which suggests that valence fluctuations are unlikely to mediate the superconductivity in this material. X-ray-diffraction results were consistent with the pressure-induced change in the Ce valence. High-resolution photoelectron spectroscopy revealed a temperature-dependent reduction of the spectral intensity at the Fermi level, indicating enhanced c -f hybridization on cooling.

  12. Ce que Foucault a appris de Bentham

    Directory of Open Access Journals (Sweden)

    Christian Laval

    2011-05-01

    Full Text Available Michel Foucault, à plusieurs reprises et sous différents angles, a dit ce qu’il devait à Jeremy Bentham, considéré comme le principal « technologue » de la société disciplinaire. Mais Foucault est beaucoup plus qu’un lecteur  de Bentham. Il doit être regardé sur certains points comme un héritier théorique inavoué et sur d’autres comme un interprète  original de son œuvre et de sa place dans l’histoire des formes et des conceptions politiques. La conception foucaldienne du pouvoir comme structuration d’un  certain champ d’action rappelle immanquablement les considérations de Bentham sur « l’influence », sur la « méthode oblique »  et sur la « législation indirecte » par lesquelles on peut orienter le comportement des sujets. D’autre part, la distinction qu’il opère entre « souveraineté » et  « gouvernementalité »   permet de considérer d’une nouvelle façon l’originalité théorique et historique de l’auteur du Fragment sur le gouvernement. Le concept foucaldien de biopolitique en est un parfait exemple.Michel Foucault insisted in several instances, and in several ways, on what he owed Jeremy Bentham, the main “technologist” of disciplinary societies. But Foucault did not only read Bentham: he must be regarded as, on the one hand, an unacknowledged disciple, and on the other, an original interpreter of his work and his role in the history of political forms and concepts. Foucault’s understanding of power as the structuring of a field of action cannot fail to recall Bentham’s views on “influence” and on “indirect legislation” as means of channelling the subjects’ behaviour. Elsewhere, his distinction between “sovereignty” and “governmentality” allows us to cast a fruitful retrospective look on the thought of the author of the Fragment on Government. Foucault’s concept of “biopolitics” provides a perfect example.

  13. New Trifluoromethyl Triazolopyrimidines as Anti-<em>Plasmodium> <em>falciparum> Agents

    Directory of Open Access Journals (Sweden)

    Núbia Boechat

    2012-07-01

    Full Text Available According to the World Health Organization, half of the World’s population, approximately 3.3 billion people, is at risk for developing malaria. Nearly 700,000 deaths each year are associated with the disease. Control of the disease in humans still relies on chemotherapy. Drug resistance is a limiting factor, and the search for new drugs is important. We have designed and synthesized new 2-(trifluoromethyl[1,2,4]triazolo[1,5-<em>a>]pyrimidine derivatives based on bioisosteric replacement of functional groups on the anti-malarial compounds mefloquine and amodiaquine. This approach enabled us to investigate the impact of: (i ring bioisosteric replacement; (ii a CF3 group substituted at the 2-position of the [1,2,4]triazolo[1,5-<em>a>]pyrimidine scaffold and (iii a range of amines as substituents at the 7-position of the of heterocyclic ring; on <em>in vitroem> activity against <em>Plasmodium falciparumem>. According to docking simulations, the synthesized compounds are able to interact with <em>P. falciparumem> dihydroorotate dehydrogenase (<em>Pf>DHODH through strong hydrogen bonds. The presence of a trifluoromethyl group at the 2-position of the [1,2,4]triazolo[1,5-<em>a>]pyrimidine ring led to increased drug activity. Thirteen compounds were found to be active, with IC50 values ranging from 0.023 to 20 µM in the anti-HRP2 and hypoxanthine assays. The selectivity index (SI of the most active derivatives 5, 8, 11 and 16 was found to vary from 1,003 to 18,478.

  14. A method for the morphometric identification of southern Italian populations of <em>Apodemus> (<em>Sylvaemus>

    Directory of Open Access Journals (Sweden)

    Claudio Panzironi

    1994-05-01

    Full Text Available Abstract The study of morphological and morphometric characteristics of <em>Apodemus> (<em>Sylvaemus> <em>sylvaticus> and <em>A.> (<em>S.> <em>flavicollis> is examined in this paper. The examined specimens were living in sympatry and allopatry in two Mediterranean habitat-types (a long-trunked forest and a cultivated treed field in southern Italy. Through discriminant analysis, trends of skull measurements (which characterize the different situations of co-presence and/or absence of the two sibling species are examined. Isometric dental measurements best discriminate the examined populations. Possible causal factors which could affect discriminant measures are discussed. Riassunto Un metodo per la discriminazione morfometrica in popolazioni di <em>Apodemus> (<em>Sylvaemus> dell'Italia meridionale - In questo studio preliminare sono state prese in esame le caratteristiche morfologiche e morfometriche di <em>Apodemus> (<em>Sylvaemus> <em>sylvaticus> e <em>A.> (<em>S.> <em>flavicollis> in condizioni di simpatria e allopatria in due ambienti mediterranei (bosco maturo e campo prossimo ad un frutteto del sud Italia. Mediante analisi discriminante sono state studiate le tendenze delle misure craniche a caratterizzare i diversi gruppi in situazione di allopatria e/o simpatria delle due specie sorelle. Le misure isometriche dentarie mostrano una maggiore capacità di discriminare i gruppi considerati. Vengono discussi i possibili fattori causali che potrebbero influire sulle misure discriminanti.

  15. Comparison of energy structure and spectral properties of Ce:LaAlO3 and Ce:Lu2(SiO4)O

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Undoped LaAlO3 and 1 at.%Ce:LaAlO3 single crystals were grown by the Czochralski process.Absorption and fluorescence spectra were measured at room temperature.Detailed energy levels structure of Ce:LaAlO3 was determined.In this paper,two viewpoints were provided.The first one is:the energy levels structure of Ce:LaAlO3 is very similar to that of Ce:Lu2(SiO4)O which is a well-known scintillator.In the energy levels structure of Ce:LaAlO3 and Ce:Lu2(SiO4)O,the lowest 5d energy level of Ce 3+ is located below the bottom of the conduction band of host crystal and the other higher 5d energy levels of Ce 3+ are located above the bottom of the conduction band of host crystal.The second one is:Ce:LaAlO3 single crystal may not be suitable for scintillation application;by comparing the energy levels structures of Ce:LaAlO3 and Ce:Lu2(SiO4)O,the large energy difference(1.13 eV)between the two lowest 5d energy levels of Ce 3+ in LaAlO3 is a crucial factor that causes the luminescence quenching.

  16. SELF-ASSEMBLY CE OXIDE/ORGANOPOLYSILOXANE COMPOSITE COATINGS.

    Energy Technology Data Exchange (ETDEWEB)

    SUGAMA,T.; SABATINI,R.; GAWLIK,K.

    2005-01-01

    A self-assembly composite synthesis technology was used to put together a Ce(OH){sub 3}-dispersed poly-acetamide-acetoxyl methyl-propylsiloxane (PAAMPA) organometallic polymer. Three spontaneous reactions were involved; condensation, amidation, and acetoxylation, between the Ce acetate and aminopropylsilane triol (APST) at 150 C. An increase in temperature to 200 C led to the in-situ phase transformation of Ce(OH){sub 3} into Ce{sub 2}O{sub 3} in the PAAMPA matrix. A further increase to 250 C caused oxidative degradation of the PAAMPA, thereby generating copious fissures in the composite. We assessed the potential of Ce(OH){sub 3}/ and Ce{sub 2}O{sub 3}/ PAAMPA composite materials as corrosion-preventing coatings for carbon steel and aluminum. The Ce{sub 2}O{sub 3} composite coating displayed better performance in protecting both metals against NaCl-caused corrosion than did the Ce(OH){sub 3} composite. Using this coating formed at 200 C, we demonstrated that the following four factors played an essential role in further mitigating the corrosion of the metals: First was a minimum susceptibility of coating's surface to moisture; second was an enhanced densification of the coating layer; third was the retardation of the cathodic oxygen reduction reaction at the metal's corrosion sites due to the deposition of Ce{sub 2}O{sub 3} as a passive film over the metal's surface; and, fourth was its good adherence to metals. The last two factors contributed to minimizing the cathodic delamination of coating film from the metal's surface. We also noted that the affinity of the composite with the surface of aluminum was much stronger than that with steel. Correspondingly, the rate of corrosion of aluminum was reduced as much as two orders of magnitude by a nanoscale thick coating. In contrast, its ability to reduce the corrosion rate of steel was lower than one order of magnitude.

  17. Magnetic, thermal and electronic properties of Ce{sub 11}Ni{sub 4}In{sub 9} and CeNi{sub 9}In{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Szytuła, A., E-mail: andrzej.szytula@uj.edu.pl [Marian Smoluchowski Institute of Physics, Jagiellonian University, Reymonta 4, 30-059 Kraków (Poland); Baran, S.; Penc, B. [Marian Smoluchowski Institute of Physics, Jagiellonian University, Reymonta 4, 30-059 Kraków (Poland); Przewoźnik, J. [Department of Solid State Physics, Faculty of Physics and Applied Computer Science, AGH University of Science and Technology, Al. Mickiewicza 30, 30-059 Kraków (Poland); Winiarski, A. [August Chełkowski Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Tyvanchuk, Yu.; Kalychak, Ya.M. [Department of Analytical Chemistry, Ivan Franko National University of Lviv, Kyryla and Mephodiya 6, 79005 Lviv (Ukraine)

    2014-03-15

    Highlights: • Basis on the X-ray data the crystal structure of Ce{sub 11}Ni{sub 4}In{sub 9} and CeNi{sub 9}In{sub 2} compounds determined. • In Ce{sub 11}Ni{sub 4}In{sub 9} the Ce magnetic moments order at low temperatures, where in CeNi{sub 9}In{sub 2} not detected localized moment. • Magnetic and specific heat data of Ce{sub 11}Ni{sub 4}In{sub 9} indicate two phase transitions at 5 and 16.5 K. • XPS spectra indicate for both compounds sizable hybridization of the Ce4f electrons with conduction band. • For CeNi{sub 9}In{sub 2} the existence of Ce3d{sup 9}4f{sup 0} configuration indicates the mixed-valence state. -- Abstract: Crystal structure, magnetic, thermal and electronic properties of Ce{sub 11}Ni{sub 4}In{sub 9} and CeNi{sub 9}In{sub 2} compounds were investigated by means of X-ray diffraction, magnetic, calorimetric and X-ray photoelectron spectroscopy measurements. Ce{sub 11}Ni{sub 4}In{sub 9} crystallizes in the orthorhombic Nd{sub 11}Pd{sub 4}In{sub 9}-type structure (space group Cmmm) while CeNi{sub 9}In{sub 2} crystallizes in the YNi{sub 9}In{sub 2}-type structure (space group P4/mbm) (in which Ce atoms occupy only one Wyckoff position). Magnetic and specific heat measurements indicate that in Ce{sub 11}Ni{sub 4}In{sub 9} the Ce magnetic moment orders below 16.5 K, while in CeNi{sub 9}In{sub 2} it does not carry a localized moment. Our data indicate that Ni atoms are likely non-magnetic in both compounds. The XPS spectra of the valence band and the core-level are reported. The contributions to the density of states at E{sub F} are dominated by the Ni3d states. The XPS Ce3d data indicate sizable hybridization of the Ce-4f electrons with conduction band for both compounds. The existence in CeNi{sub 9}In{sub 2} of Ce3d{sup 9}4f{sup 0} configuration indicates a mixed-valence system. The core-level Ni2p{sub 3/2} spectra indicate incomplete Ni3d band filling in this compound.

  18. Levels in 146Ce and the N = 88 isotones

    International Nuclear Information System (INIS)

    An investigation of the level structure of 146Ce following the beta decay of the low-spin isomer of 146La has been carried out at the ISOL facility TRISTAN at Brookhaven National Laboratory. The half-life for the low spin isomer was found to be 6.0 +- 0.4s. A partial level scheme for 146Ce below 2 MeV is given. The level energies and some B(E2) values extracted from our data have been compared with IBA-2 calculations done entirely with extrapolated parameters from neighboring Z nuclei in order to check the predictive power of the model. Systematics of the Z = 58 isotopes and N = 88 isotones indicate that although 146Ce is more deformed than its isotones with Z >= 60, the transition to the well-deformed region can probably more correctly be thought to occur after 146Ce, between N = 88 and N = 90, as it does for Z >= 60. The abrupt onset of deformation present in the higher Z isotopes is not seen in the Ce isotopes where the trend is found to be rather smooth throughout. (orig.)

  19. An Update on NiCE Support for BISON

    Energy Technology Data Exchange (ETDEWEB)

    McCaskey, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Billings, Jay Jay [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Deyton, Jordan H. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wojtowicz, Anna [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-09-01

    The Nuclear Energy Advanced Modeling and Simulation program (NEAMS) from the Department of Energy s Office of Nuclear Energy has funded the development of a modeling and simulation workflow environment to support the various codes in its nuclear energy scientific computing toolkit. This NEAMS Integrated Computational Environment (NiCE) provides extensible tools and services that enable efficient code execution, input generation, pre-processing visualizations, and post-simulation data analysis and visualization for a large portion of the NEAMS Toolkit. A strong focus for the NiCE development team throughout FY 2015 has been support for the Multiphysics Object Oriented Simulation Environment (MOOSE) and the NEAMS nuclear fuel performance modeling application built on that environment, BISON. There is a strong desire in the program to enable and facilitate the use of BISON throughout nuclear energy research and industry. A primary result of this desire is the need for strong support for BISON in NiCE. This report will detail improvements to NiCE support for BISON. We will present a new and improved interface for interacting with BISON simulations in a variety of ways: (1) improved input model generation, (2) embedded mesh and solution data visualizations, and (3) local and remote BISON simulation launch. We will also show how NiCE has been extended to provide support for BISON code development.

  20. LiCe9Mo16O35

    Directory of Open Access Journals (Sweden)

    Patrick Gougeon

    2012-03-01

    Full Text Available The structure of lithium nonacerium hexadecamolybdenum pentatridecaoxide, LiCe9Mo16O35, is isotypic with LiNd9Mo16O35 [Gougeon Gall, Cuny, Gautier, Le Polles, Delevoye & Trebosc (2011. Chem. Eur. J. 17, 13806–13813]. It is characterized by Mo16O26iO10a units (where i = inner and a = apical containing Mo16 clusters that share some of their O atoms to form infinite molybdenum cluster chains running parallel to the b axis and separated by Li+ and Ce3+ cations. The Mo16 cluster units are centred at Wyckoff positions 2c and have point-group symmetry 2/m. The Li+ atom, in a flattened octahedron of O atoms, is in a 2a Wyckoff position with 2/m symmetry. The Ce3+ cations have coordination numbers to the O atoms of 6, 9 or 10. Two Ce, two Mo and five O atoms lie on sites with m symmetry (Wyckoff site 4i, and one Ce and one O atom on sites with 2/m symmetry (Wyckoff sites 2b and 2d, respectively.

  1. Mixed cerium-platinum oxides: Electronic structure of [CeO]Ptn (n = 1, 2) and [CeO2]Pt complex anions and neutrals.

    Science.gov (United States)

    Ray, Manisha; Kafader, Jared O; Topolski, Josey E; Jarrold, Caroline Chick

    2016-07-28

    The electronic structures of several small Ce-Pt oxide complexes were explored using a combination of anion photoelectron (PE) spectroscopy and density functional theory calculations. Pt and Pt2 both accept electron density from CeO diatomic molecules, in which the cerium atom is in a lower-than-bulk oxidation state (+2 versus bulk +4). Neutral [CeO]Pt and [CeO]Pt2 complexes are therefore ionic, with electronic structures described qualitatively as [CeO(+2)]Pt(-2) and [CeO(+)]Pt2 (-), respectively. The associated anions are described qualitatively as [CeO(+)]Pt(-2) and [CeO(+)]Pt2 (-2), respectively. In both neutrals and anions, the most stable molecular structures determined by calculations feature a distinct CeO moiety, with the positively charged Ce center pointing toward the electron rich Pt or Pt2 moiety. Spectral simulations based on calculated spectroscopic parameters are in fair agreement with the spectra, validating the computationally determined structures. In contrast, when Pt is coupled with CeO2, which has no Ce-localized electrons that can readily be donated to Pt, the anion is described as [CeO2]Pt(-). The molecular structure predicted computationally suggests that it is governed by charge-dipole interactions. The neutral [CeO2]Pt complex lacks charge-dipole stabilizing interactions, and is predicted to be structurally very different from the anion, featuring a single Pt-O-Ce bridge bond. The PE spectra of several of the complexes exhibit evidence of photodissociation with Pt(-) daughter ion formation. The electronic structures of these complexes are related to local interactions in Pt-ceria catalyst-support systems. PMID:27475371

  2. Fabrication and characterization of spark plasma sintered Ce:LuAG ceramic for scintillation application

    Science.gov (United States)

    Kumar, S. Arun; Senthilselvan, J.

    2016-05-01

    Rare earth Cerium doped Lutetium Aluminum Garnet (Ce:LuAG) ceramics are widely used as phosphor material in medical imaging and high-energy physics. Due to its technological importance, an attempt has been made to fabricate Ce:LuAG ceramics by using spark plasma sintering (SPS) technique. XRD patterns of SPS sintered Ce:LuAG ceramics reveals a mixed LuAG and CeO2 (antisite defect) phases. The microstructures of SPS sintered Ce:LuAG ceramics shows limited densification, inappropriate compaction of particles and existence of residual pores, voids between the grain boundaries affects the transparency of Ce:LuAG ceramics. Relative density and hardness of post sintered Ce:LuAG ceramic is also determined. The effect of Ce3+ doping concentration and sintering temperature on optical luminescence behavior of Ce:LuAG ceramic is presented.

  3. Performance Evaluation of CE-OFDM in PLC Channel

    Directory of Open Access Journals (Sweden)

    El ghzaoui Mohammed, Belkadid Jamal, Benbassou Ali

    2011-02-01

    Full Text Available One major drawback associated with an OFDM system is that the transmitter’soutput signal may have a high peak-to-average ratio (PAPR. High levels of PARmay be a limiting factor for power line communication (PLC where regulatorybodies have fixed the maximum amount of transmit power. To overcome thisproblem, many approaches have been presented in the literature. One potentialsolution for reducing the peak-to-average power ratio (PAPR in an OFDMsystem is to utilize a constant envelope OFDM (CE-OFDM system. This paperdescribes a CE-OFDM based modem for Power Line Communications (PLCover the low voltage distribution network. The impact of the electrical applianceson the signal transmission is investigated. The good performances of the BERhave been checked by the simulation platform of real PLC channel using Matlab.Finally, CE-OFDM-CPM is compared with conventional OFDM under HomePlugAV..

  4. Performance Evaluation of CE-OFDM in PLC Channel

    Directory of Open Access Journals (Sweden)

    El Ghzaoui Mohammed

    2011-02-01

    Full Text Available One major drawback associated with an OFDM system is that the transmitter’s output signal may have a high peak-to-average ratio (PAPR. High levels of PAR may be a limiting factor for power line communication (PLC where regulatory bodies have fixed the maximum amount of transmit power. To overcome this problem, many approaches have been presented in the literature. One potential solution for reducing the peak-to-average power ratio (PAPR in an OFDM system is to utilize a constant envelope OFDM (CE-OFDM system. This paper describes a CE-OFDM based modem for Power Line Communications (PLC over the low voltage distribution network. The impact of the electrical appliances on the signal transmission is investigated. The good performances of the BER have been checked by the simulation platform of real PLC channel using Matlab. Finally, CE-OFDM-CPM is compared with conventional OFDM under HomePlug AV.

  5. Transverse wobbling motion in $^{134}$Ce and $^{136}$Nd

    CERN Document Server

    Petrache, C M

    2016-01-01

    The existence of one-phonon and possible two-phonon transverse wobbling bands is proposed for the first time in two even-even nuclei, $^{134}$Ce and $^{136}$Nd. The predominant $E2$ character of the $\\Delta I = 1$ transitions connecting the one-phonon wobbling band in $^{134}$Ce to the two-quasiparticle yrast band supports the wobbling interpretation. The extracted wobbling frequencies decrease with increasing spin, indicating the transverse character of the wobbling motion, with the angular momenta of the two quasiparticles aligned perpendicular to the axis of collective rotation. A candidate for two-phonon wobbling motion is also proposed in $^{136}$Nd. The wobbling frequencies calculated in the harmonic frozen approximation are in good agreement with the experimental ones for both the$^{134}$Ce and $^{136}$Nd nuclei.

  6. International EMS Systems

    DEFF Research Database (Denmark)

    Langhelle, Audun; Lossius, Hans Morten; Silfvast, Tom;

    2004-01-01

    Emergency medicine service (EMS) systems in the five Nordic countries have more similarities than differences. One similarity is the involvement of anaesthesiologists as pre-hospital physicians and their strong participation for all critically ill and injured patients in-hospital. Discrepancies do....... Access to on-line medical advice of a physician is not available; (2) Finland: the autonomy of the individual municipalities and their responsibility to cover for primary and specialised health care, as well as the EMS, and the lack of supporting or demanding legislation regarding the EMS; (3) Iceland...... is the only country that has emergency medicine (EM) as a recognised speciality but there is a need for more fully trained specialists in EM; (4) Norway: the ordinary ground ambulance is pointed out as the weakest link in the EM chain and a health reform demands extensive co-operation between the new health...

  7. Homoleptic Ce(III) and Ce(IV) Nitroxide Complexes: Significant Stabilization of the 4+ Oxidation State

    Energy Technology Data Exchange (ETDEWEB)

    Bogart, Justin A.; Lewis, Andrew J.; Medling, Scott A.; Piro, Nicholas A.; Carroll, Patrick J.; Booth, Corwin H.; Schelter, Eric J.

    2014-06-25

    Electrochemical experiments performed on the complex Ce-IV[2-((BuNO)-Bu-t)py](4), where [2-((BuNO)-Bu-t)py](-) = N-tert-butyl-N-2-pyridylnitroxide, indicate a 2.51 V stabilization of the 4+ oxidation state of Ce compared to [(Bu4N)-Bu-n](2)[Ce(NO3)(6)] in acetonitrile and a 2.95 V stabilization compared to the standard potential for the ion under aqueous conditions. Density functional theory calculations suggest that this preference for the higher oxidation state is a result of the tetrakis(nitroxide) ligand framework at the Ce cation, which allows for effective electron donation into, and partial covalent overlap with, vacant 4f orbitals with delta symmetry. The results speak to the behavior of CeO2 and related solid solutions in oxygen uptake and transport applications, in particular an inherent local character of bonding that stabilizes the 4+ oxidation state. The results indicate a cerium(IV) complex that has been stabilized to an unprecedented degree through tuning of its ligand-field environment.

  8. Transport properties of pure and doped CeO2

    International Nuclear Information System (INIS)

    The oxides that crystallize in the fluorite structure are noted for their ability to accommodate a high degree of disorder on the oxygen sublattice. Cerium oxide is a semiconductor and ionically- conductor oxide with important electrical and chemical applications as a solid oxide fuel cell electrolyte, a catalyst for gas phase oxidation and reduction reactions, and as an oxygen buffer in the automotive 3-way catalyst. Polycrystalline samples of different grain size were prepared by uniaxial hot pressing and their sintering behavior was investigated, at various temperatures and pressures. The cerium dioxide has been prepared by this way and characterized by X-ray diffraction and transmission electron microscopy (SEM). Measurements of electronic conductivity have confirmed that electron transport in CeO2-x proceeds via a small polaron process. The electrical properties of CeO2-UO2 solid solutions are examined as a function of temperature (600 deg. C - 1400 deg. C), oxygen partial pressure (10 - 22 - 1 atm), and Ce/U ratio (CeO2- 1.65% UO2, CeO2- 5% UO2). The PO2 values were controlled by mixing Ar-O2 and CO2-H2 or Ar-H2, gases in appropriate proportions. Electrical conductivity data obtained for U-doped CeO2 solid solution were shown to be in good agreement with predictions and thereby enable derivation of a number of key parameters, including those controlling generation of oxygen Frenkel defects, doubly ionized vacancies and electrons by reduction, and electron mobilities. (authors)

  9. Sensitive redox speciation of neptunium by CE-ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Stoebener, Nils; Amayri, Samer; Gehl, Aaron; Kaplan, Ugras; Malecha, Kurtis; Reich, Tobias [Johannes Gutenberg-Universitaet Mainz, Institute of Nuclear Chemistry, Mainz (Germany)

    2012-11-15

    Capillary electrophoresis (CE) was used to separate the neptunium oxidation states Np(IV) and Np(V), which are the only oxidation states of Np that are stable under environmental conditions. The CE setup was coupled to an inductively coupled plasma mass spectrometer (Agilent 7500ce) using a Mira Mist CE nebulizer and a Scott-type spray chamber. The combination of the separation capacity of CE with the detection sensitivity of inductively coupled plasma mass spectrometry (ICP-MS) allows identification and quantification of Np(IV) and Np(V) at the trace levels expected in the far field of a nuclear waste repository. Limits of detection of 1 x 10{sup -9} and 5 x 10{sup -10} mol L{sup -1} for Np(IV) and Np(V), respectively, were achieved, with a linear range from 10{sup -9} to 10{sup -6} mol L{sup -1}. The method was applied to study the redox speciation of the Np remaining in solution after interaction of 5 x 10{sup -7} mol L{sup -1} Np(V) with Opalinus Clay. Under mildly oxidizing conditions, a Np sorption of 31% was found, with all the Np remaining in solution being Np(V). A second sorption experiment performed in the presence of Fe{sup 2+} led to complete sorption of the Np onto the clay. After desorption with HClO{sub 4}, a mixture of Np(IV) and Np(V) was found in solution by CE-ICP-MS, indicating that some of the sorbed Np had been reduced to Np(IV) by Fe{sup 2+}. (orig.)

  10. The solid solutions (Ce1-xLax)RuSn

    International Nuclear Information System (INIS)

    X-Ray-pure samples of the solid solutions (Ce1-xLax)RuSn were obtained up to x = 0.5. Powder diffraction data show the CeRuSn-type superstructure up to x ∼ 0.3 and the CeCoAl-type subcell for higher lanthanum contents. The structure of a single crystal with x = 0.5 was refined on the basis of single-crystal X-ray diffractometer data: CeCoAl type, C2/m, a = 1160.8(2), b = 477.6(1), c = 511.6(1) pm, β = 102.97(2) , wR = 0.0510, 444 F2 values, 20 variables. Magnetic investigations were performed for all samples up to a lanthanum content of x = 0.4. No cooperative phenomena could be observed, and all samples show Curie-Weiss behavior above a certain temperature. The cerium valence is about 3.32(2) for all samples of the solid solution. Hence, La3+ has to replace Ce3+ as well as Ce4+ in a particular quantity. The electrical resistivity measurements confirm the suppression of the magnetic ordering and the structural transition upon replacement of cerium by lanthanum. 119Sn Moessbauer spectra of samples with x = 0.2 and 0.5 are indicative of single tin sites with isomer shifts of δ = 1.86(1) mm s-1 for x = 0.2 and δ = 1.88(1) mm s-1 for x = 0.5. Both signals are subject to significant quadrupole splitting, a consequence of the low site symmetry. Results of XANES measurements are perfectly in line with the cerium valences determined by susceptibility measurements and yield a constant value of 3.16(1) for all investigated compounds. (orig.)

  11. Microstructure and Composition of a Ce-pyrochlore: A Chemical Analog for Pu-pyrochlore

    Science.gov (United States)

    Xu, Huifang; Wang, Yifeng; Garvie, Laurence A. J.; Putnam, Robert L.; Navrotsky, Alexandra

    2003-07-01

    Ce-pyrochlore (CaCeTi2O7), is a chemical analogue for CaPuTi2O7, which is a proposed ceramic waste form for deposition of excess weapon-usable Pu in geological repositories. Ce-pyrochlore was synthesized by firing and annealing a mixture of Ce(NO3)4, TiO2, and Ca(OH)2 with a stoichiometry of CaCeTi2O7 at 1,300°C for 50 hours. The annealed product contains Ce-pyrochlore, Ce-bearing perovskite, CeO2 (cerianite), and minor CaO. Electron energy-loss spectroscopy (EELS) was used to determine the valence of Ce in the synthesized materials using the shape of the Ce M4,5 edge. Cerium in the perovskite is dominated by Ce3+. The Ce4+/ΣCe in the pyrochlore is 0.8, giving (Ca0.87Ce0.203+Ce0.864+Ti0.05)Ti2O7. High-resolution TEM images show that the boundary between pyrochlore and perovskite is semicoherently bonded. The orientational relationship between the neighboring pyrochlore and perovskite is not random. There are no glassy phases observed at the grain boundaries between pyrochlore and perovskite, and between CeO2 and pyrochlore. It is postulated, based on the presence of trivalent Ce in the Ce-pyrochlore, that the neutron poisons such as Gd can be incorporated into the CaPuTi2O7 phase.

  12. NMR studies on polyphosphide Ce6Ni6P17

    Science.gov (United States)

    Koyama, T.; Yamada, H.; Ueda, K.; Mito, T.; Aoyama, Y.; Nakano, T.; Takeda, N.

    2016-02-01

    We report the result of 31P nuclear magnetic resonance (NMR) studies on Ce6Ni6P17. The observed NMR spectra show a Lorentzian-type and an asymmetric shapes, reflecting the local symmetry around each P site in the cubic unit cell. We have identified the observed NMR lines corresponding to three inequivalent P sites and deduced the temperature dependence of the Knight shift for each site. The Knight shifts increase with decreasing temperature down to 1.5 K, indicating a localized spin system of Ce6Ni6P17. Antiferromagnetic correlation between 4f spins is suggested from the negative sign of the Weiss-temperature.

  13. Pd/CeO2/SiC Chemical Sensors

    Science.gov (United States)

    Lu, Weijie; Collins, W. Eugene

    2005-01-01

    The incorporation of nanostructured interfacial layers of CeO2 has been proposed to enhance the performances of Pd/SiC Schottky diodes used to sense hydrogen and hydrocarbons at high temperatures. If successful, this development could prove beneficial in numerous applications in which there are requirements to sense hydrogen and hydrocarbons at high temperatures: examples include monitoring of exhaust gases from engines and detecting fires. Sensitivity and thermal stability are major considerations affecting the development of high-temperature chemical sensors. In the case of a metal/SiC Schottky diode for a number of metals, the SiC becomes more chemically active in the presence of the thin metal film on the SiC surface at high temperature. This increase in chemical reactivity causes changes in chemical composition and structure of the metal/SiC interface. The practical effect of the changes is to alter the electronic and other properties of the device in such a manner as to degrade its performance as a chemical sensor. To delay or prevent these changes, it is necessary to limit operation to a temperature sensor structures. The present proposal to incorporate interfacial CeO2 films is based partly on the observation that nanostructured materials in general have potentially useful electrical properties, including an ability to enhance the transfer of electrons. In particular, nanostructured CeO2, that is CeO2 with nanosized grains, has shown promise for incorporation into hightemperature electronic devices. Nanostructured CeO2 films can be formed on SiC and have been shown to exhibit high thermal stability on SiC, characterized by the ability to withstand temperatures somewhat greater than 700 C for limited times. The exchanges of oxygen between CeO2 and SiC prevent the formation of carbon and other chemical species that are unfavorable for operation of a SiC-based Schottky diode as a chemical sensor. Consequently, it is anticipated that in a Pd/CeO2/SiC Schottky

  14. Isolation and functional characterization of CE1 binding proteins

    Directory of Open Access Journals (Sweden)

    Yu Ji-hyun

    2010-12-01

    Full Text Available Abstract Background Abscisic acid (ABA is a plant hormone that controls seed germination, protective responses to various abiotic stresses and seed maturation. The ABA-dependent processes entail changes in gene expression. Numerous genes are regulated by ABA, and promoter analyses of the genes revealed that cis-elements sharing the ACGTGGC consensus sequence are ubiquitous among ABA-regulated gene promoters. The importance of the core sequence, which is generally known as ABA response element (ABRE, has been demonstrated by various experiments, and its cognate transcription factors known as ABFs/AREBs have been identified. Although necessary, ABRE alone is not sufficient, and another cis-element known as "coupling element (CE" is required for full range ABA-regulation of gene expression. Several CEs are known. However, despite their importance, the cognate transcription factors mediating ABA response via CEs have not been reported to date. Here, we report the isolation of transcription factors that bind one of the coupling elements, CE1. Results To isolate CE1 binding proteins, we carried out yeast one-hybrid screens. Reporter genes containing a trimer of the CE1 element were prepared and introduced into a yeast strain. The yeast was transformed with library DNA that represents RNA isolated from ABA-treated Arabidopsis seedlings. From the screen of 3.6 million yeast transformants, we isolated 78 positive clones. Analysis of the clones revealed that a group of AP2/ERF domain proteins binds the CE1 element. We investigated their expression patterns and analyzed their overexpression lines to investigate the in vivo functions of the CE element binding factors (CEBFs. Here, we show that one of the CEBFs, AtERF13, confers ABA hypersensitivity in Arabidopsis, whereas two other CEBFs enhance sugar sensitivity. Conclusions Our results indicate that a group of AP2/ERF superfamily proteins interacts with CE1. Several CEBFs are known to mediate defense or

  15. Certification of Confluence Proofs using CeTA

    OpenAIRE

    Nagele, Julian; Thiemann, René

    2015-01-01

    CeTA was originally developed as a tool for certifying termination proofs which have to be provided as certificates in the CPF-format. Its soundness is proven as part of IsaFoR, the Isabelle Formalization of Rewriting. By now, CeTA can also be used for certifying confluence and non-confluence proofs. In this system description, we give a short overview on what kind of proofs are supported, and what information has to be given in the certificates. As we will see, only a small amount of informa...

  16. Comparação dos estímulos clique e CE-chirp® no registro do Potencial Evocado Auditivo de Tronco Encefálico Comparison of click and CE-chirp® stimuli on Brainstem Auditory Evoked Potential recording

    Directory of Open Access Journals (Sweden)

    Gabriela Ribeiro Ivo Rodrigues

    2012-12-01

    Full Text Available OBJETIVO: Comparar as latências e as amplitudes da onda V no registro do Potencial Evocado Auditivo de Tronco Encefálico (PEATE com os estímulos clique e CE-chirp® e a presença ou ausência das ondas I, III e V em fortes intensidades. MÉTODOS: Estudo transversal com 12 adultos com limiares audiométricos PURPOSE: To compare the latencies and amplitudes of wave V on the Brainstem Auditory Evoked Potential (BAEP recording obtained with click and CE-chirp® stimuli and the presence or absence of waves I, III and V in high intensities. METHODS: Cross-sectional study with 12 adults with audiometric thresholds <15 dBHL (24 ears and mean age of 27 years. The parameters used for the recording with both stimuli in intensities of 80, 60, 40, 20 dBnHL were alternate polarity and repetition rate of 27.1 Hz. RESULTS: The CE-chirp® latencies for wave V were longer than click latencies at low intensity levels (20 and 40 dBnHL. At high intensity levels (60 and 80 dBnHL, the opposite occurred. Larger wave V amplitudes were observed with CE-chirp® in all intensity levels, except at 80 dBnHL. CONCLUSION: The CE-chirp® showed shorter latencies than those observed with clicks at high intensity levels and larger amplitudes at all intensity levels, except at 80 dBnHL. The waves I and III tended to disappear with CE-chirp® stimulation.

  17. Improved sulfur-resistant ability on CO oxidation of Pd/Ce0.75Zr0.25O2 over Pd/CeO2-TiO2 and Pd/CeO2

    Institute of Scientific and Technical Information of China (English)

    沈美庆; 林放; 魏光曦; 王建强; 朱少春

    2015-01-01

    The influence of sulfation on Pd/Ce0.75Zr0.25O2, Pd/CeO2-TiO2 and Pd/CeO2 was investigated. Physical structure and chemical properties of different catalysts were characterized by N2 adsorption, X-ray diffraction (XRD), CO chemisorption, X-ray photoelectron spectroscopy (XPS), Fourier transform infrared spectroscopy (FT-IR) and X-ray fluorescence (XRF). After 10 h SO2 sulfation, it was found that the decrement on CO oxidation catalytic activity was limited on Pd/Ce0.75Zr0.25O2 compared to Pd/CeO2-TiO2 and Pd/CeO2. It demonstrated that Pd/Ce0.75Zr0.25O2 was more sulfur resistant compared to the other two catalysts. Af-ter sulfur exposure, catalyst texture was not much influenced as shown by N2 adsorption and XRD, and surface Pd atoms were poi-soned indicated by CO chemisorption results. Pd/Ce0.75Zr0.25O2 and Pd/CeO2-TiO2 exhibited less sulfur accumulation compared to Pd/CeO2 in the sulfation process. Furthermore, XPS results clarified that surface sulfur amount, especially surface sulfates amount on the sulfated catalysts was more crucial for the deactivation in sulfur containing environment.

  18. Emergency Medical Service (EMS) Stations

    Data.gov (United States)

    Kansas Data Access and Support Center — EMS Locations in Kansas The EMS stations dataset consists of any location where emergency medical services (EMS) personnel are stationed or based out of, or where...

  19. High performance of NO oxidation over Ce-Co-Ti catalyst: The interaction between Ce and Co

    Science.gov (United States)

    Shang, Danhong; Zhong, Qin; Cai, Wei

    2015-01-01

    Ce0.2Co0.2Ti mixed oxide catalyst was synthesized by a facile sol-gel method and the catalytic activity was evaluated through NO oxidation. The catalyst was characterized by XRD, Raman, TEM, H2-TPR, O2-TPD and XPS. The results showed that Ce0.2Co0.2Ti exhibited high catalytic activity of NO oxidation with maximum conversion of 76% at 300 °C under the condition of 400 ppm NO, 8% O2 and 30 000 h-1 GHSV. The high activity was ascribed to the strong interaction between Ce and Co, which resulted in small particle, excellent redox and large amount of chemisorbed oxygen. These features were favorable for the high catalytic performance of NO oxidation.

  20. Cesariana em animais de companhia: opções cirúrgicas e fatores de risco

    OpenAIRE

    Santos, Ana Cláudia Campos dos

    2016-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária O estudo retrospetivo incluiu quarenta e duas cadelas e quinze gatas sujeitas a cesariana por distócia (grupo CD e GD, respetivamente) e treze cadelas sujeitas a cesariana eletiva (grupo CE). Todos os casos foram recolhidos no Hospital Referência Veterinária Montenegro, durante o período de Março de 2008 até Junho de 2014. A cesariana pode ser indicada durante a gestação tardia em cadelas e gatas para resolução de casos de distóc...

  1. Synthesis and Luminescence Properties of (La,Ce,Tb)BO_3 Phosphors%(La,Ce,Tb)BO_3的合成及光谱性质

    Institute of Scientific and Technical Information of China (English)

    王林生; 文小强; 周健; 赖华生; 王玉香; 黄可龙

    2009-01-01

    采用高温固相法合成了(La,Ce,Tb)BO_3绿色发光粉,并对该发光粉进行了XRD和SEM分析.结果表明:(La,Ce,Tb)BO_3的晶体结构和LaBO_3相同,Ce~(3+)、Tb~(3+)的掺入并没有改变晶体的结构,发光粉颗粒大小均匀,形貌规则,粒度在5 μm左右.研究了(La,Ce,Tb)BO_3的光谱性质,在(La,Ce,Tb)BO_3的发射和激发光谱中除了有Tb~(3+)的特征发射和激发峰外,还有Ce~(3+)的特征发射和激发峰.比较了(La,Ce)BO_3发射光谱和(La,Tb)BO_3的激发光谱,两者存在重叠,这为Ce~(3+)→Tb~(3+)的能量传递提供了条件.将(La,Ce,Tb)BO_3的发射光谱与商品粉(La,Ce,Tb)PO_4进行比较,两者的发射主峰都在541 nm处, (La,Ce,Tb)BO_3在489 nm处的峰位稍有红移,通过计算表明,(La,Ce,Tb)BO_3的发光亮度达到商品粉(La,Ce,Tb)PO_4的94.7%.因此,(La,Ce,Tb)BO_3是一种很有应用前景的绿色发光粉.

  2. Salmonella sp. bacteriology monitoring in laying hens at different growing and laying periods from poultry farms in Metropolitan Region of Fortaleza Monitoramento bacteriológico para Salmonella sp. em poedeira comercial em diferentes fases de recria e produção de empresas avícolas da Região Metropolitana de Fortaleza

    Directory of Open Access Journals (Sweden)

    Emanuella Evangelista da Silva

    2008-07-01

    Full Text Available

    This work aimed to verify <em>Salmonella> occurrence in laying hen flocks from eight poultry farms in Metropolitan Region of Fortaleza city. Swab collections were performed in transport boxes of day-old-chicks, totaling 40 feces samples (5 samples/flock, which presented no <em>Salmonella> contamination. Bacterial analyses from a pool of feces were performed in the same flocks at 10, 20, 30 and 40 weeks of age. <em>Salmonella enterica em>rough strain and <em>Salmonella em>Newport were found in two flocks at 20 and 40 weeks of age, respectively. These results suggest that the birds were infected with <em>Salmonella em>after their arrival in the poultry farms. It was verified that 25% of the poultry farms presented positive feces samples for <em>Salmonella> contamination, indicating the need for a more efficacious preventive program in the poultry farms for egg production. This work suggests that day old birds were of <em>Salmonella> contamination which indicates no vertical <em>Salmonella> transmission, however the rearing phase present failures regarding bacterial control.

     

    KEY WORDS: Bacteriology, chickens, eggs, feces, Salmonella.

    O presente trabalho objetivou investigar a presença de <em>Salmonella em>em lotes de poedeiras comerciais de oito empresas da região metropolitana de Fortaleza,CE, Brasil. Realizaram-se suabes em cinco caixas de transporte por lote das oito empresas analisadas, totalizando quarenta amostras de mecônio, sendo todas negativas para <em>Salmonella. em>Os mesmos lotes (oito foram monitorados na décima, vigésima, trigésima e quadragésima semanas de idade com exame bacteriológico de <em>pool> de cem fezes frescas. Foram isoladas <em>Salmonella> <em>enterica em>subsepécie <em>enterica> cepa rugosa e<em> Salmonella em>Newport> em>das amostras de fezes nas empresas 2 e 6 na

  3. Electrochemical formation process and phase control of Mg-Li-Ce alloys in molten chlorides

    Institute of Scientific and Technical Information of China (English)

    ZHANG Meng; HAN Wei; ZHANG Milin; ZHU Fengyan; XUE Yun; ZHANG Zhijian

    2013-01-01

    An electrochemical approach for the preparation of Mg-Li-Ce alloys by co-reduction of Mg,Li and Ce on a molybdenum electrode in KCl-LiCl-MgCl2-CeCl3 melts at 873 K was investigated.Cyclic voltammograms (CVs) and square wave voltammograms indicated that the underpotential deposition (UPD) of cerium on pre-deposited magnesium led to the formation of Mg-Ce alloys at electrode potentials around-1.87 V.The order of electrode reactions was as follows:discharge of Mg(Ⅱ) to Mg-metal,UPD of Ce on the surface of pre-deposited Mg with formation of Mg-Ce alloys,discharge of Ce(Ⅲ) to Ce-metal and after that the discharge of Li+ with the deposition of Mg-Li-Ce alloys,which was investigated by CVs,chronoamperometry,chronopotentiometry and open circuit chronopotentiometry.X-ray diffraction (XRD) illuminated that Mg-Li-Ce alloys with different phases were obtained via galvanostatic electrolysis by different current densities.The microstructures of Mg-Li-Ce alloys were characterized by optical microscopy (OM) and scanning electron microscopy (SEM),respectively.The analysis of energy dispersive spectrometry (EDS) showed that Ce existed at grain boundaries to restrain the grain growth.The compositions and the average grain sizes of Mg-Li-Ce alloys could be obtained controllably corresponding with the phase structures of the XRD patterns.

  4. CE microchips: an opened gate to food analysis.

    Science.gov (United States)

    Escarpa, Alberto; González, María Cristina; Crevillén, Agustín González; Blasco, Antonio Javier

    2007-03-01

    CE microchips are the first generation of micrototal analysis systems (-TAS) emerging in the miniaturization scene of food analysis. CE microchips for food analysis are fabricated in both glass and polymer materials, such as PDMS and poly(methyl methacrylate) (PMMA), and use simple layouts of simple and double T crosses. Nowadays, the detection route preferred is electrochemical in both, amperometry and conductivity modes, using end-channel and contactless configurations, respectively. Food applications using CE microchips are now emerging since food samples present complex matrices, the selectivity being a very important challenge because the total integration of analytical steps into microchip format is very difficult. As a consequence, the first contributions that have recently appeared in the relevant literature are based primarily on fast separations of analytes of high food significance. These protocols are combined with different strategies to achieve selectivity using a suitable nonextensive sample preparation and/or strategically choosing detection routes. Polyphenolic compounds, amino acids, preservatives, and organic and inorganic ions have been studied using CE microchips. Thus, new and exciting future expectations arise in the domain of food analysis. However, several drawbacks could easily be found and assumed within the miniaturization map.

  5. Magnetic Phase Transitions of CeSb. I

    DEFF Research Database (Denmark)

    Fischer, Pernille Hertz; Lebech, Bente; Meier, G.;

    1978-01-01

    The magnetic ordering of the anomalous antiferromagnet CeSb, which has a NaCl crystal structure, was determined in zero applied magnetic field by means of neutron diffraction investigations of single crystals and powder. Below the Neel temperature TN of (16.1+or-0.1)K, there exist six partially d...

  6. Estimation of bulk transfer coefficient for latent heat flux (Ce)

    Digital Repository Service at National Institute of Oceanography (India)

    Sadhuram, Y.

    The bulk transfer coefficient for latent heat flux (Ce) has been estimated over the Arabian Sea from the moisture budget during the pre-monsoon season of 1988. The computations have been made over two regions (A: 0-8 degrees N: 60-68 degrees E: B: 0...

  7. Itinerant magnetism in CeRh3B2

    DEFF Research Database (Denmark)

    Eriksson, Olle; Johansson, Börje; Brooks, M. S. S.;

    1989-01-01

    Spin-polarized energy-band calculations, including spin-orbit coupling in the band Hamiltonian, have been performed on CeRh3B2. Good agreement is obtained between theory and experiment concerning the magnetic moment. It is also found that the magnetic moment varies strongly with volume and from...

  8. CeBIT为ICT发展奠定基石

    Institute of Scientific and Technical Information of China (English)

    电子贸促会

    2010-01-01

    @@ 德国当地时间3月6日.全球规模最大的ICT产业盛会-汉诺威消费电子、信息及通信博览会(CeBIT2010)在德国汉诺威博览中心正式落下帷幕.在此间举行的CeBIT闭幕新闻发布会上,主办方德国汉诺威展览公司董事局成员劳尔说:"本次展会的成功举办充分体现了CeBIT展所带来的行业影响力,并为未来几个月的商业发展奠定了稳固基石.为吸引新的目标群体以及巩固CeBIT的领导地位,下届展会将会更加强化各大展区主题."

  9. A Sesame Equation of State for Dense Ce

    Energy Technology Data Exchange (ETDEWEB)

    Greeff, Carl William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Crockett, Scott [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-03-15

    We generated a new Sesame equation of state table for Ce. It is a single effective phase table for the high density phases α, α ', ϵ and liquid. Also, the EOS is meant to be used with a ramp to represent the initial low density γ phase.

  10. New CeMgCo4 and Ce2MgCo9 compounds: Hydrogenation properties and crystal structure of hydrides

    Science.gov (United States)

    Denys, R. V.; Riabov, A. B.; Černý, R.; Koval'chuk, I. V.; Zavaliy, I. Yu.

    2012-03-01

    Two new ternary intermetallic compounds, CeMgCo4 (C15b pseudo-Laves phase, MgCu4Sn type) and Ce2MgCo9 (substitution derivative of PuNi3 type) were synthesized by mechanical alloying method. The structural and hydrogenation properties of these compounds were studied by X-ray diffraction and Pressure-Composition-Temperature measurements. Both compounds absorb hydrogen at room temperature and pressures below 10 MPa forming hydrides with maximum compositions CeMgCo4H6 and Ce2MgCo9H12. Single plateau behavior was observed in P-C isotherm during hydrogen absorption/desorption by Ce2MgCo9 alloy. The CeMgCo4-H2 system is characterized by the presence of two absorption/desorption plateaus corresponding to formation of β-CeMgCo4H4 and γ-CeMgCo4H6 hydride phases. The structure of β-hydride CeMgCo4H(D)4 was determined from X-ray and neutron powder diffraction data. In this structure initial cubic symmetry of CeMgCo4 is preserved and hydrogen atoms fill only one type of interstitial sites, triangular MgCo2 faces. These positions are occupied by 70% and form octahedron around Mg atom with Mg-D bond distances 1.84 Å.

  11. Luminescence properties of Gd2Si2O7:Ce and Gd2Si2O7:La,Ce under vacuum ultraviolet irradiation

    Institute of Scientific and Technical Information of China (English)

    M Koshimizu; T Yanagida; Y Fujimoto; K Asai

    2016-01-01

    The luminescence properties of Ce-or Ce and La-doped gadolinium pyrosilicate (Gd2Si2O7, GPS) were characterized using vacuum ultraviolet (VUV) excitation light. A prominent emission band was observed in the luminescence spectra with excitation at 60 nm and ascribed to 5d-4f transition of Ce3+. Because the excitation wavelength of 60 nm corresponded to the excitation in the host matrix, this result indicated that the excitation energy transfer occurred from the host matrix to Ce3+ions. On the basis of the rise in the luminescence time profiles with excitation at 60 nm, the energy transfer occurred within 2 ns, which was much shorter than that of Ce-doped Gd2SiO5. For Ce-doped GPS, the decay rate was slower for the host excitation than that for direct excitation of Ce3+. In contrast, for Ce and La-doped GPS, no significant difference was observed for the host excitation and direct excitation of Ce3+. This result indicated that the energy transfer from the host to Ce3+ions led to a different radiative decay process, and that La doping had an effect on the energy transfer and decay process.

  12. <em>An entem>-Kaurane-Type Diterpene in <em>Croton antisyphiliticusem> Mart.

    Directory of Open Access Journals (Sweden)

    Ana Maria Pereira

    2012-07-01

    Full Text Available <em>Croton antisyphiliticus em>is a medicinal plant widely used in the treatment of microbial infections, especially those affecting the genital tract. Crude extract, fractions and pure compound isolated from roots of this species were investigated to validate their antimicrobial activity against <em>Escherichia coliem> and <em>Staphylococcus aureusem>. The compound <em>ent>-kaur-16-en-18-oic acid was isolated as a major component (0.7% of crude extract, and its MIC value determined against <em>S. aureusem> (ATCC 6538 was 250 μg/mL. This is the first phytochemical work on the species monitored with antimicrobial assay.

  13. Ce3+-ion-induced visible-light photocatalytic degradation and electrochemical activity of ZnO/CeO2 nanocomposite

    Science.gov (United States)

    Rajendran, Saravanan; Khan, Mohammad Mansoob; Gracia, F.; Qin, Jiaqian; Gupta, Vinod Kumar; Arumainathan, Stephen

    2016-08-01

    In this study, pure ZnO, CeO2 and ZnO/CeO2 nanocomposites were synthesized using a thermal decomposition method and subsequently characterized using different standard techniques. High-resolution X-ray photoelectron spectroscopy measurements confirmed the oxidation states and presence of Zn2+, Ce4+, Ce3+ and different bonded oxygen species in the nanocomposites. The prepared pure ZnO and CeO2 as well as the ZnO/CeO2 nanocomposites with various proportions of ZnO and CeO2 were tested for photocatalytic degradation of methyl orange, methylene blue and phenol under visible-light irradiation. The optimized and highly efficient ZnO/CeO2 (90:10) nanocomposite exhibited enhanced photocatalytic degradation performance for the degradation of methyl orange, methylene blue, and phenol as well as industrial textile effluent compared to ZnO, CeO2 and the other investigated nanocomposites. Moreover, the recycling results demonstrate that the ZnO/CeO2 (90:10) nanocomposite exhibited good stability and long-term durability. Furthermore, the prepared ZnO/CeO2 nanocomposites were used for the electrochemical detection of uric acid and ascorbic acid. The ZnO/CeO2 (90:10) nanocomposite also demonstrated the best detection, sensitivity and performance among the investigated materials in this application. These findings suggest that the synthesized ZnO/CeO2 (90:10) nanocomposite could be effectively used in various applications.

  14. Preparation and Characterization of CeO2/YSZ/CeO2 Buffer Layers for YBCO Coated Conductors

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    CeO2 seed layer was deposited on rolling-assisted biaxially textured metal substrates by direct-current (DC) magnetron reactive sputtering. The effect of deposition temperature on epitaxial orientation of CeO2 thin films was examined. High quality CeO2 layers were achieved at deposition temperature from 750℃ to 850℃.Subsequently yttria-stabilized zirconia (YSZ) and CeO2 films were deposited to complete the buffer layer structure via the same process. The best samples exhibited a highly biaxial texture, as indicated by FWHM (full width half maximum) values in the range of 4°-5°, and 2°-4° for in-plane and out-of-plane orientations,respectively. Secondary ion mass spectrometer analysis confirmed the effective prevention of buffer layer against Ni and W metal interdiffusion. Atomic force microscope observations revealed a smooth, dense and crack-free surface morphology, which provided themselves as the good buffer structure to the YBa2Cu3O7-δ(YBCO) coated conductors.

  15. The equiatomic intermetallics REPtCd (RE = La, Ce, Pr, Nd, Eu) and magnetic properties of CeAuCd

    Energy Technology Data Exchange (ETDEWEB)

    Johnscher, Michael; Niehaus, Oliver; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Tappe, Frank [Hochschule Hamm-Lippstadt, Hamm (Germany)

    2015-06-01

    The cadmium intermetallics REPtCd (RE = La, Ce, Pr, Nd, Eu) and CeAuCd were synthesized by induction-melting of the elements in sealed niobium ampoules followed by annealing in muffle furnaces. The samples were characterized by powder X-ray diffraction. The structures of CePtCd (ZrNiAl type, P anti 62m, a = 763.8(6), c = 409.1(4) pm, wR2 = 0.0195, 298 F{sup 2} values, 14 variables) and EuPtCd (TiNiSi type, Pnma, a = 741.3(2), b = 436.4(1), c = 858.0(4) pm, wR2 = 0.0385, 440 F{sup 2} values, 20 variables) were refined from single-crystal data. The REPtCd structures exhibit three-dimensional networks of corner- and edge-sharing Cd rate at Pt{sub 2/6}Pt{sub 2/3} and Cd rate at Pt{sub 4/4} tetrahedra, which leave cages for the rare earth atoms. Temperature-dependent magnetic susceptibility data of CeAuCd reveal a paramagnetic to antiferromagnetic phase transition at T{sub N} = 3.7(5) K.

  16. Easy peak tracking in CE-UV and CE-UV-ESI-MS by incorporating temperature-correlated mobility scaling

    DEFF Research Database (Denmark)

    Li, Bin; Petersen, Nickolaj Jacob; Andersen, Line Hvass;

    2013-01-01

    A simple data reconstruction technique in capillary electrophoresis - ultraviolet - electrospray ionization - mass spectrometry (CE-UV-ESI-MS) is presented to overcome the drift in mobilities caused by various factors compromising the reproducibility of such data, e.g. Joule heating effects...

  17. Magnetic properties of Ce3+ in PbCeA (A= Te, Se, S

    Directory of Open Access Journals (Sweden)

    Golacki Z.

    2013-01-01

    Full Text Available The magnetic susceptibility of Pb1-xCexA (A = S, Se and Te crystals with 0.006 ≤  x ≤ 0.036  were studied in the temperature range from 20 mK up to room temperature. X-band (~9.5 GHz Electron Paramagnetic Resonance (EPR showed small shifts in the effective Landé factors that were attributed to crystal-field admixture. The EPR measurements were correlated with the magnetic susceptibility data and resulted in estimating the crystal-field splitting Δ = E(Γ8 - E(Γ7 of the lowest 2F5/2 manifold for Ce3+ ions in PbA (A = S, Se and Te of about 340 K, 440 K and 540 K for Pb1-xCexTe, Pb1-xCexSe, and Pb1-xCexS, respectively. The values for the crystal-field splitting deduced from the magnetic data were found to be in agreement with the calculated ones based on the point charge model. Moreover, the deHaas van-Alphen magnetic oscillations in the susceptibility measurements of Pb1-xCexTe (x~ 0.05 and 0.07 were observed at ultra-low temperature (20 mK; The oscillations were investigated and the values of the oscillatory period for Pb1-xCexTe (x = 0.0048 and 0.007 are reported.

  18. In-situ electrochemical route to aerogel electrode materials of graphene and hexagonal CeO₂.

    Science.gov (United States)

    Chen, Kunfeng; Xue, Dongfeng

    2015-05-15

    We reported a one-step in-situ electrochemical route to synthesize 3D aerogel electrode materials including graphene and hexagonal CeO2 composites. The graphene/CeO2 aerogel can be formed via freeze-drying graphene/CeO2 colloidal solution that was obtained by electrochemical exfoliation of graphite anode and in-situ deposition of CeO2 nanoparticles on graphene sheets in mixing electrolyte of (NH4)2SO4/Ce(NO3)3 and (NH4)2SO4/(NH4)2Ce(NO3)6. The as-obtained CeO2 nanoparticles were closely contacted with graphene, which can enhance the synergistic effect between graphene and CeO2. It is interesting that the as-obtained CeO2 products possessed hexagonal crystal structure that was rarely reported. The Faradaic reactivity of the graphene/CeO2 composites as supercapacitor was enhanced with the increase of the concentration of Ce salts in initial electrolyte. The introduction of CeO2 to graphene electrode can lead to the presence of additional pseudocapacitance besides the electric double-layer capacitance. This simple one-step in-situ electrochemical route can be extended to synthesize various graphene/metal oxide aerogel electrode materials for electric energy storage.

  19. Electronic structure of CeO studied by a four-component relativistic configuration interaction method.

    Science.gov (United States)

    Moriyama, Hiroko; Tatewaki, Hiroshi; Yamamoto, Shigeyoshi

    2013-06-14

    We studied the ground and excited states of CeO using the restricted active space CI method in the energy range below 25,000 cm(-1). Energy levels are computed to within errors of 2700 cm(-1). Electron correlation effects arising from the ionic core composed of Ce5s, 5p, 4f(*), 5d(*), and O2s, 2p spinors play crucial role to CeO spectra, as well as correlation effects of electrons distributed in the valence Ce 4f, 5d, 6s, and 6p spinors. Here, 4f(*) and 5d(*) denote spinors expanded to describe electron polarization between Ce and O. A bonding mechanism is proposed for CeO. As the two separate atoms in their ground states, Ce(4f(1)5d(1)6s(2))(1)G4 and O(2s(2)2p(4))(3)P2, approach each other, a CeO(2+) core is formed by two-electron transfer from Ce5d, 6s to O2p. Inside this ellipsoidal ion, a valence bond between Ce5p and O2s and an ionic bond between O2p and Ce5p are formed with back-donation through Ce 4f(*) and 5d(*). PMID:23781798

  20. Hydrolysis Activities of Resins of Complexes Made from Polysaccharides and Ce4+

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Resins of complexes made from agarose-Ce4+ (RCA-Ce) and chitosan-Ce4+ (RCC-Ce) were prepared. Hydrolysis rates of methamidophos, omethoate and chlorpyrifos treated by RCA-Ce were 32.39%, 27.12% and 46.62%, respectively, those of chlorpyrifos and methamidophos in mung bean sprout juice 38.28% and 35.45%, and that of chlorpyrifos in tea extract 59.76%. Hydrolysis rates of protein in tea extract treated by RCA-Ce increased by 86.46%. RCC-Ce could be employed in the apple juice production. The contents of methamidophos and parathion-methyl in the juice treated by RCC-Ce decreased 58.76% and 71.92%. Furthermore, RCC-Ce was used to clarification for beer by the ways of a column. RCC-Ce could hydrolyze sensitive protein and increase contents of free amino acid in the beer. Therefore, the beer treated by RCC-Ce could stay oxidation and aging procedure due to some metal ions being absorbed by RCC-Ce.

  1. Effect of CeO2 Infiltration on Hybrid Direct Carbon Fuel Cell Performance

    DEFF Research Database (Denmark)

    Ippolito, Davide; Deleebeeck, Lisa; Kammer Hansen, Kent

    2014-01-01

    The effect of CeO2 infiltration into the anode or CeO2 mixed with the carbon-fuel on the performance of a Hybrid Direct Carbon Fuel Cell (HDCFC) was studied through the use of polarization curves and electrochemical impedance spectroscopy. The use CeO2 in both ways helped to increase the cell...

  2. Expression of Selected <em>Ginkgo em>>biloba em>Heat Shock Protein Genes After Cold Treatment Could Be Induced by Other Abiotic Stress

    Directory of Open Access Journals (Sweden)

    Feng Xu

    2012-05-01

    Full Text Available Heat shock proteins (HSPs play various stress-protective roles in plants. In this study, three <em>HSP> genes were isolated from a suppression subtractive hybridization (SSH cDNA library of <em>Ginkgo bilobaem> leaves treated with cold stress. Based on the molecular weight, the three genes were designated <em>GbHSP16.8em>, <em>GbHSP17em> and <em>GbHSP70em>. The full length of the three genes were predicted to encode three polypeptide chains containing 149 amino acids (Aa, 152 Aa, and 657 Aa, and their corresponding molecular weights were predicted as follows: 16.67 kDa, 17.39 kDa, and 71.81 kDa respectively. The three genes exhibited distinctive expression patterns in different organs or development stages. <em>GbHSP16.8em> and <em>GbHSP70em> showed high expression levels in leaves and a low level in gynoecia, <em>GbHSP17em> showed a higher transcription in stamens and lower level in fruit. This result indicates that <em>GbHSP16.8em> and <em>GbHSP70 em>may play important roles in <em>Ginkgo> leaf development and photosynthesis, and <em>GbHSP17em> may play a positive role in pollen maturation. All three <em>GbHSPs> were up-regulated under cold stress, whereas extreme heat stress only caused up-regulation of <em>GbHSP70em>, UV-B treatment resulted in up-regulation of <em>GbHSP16.8em> and <em>GbHSP17em>, wounding treatment resulted in up-regulation of <em>GbHSP16.8em> and <em>GbHSP70em>, and abscisic acid (ABA treatment caused up-regulation of <em>GbHSP70em> primarily.

  3. Características agronômicas do amendoinzeiro sob irrigação com águas salinas em solo com biofertilizantes = Agronomics Characteristicsof Peanuts under irrigation with saline water on soil with biofertilizers.

    OpenAIRE

    Geocleber Gomes de Sousa; Benito Moreira de Azevedo; André Henrique Pinheiro Albuquerque; José Bruno Rego de Mesquita; Thales Vinicius de Araújo Viana

    2012-01-01

    Objetivou-se com esse trabalho avaliar o efeito da salinidade da água de irrigação nas características agronômicas do amendoinzeiro (Arachis hypogaea L.) cultivado em solo sem e com biofertilizantes. O experimento foi conduzido em estufa telada na Estação Agrometereológica, Campus do Pici, Fortaleza, CE. A semeadura foi feita em vasos utilizando-se, como substrato, um Argissolo Vermelho-Amarelo, com uma planta por vaso. O experimento obedeceu a um delineamento inteiramente casualizado, em esq...

  4. Controle de Sitophilus zeamais Mots., 1855 (Coleoptera: Curculionidae com inseticidas empregados em frutíferas temperadas

    Directory of Open Access Journals (Sweden)

    Faria João Luiz

    2005-01-01

    Full Text Available O gorgulho do milho Sitophilus zeamais Mots. tem sido relatado com freqüência atacando frutíferas temperadas em condições de campo, com destaque para o pessegueiro em Pelotas, RS, macieira em Fraiburgo, SC e videira na Serra Gaúcha, RS. Este trabalho avaliou, em laboratório, o efeito dos inseticidas deltametrina (Decis 25 CE, 40mL 100L-1, dimetoato (Dimetoato 400 CE, 150mL 100L-1, triclorfon (Dipterex 500 SNAqC, 300mL 100L-1, fosmet (Imidan 500 PM, 200g 100L-1, fention (Lebaycid 500 CE, 100mL 100L-1, clorpirifós (Lorsban 480 BR, 150mL 100L-1, malation (Malation 1000, 200mL 100L-1, carbaril (Sevin 480 SC, 360mL 100L-1, fenitrotion (Sumithion 500 CE, 150mL 100L-1 e metidation (Supracid 400 CE, 100mL 100L-1 atualmente empregados no controle de pragas em frutíferas temperadas e os novos inseticidas tiametoxam (Actara 250 WG, 15 e 30g 100L-1, benzoato de emamectina (Proclaim 5 SG, 10 e 20g 100L-1, imidacloprid (Provado 200 SC, 30 e 60mL 100L-1, spinosad (Tracer 480 CE, 10 e 20mL 100L-1 e etofenprox (Trebon 100 SC, 100 e 150mL 100L-1. No primeiro experimento, frutos de maçã foram mergulhados na calda inseticida por 10 segundos e oferecidos a adultos de S. zeamais sp (contato residual e, no segundo, os produtos foram aplicados diretamente sobre os insetos (contato direto em torre de pulverização. Os inseticidas triclorfon (150g 100L-1, fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, metidation (40g 100L-1 e tiametoxam (3,75 e 7,5g 100L-1 foram eficientes no controle do gorgulho do milho, via contato residual, enquanto fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, fenitrotion (75g 100L-1 e metidation (40g 100L-1 foram eficientes via contato direto.

  5. Comparison between the Oxygen Reduction Reaction Activity of Pd5Ce and Pt5Ce

    DEFF Research Database (Denmark)

    Tripkovic, Vladimir; Zheng, Jian; Rizzi, Gian Andrea;

    2015-01-01

    if results on a several-fold activity increase of a series of Pt/rare-earth alloys hold also for Pd rare-earth alloys. Pd5Ce crystallizes in two phases, a so-called low-temperature phase, L-Pd5Ce, which has a cubic symmetry, and a high-temperature phase, H-Pd5Ce, with a hexagonal symmetry. In both cases...

  6. Osteoartrites em equinos

    OpenAIRE

    Rocha, Francisco José Martins

    2008-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A Osteoartrite (OA) é a principal causa de claudicação no cavalo de desporto e lazer, sendo uma afecção que tem grandes repercussões económicas. Este trabalho descreve algumas das características importantes da estrutura articular, bem como da sua fisiologia. Define a OA e todas as estruturas envolvidas no seu processo. Os mecanismos fisiopatológicos põem em evidência os factores de risco em causa e que determinam tod...

  7. Homeopatia em Pediatria

    OpenAIRE

    Pinto, Ana Isabel Alves

    2013-01-01

    Numa sociedade em constante processo de formação e de informação, não conhecer determinada terapia não pode ser a resposta de um profissional de farmácia ao seu utente. A divulgação massiva de tratamentos naturalistas, alternativos e baseados em saberes ancestrais, frequentemente entram em conflito com as prescrições médicas e aconselhamentos farmacêuticos. Com as medicinas alternativas a ganhar terreno paulatinamente, como se observa com a utilização da acupunctura e de fitote...

  8. Morphology-dependent bactericidal activities of Ag/CeO2 catalysts against Escherichia coli.

    Science.gov (United States)

    Wang, Lian; He, Hong; Yu, Yunbo; Sun, Li; Liu, Sijin; Zhang, Changbin; He, Lian

    2014-06-01

    Silver-loaded CeO2 nanomaterials (Ag/CeO2) including Ag/CeO2 nanorods, nanocubes, nanoparticles were prepared with hydrothermal and impregnation methods. Catalytic inactivation of Escherichia coli with Ag/CeO2 catalysts through the formation of reactive oxygen species (ROS) was investigated. For comparison purposes, the bactericidal activities of CeO2 nanorods, nanocubes and nanoparticles were also studied. There was a 3-4 log order improvement in the inactivation of E. coli with Ag/CeO2 catalysts compared with CeO2 catalysts. Temperature-programmed reduction of H2 showed that Ag/CeO2 catalysts had higher catalytic oxidation ability than CeO2 catalysts, which was the reason for that Ag/CeO2 catalysts exhibited stronger bactericidal activities than CeO2 catalysts. Further, the bactericidal activities of CeO2 and Ag/CeO2 depend on their shapes. Results of 5,5-dimethyl-1-pyrroline-N-oxide spin-trapping measurements by electron spin resonance and addition of catalase as a scavenger indicated the formation of OH, O2(-), and H2O2, which caused the obvious bactericidal activity of catalysts. The stronger chemical bond between Ag and CeO2 nanorods led to lower Ag(+) elution concentrations. The toxicity of Ag(+) eluted from the catalysts did not play an important role during the bactericidal process. Experimental results also indicated that Ag/CeO2 induced the production of intracellular ROS and disruption of the cell wall and cell membrane. A possible production mechanism of ROS and bactericidal mechanism of catalytic oxidation were proposed. PMID:24662462

  9. Air, aqueous and thermal stabilities of Ce3+ ions in cerium oxide nanoparticle layers with substrates

    KAUST Repository

    Naganuma, Tamaki

    2014-01-01

    Abundant oxygen vacancies coexisting with Ce3+ ions in fluorite cerium oxide nanoparticles (CNPs) have the potential to enhance catalytic ability, but the ratio of unstable Ce3+ ions in CNPs is typically low. Our recent work, however, demonstrated that the abundant Ce3+ ions created in cerium oxide nanoparticle layers (CNPLs) by Ar ion irradiation were stable in air at room temperature. Ce valence states in CNPs correlate with the catalytic ability that involves redox reactions between Ce3+ and Ce4+ ions in given application environments (e.g. high temperature in carbon monoxide gas conversion and immersion conditions in biomedical applications). To better understand the mechanism by which Ce3+ ions achieve stability in CNPLs, we examined (i) extra-long air-stability, (ii) thermal stability up to 500 °C, and (iii) aqueous stability of Ce 3+ ions in water, buffer solution and cell culture medium. It is noteworthy that air-stability of Ce3+ ions in CNPLs persisted for more than 1 year. Thermal stability results showed that oxidation of Ce 3+ to Ce4+ occurred at 350 °C in air. Highly concentrated Ce3+ ions in ultra-thin CNPLs slowly oxidized in water within 1 day, but stability was improved in the cell culture medium. Ce 3+ stability of CNPLs immersed in the medium was associated with phosphorus adsorption on the Ce3+ sites. This study also illuminates the potential interaction mechanisms of stable Ce3+ ions in CNPLs. These findings could be utilized to understand catalytic mechanisms of CNPs with abundant oxygen vacancies in their application environments. © The Royal Society of Chemistry 2014.

  10. COMPARISION OF THE COLOR PROPERTIES OF COMPOUNDS Ln2Ce2O7 AND Ln2CeZrO7

    OpenAIRE

    B. Hablovicova; P. Sulcova

    2015-01-01

    Pyrochlore type pigments Ln2Ce2O7 and Ln2CeZrO7 (Ln = Nd, Sm, Gd, Dy, Er, Yb and Y) prepared by solid-state reaction were investigated. Effect of rare earths and zirconium ions and calcination temperature (1400, 1500 and 1600oC for Ln2Ce2O7 and 1400, 1450 and 1500 C for Ln2CeZrO7) on their color properties in organic matrix and ceramic glazes, particle size distribution and phase composition were evaluated. The most interesting shades achieve compounds with the highest calcination temperature...

  11. Physical, biochemical and genetic characterization of enterocin CE5-1 produced by Enterococcus faecium CE5-1 isolated from Thai indigenous chicken intestinal tract

    Directory of Open Access Journals (Sweden)

    Kraiyot Saelim

    2015-06-01

    Full Text Available Enterocin CE5-1 produced by Enterococcus faecium CE5-1 isolated from the chicken gastrointestinal tract was active in the wide range of pH 2-10 and temperature 30-100°C and sensitive to proteolytic enzymes and -amylase. It remained active after storage at -20°C for 2 months. Moreover, enterocin CE5-1 showed antibacterial activity against lactobacilli, bacilli, listeria, staphylococci and enterococci, especially antibiotic-resistant enterococci. In vitro study of enterocin CE5-1 decreased the population of Ent. faecalis VanB from 6.03 to 4.03 log CFU/ml. The lethal mode of action of enterocin CE5-1 appeared to be pore and filament formation in the cell wall. PCR sequencing analysis revealed the presence of two open reading frames (ORFs, containing enterocin CE5-1 (entCE5-1 and enterocin immunity (entI gene. Therefore, enterocin CE5-1 from Ent. faecium CE5-1 could possibly be used as an antimicrobial agent to control foodborne pathogen, spoilage bacteria and antibiotic-resistant enterococci in foods, feeds and the environments.

  12. Redox potentials and kinetics of the Ce 3+/Ce 4+ redox reaction and solubility of cerium sulfates in sulfuric acid solutions

    Science.gov (United States)

    Paulenova, A.; Creager, S. E.; Navratil, J. D.; Wei, Y.

    Experimental work was performed with the aim of evaluating the Ce 4+/Ce 3+ redox couple in sulfuric acid electrolyte for use in redox flow battery (RFB) technology. The solubility of cerium sulfates in 0.1-4.0 M sulfuric acid at 20-60 °C was studied. A synergistic effect of both sulfuric acid concentration and temperature on the solubility of cerous sulfate was observed. The solubility of cerous sulfate significantly decreased with rising concentration of sulfuric acid and rising temperature, while the solubility of ceric sulfate goes through a significant maximum at 40 °C. Redox potentials and the kinetics of the cerous/ceric redox reaction were also studied under the same temperature-concentration conditions. The redox potentials were measured using the combined redox electrode (Pt-Ag/AgCl) in equimolar Ce 4+/Ce 3+ solutions (i.e.[Ce 3+]=[Ce 4+]) in sulfuric acid electrolyte. The Ce 3+/Ce 4+ redox potentials significantly decrease (i.e. shift to more negative values) with rising sulfuric acid concentration; a small maximum is observed at 40 °C. Cyclic voltammetric experiments confirmed slow electrochemical kinetics of the Ce 3+/Ce 4+ redox reaction on carbon glassy electrodes (CGEs) in sulfuric acid solutions. The observed dependencies of solubilities, the redox potentials and the kinetics of Ce 3+/Ce 4+ redox reaction on sulfuric acid concentration are thought to be the result of inequivalent complexation of the two redox species by sulfate anions: the ceric ion is much more strongly bound to sulfate than is the cerous ion. The best temperature-concentration conditions for the RFB electrolytes appear to be 40 °C and 1 M sulfuric acid, where the relatively good solubility of both cerium species, the maximum of redox potentials, and the more or less satisfying stability of CGE s were found. Even so, the relatively low solubility of cerium salts in sulfuric acid media and slow redox kinetics of the Ce 3+/Ce 4+ redox reaction at carbon indicate that the Ce 3+/Ce

  13. Molecular magnetism and crystal field effects in the Kondo system Ce{sub 3}Pd{sub 20}(Si,Ge){sub 6} with two Ce sublattices

    Energy Technology Data Exchange (ETDEWEB)

    Nikiforov, V.N. [M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Koksharov, Yu.A. [M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Kurnakov Institute of General and Inorganic Chemistry, Leninskii pr. 31, Moscow 119991 (Russian Federation); Gribanov, A.V. [M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Baran, M. [Institute of Physics, Polish Academy of Science, Warsaw (Poland); Irkhin, V.Yu., E-mail: valentin.irkhin@imp.uran.ru [Institute of Metal Physics, Ekaterinburg 620990 (Russian Federation)

    2015-06-01

    The unusual electronic and magnetic properties of the systems Ce{sub 3}Pd{sub 20}T{sub 6} (T=Ge, Si) with two non-equivalent Ce positions are discussed. The logarithmic growth of resistance for both systems confirms the presence of the Kondo effect in the two respective temperature ranges. The two-scale behavior is explained by consecutive splitting of Ce ion levels in the crystal field. The effects of the frustration caused by the coexistence of the different Ce positions are treated, which may also significantly enhance the observed values of specific heat. A model of “molecular magnetism” with Ce2 cubes is developed. - Highlights: • We study unusual properties of the systems Ce{sub 3}Pd{sub 20}T{sub 6} with two Ce positions. • The logarithmic growth of resistance confirms presence of the Kondo effect. • The effects of the frustration owing to different Ce positions are discussed. • A model of “molecular magnetism” with Ce2 cubes is developed.

  14. Synthesis and characterization of manganese doped CeO2 nanopowders from hydrolysis and oxidation of Ce37Mn18C45

    Institute of Scientific and Technical Information of China (English)

    DU Yanan; NI Jiansen; HU Pengfei; WANG Jun'an; HOU Xueling; XU Hui

    2013-01-01

    The Mn-doped CeO2 nanopowders with high catalysis activity were successfully fabricated through a simple hydrolyzed-oxidized approach.Firstly,the alloy Ce37Mn18C45 was prepared in vacuum induction melting furnace.Subsequently,Mn-doped CeO2 nanopowders with 142 m2/g of specific surface area were obtained through a simple hydrolyzed-oxidized procedure of the alloy.Those nanopowders were heat treated at different temperatures.The obtained materials were characterized by X-ray diffraction (XRD),transmission electron microscopy (TEM),high-resolution transmission electron microscopy (HRTEM) and energy dispersive spectroscopy (EDS).And the catalytic activity on vinyl chloride (VC) emission combustion was investigated.The results showed that those nanopowders after hydrolyzed-oxidized from Ce37Mn1sC45 mainly consisted of CeO2 and Mn3O4.Manganese element increased the thermal stability of CeO2 nanopowders.The Mn-doped CeO2 nanopowders had three morphologies.Small particles were Mn-doped CeO2,square particles were Mn3O4 and the rods were Mn3O4 and Mn2O3.The Mn-doped CeO2 nanopowders had good vinyl chloride (VC) emission catalytic performance.

  15. Influence of CeO_2 on scintillating properties of Tb~(3+)-doped silicate glasses

    Institute of Scientific and Technical Information of China (English)

    孙心瑗; 顾牡; 张敏; 黄世明

    2010-01-01

    A series of Tb3+-,Ce3+-doped,and Tb3+/Ce3+-codoped silicate glasses were synthesized by melt-quenching technique.Some properties of the investigated glasses were characterized by X-ray photoelectron spectroscopy(XPS),photoluminescence(PL),X-ray excited luminescence(XEL) and thermoluminescence(TL) spectra.The result of XPS revealed that both Ce3+ and Ce4+ ions coexisted in these silicate glasses,and energy transfer from Ce3+ to Tb3+ ions was observed under UV excitation.However,under X-ray excitation the XEL...

  16. Violet/blue photoluminescence from CeO2 thin film

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    CeO2 thin film was fabricated by dual ion beam epitaxial technique. The violet/blue PL at room temperature and lower temperature was observed from the CeO2 thin film. After the analysis of crystal structure and valence in the compound was carried out by the XRD and XPS technique, it was inferred that the origin of CeO2 PL was due to the electrons transition from Ce4f band to O2p band and the defect level to O2p band. And these defects levels were located in the range of 1 eV around Ce4f band.

  17. Electron spectroscopic investigation of metal-insulator transition in Ce1-SrTiO3

    Indian Academy of Sciences (India)

    U Manju; S R Krishnakumar; Sugata Ray; S Raj; M Onoda; C Carbone; D D Sarma

    2003-10-01

    We have carried out detailed electron spectroscopic investigation of Ce1-SrTiO3 exhibiting insulator-metal transition with . Core level X-ray photoelectron spectra of Ce 3 as well as resonant photoemission spectra obtained at the Ce 4 → 4 resonant absorption threshold establish Ce as being in the trivalent state throughout the series. Using the `off-resonance’ condition for Ce 4 states, we obtain the Ti 3 dominated spectral features close to , exhibiting clear signatures of coherent and incoherent peaks. We discuss the implications of our findings in relation to the metal-insulator transition observed in this series of compounds.

  18. Chemical Composition and <em>in Vitroem> Evaluation of the Antioxidant and Antimicrobial Activities of <em>Eucalyptus gillii em>Essential Oil and Extracts<em>>

    Directory of Open Access Journals (Sweden)

    François Couderc

    2012-08-01

    Full Text Available In this study, essential oil and various extracts (hexane, petroleum ether, acetone, ethanol, methanol and water of <em>Eucalyptus giliiem> were screened for their chemical composition, antimicrobial and antioxidant activities. The essential oil chemical composition was analyzed by gas chromatography-mass spectrometry (GC-MS and gas chromatography-flame ionization detection (GC-FID, respectively. Thirty four compounds were identified, corresponding to 99.5% of the total essential oil. Tannins [104.9–251.3 g catechin equivalent (CE/Kg dry mass], flavonoids [3.3–34.3 g quercetin equivalent (QE/Kg dry mass], phenolics [4.7–216.6 g gallic acid equivalent (GAE/Kg dry mass] and anthocyannins [1.2–45.3 mg cyanidin-3-glucoside equivalent (C3GE/Kg dry mass] of various extracts were investigated. Free radical scavenging capacity of all samples was determinedt. In the 1,1-diphenyl-2-picrylhydrazyl (DPPH assay, the IC50 of essential oil was 163.5 ± 10.7 mg/L and in the 2,2'-azinobis-3-ethylbenzothiazoline-6-sulphonate (ABTS assay, it was 94.7 ± 7.1 mg/L. Among the various extracts, the water extract showed the best result (IC50 = 11.4 ± 0.6 mg/L in the DPPH assay which was comparable to vitamin C (IC50 = 4.4 ± 0.2 mg/L. The antimicrobial activities were evaluated against different bacterial and fungal strains. Gram positive bacteria were found to be more sensitive to the essential oil and extracts than Gram negative ones. Anthocyanins seem to have a major effect on the growth of <em>Bacillus subtilisem> (R2 = 0.79. A significant antifungal activity was observed against the yeast and fungi. Correlations between chemical composition and antioxidant activities were studied and R2 values were about 0.96 for the effect of phenolics on the DPPH assay.

  19. The data distribution of the ESPaCE project

    Science.gov (United States)

    Thuillot, W.

    2015-10-01

    In the framework of the European Union project entitled ESPaCE (European Satellite Partnership for Computing Ephemerides, 2011-2015) we have carried out research by collecting unexploited space data and ground-based data for providing new dynamical orbit models and ephemeris of natural satellites and spacecraft orbits. Besides new digitization of old astrometric plate data, Radio Science, VLBI tracking, Laser Ranging methods are applied to these goals. Furthermore shape and gravity field data, reference systems are provided for several natural satellites. This project intends to put all this material online for free access by the scientific community. We will describe the data acquisition and distribution performed and in particular the setup of the ESPaCE-NSDB astrometric database.

  20. Thermal Conductivity of Ce Doped Bi-2212 Superconductors

    Institute of Scientific and Technical Information of China (English)

    LI Bo; WU Bai-Mei; M.Ausloos

    2004-01-01

    The temperature dependence of the thermal conductivity in Bi2Sr2 Ca1-x Cex Cu2Oy x = 0.1, 0.2, 0.3, 0.4 is presented. With increasing Ce-doping level, the thermal conductivity peak under TC is suppressed then disappears,while another peak appears at low temperatures for the non-superconducting compounds. The numerical analysis shows that the thermal conductivity peak under TC can be well described by the normal electron relaxation-time contribution model, and the phonon-induced thermal conductivity peak could be well described within the Debye approximation of the phonon spectrum. The existence and variation of these two thermal conductivity peaks indicate the adjustability between the superconducting and insulating components in the samples with different Ce-doping levels.

  1. Boèce, Traité de la musique

    OpenAIRE

    Lejbowicz, Max

    2008-01-01

    Le destin du De institutione musica de Boèce est étrange. Si l’on excepte une allusion purement rhétorique de son rival Cassiodore, trois siècles séparent la rédaction du texte de son premier témoin, sans que les spécialistes se soient accordés sur l’origine de l’archétype (voir, dans le livre sous examen, les p. 12-13). Mais, à partir de cette résurgence, quel succès ! Entre le VIIIe et le XVe s., ce sont près de cent soixante-dix manuscrits qu’il faut compter, tandis que la Renaissance l’éd...

  2. CeBIT:"数字"嘉年华

    Institute of Scientific and Technical Information of China (English)

    李璐

    2006-01-01

    @@ 随着全球ICT技术和产业迅猛发展,ICT市场持续稳定增长,全球规模最大的信息和通信技术盛会CeBIT(汉诺威信息及通信技术博览会)受到越来越多人的关注.2006年3月9~15日,CeBIT2006再次在德国汉诺威市隆重举行,展会全面展示整个信息及通信技术领域最新产品,也为知识转让和网络化提供了平台.

  3. Identification and Quality Assessment of Chrysanthemum Buds by CE Fingerprinting

    Directory of Open Access Journals (Sweden)

    Xiaoping Xing

    2015-01-01

    Full Text Available A simple and efficient fingerprinting method for chrysanthemum buds was developed with the aim of establishing a quality control protocol based on biochemical makeup. Chrysanthemum bud samples were successively extracted by water and alcohol. The fingerprints of the chrysanthemum buds samples were obtained using capillary electrophoresis and electrochemical detection (CE-ED employing copper and carbon working electrodes to capture all of the chemical information. 10 batches of chrysanthemum buds were collected from different regions and various factories to establish the baseline fingerprint. The experimental data of 10 batches electropherogram buds by CE were analyzed by correlation coefficient and the included angle cosine methods. A standard chrysanthemum bud fingerprint including 24 common peaks was established, 12 from each electrode, which was successfully applied to identify and distinguish between chrysanthemum buds from 2 other chrysanthemum species. These results demonstrate that fingerprint analysis can be used as an important criterion for chrysanthemum buds quality control.

  4. Ni-CeO2 Cermets Synthesis by Solid State Sintering of Ni/CeO2 Multilayer

    Directory of Open Access Journals (Sweden)

    Aleksandras ILJINAS

    2013-12-01

    Full Text Available Nickel and gadolinium doped cerium oxide (GDC cermet is intensively investigated for an application as an anode material for solid oxide fuel cells based on various electrolytes. The purpose of the present investigation is to analyze morphology, microstructure, and optical properties of deposited and annealed for one hour in the temperatures from 500 ºC to 900 ºC Ni/CeO2 multilayer thin films deposited by sputtering. The crystallographic structure of thin films was investigated by X-ray diffraction. The morphology of the film cross-section was investigated with scanning electron microscope. The elemental analysis of samples was investigated by energy-dispersive X-ray spectroscopy. The fitting of the optical reflectance data was made using Abeles matrix method that is used for the design of interference coatings. The film cross-section of the post-annealed samples consisted of four layers. The first CeO2 layer (on Si had the same fine columnar structure with no features of Ni intermixing. The part of Ni (middle-layer after annealing was converted to NiO with grain size exceeding 100 nm. The CeO2 layer deposited on Ni was divided into two layers. Lower layer had small grains not exceeding 25 nm and consisting of NiO and CeO2 mixture. Upper layer consisted of CeO2 columns with approximate thickness of 50 nm. Ni sample annealed at 600 ºC was fully oxidized. The NiO thickness and refraction index were almost steady after annealing in various temperatures. The approximation of experimental reflectance data was successful only for the samples with one transparent homogeneous layer. The reflectance of the Ni/CeO2 samples annealed at intermediate temperatures could not be fitted using one-layer or three-layer model. That may show that a simplified model could not be implemented.  The real system has complicated distribution of refraction index. DOI: http://dx.doi.org/10.5755/j01.ms.19.4.3073

  5. Contamination in LaCl3:Ce Scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Milbrath, Brian D.; McIntyre, Justin I.; Runkle, Robert C.; Smith, Leon E.

    2005-12-01

    The gamma-, beta-, and x-ray-contamination in LaCl3:Ce scintillators due to the presence of the naturally occurring radioisotope La-138 is discussed. As the size of lanthanum halide crystals grows towards commercially useful sizes, and the effects of alpha-contamination due to Ac-227 has been substantially reduced, the effects of La-138 in background and low-count spectra become more problematic. The crystal's performance in high neutron fluxes is also examined.

  6. Proposal for product development model focused on ce certification methodology

    Directory of Open Access Journals (Sweden)

    Nathalia Marcia Goulart Pinheiro

    2015-09-01

    Full Text Available This paper presents a critical analysis comparing 21 product development models in order to identify whether these structures meet the demands Product Certification of the European Community (CE. Furthermore, it presents a product development model, comprising the steps in the models analyzed, including improvements in activities for referred product certification. The proposed improvements are justified by the growing quest for the internationalization of products and processes within companies.

  7. Burstein Moss effect in nanocrystalline CaS : Ce

    Indian Academy of Sciences (India)

    Geeta Sharma; Puja Chawla; S P Lochab; Nafa Singh

    2011-07-01

    The nanocrystalline CaS : Ce nanophosphors are synthesized by wet chemical co-precipitation method. The particles possess an average size of 10 nm as calculated using Debye–Scherrer formula. The particle size and the crystalline nature of the formed nanoparticles are confirmed by TEM micrograph. The optical studies are carried out using UV–Vis absorption spectroscopy. The absorption edge is found to show blue shift with increasing cerium concentration. The shift may be attributed to Burstein Moss effect.

  8. Structure of ∼130 nuclei in La–Ce region

    Indian Academy of Sciences (India)

    Tumpa Bhattacharjee

    2010-07-01

    The variety of shapes and structures, observed in light rare earth $A ∼ 130$ nuclei, have been discussed in view of different angular momentum coupling schemes and their interplay that comes into effect at high spin. The = 79 and 80 isotopes in La–Ce region, produced via fusion evaporation reaction, have been studied using the Indian National Gamma Array (INGA) consisting of 18 clover HPGe detectors. Two nearly degenerate = 1 bands have been observed at high spin of 137Ce and a triaxial deformation of = ± 30°$ has been assigned to the bands, from the total Routhian surface (TRS) calculations. The high-spin candidates of the yrast band of 138Ce show signature splitting both in energy and (1)/(2) values. The bandcrossing due to the alignment of a pair of ℎ11/2 proton particles has been conjectured at ħ ω ∼ 0.3 MeV, from the single-particle Routhians obtained from TRS calculations. Lifetime measurements by Doppler shift attenuation method (DSAM) has been carried out and from the estimated reduced transition probability (1), the = 1 band in 138Ce has been characterized as a magnetic rotation (MR) band. The rise in the values of (1), for the higher spin candidates of the band, has been conjectured as the reopening of a different shear at the top of the Band B1. The characteristic of the MR bands in ∼ 130 region has been discussed in the light of a phenomenological calculation and compared to the MR bands in other mass regions.

  9. Saccharinato complexes of Ce(V) with 2-hydroxypyridine: Synthesis, spectroscopic and thermal characteristics of [Ce(sac) 2(SO 4)(H 2O) 4] and [Ce(sac) 2(SO 4)(PyOH) 2

    Science.gov (United States)

    Gaballa, Akmal S.; Teleb, Said M.; Müller, Thomas

    2008-10-01

    The synthesis of Ce(IV) complexes [Ce(sac) 2(SO 4)(H 2O) 4] ( 1) and [Ce(sac) 2 (SO 4)(PyOH) 2] ( 2) (sac = saccharinate, PyOH = 2-hydroxypyridine) starting with sodium saccharinate is described. Their vibrational and nuclear magnetic resonance ( 1H, 13C) spectra as well as their thermal mode of degradation were investigated. The data indicate that sac in complex 1 behaves as a monodentate ligand through the nitrogen atoms. Saccharinato ligand in complex 2 shows different mode of coordination, where it behaves as tridentate and binds Ce(IV) through its carbonylic oxygen, nitrogen and sulphonylic oxygen atoms. The most probable structure in complex 2 is that, units of [Ce(sac) 2(SO 4)(PyOH) 2] are linked by bridges of the O- of sac sulphonyl leading to polymeric chains.

  10. Role of Ce in Yb/Al laser fibers: prevention of photodarkening and thermal effects.

    Science.gov (United States)

    Jetschke, Sylvia; Unger, Sonja; Schwuchow, Anka; Leich, Martin; Jäger, Matthias

    2016-06-13

    We report on detailed investigations of ytterbium (Yb) and aluminum (Al) doped silica fiber and preform samples co-doped with cerium (Ce). The prevention of pump-induced photodarkening (PD) by temporary oxidation of Ce3+ to Ce4+ (or rather Ce3++) was proved by observed modifications in the ultraviolet (UV) spectra of transient absorption during near-infrared (NIR) pumping of thin preform slices. Only a small part of available Ce3+ ions (absorption spectra disappeared completely when the pump power was switched-off. From these observations we conclude that the recombination to Ce3+ takes place very fast thereby enabling these ions to capture liberated holes h+ perpetually during further pumping. We found a concentration ratio of Ce/Yb ≈0.5 to be sufficient to reduce PD loss to 10% in comparison to Ce-free fibers. Thus, the thermal load caused by absorption of PD color centers at pump (and laser) wavelength is expected to be also reduced. Unfortunately, new heat sources arise with the presence of Ce which cannot be explained by the absorption of Ce ions at the pump wavelength but must be attributed to the interaction with excited Yb ions. Fiber temperature increase of more than 200 K was observed if both, Yb2O3 and Ce2O3 concentration exceed 0.4 mol%. PMID:27410320

  11. Preparation and characterization of CNT-CeO{sub 2} nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Jasmeet, E-mail: jasmeet.dayal@gmail.com; Anand, Kanika; Singh, Ravi Chand [Department of Physics, Guru Nanak Dev University, Amritsar-143005 (India)

    2015-06-24

    This paper reports decoration of CeO{sub 2} nanoparticles on multi-walled carbon nanotubes through a reflux process in which Ce (NO{sub 3}) {sub 3}·6H{sub 2}O serves as precursor and hydrazine hydrate (N{sub 2}H{sub 4}.H{sub 2}O) as reducing agent. Successful deposition of cubic fluorite CeO{sub 2} nanoparticles onto multi-walled carbon nanotubes has been confirmed by x-ray diffraction (XRD), Raman spectroscopy, field-emission scanning electron microscopy (FE-SEM) and energy dispersive x-ray spectroscopy (EDS). It was found that CeO{sub 2} nanoparticles formed in the presence of CNTs were larger as compared to pure CeO{sub 2} nanoparticles. Raman analysis showed that CeO{sub 2} induced a decrease in the size of the carbon grain in the CNTs. A red shift from 460 cm{sup −1} to 463 cm{sup −1} for F{sub 2g} mode of CeO{sub 2} has also been observed in Raman spectra of CNT- CeO{sub 2} nanocomposite as compared to pure CeO{sub 2}. The CeO{sub 2} coated multi-wall carbon nanotubes (CNT-CeO{sub 2}) nanocomposite would be a promising candidate for practical applications such as catalysis, sensing and power source applications.

  12. Collective magnetic response of CeO2 nanoparticles

    Science.gov (United States)

    Coey, Michael; Ackland, Karl; Venkatesan, Munuswamy; Sen, Siddhartha

    2016-07-01

    The magnetism of nanoparticles and thin films of wide-bandgap oxides that include no magnetic cations is an unsolved puzzle. Progress has been hampered by both the irreproducibility of much of the experimental data, and the lack of any generally accepted theoretical explanation. The characteristic signature is a virtually anhysteretic, temperature-independent magnetization curve that saturates in an applied field that is several orders of magnitude greater than the magnetization. It would seem as if a tiny volume fraction, sugar or latex microspheres. The saturation magnetization, Ms ≍ 60 A m-1 for compact samples, is maximized by 1 wt% lanthanum doping. Dispersing the CeO2 nanopowder reduces its magnetic moment by up to an order of magnitude, and there is a characteristic length scale of order 100 nm for the magnetism to appear in CeO2 nanoparticle clusters. The phenomenon is explained in terms of a giant orbital paramagnetism that appears in coherent mesoscopic domains due to resonant interaction with zero-point fluctuations of the vacuum electromagnetic field. The theory explains the observed temperature-independent magnetization curve and its doping and dispersion dependence, based on a length scale of 300 nm that corresponds to the wavelength of a maximum in the ultraviolet absorption spectrum of the magnetic CeO2 nanoparticles. The coherent domains occupy roughly 10% of the sample volume.

  13. Tunable luminescence from Ce-doped aluminoborosilicate glasses

    Institute of Scientific and Technical Information of China (English)

    E Malchukova; B Boizot

    2014-01-01

    A series of aluminoborosilicate glasses were prepared using the melt-quenching technique for mixture of stoichiometric amounts of SiO2, Al2O3, H3BO3, Na2CO3, and ZrO2 with adding of different amounts of CeO2. The samples were investigated by means of luminescence spectroscopy. Tunable luminescence from violet to blue/green was observed from these glasses with different Xe-lamp excitation wavelengths ranging from 370 to 480 nm as well as with laser excitation of 266 and 355 nm. Moreover it was found that the possibility of tuning the light by changing of excitation wavelength was not unique. The same effect was observed by adjusting conditions for luminescence measurements as well as under exposure toβ-irradiation. The obtained phenomena could be explained taking into account structural characteristics of this glass and it could be concluded that tunable luminescence results from the presence of different Ce-sites the glass matrix. Thus the results suggest that Ce-doped glasses could be considered as conversion materials for blue light-emitting diode chips to generate white light-emitting diodes.

  14. Level structure studies in 140La and 140Ce

    International Nuclear Information System (INIS)

    Energy and relative intensity measurements with precision have been done in 140Li and 140Ce using 8 c.c. Ge(Li) detector. In addition, gamma-gamma directional correlation measurements were carried out for 537-(14)-30, 305-(133)-30 and 305-162 keV cascades in 140Ia and 329-487, 487-1596 and 329-487, 487-1596 and 329-(487)-1596 keV cascades in 140Ce. From the data, spin assignments 0- and 1- have been made to the 581 and 468 keV levels in 140La. Multipole admixtures in 30,305,162,329, and 487 keV gamma-rays have been found to be M1+(2.5 +-.5)%E2, M1+(94+-1)%E2, M+(1+-.5)%E2, E2+(2+-1)%M3 and M1+0.25%E2 respectively. A comparison of experimental transition probabilities with Weisskopf estimates describes low lying states of 140La as states in which f7sub(/)2 neutron is coupled to unpaired proton and these of 140Ce, as single particle states with some core contribution. (author)

  15. Synthesis and Characterization of Ce-Containing MCM-41

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ SUMMARY. The cerium-containing MCM-41 (Ce-MCM-41) has been synthesized with size in the micrometer range by direct hydrothermal method. Transmission electron microscopy shows the regular hexagonal array of uniform channel characteristics of MCM-41. Five peaks were detected in the lov-angle XRD patterns,an interplanar spacing d100 = 40.6 A was obtained that can be indexed on a hexagonal unit cell with a0 = 46.9 A. Nitrogen adsorption isotherm at 77 K revealed a surface area of 920 m2/g, pore size of 26.2 A and wall thickness of 18.1 A. A cell contraction of 2.6 A upon calcination was observed. The spectroscopic studies indicate that the synthesized sample is with MCM-41 structure and Ce is in the framework position. A weak Lewis acidity was indicated by infrared spectra of pyridine adsorption. The synthesized Ce-MCM-41 exhibits fairly catalytic activity for the NO reduction by CO.

  16. Synthesis and Characterization of Ce-Containing MCM-41

    Institute of Scientific and Technical Information of China (English)

    CHIEN; ShuHua

    2001-01-01

    SUMMARY.  The cerium-containing MCM-41 (Ce-MCM-41) has been synthesized with size in the micrometer range by direct hydrothermal method. Transmission electron microscopy shows the regular hexagonal array of uniform channel characteristics of MCM-41. Five peaks were detected in the lov-angle XRD patterns,an interplanar spacing d100 = 40.6 A was obtained that can be indexed on a hexagonal unit cell with a0 = 46.9 A. Nitrogen adsorption isotherm at 77 K revealed a surface area of 920 m2/g, pore size of 26.2 A and wall thickness of 18.1 A. A cell contraction of 2.6 A upon calcination was observed. The spectroscopic studies indicate that the synthesized sample is with MCM-41 structure and Ce is in the framework position. A weak Lewis acidity was indicated by infrared spectra of pyridine adsorption. The synthesized Ce-MCM-41 exhibits fairly catalytic activity for the NO reduction by CO.  ……

  17. Radon gamma-ray spectrometry with YAP:Ce scintillator

    CERN Document Server

    Plastino, W; De Notaristefani, F

    2002-01-01

    The detection properties of a YAP:Ce scintillator (YAlO sub 3 :Ce crystal) optically coupled to a Hamamatsu H5784 photomultiplier with standard bialkali photocathode have been analyzed. In particular, the application to radon and radon-daughters gamma-ray spectrometry was investigated. The crystal response has been studied under severe extreme conditions to simulate environments of geophysical interest, particularly those found in geothermal and volcanic areas. Tests in water up to a temperature of 100 deg.C and in acids solutions such as HCl (37%), H sub 2 SO sub 4 (48%) and HNO sub 3 (65%) have been performed. The measurements with standard radon sources provided by the National Institute for Metrology of Ionizing Radiations (ENEA) have emphasized the non-hygroscopic properties of the scintillator and a small dependence of the light yield on temperature and HNO sub 3. The data collected in this first step of our research have pointed out that the YAP:Ce scintillator can allow high response stability for rad...

  18. Optical properties of CeO2 thin films

    Indian Academy of Sciences (India)

    S Debnath; M R Islam; M S R Khan

    2007-08-01

    Cerium oxide (CeO2) thin films have been prepared by electron beam evaporation technique onto glass substrate at a pressure of about 6 × 10-6 Torr. The thickness of CeO2 films ranges from 140–180 nm. The optical properties of cerium oxide films are studied in the wavelength range of 200–850 nm. The film is highly transparent in the visible region. It is also observed that the film has low reflectance in the ultra-violet region. The optical band gap of the film is determined and is found to decrease with the increase of film thickness. The values of absorption coefficient, extinction coefficient, refractive index, dielectric constant, phase angle and loss angle have been calculated from the optical measurements. The X-ray diffraction of the film showed that the film is crystalline in nature. The crystallite size of CeO2 films have been evaluated and found to be small. The experimental -values of the film agreed closely with the standard values.

  19. Oxygen non-stoichiometries in (Th0.7Ce0.3)O2-x

    International Nuclear Information System (INIS)

    Oxygen non-stoichiometry in (Th0.7Ce0.3)O2-x oxide solid solutions was investigated from the viewpoint of Ce reduction. The oxygen non-stoichiometry was experimentally determined by means of thermogravimetric analysis as a function of oxygen potential at 1173, 1273 and 1373 K. Features of the isotherms of oxygen non-stoichiometry in (Th0.7Ce0.3)O2-x similar to those in oxygen non-stoichiometric actinide and lanthanide dioxides were observed. The oxygen non-stoichiometry in (Th0.7Ce0.3)O2-x was compared with those of CeO2-x and (U0.7Ce0.3)O2-x. It was concluded that the Ce reduction has some relation to defect forms and their transformations in the solid solutions.

  20. Electrorheological Performance of SiO2 Particle Materials of Ce-Doping and Adsorbed Chitosan

    Institute of Scientific and Technical Information of China (English)

    Li Shuxin; Ma Shuzhen; Xu Mingyuan; Shang Yanli; Li Junran; Zhang Shaohua; Zhang Yuanjing; Gao Song

    2004-01-01

    The electrorheological(ER) materials of pure SiO2 ( Sample 1 ), Ce-doping SiO2 ( Ce-SiO2, Sample 2) and Ce-SiO2 adsorbed chitosan (Ce-SiO2-chitosan, Sample 3 ) were prepared using Na2SiO3, Ce( NO3 )3 and chitosan as starting materials. Their ER properties were studied. The results show that Ce-doping can enhance the ER activity of SiO2, and the ER activity of SiO2 can be further improved by adsorbing chitosan on the surfaces of Ce-SiO2 particles.The ER activity of a particle material is correlated with the average grain size, surface area, pore volume and average pore size of the material.

  1. Isolation of several metastable phases in Ce-Gd-Zr-O system

    International Nuclear Information System (INIS)

    Cerium based zirconates pyrochlore; Ce2Zr2O7 attracts special attention due to potential catalytic application of CeO2-ZrO2 system in various chemical reactions. The mechanistic studies revealed that oxygen stoichiometry between CeO2 and Ce2O3 plays an important role in Ce2Zr2O7 for oxygen storage and release at relatively lower temperature by fluctuation of oxidation state of cerium. The crystal chemical properties of CeO2-ZrO2 system studied under different redox conditions indicate that the pyrochlore lattice can be maintained by a mild oxygen intercalation. The instability of the stoichiometric CeO2-ZrO2 system with pyrochlore structure imposes a major challenge on the synthetic methods. Several metastable phases have been isolated, for the first time, by adopting various modified reaction parameters

  2. Energy transfer from Ce~(3+) to Tb~(3+) and Eu~(3+) in zinc phosphate glasses

    Institute of Scientific and Technical Information of China (English)

    马崇庚; 江莎; 周贤菊

    2010-01-01

    Ce3+,Eu3+ and Tb3+ singly doped and Ce3+/Eu3+ and Ce3+/Tb3+ co-doped zinc phosphate glasses were prepared by sintering P2O5,ZnO,Ce2(C2O4)3·10H2O and Eu2O3/Tb4O7 mixtures at 1200 °C in the air for 2 h and then annealing at 450 °C for 10 h.The obtained glasses were homogeneous and transparent.The glasses without Ce3+ were colorless and those with Ce3+ showed slightly yellow.The singly doped glasses showed strong emissions and excitations from doped trivalent rare earth ions.Strong energy transfer from Ce3+ to...

  3. Structure and Dielectric Study of Ce3 NbO7+δ

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The structure, phase composition, and migration of oxygen ion in Ce3NbO7+δ were reported on the basis of lone-pair substitution concept.X-ray diffraction study revealed that Ce3NbO7+δ sample was comprised of Ce3NbO7+δ phase and CeNbO4.25 phase.In the dielectric study of Ce3NbO7+δ sample, two dielectric loss peaks were observed both in temperature spectra and frequency spectra.Both peaks were shifted towards higher temperature with increase in frequency in temperature spectra and towards higher frequency with increase in temperature in frequency spectra, indicating the relaxation essence of these two peaks.It was suggested that the short distance diffusions of oxygen ions in both Ce3NbO7+δ phase and CeNbO4.25 phase gave rise to the two dielectric relaxation peaks.

  4. Investigation of the isothermal section of the Ce-Co-Al ternary system at 573 K

    Institute of Scientific and Technical Information of China (English)

    YAO Qingrong; ZHOU Huaiying; TANG Chengying; PAN Shunkang

    2011-01-01

    The isothermal section of the Ce-Co-Al ternary system at 573 K was investigated by X-ray powder diffraction (XRD),scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS) techniques.It consisted of 19 single-phase regions,46 two-phase regions and 25 three-phase regions.Four ternary compounds,namely CeCoAl,Ce2Co15Al2,CeCoAl4,CeCo2Al8,were confirmed in this system.At 573 K,the maximum solid solubilities of Co in CeAl2 and A1 in CeCo2 were about 10.4 at.% and 10.0 at.%,respectively.The homogeneity range of CoAl phase extended from about 46.0 to 56.0 at.% Al.

  5. <em>In Vitro em>and <em>in em>Vivo> Antitumor Effect of Trachylobane-360, a Diterpene from<em> Xylopia langsdorffianaem>

    Directory of Open Access Journals (Sweden)

    João Carlos Lima Rodrigues Pita

    2012-08-01

    Full Text Available Trachylobane-360 (<em>ent>-7α-acetoxytrachyloban-18-oic acid was isolated from <em>Xylopia langsdorffianaem>. Studies have shown that it has weak cytotoxic activity against tumor and non-tumor cells. This study investigated the <em>in vitroem>> em>and <em>in vivoem> antitumor effects of trachylobane-360, as well as its cytotoxicity in mouse erythrocytes. In order to evaluate the <em>in vivoem> toxicological aspects related to trachylobane-360 administration, hematological, biochemical and histopathological analyses of the treated animals were performed. The compound exhibited a concentration-dependent effect in inducing hemolysis with HC50 of 273.6 µM, and a moderate <em>in vitroem>> em>concentration-dependent inhibitory effect on the proliferation of sarcoma 180 cells with IC50 values of 150.8 µM and 150.4 µM, evaluated by the trypan blue exclusion test and MTT reduction assay, respectively. The <em>in vivoem> inhibition rates of sarcoma 180 tumor development were 45.60, 71.99 and 80.06% at doses of 12.5 and 25 mg/kg of trachylobane-360 and 25 mg/kg of 5-FU, respectively. Biochemical parameters were not altered. Leukopenia was observed after 5-FU treatment, but this effect was not seen with trachylobane-360 treatment. The histopathological analysis of liver and kidney showed that both organs were mildly affected by trachylobane-360 treatment. Trachylobane-360 showed no immunosuppressive effect. In conclusion, these data reinforce the anticancer potential of this natural diterpene.

  6. New CeMgCo{sub 4} and Ce{sub 2}MgCo{sub 9} compounds: Hydrogenation properties and crystal structure of hydrides

    Energy Technology Data Exchange (ETDEWEB)

    Denys, R.V.; Riabov, A.B. [Karpenko Physico-Mechanical Institute NAS Ukraine, 5, Naukova Street, Lviv, 79000 (Ukraine); Cerny, R., E-mail: alexr@ipm.lviv.ua [Laboratory of Crystallography, University of Geneva, 24, Quai Ansermet, Geneva (Switzerland); Koval' chuk, I.V.; Zavaliy, I.Yu. [Karpenko Physico-Mechanical Institute NAS Ukraine, 5, Naukova Street, Lviv, 79000 (Ukraine)

    2012-03-15

    Two new ternary intermetallic compounds, CeMgCo{sub 4} (C15b pseudo-Laves phase, MgCu{sub 4}Sn type) and Ce{sub 2}MgCo{sub 9} (substitution derivative of PuNi{sub 3} type) were synthesized by mechanical alloying method. The structural and hydrogenation properties of these compounds were studied by X-ray diffraction and Pressure-Composition-Temperature measurements. Both compounds absorb hydrogen at room temperature and pressures below 10 MPa forming hydrides with maximum compositions CeMgCo{sub 4}H{sub 6} and Ce{sub 2}MgCo{sub 9}H{sub 12}. Single plateau behavior was observed in P-C isotherm during hydrogen absorption/desorption by Ce{sub 2}MgCo{sub 9} alloy. The CeMgCo{sub 4}-H{sub 2} system is characterized by the presence of two absorption/desorption plateaus corresponding to formation of {beta}-CeMgCo{sub 4}H{sub 4} and {gamma}-CeMgCo{sub 4}H{sub 6} hydride phases. The structure of {beta}-hydride CeMgCo{sub 4}H(D){sub 4} was determined from X-ray and neutron powder diffraction data. In this structure initial cubic symmetry of CeMgCo{sub 4} is preserved and hydrogen atoms fill only one type of interstitial sites, triangular MgCo{sub 2} faces. These positions are occupied by 70% and form octahedron around Mg atom with Mg-D bond distances 1.84 A. - Graphical abstract: Crystal structure of the {beta}-CeMgCo{sub 4}D{sub 4.2} deuteride. Octahedra of D-sites around Mg atoms are shown. Highlights: Black-Right-Pointing-Pointer Two new ternary compounds have been synthesized in the Ce-Mg-Co system. Black-Right-Pointing-Pointer Below 100 bar H{sub 2} CeMgCo{sub 4} and Ce{sub 2}MgCo{sub 9} reversibly absorb hydrogen at room temperature. Black-Right-Pointing-Pointer Crystal structure of cubic CeMgCo{sub 4}D{sub 4.2} deuteride has been determined.

  7. Glycosylation of Vanillin and 8-Nordihydrocapsaicin by Cultured <em>Eucalyptus perrinianaem> Cells

    Directory of Open Access Journals (Sweden)

    Naoji Kubota

    2012-05-01

    Full Text Available Glycosylation of vanilloids such as vanillin and 8-nordihydrocapsaicin by cultured plant cells of <em>Eucalyptus perrinianaem> was studied. Vanillin was converted into vanillin 4-<em>O>-b-D-glucopyranoside, vanillyl alcohol, and 4-<em>O>-b-D-glucopyranosylvanillyl alcohol by <em>E. perriniana em>cells. Incubation of cultured <em>E. perrinianaem> cells with 8-nor- dihydrocapsaicin gave 8-nordihydrocapsaicin 4-<em>O>-b-D-glucopyranoside and 8-nordihydro- capsaicin 4-<em>O>-b-D-gentiobioside.

  8. Preparation and thermochromic properties of Ce-doped VO{sub 2} films

    Energy Technology Data Exchange (ETDEWEB)

    Song, Linwei [College of Materials Science and Engineering, Sichuan University, Chengdu 610064 (China); Zhang, Yubo [College of Materials Science and Engineering, Sichuan University, Chengdu 610064 (China); Sichuan Engineering Technical College, Deyang 618000 (China); Huang, Wanxia, E-mail: huangwanxiascu@yahoo.com.cn [College of Materials Science and Engineering, Sichuan University, Chengdu 610064 (China); Shi, Qiwu; Li, Danxia; Zhang, Yang; Xu, Yuanjie [College of Materials Science and Engineering, Sichuan University, Chengdu 610064 (China)

    2013-06-01

    Graphical abstract: This effect of doping concentration on the phase transition temperature of VO{sub 2} films demonstrates that the phase transition temperature is decreasing along with the increase of the Ce dopant concentrations. After doping Ce, the transition temperature of VO{sub 2} film changes appreciably. Highlights: ► Ce-doped VO{sub 2} films were prepared on muscovite substrate by inorganic sol–gel method for the first time. ► The cerium existing in the VO{sub 2} films in the form of Ce{sup 4+} and Ce{sup 3+} was substituted for part of V atoms in the lattice. ► Ce doping could remarkably reduce the particle size of the Ce-doped films compared with undoped films. ► The phase transition temperature of Ce-doped VO{sub 2} films decreased appreciably with maintaining high-quality phase transition. - Abstract: Mixture of cerium (III) nitrate hexahydrate and vanadium pentaoxide powder were used as precursor to prepare Ce-doped VO{sub 2} films on the muscovite substrate by inorganic sol–gel method. SEM, XRD and XPS were used to investigate the morphologies and structures of VO{sub 2} films. The results show that the VO{sub 2} films grow on the muscovite substrate with preferred orientated (0 1 1) plane and the Ce exists in the form of Ce{sup 4+} and Ce{sup 3+} replacing part of V atoms in the lattice. The infrared transmittance change was measured from room temperature to the temperature above the metal–insulator transition. The films have excellent thermochromic performance. The metal–insulator transition temperature of VO{sub 2} films changes appreciably with Ce doped, which decreases by 4.5 °C per 1 at.% doping. Furthermore, Ce doping could remarkably reduce the particle size of VO{sub 2} films.

  9. Effects of Ce additions on the age hardening response of Mg–Zn alloys

    International Nuclear Information System (INIS)

    The effects of Ce additions on the precipitation hardening behaviour of Mg–Zn are examined for a series of alloys, with Ce additions at both alloying and microalloying levels. The alloys are artificially aged, and studied using hardness measurement and X-ray diffraction, as well as optical and transmission electron microscopy. It is found that the age-hardening effect is driven by the formation of fine precipitates, the number density of which is related to the Zn content of the alloy. Conversely, the Ce content is found to slightly reduce hardening. When the alloy content of Ce is high, large secondary phase particles containing both Ce and Zn are present, and remain stable during solutionizing. These particles effectively reduce the amount of Zn available as solute for precipitation, and thereby reduce hardening. Combining hardness results with thermodynamic analysis of alloy solute levels also suggests that Ce can have a negative effect on hardening when present as solutes at the onset of ageing. This effect is confirmed by designing a pre-ageing heat treatment to preferentially remove Ce solutes, which is found to restore the hardening capability of an Mg–Zn–Ce alloy to the level of the Ce-free alloy. - Highlights: • The effects of Ce additions on precipitation in Mg–Zn alloys are examined. • Additions of Ce to Mg–Zn slightly reduce the age-hardening response. • Ce-rich secondary phase particles deplete the matrix of Zn solute. • Hardening is also decreased when Ce is present in solution. • Pre-ageing to preferentially precipitate out Ce restores hardening capabilities

  10. Search for double beta decay of {sup 136}Ce and {sup 138}Ce with HPGe gamma detector

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P. [INFN sezione Roma “Tor Vergata”, I-00133 Rome (Italy); Bernabei, R., E-mail: rita.bernabei@roma2.infn.it [INFN sezione Roma “Tor Vergata”, I-00133 Rome (Italy); Dipartimento di Fisica, Università di Roma “Tor Vergata”, I-00133 Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Cappella, F. [INFN sezione Roma, I-00185 Rome (Italy); Dipartimento di Fisica, Università di Roma “La Sapienza”, I-00185 Rome (Italy); Cerulli, R. [INFN, Laboratori Nazionali del Gran Sasso, I-67010 Assergi (AQ) (Italy); Danevich, F.A. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Incicchitti, A. [INFN sezione Roma, I-00185 Rome (Italy); Dipartimento di Fisica, Università di Roma “La Sapienza”, I-00185 Rome (Italy); Kropivyansky, B.N. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, I-67010 Assergi (AQ) (Italy); Poda, D.V. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); INFN sezione Roma, I-00185 Rome (Italy)

    2014-10-15

    Search for double β decay of {sup 136}Ce and {sup 138}Ce was realized with 732 g of deeply purified cerium oxide sample measured over 1900 h with the help of an ultra-low background HPGe γ detector with a volume of 465 cm{sup 3} at the STELLA facility of the Gran Sasso National Laboratories of the INFN (Italy). New improved half-life limits on double beta processes in the cerium isotopes were set at the level of lim⁡T{sub 1/2}∼10{sup 17}–10{sup 18} yr; many of them are even two orders of magnitude larger than the best previous results.

  11. Purification, Characterization and Antioxidant Activities <em>in Vitroem>> em>and <em>in Vivoem> of the Polysaccharides from <em>Boletus edulisem> Bull

    Directory of Open Access Journals (Sweden)

    Yijun Fan

    2012-07-01

    Full Text Available A water-soluble polysaccharide (BEBP was extracted from <em>Boletus edulis em>Bull using hot water extraction followed by ethanol precipitation. The polysaccharide BEBP was further purified by chromatography on a DEAE-cellulose column, giving three major polysaccharide fractions termed BEBP-1, BEBP-2 and BEBP-3. In the next experiment, the average molecular weight (Mw, IR and monosaccharide compositional analysis of the three polysaccharide fractions were determined. The evaluation of antioxidant activities both <em>in vitroem> and <em>in vivo em>suggested that BEBP-3 had good potential antioxidant activity, and should be explored as a novel potential antioxidant.

  12. Localized and mixed valence state of Ce 4 f in superconducting and ferromagnetic CeO1 -xFxBiS2 revealed by x-ray absorption and photoemission spectroscopy

    Science.gov (United States)

    Sugimoto, T.; Ootsuki, D.; Paris, E.; Iadecola, A.; Salome, M.; Schwier, E. F.; Iwasawa, H.; Shimada, K.; Asano, T.; Higashinaka, R.; Matsuda, T. D.; Aoki, Y.; Saini, N. L.; Mizokawa, T.

    2016-08-01

    We have performed Ce L3-edge x-ray absorption spectroscopy (XAS) and Ce 4 d -4 f resonant photoemission spectroscopy (PES) on single crystals of CeO1 -xFxBiS2 for x =0.0 and 0.5 in order to investigate the Ce 4 f electronic states. In Ce L3-edge XAS, a mixed valence of Ce was found in the x =0.0 sample, and F doping suppressed it, which is consistent with the results on polycrystalline samples. As for resonant PES, we found that the Ce 4 f electrons in both x =0.0 and 0.5 systems respectively formed a flat band at 1.0 and 1.4 eV below the Fermi level and there was no contribution to the Fermi surfaces. Interestingly, Ce valence in CeOBiS2 deviates from Ce3 + even though Ce 4 f electrons are localized, indicating the Ce valence is not in a typical valence fluctuation regime. We assume that localized Ce 4 f in CeOBiS2 is mixed with unoccupied Bi 6 pz , which is consistent with a previous local structural study. Based on the analysis of the Ce L3-edge XAS spectra using Anderson's impurity model calculation, we found that the transfer integral becomes smaller, increasing the number of Ce 4 f electrons upon the F substitution for O.

  13. Estudos sobre a Esquistosomose em Pernambuco, Brasil

    Directory of Open Access Journals (Sweden)

    Aggeu Magalhães

    1940-01-01

    Full Text Available Os autores referem os resultados dos estudos sobre esquistosomose realisados, em Pernambuco, de Novembro de 1938 a Dezembro de 1939. Não se extendem em discussão, nem comentarios, tampouco, relacionam suas verificações com o que já foi relatado sobre o assunto em trabalhos nacionais e estrangeiros, pelo fato de que, não se trata de um resultado definitivo e sim de atividades que irão proseguir. Os estudos sistematicos em torno da endemia esquistosomica foram executados em duas localidades diversas pela população e pela situação geografica e ecologica. Pontezinha é uma povoação de 1200 habitantes localizada proximo a um conjunto de charcos e lagõas de agua dôce onde pululam caramujos do tipo olivaceus de Spix, e apresenta uma taxa de infestação de 21,4% para individuos do sexo masculino, e de 14,7% para os do sexo feminino. A distribuição por grupos de idade mostra que a incidencia cresce até o grupo de 16 a 20 anos de idade, quando atinge a percentagem de 37,8%, para decrescer em seguida. Em Vitoria a incidencia foi maior nos indivíduos do sexo feminino, atingindo a taxa de 41,4%, dando o sexo masculino a taxa de 36,9%. Por idade a percentagem maxima é atingida pelo grupo de 11 a 15 anos. Vitoria é uma cidade de 1500 habitantes, construida á margem do rio Tapacurá, onde se encontram numerosos caramujos do tipo centimetralis Lutz. A divergencia de incidencia corre por conta dos habitos da população e pela utilização que ela faz do rio, sendo maior em Vitoria porque a proximidade do rio facilita o uso de suas aguas para banho e serviços domesticos, condicionando este ultimo fato, a maior infestação das mulheres. O estudo da frequencia da infestação dos caramujos por cercarias de diversos trematodios, permite suspeitar uma relação inversa entre a taxa de infestação e o diametro maximo atingido pelos caramujos, parecendo este fato confirmar os trabalhos de Vianna Martins sobre a identidade dos hospedeiros

  14. A specimen of <em>Sorex> cfr. <em>samniticus> in Barn Owl's pellets from Murge plateau (Apulia, Italy / Su di un <em>Sorex> cfr. <em>samniticus> (Insectivora, Soricidae rinvenuto in borre di <em>Tyto albaem> delle Murge (Puglia, Italia

    Directory of Open Access Journals (Sweden)

    Giovanni Ferrara

    1992-07-01

    Full Text Available Abstract In a lot of Barn Owl's pellets from the Murge plateau a specimen of <em>Sorex> sp. was detected. Thank to some morphological and morphometrical features, the cranial bones can be tentatively attributed to <em>Sorex samniticusem> Altobello, 1926. The genus <em>Sorex> was not yet included in the Apulia's fauna southwards of the Gargano district; the origin and significance of the above record is briefly discussed, the actual presence of a natural population of <em>Sorex> in the Murge being not yet proved. Riassunto Viene segnalato il rinvenimento di un esemplare di <em>Sorex> cfr. <em>samniticus> da borre di <em>Tyto albaem> delle Murge. Poiché il genere non era stato ancora segnalato nella Puglia a sud del Gargano, viene discusso il significato faunistico del reperto.

  15. Study of the <em>in Vitroem> Antiplasmodial, Antileishmanial and Antitrypanosomal Activities of Medicinal Plants from Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Nawal M. Al-Musayeib

    2012-09-01

    Full Text Available The present study investigated the <em>in vitroem> antiprotozoal activity of sixteen selected medicinal plants. Plant materials were extracted with methanol and screened <em>in vitroem> against erythrocytic schizonts of <em>Plasmodium falciparumem>, intracellular amastigotes of <em>Leishmania infantum em>and <em>Trypanosoma cruzi em>and free trypomastigotes of<em> T. bruceiem>. Cytotoxic activity was determined against MRC-5 cells to assess selectivity<em>. em>The criterion for activity was an IC50 < 10 µg/mL (4. Antiplasmodial activity was found in the<em> em>extracts of<em> em>>Prosopis julifloraem> and <em>Punica granatumem>. Antileishmanial activity<em> em>against <em>L. infantumem> was demonstrated in <em>Caralluma sinaicaem> and <em>Periploca aphylla.em> Amastigotes of<em> T. cruzi em>were affected by the methanol extract of<em> em>>Albizia lebbeckem>> em>pericarp, <em>Caralluma sinaicaem>,> Periploca aphylla em>and <em>Prosopius julifloraem>. Activity against<em> T. brucei em>was obtained in<em> em>>Prosopis julifloraem>. Cytotoxicity (MRC-5 IC50 < 10 µg/mL and hence non-specific activities were observed for<em> em>>Conocarpus lancifoliusem>.>

  16. Impression and Charm of CeBIT 2005%2005年CeBIT印象与魅力

    Institute of Scientific and Technical Information of China (English)

    何发; 雨霞

    2005-01-01

    2005年3月10日,一年一度的德国CeBIT大展再次拉开全球IT产品盛会的序幕。作为行业的晴雨表,CeBIT总能搅动着IT行业的激情,牵动着ICT市场的神经。作为全球顶级IT盛会的CeBIT在组织者的有产管理下,历久弥新,以其宏大的规模和合理的会场安排,奉献给业界一道德式大餐。琳琅满目的参展产品从MP3、DV到大型计算机,解决方案应有尽有,新产品、新技术、新方案层出不穷,行业的权威企业悉数到场。

  17. Sensitive and specific immunohistochemical diagnosis of human alveolar echinococcosis with the monoclonal antibody Em2G11.

    Directory of Open Access Journals (Sweden)

    Thomas F E Barth

    Full Text Available BACKGROUND: Alveolar echinococcosis (AE is caused by the metacestode stage of Echinococcus multilocularis. Differential diagnosis with cystic echinococcosis (CE caused by E. granulosus and AE is challenging. We aimed at improving diagnosis of AE on paraffin sections of infected human tissue by immunohistochemical testing of a specific antibody. METHODOLOGY/PRINCIPAL FINDINGS: We have analysed 96 paraffin archived specimens, including 6 cutting needle biopsies and 3 fine needle aspirates, from patients with suspected AE or CE with the monoclonal antibody (mAb Em2G11 specific for the Em2 antigen of E. multilocularis metacestodes. In human tissue, staining with mAb Em2G11 is highly specific for E. multilocularis metacestodes while no staining is detected in CE lesions. In addition, the antibody detects small particles of E. multilocularis (spems of less than 1 µm outside the main lesion in necrotic tissue, liver sinusoids and lymphatic tissue most probably caused by shedding of parasitic material. The conventional histological diagnosis based on haematoxylin and eosin and PAS stainings were in accordance with the immunohistological diagnosis using mAb Em2G11 in 90 of 96 samples. In 6 samples conventional subtype diagnosis of echinococcosis had to be adjusted when revised by immunohistology with mAb Em2G11. CONCLUSIONS/SIGNIFICANCE: Immunohistochemistry with the mAb Em2G11 is a new, highly specific and sensitive diagnostic tool for AE. The staining of small particles of E. multilocularis (spems outside the main lesion including immunocompetent tissue, such as lymph nodes, suggests a systemic effect on the host.

  18. Ação de produtos fitossanitários utilizados em cafeeiros sobre pupas e adultos de Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Silva Rogério Antônio

    2006-01-01

    Full Text Available Avaliou-se a ação de produtos fitossanitários usados em cafeeiros sobre pupas e adultos de Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae. Os bioensaios foram conduzidos no Departamento de Entomologia da Universidade Federal de Lavras - UFLA, Lavras, MG, Brasil. Os tratamentos avaliados, em g i.a.L-1 de água, foram: 1- endosulfan (Thiodan 350 CE - 1,75, 2- chlorpyrifos (Lorsban 480 CE -1,2, 3- betacyfluthrin (Turbo 50 CE - 0,013, 4- enxofre (Kumulus 800 PM - 4,0, 5- azocyclotin (Peropal 250 PM - 0,31, 6- oxicloreto de cobre (Cuprogarb 500 PM - 5,0 e 7- Testemunha (água. As pulverizações foram realizadas diretamente sobre pupas e adultos do crisopídeo por meio de torre de Potter. As pupas foram colocadas em tubos de vidro e os adultos em gaiolas de PVC, e mantidos em sala climatizada a 25 ? 2degreesC, UR de 70 ? 10% e fotofase de 12 horas. O delineamento experimental foi inteiramente casualizado, com sete tratamentos e dez repetições, sendo cada parcela formada por quatro pupas ou um casal de C. externa. Os produtos foram distribuídos nas quatro classes de toxicidade conforme escala estabelecida pela IOBC. O chlorpyrifos mostrou-se levemente nocivo para pupas (classe 2, 30?E?79%, e os demais produtos foram inócuos (classe 1, E99%. Os produtos testados à base de endosulfan, enxofre, azocyclotin e oxicloreto de cobre podem ser recomendados em programas de manejo de pragas do cafeeiro em associação com C. externa, em função da baixa toxidade apresentada por esses compostos ao predador.

  19. Scintillation response of YAlO3:Ce and Lu0.7Y0.3AlO3:Ce single crystal scintillators

    Science.gov (United States)

    Phunpueok, A.; Chewpraditkul, W.; Limsuwan, P.; Wanarak, C.

    2012-09-01

    The scintillation response of YAlO3:Ce (YAP:Ce) and Lu0.7Y0.3AlO3:Ce (LuYAP:Ce) crystals with same size of 10 × 10 × 5 mm3 were studied for gamma ray energies ranging from 22.1 to 1274.5 keV. The light yield, its non-proportionality and the energy resolution were measured with the photomultiplier tube (PMT). The intrinsic resolution of the crystals versus energy of gamma rays has been determined after correcting the measured energy resolution for photomultiplier tube statistics. For 662 keV gamma rays (137Cs source), the YAP:Ce showed the light yield of 32,000 ph/MeV,which is much higher than that of 9800 ph/MeV obtained for LuYAP:Ce. The energy resolution of 4.4% obtained for YAP:Ce is much better than that of 7.9% obtained for LuYAP:Ce, due to its much higher light yield and better intrinsic resolution. The scintillation light loss of tested crystals at 511 keV gamma rays (22Na source) was also presented. The estimated photofraction was determined for both crystals and compared with the cross-sections ratio calculated using WinXCom program. The experimental results of the total mass attenuation coefficients for both crystals are in good agreement with the theoretical values, within the experimental uncertainty.

  20. Glass forming ability of the Al-Ce-Ni system; Avaliacao da capacidade de formacao vitrea do sistema Al-Ce-Ni

    Energy Technology Data Exchange (ETDEWEB)

    Triveno Rios, C. [Engenharia Mecanica, Universidade Federal de Mato Grosso, Rondonopolis, MT (Brazil)], e-mail: triveno@ufmt.br; Surinach, S.; Baro, M.D. [Departamento de Engenharia de Materiais - Universidade Federal de Sao Carlos, SP (Brazil); Bolfarini, C.; Botta, W.J.; Kiminami, C.S. [Departamento de Fisica da Universidade Autonoma de Barcelona, Bellaterra (Spain)

    2010-07-01

    In the present work, the glass forming ability (GFA) and its compositional dependence on Al-Ni-Ce system alloys were investigated in function of several thermal parameters. Rapidly quenched Al{sub 85}Ni{sub 15}-{sub X}Ce{sub X} (X=4,5,6,7,10), Al{sub 90}Ni{sub 5}Ce{sub 5}, Al{sub 89}Ni{sub 2}.{sub 4}Ce{sub 8}.{sub 6}, Al{sub 80}Ni{sub 15.6}Ce{sub 4}.{sub 4} and Al{sub 78}Ni{sub 18.5}Ce{sub 3.5} amorphous ribbons were produced by melt-spinning and the structural transformation during heating was studied using a combination of X-ray diffraction (XRD) and differential scanning calorimetry (DSC). The results showed that the GFA and the thermal stability in the Al-rich corner of Al- Ni-Ce system alloys were enhanced by increasing the solute content and specifically the Ce content (author)

  1. Temperature-dependent nonradiative energy transfer from Gd{sup 3+} to Ce{sup 3+} ions in co-doped LuAG:Ce,Gd garnet scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Onderisinova, Z. [Charles University, Faculty of Mathematics and Physics, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic); Kucera, M., E-mail: kucera@karlov.mff.cuni.cz [Charles University, Faculty of Mathematics and Physics, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic); Hanus, M. [Charles University, Faculty of Mathematics and Physics, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic); Nikl, M. [Institute of Physics, AS CR, Cukrovarnicka 10, 162 00 Prague 6 (Czech Republic)

    2015-11-15

    Energy transfer from donor Gd{sup 3+} to acceptor Ce{sup 3+} ions was studied in low doped lutetium aluminum garnet, LuAG:Ce,Gd. High purity single crystalline films were prepared by liquid phase epitaxy. The mechanism of nonradiative energy transfer from {sup 6}P{sub J} (Gd{sup 3+}) multiplet to crystal field split 5d{sub 2} ({sup 2}D) states of Ce{sup 3+} was established as long-range dipole–dipole interaction and the average critical transfer distance between Gd{sup 3+} and Ce{sup 3+} ions was found ~14 Å at room temperature. It is shown that the single step energy transfer between donor–acceptor pairs is dominant while migration of excitation energy within the donor Gd{sup 3+} subsystem is only a small perturbation in the energy transfer mechanism in the studied low doped garnets. - Highlights: • Photoluminescence and decay kinetics in co-doped LuAG:Ce,Gd garnets. • Energy transfer from Gd{sup 3+} to Ce{sup 3+} in LuAG:Ce,Gd garnets. • Ce doped multicomponent garnet scintillators.

  2. Efeito de inseticidas em insetos predadores em culturas de algodão Effect of insecticides on predator insects associated with cotton

    Directory of Open Access Journals (Sweden)

    JOSÉ JANDUI SOARES

    2000-09-01

    Full Text Available Com o objetivo de verificar o efeito de inseticidas em insetos predadores em cultura de algodão (Gossypium hirsutum L., instalaram-se, em 1993-1994, dois experimentos, um no campo, e outro, em laboratório. No experimento realizado no campo, os tratamentos foram: Fipronil 200 SC (75 g/ha de i.a.; Fipronil 800 WDG (64, 80 e 100 g/ha de i.a.; Endosulfan 350 CE (700 g/ha de i.a.; e testemunha. Em laboratório, além das formulações à base de Fipronil foi utilizado o Paration metílico 600 CE (480 g/ha de i.a.. Fipronil foi seletivo para os artrópodes predadores (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea e Doru lineare no campo, e a Cycloneda sanguinea (L., em laboratório, e pode ser recomendado em programas de manejo integrado de pragas na cultura do algodoeiro para o controle de Alabama argillacea (Rueb., e Anthonomus grandis Boh. Endosulfan foi seletivo em relação a Scymnus sp., Geocoris ventralis Thomazini e Doru lineare (Eschs no campo, com uma redução dos insetos inferior a 30%, e o Paration metílico não foi seletivo para C. sanguinea em laboratório.To assess the selectivity of insecticides to predator insects in cotton (Gossypium hirsutum L. crops two, trials, 1993-1994, under field and laboratory conditions were conducted. Under field conditions, the following treatments were compared: Fipronil 200 CS (75 g/ha of a.i.; Fipronil 800 WDG (64, 80 and 100 g/ha of a.i.; Endosulfan 350 EC (700 g/ha of a.i.; and control. Under laboratory conditions, in addition to Friponil, Methyl parathion 600 EC 480 g/ha of a.i. was also tested. Fipronil was selective to predators (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea and Doru lineare under field condition and to Cycloneda sanguinea (L. under laboratory conditions. This product can be used in integrated pest management programs in cotton crops to control Alabama argillacea (Rueb., and Anthonomus grandis Boh. Endosulfan was selective to Scymnus sp., Geocoris ventralis

  3. Determinantes do aborto provocado entre mulheres admitidas em hospitais em localidade da região Nordeste do Brasil Determinants of iduced abortion among poor women admitted to hospitals in locality of the region northeast Brazil

    OpenAIRE

    Walter Fonseca; Chizuru Misago; Luciano L. Correia; João A. M. Parente; Francisco Chagas Oliveira

    1996-01-01

    Com o objetivo de identificar os determinantes do aborto provocado entre mulheres admitidas por complicações decorrentes dos abortos, nos hospitais-maternidades públicos em Fortaleza, CE (Brasil) foram entrevistadas 4.359 pacientes entre 1º de outubro de 1992 e 30 de setembro de 1993. Os dados foram coletados através de questionário estruturado. São apresentados os determinantes dos abortos provocados em 2.084 (48%) mulheres classificadas como tendo induzido aborto. Dois terços (66%) das mulh...

  4. Effect of Ce addition on the surface properties and n-dodecane dehydrogenation performance of Pt-Sn/Ce-Al2O3 catalyst

    Science.gov (United States)

    Li, Xianru; He, Songbo; Wei, Huangzhao; Luo, Sha; Gu, Bin; Sun, Chenglin

    2015-08-01

    Ce-modified alumina carriers with different Ce content were prepared by vacuum isovolume impregnation method aiming to improve the n-dodecane catalytic dehydrogenation performance of PtSn/Al2O3 catalyst. The support and catalyst were characterized by XRD, N2 adsorption-desorption, NH3-TPD, H2-TPR, CO-pulse adsorption and TG-DTG. Results showed that Ce addition decreased the surface acid amount significantly and inhibited the reduction of SnO x species. Besides, Ce containing catalyst showed higher n-dodecane dehydrogenation activity and stability and lower coke deposition amount and coke burning temperature. In our study, the optimal Ce addition amount for n-dodecane dehydrogenation was 2%.

  5. Thermodynamic Assessment of the ZrO2-CeO2 and ZrO2-CeO1.5 Binary System

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    An optimal set of thermodynamic parameters of the ZrO2-CeO1.5 system has been obtained using phase diagram data by modern CALPHAD (CALculation of PHAse Diagrams) technique. The liquid and other solid solution phases were regarded as substitutional solution. The ordered Zr2Ce2O7 phase was treated as a stoichiometric compound. The ZrO2-CeO2 system has been re-optimized with new reference state. A comparison between the ZrO2-CeO2 system and ZrO2-CeO1.5 system has been made through calculation. With the calculation, the experimental information is well reproduced and a good agreement is obtained.

  6. Enhancement of red to orange emission ratio of YPO4:Eu3+,Ce3+ and its dependence on Ce3+ concentration

    Institute of Scientific and Technical Information of China (English)

    ZHAN Shiping; GAO Yongyi; LIU Yunxin; ZHONG Hui

    2012-01-01

    Eu3+ and Ce3+ co-doped YPO4 microspheres were synthesized by hydrothermal method without template.The emission spectra showed that the red emission centered at 618 nm could be readily increased relatively to the orange emission centered at 590 nm by controlling the doping concentration of Ce3+ ion.The investigation based on excitation spectra and decay curves demonstrated that the doped Ce3+ ions took two efficient energy transfers to Eu3+ ions and affected the lifetime of the emission states ofEu3+ ions so that the emission spectra of Eu3+ ion were accordingly tuned with the Ce3+ content increasing.This controllable red (5D0→7F2) to orange (5D0→7F1) emission ratio of YPO4:Eu3+,Ce3+ made it very promising for encoded anti-fake labels and bio-labels.

  7. Investigation of structural and magnetic properties of Ce{sup 3+}-substituted nanosized Co–Cr ferrites for a variety of applications

    Energy Technology Data Exchange (ETDEWEB)

    Mustafa, Ghulam, E-mail: ghulammustafabzu@gmail.com [Department of Physics, Bahauddin Zakariya University, Multan 60800 (Pakistan); Islam, M.U. [Department of Physics, Bahauddin Zakariya University, Multan 60800 (Pakistan); Zhang, Wenli [State Key Laboratory of Electronic Thin Films and Integrated Devices, Chengdu 610054 (China); Jamil, Yasir [Department of Physics, University of Agriculture, Faisalabad 38040 (Pakistan); Anwar, Abdul Waheed [Department of Physics, University of Engineering and Technology, Lahore 54890 (Pakistan); Hussain, Mudassar [Department of Physics, Bahauddin Zakariya University, Multan 60800 (Pakistan); Ahmad, Mukhtar, E-mail: ahmadmr25@yahoo.com [Department of Physics, COMSATS Institute of Information Technology, Islamabad 44000 (Pakistan)

    2015-01-05

    Highlights: • Ce-substituted spinel ferrites synthesized by coprecipitation route have been investigated. • The average particle size was in the range of 30.8–63.7 nm estimated by Scherer formula. • Saturation magnetization values were decreased with increasing Ce contents. • Coercivity for all samples is suitable for recording media, switching and EM materials. - Abstract: Nanocrystalline samples of Ce{sup 3+} substituted Co–Cr ferrite with chemical formula CoCr{sub 0.04}Ce{sub x}Fe{sub 1.96−x}O{sub 4} (0 ⩽ x ⩽ 0.1) have been synthesized by co-precipitation method and sintered at a temperature of 850 °C for 8 h. The samples were characterized using thermo-gravimetric and differential thermal analysis, X-ray diffraction, Fourier transform infrared spectroscopy, Raman spectroscopy, scanning electron microscopy, atomic force microscopy and vibrating sample magnetometry. The XRD patterns and FTIR spectra confirm that the prepared samples reveal the formation of spinel ferrites. The average particle size was found to be in the range of 30.8–63.7 nm estimated by Scherer formula. The lattice constant varies in the range of 8.352–8.382 Å due to difference in the ionic radii of the substituted cations. IR studies confirm two main absorption bands in the frequency range of 400–800 cm{sup −1} arising due to the tetrahedral (A-site) and octahedral (B-site) stretching vibrations. The elemental analysis as obtained from the EDXS measurement is in close agreement with the expected composition from the stoichiometry of the reactant solutions. The M–H loops show that the saturation magnetization decreased gradually with increasing Ce content, while the coercivity is related to the microstructure of Ce-substituted samples. The obtained results suggest that the investigated materials are potential candidates for magnetic recording media, security, switching and high frequency applications.

  8. The effect of precursors salts on surface state of Pd/Al2O3 and Pd/CeO2/Al2O3 catalysts

    Directory of Open Access Journals (Sweden)

    André L. Guimarães

    2004-12-01

    Full Text Available The influence of the precursors on the promoting effect of ceria on Pd/Al2O3 catalyst, when ceria is coated over alumina was studied. The reaction of propane oxidation proceeded under different feed conditions and the surface active sites were characterized by X-ray photoelectron spectroscopy (XPS and in situ diffuse reflectance spectroscopy (DRS. XPS and DRS results show that PdO/Pd0 interface are the active sites independent of the precursor, while the catalysts containing CeO2 showed formation of palladium species in the highest oxidation state, probably PdO2 (338 eV after the oxidation of propane. Besides, the O/Al and O/Ce ratios evidenced the increase of oxygen storage in the presence of CeO2. In addition, the precursor acetylacetonate favors the oxygen storage in the lattice.Estudo da influência dos precursores sobre os catalisadores de Pd/Al2O3 promovidos com céria ancorado sobre a alumina. A oxidação do propano foi feita sob diferentes condições de alimentação sendo caracterizados os sítios superficiais por Espectroscopia Fotoeletrônica de raios X (XPS e por Refletância Difusa em ''situ''. Resultados de XPS e DRS mostraram a formação de interfaces de PdO/Pd0 como sendo os sítios ativos, independentes do precursor utilizado na preparação, enquanto que os catalisadores contendo CeO2 mostraram a formação de espécies de paládio com estado de oxidação mais altos, provavelmente PdO2 (338 eV após a oxidação do propano. Além disso, as razões O/Al e O/Ce evidenciaram um aumento de oxigênio armazenado na presença de CeO2. O precursor acetilacetonato favoreceu o armazenamento de oxigênio na rede.

  9. <em>In Vivoem> Histamine Optical Nanosensors

    Directory of Open Access Journals (Sweden)

    Heather A. Clark

    2012-08-01

    Full Text Available In this communication we discuss the development of ionophore based nanosensors for the detection and monitoring of histamine levels <em>in vivoem>. This approach is based on the use of an amine-reactive, broad spectrum ionophore which is capable of recognizing and binding to histamine. We pair this ionophore with our already established nanosensor platform, and demonstrate <em>in vitroem> and <em>in vivoem> monitoring of histamine levels. This approach enables capturing rapid kinetics of histamine after injection, which are more difficult to measure with standard approaches such as blood sampling, especially on small research models. The coupling together of <em>in vivoem> nanosensors with ionophores such as nonactin provide a way to generate nanosensors for novel targets without the difficult process of designing and synthesizing novel ionophores.

  10. Scintillation and optical properties of Ce-doped YAGG transparent ceramics

    Institute of Scientific and Technical Information of China (English)

    Masaki Mori; Jian Xu; Go Okada; Takayuki Yanagida; Jumpei Ueda; Setsuhisa Tanabe

    2016-01-01

    We investigated photoluminescence (PL) and scintillation properties of Ce3+-doped Y3Al2Ga3O12 (Ce:YAGG) trans-parent ceramics synthesized by vacuum sintering with different Ce3+ concentrations (mol.%) from 0.3% to 1% (0.3%Ce:YAGG, 0.5%Ce:YAGG, 0.8%Ce:YAGG and 1%Ce:YAGG). The samples were synthesized by the vacuum sintering technique. The obtained samples showed a very strong and broad PL emission by the 5d1-4f transition of Ce3+in the wavelength range from 470 to 600 nm. The PL decay profiles were approximated by a single exponential decay function with the time constants of around 33–39 ns. Fur-thermore, the scintillation spectra induced by X-rays showed similar features with those observed in PL. The scintillation decay time profiles followed a second-order exponential decay function. The fast component group (ranged 35–42 ns) were dominantly contrib-uted by the 5d1-4f transition of Ce3+. The pulse height spectra utilizing the latter emissions showed a clear photoabsorption peak. Among those samples tested, 0.5%Ce:YAGG sample showed the highest scintillation light yield of 21,400 ph/MeV under 137Csγ-ray irradiation.

  11. Microstructures and mechanical properties in B{sub 4}C-CeO{sub 2} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Sun Shuchen, E-mail: sunsc@smm.neu.edu.cn [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Sakamoto, Tatsuaki; Nakai, Kiyomichi [Department of Materials Science and Biotechnology, Ehime University, 3Bunkyo-cho, Matsuyama 790-8577 (Japan); Kurishita, Hiroaki [International Research Center for Nuclear Materials Science, Institute for Materials Research, Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Kobayashi, Sengo [Department of Materials Science and Biotechnology, Ehime University, 3Bunkyo-cho, Matsuyama 790-8577 (Japan); Xu Jingyu; Cao Hui; Gao Bo; Bianxue; Wu Wenyuan; Tu Ganfeng [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Matsuda, Seiji [Department of Anatomy and Embryology, Ehime University, Shizugawa, Toon 791-0295 (Japan)

    2011-10-01

    B{sub 4}C-CeO{sub 2} composite ceramics with various concentrations of CeO{sub 2} were fabricated by hot press. The effects of CeO{sub 2} on the microstructures and mechanical properties of the B{sub 4}C-CeO{sub 2} ceramics have been investigated. During hot press, CeB{sub 6} was formed by the reaction between CeO{sub 2} and B{sub 4}C. The B{sub 4}C-CeO{sub 2} ceramics had higher levels of density, fracture toughness, flexural strength and Vickers hardness than those in monolithic B{sub 4}C. The microstructures of the B{sub 4}C-CeO{sub 2} ceramics were observed and analyzed by transmission electron microscopy. In-situ synthesized CeB{sub 6} indicated whisker-like shape and grew along the interface with B{sub 4}C, and different boron carbides with different content of C existed at/around the interface of CeB{sub 6} with B{sub 4}C in the composite ceramics. It made mechanical properties greatly improved.

  12. Controllable preparation of CeO2 nanostructure materials and their catalytic activity

    Institute of Scientific and Technical Information of China (English)

    Shan Wenjuan; Guo Hongjuan; Liu Chang; Wang Xiaonan

    2012-01-01

    Well-crystalline CeO2 nanostructures with the morphology ofnanorods and nanocubes were synthesized by a template-free hydrothermal method.X-ray diffraction (XRD),transmission electron microscopy (TEM),Brunauer-Emmett-Teller (BET) nitrogen adsorption-desorption measurements were employed to characterize the synthesized materials.The reducibility and catalytic activity of nanostructured CeO2 were examined by hydrogen temperature-programmed reduction (H2-TPR) and CO oxidation.The results showed that CeO2 nanorods could be converted into CeO2 nanocubes with the increasing of the reaction time and the hydrothermal temperature,CeO2 nanorods became longer gradually with the increasing of the concentrations of NaOH.H2-TPR characterization demonstrated that the intense low-temperature reduction peak in the CeO2 nanorods indicated the amount of hydrogen consumed is larger than CeO2 nanocubes.Meantime the CeO2 nanorods enhanced catalytic activity for CO oxidation,the total conversion temperature was 340 ℃.The reasons were that CeO2 nanorods have much smaller crystalline sizes and higher surface areas than CeO2 nanocubes.

  13. Chemical interaction of Ce-Fe mixed oxides for methane selective oxidation

    Institute of Scientific and Technical Information of China (English)

    祝星; 杜云鹏; 王华; 魏永刚; 李孔斋; 孙令玥

    2014-01-01

    Chemical interaction of Ce-Fe mixed oxides was investigated in methane selective oxidation via methane temperature pro-grammed reduction and methane isothermal reaction tests over Ce-Fe oxygen carriers. In methane temperature programmed reduction test, Ce-Fe oxide behaved complete oxidation at the lower temperature and selective oxidation at higher temperatures. Ce-Fe mixed oxides with the Fe content in the range of 0.1-0.5 was able to produce syngas with high selectivity in high-temperature range (800-900 °C), and a higher Fe amount over 0.5 seemed to depress the CO formation. In isothermal reaction, complete oxidation oc-curred at beginning following with selective oxidation later. Ce1-xFexO2-δ oxygen carriers (x≤0.5) were proved to be suitable for the selective oxidation of methane. Ce-Fe mixed oxides had the well-pleasing reducibility with high oxygen releasing rate and CO selec-tivity due to the interaction between Ce and Fe species. Strong chemical interaction of Ce-Fe mixed oxides originated from both Fe* activated CeO2 and Ce3+ activated iron oxides (FeOm), and those chemical interaction greatly enhanced the oxygen mobility and se-lectivity.

  14. Low-frequency dielectric spectroscopy of BaTiO3:Ce3+ ceramics

    Science.gov (United States)

    Berbecaru, Ciceron

    2015-10-01

    Dielectric spectroscopy of BaTiO3 (BT) doped with Ce3+ (BT:Ce3+) ceramics was performed at extended temperatures and in the low-frequency ranges. BT:Ce3+ displays decreasing values of all phase transition temperatures with increasing Ce3+ content. Permittivity versus temperature plots showed decreasing values with increasing frequency with low dispersion and shifting values of the Curie temperatures (Tc) towards high frequencies. Comparable values of losses for BT and BT:Ce3+ ceramics suggest good charge compensation. At low frequencies and higher temperatures, thermally activated mechanisms of conduction increase the loss values. With increasing frequency, the BT:Ce3+ system displays increased and shifted loss peaks up to Tc and decreasing values above Tc. The characteristic exponent of the modified Curie-Weiss law is higher than one. These figures suggest a relaxor-like behaviour of BT:Ce3+ ceramics for low Ce3+ content. Phase diagrams of BT:Ce3+ ceramics show a strong decrease of Tc for low Ce3+ content.

  15. The scintillation mechanism in LaCl sub 3 :Ce sup 3 sup +

    CERN Document Server

    Loef, E; Eijk, C W E

    2003-01-01

    The scintillation properties of LaCl sub 3 crystals, doped with Ce sup 3 sup + concentrations of 0.57, 1.0, 2.0, 4.0, and 10%, are studied under x-ray and gamma-quanta excitation at various temperatures. Under x-ray excitation, characteristic doublet Ce sup 3 sup + emission is observed with a maximum at 3.7 eV. Also self-trapped exciton (STE) emission is observed with a maximum near 3.1 eV. The contribution of STE luminescence to the total light yield decreases with increasing Ce concentration. For LaCl sub 3 :0.57%Ce sup 3 sup + , the contribution is 33%, whereas for LaCl sub 3 :10%Ce sup 3 sup + it is 4%. The total light yield of the Ce sup 3 sup + -doped samples ranges from 38 000 photons per megaelectronvolt (ph MeV sup - sup 1) of absorbed gamma-ray energy to 47 000(ph MeV sup - sup 1) for LaCl sub 3 :0.57%Ce sup 3 sup + and LaCl sub 3 :10%Ce sup 3 sup + , respectively. A model is proposed to explain the energy transfer from the host lattice to the Ce sup 3 sup + ions. At these Ce concentrations, energy ...

  16. Mesoporous CeTiSiMCM-48 as novel photocatalyst for degradation of organic compounds

    Energy Technology Data Exchange (ETDEWEB)

    Mureseanu, Mihaela, E-mail: mihaela_mure@yahoo.com [Faculty of Chemistry, University of Craiova, 107 I Calea Bucureşti, 200478 Craiova (Romania); Parvulescu, Viorica, E-mail: vpirvulescu@icf.ro [“Ilie Murgulescu” Institute of Physical Chemistry, Romanian Academy, Spl. Independentei 202, 060021 Bucharest (Romania); Radu, Teodora, E-mail: teocluj@gmail.com [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath Street, 400293 Cluj Napoca (Romania); Institute of Interdisciplinary Research in Bio-Nano-Sciences, Babes Bolyai University, 400271 Cluj-Napoca (Romania); Filip, Mihaela [“Ilie Murgulescu” Institute of Physical Chemistry, Romanian Academy, Spl. Independentei 202, 060021 Bucharest (Romania); Carja, Gabriela, E-mail: carja@uaic.ro [Faculty of Chemical Engineering and Environmental Protection, Technical University of Iasi, 71 D. Mangeron, Iasi (Romania)

    2015-11-05

    This work presents novel photocatalysts containing Ti and/or Ce embedded in the mesoporous silica framework (TiSiMCM-48, CeSiMCM-48 and CeTiSiMCM-48) that were prepared via a facile sol–gel process in the presence of ionic structure directing agents. The structural properties of the obtained materials were analyzed by X-ray diffraction (XRD), nitrogen adsorption-desorption, scanning and transmission electron microscopy (SEM, TEM), EDAX analysis, X-ray photoelectron microscopy (XPS), ultraviolet–visible diffuse reflectance spectroscopy (UV–vis DRS) and Fourier transformation infrared spectroscopy (FT-IR). The results indicated that Ce and Ti were highly dispersed or incorporated into the framework of the cubic SiMCM-48, with an enhanced light-trapping effect both in the UV and Vis regions. When applied to the photocatalytic degradation of phenol, the best results were obtained for the bimetallic hybrid. The best activity of CeTiSiMCM-48 photocatalyst was ascribed to improved electron–hole pair separation efficiency and formation of more reactive oxygen species due to the presence of Ce{sup 4+}/Ce{sup 3+}. The mesoporous support increases the dispersability of the photoactive Ti{sup 4+} or Ce{sup 4+}/Ce{sup 3+} species on the catalyst surface and the accessibility of the substrate to the active sites. Furthermore, the catalysts can be easily recovered and reused for four cycles without significant loss of activity. - Highlights: • Novel photocatalysts containing Ti and/or Ce embedded in the mesoporous MCM-48 silica. • Ce{sup 4+}/Ce{sup 3+} improved electron–hole pair separation and reactivity of oxygen species. • The mesoporous support increases the dispersability of the photoactive species. • The photocatalyst was highly active and stable for phenol degradation under UV irradiation. • TiCeSiMCM-48 can be recycled up to four cycles without significant loss of activity.

  17. Hydrothermal synthesis of hexagonal CeO{sub 2} nanosheets and their room temperature ferromagnetism

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Fanming, E-mail: mrmeng@ahu.edu.cn [School of Physics and Materials Science, Anhui University, Hefei 230601 (China); Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Dalian University of Technology, Ministry of Education, Dalian 116024 (China); Zhang, Cheng; Fan, Zhenghua; Gong, Jinfeng; Li, Aixia; Ding, Zongling; Tang, Huaibao; Zhang, Miao; Wu, Guifang [School of Physics and Materials Science, Anhui University, Hefei 230601 (China)

    2015-10-25

    Hexagonal CeO{sub 2} nanosheets of 40–50 nm in thickness and 300–400 nm in side-length have been successfully synthesized via controlling the morphology of CeCO{sub 3}OH precursors by a facile hydrothermal technique using CeCl{sub 3}·7H{sub 2}O as cerium source, ammonium hydrogen carbonate as precipitants, and ethylenediamine as complexant. The reaction time and the amount of CeCl{sub 3}·7H{sub 2}O and ethylenediamine were systematically investigated. The as-synthesized hexagonal CeO{sub 2} nanosheets were examined by XRD, SEM, TEM, XPS, Raman scattering and magnetization measurements. It is found that the amount of CeCl{sub 3}·7H{sub 2}O and ethylenediamine are key parameters for controlling the final morphology. The hexagonal CeO{sub 2} nanosheets have a fluorite cubic structure and there are Ce{sup 3+} ions and oxygen vacancies in surface of samples. The synthesized CeO{sub 2} shows excellent room temperature optical properties. M–H curve exhibits excellent room-temperature ferromagnetism (RTFM) with saturation magnetization (M{sub s}) of 3.02 × 10{sup −2} emu/g, residual magnetization (M{sub r}) of 0.68 × 10{sup −2} emu/g and coercivity (H{sub c}) of 210 Oe, which is likely attributed to the effects of the Ce{sup 3+} ions and oxygen vacancies. - Highlights: • Hexagonal CeO{sub 2} nanosheets with superexerllent RTFM are synthesized by a facile hydrothermal method. • RTFM mechanism of CeO{sub 2} nanosheets can be attributed to the influences of oxygen vacancies and Ce{sup 3+} ions. • A defect driven dissolution–recrystallization mechanism is suggested to explain the transformation from nanowires to nanosheets.

  18. Manipulating Ce Valence in RE2Fe14B Tetragonal Compounds by La-Ce Co-doping: Resultant Crystallographic and Magnetic Anomaly.

    Science.gov (United States)

    Jin, Jiaying; Zhang, Yujing; Bai, Guohua; Qian, Zeyu; Wu, Chen; Ma, Tianyu; Shen, Baogen; Yan, Mi

    2016-01-01

    Abundant and low-cost Ce has attracted considerable interest as a prospective alternative for those critically relied Nd/Pr/Dy/Tb in the 2:14:1-type permanent magnets. The (Nd, Ce)2Fe14B compound with inferior intrinsic magnetic properties to Nd2Fe14B, however, cannot provide an equivalent magnetic performance. Since Ce valence is sensitive to local steric environment, manipulating it towards the favorable trivalent state provides a way to enhance the magnetic properties. Here we report that such a desirable Ce valence can be induced by La-Ce co-doping into [(Pr, Nd)1-x(La, Ce)x]2.14Fe14B (0 ≤ x ≤ 0.5) compounds via strip casting. As verified by X-ray photoelectron spectroscopy results, Ce valence shifts towards the magnetically favorable Ce(3+) state in the composition range of x > 0.3, owing to the co-doping of large radius La(3+) into 2:14:1 phase lattice. As a result, both crystallographic and magnetic anomalies are observed in the same vicinity of x = 0.3, above which lattice parameters a and c, and saturation magnetization Ms increase simultaneously. Over the whole doping range, 2:14:1 tetragonal structure forms and keeps stable even at 1250 K. This finding may shed light on obtaining a favorable Ce valence via La-Ce co-doping, thus maintaining the intrinsic magnetic properties of 2:14:1-type permanent magnets. PMID:27457408

  19. Manipulating Ce Valence in RE2Fe14B Tetragonal Compounds by La-Ce Co-doping: Resultant Crystallographic and Magnetic Anomaly

    Science.gov (United States)

    Jin, Jiaying; Zhang, Yujing; Bai, Guohua; Qian, Zeyu; Wu, Chen; Ma, Tianyu; Shen, Baogen; Yan, Mi

    2016-01-01

    Abundant and low-cost Ce has attracted considerable interest as a prospective alternative for those critically relied Nd/Pr/Dy/Tb in the 2:14:1-type permanent magnets. The (Nd, Ce)2Fe14B compound with inferior intrinsic magnetic properties to Nd2Fe14B, however, cannot provide an equivalent magnetic performance. Since Ce valence is sensitive to local steric environment, manipulating it towards the favorable trivalent state provides a way to enhance the magnetic properties. Here we report that such a desirable Ce valence can be induced by La-Ce co-doping into [(Pr, Nd)1−x(La, Ce)x]2.14Fe14B (0 ≤ x ≤ 0.5) compounds via strip casting. As verified by X-ray photoelectron spectroscopy results, Ce valence shifts towards the magnetically favorable Ce3+ state in the composition range of x > 0.3, owing to the co-doping of large radius La3+ into 2:14:1 phase lattice. As a result, both crystallographic and magnetic anomalies are observed in the same vicinity of x = 0.3, above which lattice parameters a and c, and saturation magnetization Ms increase simultaneously. Over the whole doping range, 2:14:1 tetragonal structure forms and keeps stable even at 1250 K. This finding may shed light on obtaining a favorable Ce valence via La-Ce co-doping, thus maintaining the intrinsic magnetic properties of 2:14:1-type permanent magnets. PMID:27457408

  20. Efeito de agentes anti-hipertensivos sobre as células estreladas durante a regeneração hepática em ratos

    Directory of Open Access Journals (Sweden)

    Ramalho Fernando S.

    2000-01-01

    Full Text Available O efeito de um inibidor da enzima conversora da angiotensina (lisinopril, de um antagonista do receptor da angiotensina II (losartan e da bradicinina na população de células estreladas (CE durante o fenômeno regenerativo hepático foi estudado. Ratos machos Wistar receberam lisinopril, losartan, bradicinina ou solução salina em volumes proporcionais, intraperitonealmente, antes e após hepatectomia parcial a 70% (HP. Cinco animais de cada grupo experimental e controle foram sacrificados sob anestesia com éter em 36 horas após a HP. A população de CE marcadas para alfa-actina de músculo liso foi estimada nas zonas periportal e pericentral das amostras hepáticas. A população de CE foi menor no grupo tratado com losartan, e maior nos grupos tratados com bradicinina e lisinopril que no grupo controle. Estes resultados sugerem que o losartan pode inibir, e a bradicinina e o lisinopril podem estimular a população de CE durante a regeneração hepática em ratos.

  1. Burnout em cuidados paliativos

    OpenAIRE

    Simões, Sílvia Cristina Almeida

    2013-01-01

    Dissertação apresentada ao Instituto Politécnico de Castelo Branco para cumprimento dos requisitos necessário à obtenção de grau de Mestre em Cuidados Paliativos. O presente trabalho foi realizado no âmbito do 3º semestre do 1º Curso de Mestrado em Cuidados Paliativos, da Escola Superior de Saúde Dr. Lopes Dias. O trabalho encontra-se estruturado em quatro capítulos: o primeiro diz respeito ao relatório da prática clínica, o segundo aborda o enquadramento teórico sobre a Síndrome de Bur...

  2. EMS in Mauritius.

    Science.gov (United States)

    Ramalanjaona, Georges; Brogan, Gerald X

    2009-02-01

    Mauritius lies in the southwest Indian Ocean about 1250 miles from the African coast and 500 miles from Madagascar. Mauritius (estimated population 1,230,602) became independent from the United Kingdom in 1968 and has one of the highest GDP per capita in Africa. Within Mauritius there is a well established EMS system with a single 999 national dispatch system. Ambulances are either publicly or privately owned. Public ambulances are run by the Government (SAMU). Megacare is a private subscriber only ambulance service. The Government has recently invested in new technology such as telemedicine to further enhance the role of EMS on the island. This article describes the current state of EMS in Mauritius and depicts its development in the context of Government effort to decentralise and modernise the healthcare system.

  3. Kinetic Study of Ce4+ Extraction with Cyanex 923

    Institute of Scientific and Technical Information of China (English)

    于桂红; 乐善堂; 李德谦; 凤优游

    2001-01-01

    Ce4+ extraction rate from aqueous sulphate solutions by Cyanex923 in heptane was studied using a constant interfacial cell with laminar flow at 30 ℃. The experimental hydrodynamic conditions were chosen and the contribution of diffusion to the measured rate of reaction was minimized. Cerium extraction rate was measured at different chemical composition by varying the concentrations of hydrogen ion, sulphate and Cyanex923. A cerium-Cyanex923(B) extractive is formed at the interface. The data were analyszed in terms of pseudo-first order constants and a reaction mechanism was developed.

  4. Programming Windows® Embedded CE 60 Developer Reference

    CERN Document Server

    Boling, Douglas

    2010-01-01

    Get the popular, practical reference to developing small footprint applications-now updated for the Windows Embedded CE 6.0 kernel. Written by an authority on embedded application development, this book focuses in on core operating concepts and the Win32 API. It delivers extensive code samples and sample projects-helping you build proficiency creating innovative Windows applications for a new generation of devices. Discover how to: Create complex applications designed for the unique requirements of embedded devicesManage virtual memory, heaps, and the stack to minimize your memory footprintC

  5. Kantavien teräsrakenteiden CE-merkintä

    OpenAIRE

    Rissanen, Ilkka

    2016-01-01

    Tässä diplomityössä käsitellään pienelle kotimaiselle konepajalle tehtyä kehityshanketta. Työn taustalla on Euroopan unionin talousalueella 1.7.2013 voimaan astunut asetus. Asetuksessa vaaditaan, että rakennustuotteilla, joita markkinoidaan Euroopan unionin talousalueella ja, joita koskevat yhtenäistetyt Euroopan unionin tuotedirektiivit täytyy olla varustettuna CE-merkinnällä. Teräsrakenteille asetus astui lopullisesti voimaan 1.7.2014. Työn tavoitteena oli kehittää kohdeyrityksen teräs...

  6. Projected shell model study of neutron-deficient 122Ce

    Indian Academy of Sciences (India)

    Rani Devi; B D Sehgal; S K Khosa

    2006-09-01

    The observed excited states of 122Ce nucleus have been studied in the frame-work of projected shell model (PSM). The yrast band has been studied up to spin 26 ħ. The first band crossing has been predicted above a rotational frequency of 0.4 MeV/ħ that corresponds to first backbending. The calculation reproduces the experimentally observed ground state band up to spin 14ħ. The electromagnetic quantities, transition quadrupole moments and -factors are predicted and there is a need to measure these quantities experimentally.

  7. Evaluation of Pseudopteroxazole and Pseudopterosin Derivatives against <em>Mycobacterium> <em>tuberculosis> and Other Pathogens

    OpenAIRE

    McCulloch, Malcolm W. B.; Brad Haltli; Marchbank, Douglas H.; Kerr, Russell G.

    2012-01-01

    Pseudopterosins and pseudopteroxazole are intriguing marine natural products that possess notable antimicrobial activity with a commensurate lack of cytotoxicity. New semi-synthetic pseudopteroxazoles, pseudopteroquinoxalines and pseudopterosin congeners along with simple synthetic mimics of the terpene skeleton were synthesized. In order to build structure-activity relationships, a set of 29 new and previously reported compounds was assessed for <em>in> <em>vitro...

  8. Ulisses em Kafka

    Directory of Open Access Journals (Sweden)

    Stéphane Mosès

    2015-02-01

    Full Text Available ResumoEm sua introdução para Exegese de uma lenda, Stéphane Mosès afirma que a obra de Kafka não necessita de novas interpretações, mas sim de uma “análise rigorosa de sua lógica subjacente”. Assim, em “Ulisses em Kafka”, investigandoa dialética formal de “O silêncio das sereias”, Mosès procura expor a estrutura narrativa que comandaria esse breve texto em que o escritor tcheco acrescenta à astucia de Ulisses a ingenuidade como elemento de salvação.Palavras-chave: Kafka; dialética; salvação.AbstractIn his introduction to Exegèse d’une légende, Stéphane Mosès affirms that Kafka’s works are not in need of new interpretations, but rather, of a “rigorous analysis of their underlying logic”. Thus, in “Ulisses chez Kafka”, by investigating the formal dialectic of “Das Schweigen der Sirenen”, Mosès seeks to exhibit the narrative structure that would supposedly guide this short text in which the Czech author adds naïveté to Ulisses’s cunning intelligence as an element of salvation.Keywords: Kafka; dialectic; salvation.Stéphane Mosès foi professor emérito da Universidade Hebraica de Jerusalém, onde ensinou Literatura Alemã e Comparada, entre os seus principais interesses estavam o pensamento de Franz Rosenzweig e de Walter Benjamin e as literaturas de Franz Kafka e de Paul Célan. Autor de diversos livros, entre eles: L'ange de l'histoire. Rosenzweig, Benjamin, Scholem, Exégèse d'une légende, lectures de Kafka, e Rêves de Freud. Six lectures.Rodrigo Ielpo é doutor em literatura francesa pela UFRJ e em História e Semiologia do texto e da imagem pela Université Paris VII, com pós-doutorado em Teoria Literária pela UNICAMP. Professor Adjunto do Departamento de Letras Neolatinas da Universidade Federal do Rio de Janeiro, possui publicações e traduções nos seguintes temas: teoria e literatura francesa contemporâneas, escrita e processos de subjetivação.rodrigoielpo@gmail.com 

  9. Preparation and Characterization of Nanocrystalline CeO2 by Precipitation Method

    Institute of Scientific and Technical Information of China (English)

    董相廷; 李明; 张伟; 刘桂霞; 洪广言

    2002-01-01

    CeO2 nanocrystalline particulates with different sizes were prepared by precipitation method using ethanol as dispersive and protective reagent. XRD spectra show that the synthesized CeO2 has cubic crystalline structure of space group O5H-FM3M, when calcination temperature is in the range of 250~800 ℃. TEM images reveal that CeO2 particles are spherical in shape. The average size of the particles increases with the increase of calcination temperature. Thermogravimetric analysis indicates that the weight loss of precursor mainly depends on the calcination temperature, and little depends on the calcination time. Measurements of CeO2 relative density show that the relative density of CeO2 nanocrystalline powders increases with increasing CeO2 particle size.

  10. Equiatomic cerium intermetallics CeXX' with two p elements

    Energy Technology Data Exchange (ETDEWEB)

    Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Chevalier, Bernard [Bordeaux Univ., Pessac (France). Institut de Chimie de la Matiere Condensee de Bordeaux

    2015-07-01

    The equiatomic CeXX' phases (X and X' = elements of the 3{sup rd}, 4{sup th}, or 5{sup th} main group) extend the large series of CeTX intermetallics (T = electron-rich transition metal). These phases crystallize with simple structure types, i.e. ZrNiAl, TiNiSi, CeScSi, α-ThSi{sub 2}, AlB{sub 2}, and GdSi{sub 2}. In contrast to the CeTX intermetallics one observes pronounced solid solutions for the CeXX' phases. The main influence on the magnetic ground states results from the absence of d electrons. All known CeXX' phases show exclusively trivalent cerium and antiferro- or ferromagnetic ordering at low temperatures. The crystal chemical details and some structure-property relationships are reviewed.

  11. Long Lasting Phosphorescence in Eu2+ and Ce3+ Co-Doped Strontium Borate Glasses

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Long lasting phosphorescence (LLP) was observed in Eu2+, Ce3+ co-doped strontium borate glasses prepared under the reducing atmosphere due to the emission of both Eu2+ and Ce3+. The methods of photoluminescence, thermoluminescence and phosphorescence were used to study the samples, and possible mechanism was suggested. The co-doping of Ce3+ ions poisoned the phosphorescence emission of Eu2+ because of the competition to obtain the trapped electron. The phosphorescence of Ce3+ in the sample decays more quickly than that of Eu2+, which is suggested for the reason that the emission energy of Ce3+ is higher or the distance between Ce3+ and electron traps of the glasses is longer.

  12. Horizontal Transmission of the Entomopathogen Fungus <em>Metarhizium anisopliae em>in <em>Microcerotermes diversusem> Groups

    Directory of Open Access Journals (Sweden)

    Mohammad Saied Mossadegh

    2012-08-01

    Full Text Available An experiment was carried out in order to investigate fungal conidia transmission of <em>Metarhizium anisopliae em>(Metschnikoff> em>Sorokin from vector (donor to healthy <em>Microcerotermes diversusem> Silvestri (Iso.: Termitidae and determine the best donor/concentration ratio for transmission. After preliminary trials, concentrations of 3.1 × 104, 3.9 × 105, 3.2 × 106 and 3.5 × 108 conidia mL−1 were selected for testing. The experiment was performed at three donor : Recipient ratios of 10, 30 and 50%. The highest mortality of recipient workers was observed after 14 days at the concentration of 3.5 × 108 conidia mL−1 and donor ratio of 50%. The mortality of recipient workers was less than 20% at all concentrations at a donor ratio of 10%. Our observations indicate social behavior of <em>M. diversusem>, such as grooming, can be effective in promoting epizootic outbreaks in a colony. While the current results suggest good potential for efficacy, the use of <em>M. anisopliaeem> as a component of integrated pest management of <em>M. diversusem> still needs to be proven under field conditions.

  13. Diversity of Scarabaeinae (Coleoptera: Scarabaeidae in the Ceará Botanical Park, Caucaia - CE, Brazil = Diversidade de Scarabaeinae (Coleoptera: Scarabaeidae no Parque Botânico do Ceará, Caucaia - CE, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Goretti Araújo Lima

    2013-04-01

    Full Text Available Abstract - The objective of this study was to survey and analyze richness, abundance, equitability and diversity of Scarabaeinae species in two different environments, Carnaúba Riparian Forest and in Tabuleiro Forest in Ceará Botanic Park, Caucaia - CE, Brazil. Samples were collected monthly during the period from March to November 2008. To capture the scarabs were used 48 traps Pitfall, baited with human feces, being 24 traps in each area, distributed in two parallel transects constituted by twelve traps. Were collected at the end of the survey 5382 subfamily Scarabaeinae specimens belonging to five tribes, nine gender and 11 species. In Carnaúba Riparian Forest 3175 insects were found distributed in seven species. In Tabuleiro Forest were collected 2207 specimens belonging to 10 species. Six species occurred in both areas, one only in Riparian Forest and four in Tabuleiro Forest. Uroxys sp. was the most abundant species in both areas (35.2%, followed by Sylvicanthon sp. (31.9% and Canthidium sp.2 (16.7%. The Tabuleiro Forest showed greater wealth and Carnaúba Riparian Forest greater abundance. The observed diversity broadens the information about the community of Scarabaeinae in the state of Ceará. = Resumo - Objetivou-se com o presente trabalho realizar levantamento e análise da riqueza, abundância, equitabilidade e diversidade das espécies de Scarabaeinae em dois ambientes, Mata Ciliar de Carnaúba e Mata de Tabuleiro, no Parque Botânico do Ceará, Caucaia – CE, Brasil. As coletas foram realizadas mensalmente durante o período de março a novembro de 2008. Para captura dos escarabeídeos foram utilizadas 48 armadilhas de solo tipo “Pitfall”, iscadas com fezes humanas, sendo 24 armadilhas em cada área, distribuídas em dois transectos paralelos constituídos por doze armadilhas. Foram coletados ao final do levantamento 5.382 espécimes da subfamília Scarabaeinae pertencentes a cinco tribos, nove gêneros e 11 espécies. Na

  14. Tuning the properties of the UiO-66 metal organic framework by Ce substitution.

    Science.gov (United States)

    Nouar, Farid; Breeze, Matthew I; Campo, Betiana C; Vimont, Alexandre; Clet, Guillaume; Daturi, Marco; Devic, Thomas; Walton, Richard I; Serre, Christian

    2015-10-01

    Crystallisation of a mixed-metal form of the porous framework UiO-66 in which Zr is partially replaced by Ce produces a ligand-defective material, that contains some Ce(III) as well as a majority of Ce(IV). Infrared spectroscopy shows enhanced binding of methanol in the substituted material that leads to catalytic decomposition of the alcohol, which may be due to a combination of defects and redox activity. PMID:26278204

  15. Structural and magnetic phase transitions in CeCu6 -xTx (T =Ag ,Pd )

    Science.gov (United States)

    Poudel, L.; de la Cruz, C.; Payzant, E. A.; May, A. F.; Koehler, M.; Garlea, V. O.; Taylor, A. E.; Parker, D. S.; Cao, H. B.; McGuire, M. A.; Tian, W.; Matsuda, M.; Jeen, H.; Lee, H. N.; Hong, T.; Calder, S.; Zhou, H. D.; Lumsden, M. D.; Keppens, V.; Mandrus, D.; Christianson, A. D.

    2015-12-01

    The structural and the magnetic properties of CeCu6 -xAgx (0 ≤x ≤0.85 ) and CeCu6 -xPdx (0 ≤x ≤0.4 ) have been studied using neutron diffraction, resonant ultrasound spectroscopy (RUS), x-ray diffraction measurements, and first principles calculations. The structural and magnetic phase diagrams of CeCu6 -xAgx and CeCu6 -xPdx as a function of Ag/Pd composition are reported. The end member, CeCu6, undergoes a structural phase transition from an orthorhombic (P n m a ) to a monoclinic (P 21/c ) phase at 240 K. In CeCu6 -xAgx , the structural phase transition temperature (Ts) decreases linearly with Ag concentration and extrapolates to zero at xS ≈0.1 . The structural transition in CeCu6 -xPdx remains unperturbed with Pd substitution within the range of our study. The lattice constant b slightly decreases with Ag/Pd doping, whereas a and c increase with an overall increase in the unit cell volume. Both systems, CeCu6 -xAgx and CeCu6 -xPdx , exhibit a magnetic quantum critical point (QCP), at x ≈0.2 and x ≈0.05 , respectively. Near the QCP, long range antiferromagnetic ordering takes place at an incommensurate wave vector (δ10 δ2), where δ1˜0.62 ,δ2˜0.25 ,x =0.125 for CeCu6 -xPdx and δ1˜0.64 ,δ2˜0.3 ,x =0.3 for CeCu6 -xAgx . The magnetic structure consists of an amplitude modulation of the Ce moments which are aligned along the c axis of the orthorhombic unit cell.

  16. Thermal-neutron scintillator: Ce3+ activated Rb2LiYBr6

    NARCIS (Netherlands)

    Birowosuto, M.D.; Dorenbos, P.; De Haas, J.T.M.; Van Eijk, C.W.E.; Krämer, K.W.; Güdel, H.U.

    2007-01-01

    Scintillation and luminescence characteristics of Rb2LiYBr6 doped with 0.1%, 0.5%, 1%, and 5% Ce3+ are presented. Under optical and x-ray excitation, Ce3+ doublet emission is observed at 385 and 420 nm. Rb2LiYBr6:0.5% Ce3+ shows very high thermal neutron scintillation light output of 83 000 photons/

  17. Neutron scattering studies of non-Fermi liquid behavior in Ce compounds

    Science.gov (United States)

    Park, J.-G.; Adroja, D. T.; McEwen, K. A.; Murani, A. P.; So, J.-Y.; Beirne, E.; Echizen, Y.; Takabatake, T.

    2002-03-01

    We have studied the inelastic neutron scattering from two Ce heavy fermion compounds, Ce(Ni0.935Cu0.065)Sn and Ce(Rh0.8Pd0.2)Sb, that are located at the magnetic-non-magnetic boundary. We find that the magnetic scattering follows a power law scaling behavior, and that the dynamical susceptibility, as deduced from the magnetic scattering, shows E/T scaling behavior with significantly different exponents for the two systems.

  18. Spectral characteristics and energy transfer from Ce3+ to Tb3+ in compounds Lu1 - x - y Ce x Tb y BO3

    Science.gov (United States)

    Shmurak, S. Z.; Kedrov, V. V.; Kiselev, A. P.; Fursova, T. N.; Smyt'ko, I. M.

    2016-03-01

    The structure, IR absorption spectra, morphology, and spectral characteristics of compounds Lu1 - x - y Ce x Tb y BO3 have been investigated. It has been shown that the Tb3+ luminescence excitation spectrum of the Lu1 - x - y Ce x Tb y BO3 compounds is dominated by a broad band coinciding with the excitation band of Ce3+ ions, which clearly indicates energy transfer from the Ce3+ ions to the Tb3+ ions. The spectral position of this band depends on the structural state of the sample: in the structures of calcite and vaterite, the band has maxima at ~339 and ~367 nm, respectively. By varying the ratio between the calcite and vaterite phases in the sample, it is possible to purposefully change the Tb3+ luminescence excitation spectrum, which is important for the optimization of the spectral characteristics of Lu1 - x - y Ce x Tb y BO3 when it is used in light-emitting diode sources. An estimate has been obtained for the maximum distance between Ce3+ and Tb3+ ions, which corresponds to electronic excitation energy transfer. It has been shown that the high intensity of Tb3+ luminescence in these compounds is due to the high efficiency of electronic excitation energy transfer from the Ce3+ ions to the Tb3+ ions as a result of the dipole-dipole interaction.

  19. Synthesis and Characterization of Ce-Doped Y3Al5O12 (YAG:Ce Nanopowders Used for Solid-State Lighting

    Directory of Open Access Journals (Sweden)

    Do Ngoc Chung

    2014-01-01

    Full Text Available Nano-Ce-doped Y3Al5O12 (YAG:Ce powders were synthesized by using a sol-gel low temperature combustion method, followed by thermal annealing. The annealing temperature for enriching nanoparticles was optimized and found to be 1000°C. The process for enriching uniform nanoparticles of YAG:Ce powder was carried out by using the nanosteam technique (NST. The nanoparticles obtained from this NST treatment had a size in the range of 9–20 nm. Measurements of the photoluminescence spectra of the dispersed YAG:Ce nanoparticles solutions showed a blue shift in the photoemission with a value of ca. 10 nm in the green region. WLEDs made from the blue LED chip coated with the nano-YAG:Ce + MEH-PPV composite epoxy exhibit white light with a broad band luminescent spectrum and a high color rending index (CRI. The photoluminescence spectra of the YAG:Ce nanoparticles showed a potential application of the prepared nanostructured YAG:Ce phosphor not only in energy-efficient solid-state lighting, but also in optoelectronic devices, including organic composite solar cells. In addition, it is suggested that NST can be applied for the enrichment of uniform inorganic nanoparticles.

  20. High-pressure Raman study on CeO{sub 2} nanospheres self-assembled by 5 nm CeO{sub 2} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Bo; Liu, Bingbing; Li, Quanjun; Li, Zepeng; Yao, Mingguang; Liu, Ran; Zou, Xu; Lv, Hang; Wu, Wei; Cui, Wen; Liu, Zhaodong; Li, Dongmei; Zou, Bo; Cui, Tian; Zou, Guangtian [State Key Laboratory of Superhard Materials, Jilin University, Changchun 130012 (China)

    2011-05-15

    CeO{sub 2} undergoes a first-order phase transition from fluorite to {alpha}-PbCl{sub 2}-type structure under high pressure. To evaluate the changes in physical properties of CeO{sub 2} nanomaterials as the particle size decreasing, high-pressure Raman study under quasi-hydrostatic condition has been performed on CeO{sub 2} nanospheres self-assembled by 5 nm CeO{sub 2} nanoparticles at room temperature. Surprisingly, as the pressure elevate to 34 GPa, the CeO{sub 2} nanospheres still retain the cubic fluorite-type structure, indicating the sample is more stable than the bulk counterpart. Whereas, previous high-pressure studies show the phase transition at 22.3/26.5 GPa for 12 nm CeO{sub 2} nanoparticles, which is less stable than the bulk materials. The enhancement of phase stability might be attributed to the increase of surface energy of CeO{sub 2} nanospheres as the size of the building units decrease. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  1. Clinical Relevance of <em>CDH1em> and <em>CDH13em> DNA-Methylation in Serum of Cervical Cancer Patients

    Directory of Open Access Journals (Sweden)

    Günther K. Bonn

    2012-07-01

    Full Text Available This study was designed to investigate the DNA-methylation status of <em>E>-cadherin (<em>CDH1em> and <em>H>-cadherin (<em>CDH13em> in serum samples of cervical cancer patients and control patients with no malignant diseases and to evaluate the clinical utility of these markers. DNA-methylation status of <em>CDH1em> and <em>CDH13em> was analyzed by means of MethyLight-technology in serum samples from 49 cervical cancer patients and 40 patients with diseases other than cancer. To compare this methylation analysis with another technique, we analyzed the samples with a denaturing high performance liquid chromatography (DHPLC PCR-method. The specificity and sensitivity of <em>CDH1em> DNA-methylation measured by MethyLight was 75% and 55%, and for <em>CDH13em> DNA-methylation 95% and 10%. We identified a specificity of 92.5% and a sensitivity of only 27% for the <em>CDH1em> DHPLC-PCR analysis. Multivariate analysis showed that serum <em>CDH1em> methylation-positive patients had a 7.8-fold risk for death (95% CI: 2.2–27.7; <em>p> = 0.001 and a 92.8-fold risk for relapse (95% CI: 3.9–2207.1; <em>p> = 0.005. We concluded that the serological detection of <em>CDH1em> and <em>CDH13em> DNA-hypermethylation is not an ideal diagnostic tool due to low diagnostic specificity and sensitivity. However, it was validated that <em>CDH1em> methylation analysis in serum samples may be of potential use as a prognostic marker for cervical cancer patients.

  2. Fumigant Antifungal Activity of Myrtaceae Essential Oils and Constituents from <em>Leptospermum petersoniiem> against Three <em>Aspergillus> Species

    Directory of Open Access Journals (Sweden)

    Il-Kwon Park

    2012-09-01

    Full Text Available Commercial plant essential oils obtained from 11 Myrtaceae plant species were tested for their fumigant antifungal activity against <em>Aspergillus ochraceusem>, <em>A. flavusem>, and <em>A. nigerem>. Essential oils extracted from<em> em>Leptospermum> <em>petersonii> at air concentrations of 56 × 10−3 mg/mL and 28 × 10−3 mg/mL completely inhibited the growth of the three <em>Aspergillus> species. However, at an air concentration of 14 × 10−3 mg/mL, inhibition rates of <em>L. petersoniiem> essential oils were reduced to 20.2% and 18.8% in the case of <em>A. flavusem> and <em>A. nigerem>, respectively. The other Myrtaceae essential oils (56 × 10−3 mg/mL only weakly inhibited the fungi or had no detectable affect. Gas chromatography-mass spectrometry analysis identified 16 compounds in <em>L. petersoniiem>> em>essential> em>oil.> em>The antifungal activity of the identified compounds was tested individually by using standard or synthesized compounds. Of these, neral and geranial inhibited growth by 100%, at an air concentration of 56 × 10−3 mg/mL, whereas the activity of citronellol was somewhat lover (80%. The other compounds exhibited only moderate or weak antifungal activity. The antifungal activities of blends of constituents identified in <em>L. petersoniiem> oil indicated that neral and geranial were the major contributors to the fumigant and antifungal activities.

  3. Non-aqueous CE-MS of cinchona alkaloids - characterization of a novel CE-ESI-MS interface

    DEFF Research Database (Denmark)

    Hansen, Frederik André; Hansen, Steen Honoré; Petersen, Nickolaj J.

    the composition of alkaloids in Cinchona bark. One common problem for sheatless interfaces for CE-MS has been establishing a stable electric contact at the end of the separation capillary that does not induce band broadening or affect the spray stability. In our device the electric contact is generated through....... Furthermore, the increased conductivity of the buffer in the fracture generates field free pumping of the analytes towards the ESI spray tip. In this study the device was used to analyze the four major alkaloids (diastereomeric pairs of quinine/quinidine and cinchonine/cinchonidine) in Cinchona bark samples...

  4. Study of structural and electronic transport properties of Ce-doped LaMnO3

    Indian Academy of Sciences (India)

    Shahid Husain; R J Choudhary; Ravi Kumar; S I Patil; J P Srivastava

    2002-05-01

    The structural and electronic transport properties of La1-CeMnO3 (=0.0-1.0) have been studied. All the samples exhibit orthorhombic crystal symmetry and the unit cell volume decreases with Ce doping. They also make a metal–insulator transition (MIT) and transition temperature increases with increase in Ce concentration up to 50% doping. The system La0.5Ce0.5MnO3 also exhibits MIT instead of charge-ordered state as observed in the hole doped systems of the same composition.

  5. Growth and Photoluminescence of Epitaxial CeO2 Film on Si (111) Substrate

    Institute of Scientific and Technical Information of China (English)

    GAO Fei; ZHANG Jian-Hui; QIN Fu-Guang; YAO Zhen-Yu; LIU Zhi-Kai; WANG Zhan-Guo; LIN Lan-Ying

    2001-01-01

    A CeO2 film with a thickness of about 80nm was deposited by a mass-analysed low-energy dual ion beam deposition technique on an Si(111) substrate. Reflection high-energy electron diffraction and x-ray diffraction measurements showed that the film is a single crystal. The tetravalent state of Ce in the film was confirmed by xray photoelectron spectroscopy measurements, indicating that stoichiometric CeO2 was formed. Violet/blue light emission (379.5 nm) was observed at room temperature, which may be tentatively explained by charge transitions from the 4f band to the valence band of CeO2.

  6. Experimental investigation and thermodynamic calculation of the Zn–Fe–Ce system

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Longfei; Wu, Changjun [Jiangsu Key Laboratory of Materials Surface Science and Technology, Changzhou University, Jiangsu 213164 (China); Jiangsu Collaborative Innovation Center of Photovolatic Science and Engineering, Changzhou University, Jiangsu 213164 (China); Wang, Jianhua, E-mail: wangjh@cczu.edu.cn [Jiangsu Key Laboratory of Materials Surface Science and Technology, Changzhou University, Jiangsu 213164 (China); Jiangsu Collaborative Innovation Center of Photovolatic Science and Engineering, Changzhou University, Jiangsu 213164 (China); Liu, Ya; Tu, Hao; Su, Xuping [Jiangsu Key Laboratory of Materials Surface Science and Technology, Changzhou University, Jiangsu 213164 (China); Jiangsu Collaborative Innovation Center of Photovolatic Science and Engineering, Changzhou University, Jiangsu 213164 (China)

    2015-11-05

    The 450 °C and 600 °C isothermal sections of the Zn–Fe–Ce system were investigated using equilibrated alloys and diffusion couples. The samples were analyzed by Scanning Electron Microscopy equipped with Energy Dispersive X-ray Spectrometer analysis and X-ray power diffraction. 15 and 13 three-phase regions were identified to exist at 450 °C and 600 °C, respectively. No ternary compound was found. Ce can not dissolve into all the Zn–Fe binary compounds and the solubilities of Fe in all the Zn–Ce binary phases were limited. All the Zn–Fe compounds can equilibrate with CeZn{sub 11} and all the Ce–Zn compounds (except CeZn) can equilibrate with α-Fe. Furthermore, thermodynamic extrapolation of the Zn–Fe–Ce system was carried out and showed good agreement well with detected phase relationships. - Highlights: • 450 °C and 600 °C sections of the Zn–Fe–Ce system were constructed. • No ternary compound exists. • Ce can not dissolve into all the Zn–Fe compounds. • All the Fe–Zn compounds can equilibrate with CeZn{sub 11}. • Thermodynamic extrapolation results agree with experimental data.

  7. Oxygen storage and catalytic NO removal promoted by CeO2-containing mixed oxides

    International Nuclear Information System (INIS)

    CeO2-ZrO2 mixed oxides show improved redox properties as compared to CeO2 which makes them important innovative materials for three-way catalysts. The origin of this effect and the structural/redox correlation are discussed. The influence of the improved redox capacities on the reduction of NO by CO catalyzed by Rh/CeO2-ZrO2 catalysts is reported and evidence for an active role of the CeO2-ZrO2 support in NO activation is presented. (orig.)

  8. Selective synthesis and growth mechanism of CeVO4 nanoparticals via hydrothermal method

    Institute of Scientific and Technical Information of China (English)

    LIU Fengzhen; SHAO Xin; YIN Yibin; ZHAO Limin; SUN Qiaozhen; SHAO Zhuwei; LIU Xuehua; MENG Xianhua

    2011-01-01

    Selective-controlled structure and shape of CeVO4 nanocrystals were successfully synthesized via a hydrothermal method from electron microscopy (FESEM) and energy dispersive spectroscopy (EDS). The influence of hydrothermal temperature, precursor solution concentration on the crystal and morphology of products were further studied. The results showed that the as-synthesized products exhibited pure single-crystal CeVO4 nanoparticles with tetragonal structure. The hydrothermal temperature and precursor solution concentration had important effects on the formation of CeVO4 nanoparticles. Furthermore, the growth mechanism of CeVO4 nanoparticles was explained with Ostwald ripening mechanism.

  9. Growth and Electronic Properties of Ag Nanoparticles on Reduced CeO2-x(111) Films

    Institute of Scientific and Technical Information of China (English)

    Dan-dan Kong; Yong-he Pan; Guo-dong Wang; Hai-bin Pan; Jun-fa Zhu

    2012-01-01

    Ag nanoparticles grown on reduced CeO2-x thin films have been studied by X-ray photoelectron spectroscopy and resonant photoelectron spectroscopy of the valence band to understand the effect of oxygen vacancies in the CeO2-x thin films on the growth and interfacial electronic properties of Ag.Ag grows as three-dimensional particles on the CeO2-x(111) surface at 300 K.Compared to the fully oxidized ceria substrate surface,Ag favors the growth of smaller particles with a larger particle density on the reduced ceria substrate surface,which can be attributed to the nucleation of Ag on oxygen vacancies.The binding energy of Ag3d increases when the Ag particle size decreases,which is mainly attributed to the final-state screening.The interfacial interaction between Ag and CeO2-x(111) is weak.The resonant enhancement of the 4f level of Ce3+ species in RPES indicates a partial Ce4+→Ce3+ reduction after Ag deposited on reduced ceria surface.The sintering temperature of Ag on CeO 1.85 (111) surface during annealing is a little higher than that of Ag on CeO2 (111) surface,indicating that Ag nanoparticles are more stable on the reduced ceria surface.

  10. Effect of Cerium on Chemical Short-Range Order of Al-Fe-Ce Amorphous Alloy

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The chemical short-range order of Al-Fe-Ce amorphous alloy was studied by means of X-ray diffraction(XRD) and differential scanning calorimetry(DSC). It is found that the prepeak position in X-ray diffraction intensity curve shifts to higher angles as the content of Fe increases, but it shifts to smaller angles as the content of Ce increases. The crystallization character of the amorphous alloy changes with the variation of the content of Fe and Ce. Ce can improve the interaction between atoms and the capacity of compound formation, so it is favorable to Al-based glass formability.

  11. Research on CeO2 cap layer for YBCO-coated conductor

    Institute of Scientific and Technical Information of China (English)

    Shi Dong-Qi; Ma Ping; Ko Rock-Kil; Kim Ho-Sup; Chung Jun-Ki; Song Kyu-Jeong; Park Chan

    2007-01-01

    Two groups of coated conductor samples with different thicknesses of CeO2 cap layers deposited by pulsed laser deposition (PLD) under the same conditions have been studied. Of them, one group is of CeO2 films, which are deposited on stainless steel (SS) tapes coated by IBAD-YSZ (IBAD-YSZ/SS), and the other group is of CeO2/YSZ/Y2O3 multilayers, which are deposited on NiW substrates by PLD for the fabrication of YBCO-coated conductor through the RABiTS approach. YBCO film is then deposited on the tops of both types of buffer layers by PLD. The effects of the thickness of the CeO2 film on the texture of the CeO2 film and the critical current density (Jc) of the YBCO film are analysed. For the case of CeO2 film on IBAD-YSZ/SS, there appears a self-epitaxy effect with increasing thickness of the CeO2 film. For CeO2/YSZ/Y2O3/NiW, in which the buffer layers are deposited by PLD, there occurs no self-epitaxy effect, and the optimal thickness of CeO2 is about 50nm. The surface morphologies of the two groups of samples are examined by SEM.

  12. Electronic structure of the heavy fermion superconductor Ce2PdIn8: Experiment and calculations

    International Nuclear Information System (INIS)

    The electronic structure of a heavy-fermion superconductor Ce2PdIn8 was investigated by means of X-ray photoelectron spectroscopy (XPS) and ab initio density functional band structure calculations. The Ce 3d core-level XPS spectra point to stable trivalent configuration of Ce atoms that is also reproduced in the band structure calculations within the generalized gradient approximation GGA+U approach. Analysis of the 3d9f2 weight in the 3d XPS spectra within the Gunnarsson-Schönhammer model suggests that the onsite hybridization energy between Ce 4f and the conduction band states, Δfs, is ∼120 meV, which is about 30 meV larger than Δfs in isostructural Ce2TIn8 compounds with T = Co, Rh, and Ir. Taking into account a Coulomb repulsion U on both the Ce 4f and Pd 4d states in electronic band structure calculations, a satisfactory agreement was found between the calculated density of states (DOS) and the measured valence band XPS spectra. - Highlights: • XPS data validated strong electronic correlations in superconducting Ce2PdIn8. • DFT calculations reproduced XPS spectra measured for Ce2PdIn8. • Crucial role of Pd d electrons in the HF behavior of Ce2PdIn8 was established

  13. Effects of CeF3 on properties of self-shielded flux cored wire

    Institute of Scientific and Technical Information of China (English)

    Yu Ping; Tian Zhiling; Pan Chuan; Xue Jin

    2006-01-01

    Effects of CeF3 on properties of self-shielded flux cored wire including welding process, inclusions in weld metal and mechanical properties are systematically studied. Welding smoke and spatter are reduced with the addition of CeF3. The main non-metallic inclusions in weld metal are AlN and Al2 O3. CeF3 can refine non-metallic inclusions and reduce the amount of large size inclusions, which is attributed to the inclusion floating behavior during the solidification of weld metal. The low temperature impact toughness is improved by adding suitable amount of CeF3 in the flux.

  14. Microstructure and properties of a Mo-CeO2 heated cathode material

    Institute of Scientific and Technical Information of China (English)

    ZHANG Jiuxing; WAN Xiaofeng; LI Xiangbo; ZHOU Wenyuan; ZHOU Meiling

    2004-01-01

    The microstructure, mechanical properties, and electron-emission properties of a newly developed heated cath ode material Mo-CeO2 with 4.0% (mass fraction) of CeO2 were investigated. It is shown that the Mo-CeO2 cathode material possesses high tensile strength and good room-temperature ductility. After carbonized, the Mo-CeO2 cathode material has a higher zero field emission current density and a lower work function compared with the W-ThO2 cathode material.

  15. Fragility and glass forming ability of Al-Ni-Ce alloy melts

    Institute of Scientific and Technical Information of China (English)

    赵岩; 边秀房; 孙民华; 张均艳

    2004-01-01

    The fragility of Al-Ni-Ce alloy melts with three kinds of different compositions, Al85Ni10Ce5,Al85Ni8Ce7, Al85Ni5Ce10(mole fraction, %), was studied using oscillating-vessel viscometer and differential scanning calorimetry. Their fragility parameters obtained from experiments and theoretic calculation are:238,228 and 335 respectively. The results indicate that these three kinds of Al-Ni-Ce alloy melts are very fragile liquids, which kinetically show strong non-Arrhenius behaviour in the Angell plot, so they have poor glass forming ability (GFA).The alloy melt Al85Ni5Ce10 has the largest fragility parameter among the three alloy melts. In the preparation of rapidly quenched amorphous ribbons, Al85Ni10Ce5 and Al85Ni8Ce7 can gain amorphous ribbons when the rotate speed of the roller reaches 800 r/min, while for Al85Ni5Ce10 it must exceed 1 000 r/min.

  16. Perturbing the superconducting planes in CeCoIn5 by Snsubstitution

    Energy Technology Data Exchange (ETDEWEB)

    Daniel, M.; Bauer, E.D.; Han, S.-W.; Booth, C.H.; Cornelius,A.L.; Pagliuso, P.G.; Sarrao, J.L.

    2005-01-11

    In contrast to substitution on the Co or Ce site, Sn substitution has a remarkably strong effect on superconductivity in CeCoIn{sub 5-x}Sn{sub x}, with T{sub c} {yields} 0 beyond only {approx}3.6% Sn. Instead of being randomly distributed on in-plane and out-of-plane In sites, extended x-ray absorption fine structure measurements show the Sn atoms preferentially substitute within the Ce-In plane. This result highlights the importance of the In(1) site to impurity scattering and clearly demonstrates the two-dimensional nature of superconductivity in CeCoIn{sub 5}.

  17. High frequency of labral pathology in dysplastic hips with a CE angle between 20-25

    DEFF Research Database (Denmark)

    Jakobsen, Stig Storgaard; Hartig-Andreasen, Charlotte; Mikkelsen, Lone Rømer;

    Background: Hip dysplasia becomes symptomatic due to labral pathology and secondary muscular pain. A CE angle pathologic and defined as dysplasia in PAO centres in Denmark. However, it is debated whether a CE angle between 20 and 25 is borderline. Purpose / Aim of Study: We aimed...... to investigate the degree of labral pathology in symptomatic patients with CE between 20 and 25 compared with patients with CE ... of osteoarthritis 0 or 1. All patients had a magnetic resonance arthrography (MRA) performed. The MRA was assessed for labral pathology in terms of degeneration, hypertrophic changes, tears and paralabral cysts. Labral lesions were graded according to the Czerny classification. Findings / Results: In the group...

  18. Low-temperature catalytic oxidation of NO over Mn-Ce-O_x catalyst

    Institute of Scientific and Technical Information of China (English)

    李华; 唐晓龙; 易红宏; 于丽丽

    2010-01-01

    A series of manganese-cerium oxide catalysts were prepared by different methods and used for low-temperature catalytic oxidation of NO in the presence of excess O2.Their surface properties were evaluated by means of BET and were characterized by using scanning electron microscopy(SEM) and X-ray diffractometer(XRD).The activity test of Mn-Ce-Ox catalysts showed that addition of Ce enhanced the activities of NO oxidation.The most active catalysts with a molar Ce/(Mn+Ce) ratio of 0.3 were prepared by co-precip...

  19. Optical properties of Ce3+ doped fluorophosphates scintillation glasses

    Science.gov (United States)

    Yao, Yongxin; Liu, Liwan; Zhang, Yu; Chen, Danping; Fang, Yongzheng; Zhao, Guoying

    2016-01-01

    Fluorophosphates (P2O5-BaO-BaF2-Al2O3-Gd2O3-Ce2O3) glasses with different Gd2O3 and BaF2 concentrations have been prepared by a melt quenching method. The effect of Gd2O3 and BaF2 on the glass performance including the density, absorption as well as luminescence properties under both ultraviolet (UV) and X-ray excitation was studied systematically. Energy transfer from Gd3+ to Ce3+ plays an important role in the scintillation mechanism of these glasses and the optimum concentration of Gd2O3 is found to be approximately 3 mol%. The highest integrated light emission intensity of these glass samples excited by X-ray is 25% of BGO and the decay time constants are in the range of 25-35 ns, much shorter than the 300 ns decay time of BGO. Meanwhile, replacing lighter compound BaO with the BaF2 can increase the density of the glasses and also improve the light yield.

  20. Band structures in near spherical {sup 138}Ce

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharjee, T. [Variable Energy Cyclotron Centre, Kolkata 700 064 (India)], E-mail: btumpa@veccal.ernet.in; Chanda, S. [Variable Energy Cyclotron Centre, Kolkata 700 064 (India); Fakir Chand College, Diamond Harbour, West Bengal (India); Bhattacharyya, S.; Basu, S.K. [Variable Energy Cyclotron Centre, Kolkata 700 064 (India); Bhowmik, R.K.; Das, J.J. [Inter University Accelerator Centre, New Delhi 110 067 (India); Pramanik, U. Datta [Saha Institute of Nuclear Physics, Kolkata 700 064 (India); Ghugre, S.S. [UGC-DAE Consortium for Scientific Research, Kolkata Centre, Kolkata 700 098 (India); Madhavan, N. [Inter University Accelerator Centre, New Delhi 110 067 (India); Mukherjee, A.; Mukherjee, G. [Variable Energy Cyclotron Centre, Kolkata 700 064 (India); Muralithar, S.; Singh, R.P. [Inter University Accelerator Centre, New Delhi 110 067 (India)

    2009-06-15

    The high spin states of N=80{sup 138}Ce have been populated in the fusion evaporation reaction {sup 130}Te({sup 12}C, 4n){sup 138}Ce at E{sub beam}=65 MeV. The {gamma} transitions belonging to various band structures were detected and characterized using an array of five Clover Germanium detectors. The level scheme has been established up to a maximum spin and excitation energy of 23h and 9511.3 keV, respectively, by including 53 new transitions. The negative parity {delta}I=1 band, developed on the 6536.3 keV 15{sup -} level, has been conjectured to be a magnetic rotation band following a semiclassical analysis and comparing the systematics of similar bands in the neighboring nuclei. The said band is proposed to have a four quasiparticle configuration of [{pi}g{sub 7/2}h{sub (11)/2}]x[{nu}h{sub (11)/2}]{sup -2}. Other band structures are interpreted in terms of multi-quasiparticle configurations, based on Total Routhian Surface (TRS) calculations. For the low and medium spin states, a shell model calculation using a realistic two body interaction has been performed using the code OXBASH.

  1. Genome Mining in Sorangium cellulosum So ce56

    Science.gov (United States)

    Ewen, Kerstin Maria; Hannemann, Frank; Khatri, Yogan; Perlova, Olena; Kappl, Reinhard; Krug, Daniel; Hüttermann, Jürgen; Müller, Rolf; Bernhardt, Rita

    2009-01-01

    Myxobacteria, especially members of the genus Sorangium, are known for their biotechnological potential as producers of pharmaceutically valuable secondary metabolites. The biosynthesis of several of those myxobacterial compounds includes cytochrome P450 activity. Although class I cytochrome P450 enzymes occur wide-spread in bacteria and rely on ferredoxins and ferredoxin reductases as essential electron mediators, the study of these proteins is often neglected. Therefore, we decided to search in the Sorangium cellulosum So ce56 genome for putative interaction partners of cytochromes P450. In this work we report the investigation of eight myxobacterial ferredoxins and two ferredoxin reductases with respect to their activity in cytochrome P450 systems. Intriguingly, we found not only one, but two ferredoxins whose ability to sustain an endogenous So ce56 cytochrome P450 was demonstrated by CYP260A1-dependent conversion of nootkatone. Moreover, we could demonstrate that the two ferredoxins were able to receive electrons from both ferredoxin reductases. These findings indicate that S. cellulosum can alternate between different electron transport pathways to sustain cytochrome P450 activity. PMID:19696019

  2. CE-4 Mission and Future Journey to Lunar

    Science.gov (United States)

    Zou, Yongliao; Wang, Qin; Liu, Xiaoqun

    2016-07-01

    Chang'E-4 mission, being undertaken by phase two of China Lunar Exploration Program, represents China's first attempt to explore farside of lunar surface. Its probe includes a lander, a rover and a telecommunication relay which is scheduled to launch in around 2018. The scientific objectives of CE-4 mission will be implemented to investigate the lunar regional geological characteristics of landing and roving area, and also will make the first radio-astronomy measurements from the most radio-quiet region of near-earth space. The rover will opreate for at least 3 months, the lander for half a year, and the relay for no less than 3 years. Its scinetific instruments includes Cameras, infrared imaging spectrometer, Penetrating Radar onboard the rover in which is the same as the paylads on board the CE-3 rover, and a Dust-analyzer, a Temperature-instrument and a Wide Band Low Frequency Digital Radio Astronomical Station will be installed on board the lander. Our scientific goals of the future lunar exploration will aim at the lunar geology, resources and surface environments. A series of exploraion missions such as robotic exploration and non-manned lunar scientific station is proposed in this paper.

  3. La vérite sur ce qui nous motive

    CERN Document Server

    Pink, Daniel H

    2011-01-01

    Voici enfin la traduction française du best-seller international DRIVE ! Qu'est-ce qui nous motive vraiment ? Dans quels cas sommes-nous les plus performants et les plus enthousiastes ? La plupart d'entre nous sommes persuadés que les récompenses (salaire, primes...) sont notre meilleure motivation. La logique de la carotte et du bâton finalement... Et si nous faisions fausse route ? En s'appuyant sur quatre décennies d'études scientifiques et psychologiques sur la motivation humaine, Pink démontre que les entreprises dirigent très mal leurs équipes avec d'énormes conséquences sur notre vie (absence d'ambition, lassitude, morosité). Le secret de la performance (et de la satisfaction) dans les entreprises, l'enseignement ou dans notre vie personnelle , c'est le besoin profondément humain de diriger sa propre vie, d'apprendre, de créer de nouvelles choses et de s'améliorer. Dans ce livre, Pink examine les 3 éléments de la motivation, l'autonomie, la maîtrise et le besoin de donner un sens ...

  4. The role of Ce reduction in the segregation of metastable phases in the ZrO2–CeO2 system

    OpenAIRE

    Sanjuán, M. L.; Oliete, Patricia B.; Várez, A.; Sanz Lázaro, Jesús

    2012-01-01

    The complexity of the ZrO2–CeO2 phase diagram arises from several factors: the low solubility of each compound into the other one, the slow kinetics of cation diffusion, the occurrence of Ce reduction at high temperatures, and the existence of several metastable phases whose appearance and evolution depend on synthesis method and thermal history of the sample. Identification of phase content is moreover complicated because the X-ray diffractograms of some ZrO2–CeO2 phases are very close or ev...

  5. Synergistic Interactions of Methanolic Extract of <em>Acacia mearnsiiem>> em>De Wild. with Antibiotics against Bacteria of Clinical Relevance

    Directory of Open Access Journals (Sweden)

    Anthony J. Afolayan

    2012-07-01

    Full Text Available With the emergence of multidrug-resistant organisms, combining medicinal plants with synthetic or orthodox medicines against resistant bacteria becomes necessary. In this study, interactions between methanolic extract of <em>Acacia> <em>mearnsii em>and eight antibiotics were investigated by agar diffusion and checkerboard assays. The minimum inhibitory concentrations (MICs of all the antibiotics ranged between 0.020 and 500 µg/mL while that of the crude extract varied between 0.156 and 1.25 mg/mL. The agar diffusion assay showed that extract-kanamycin combination had zones of inhibition ≥20 ± 1.0 mm in all the bacteria tested (100%, followed by extract-chloramphenicol (90% > extract-ciprofloxacin = extract-tetracycline (70% > extract-amoxicillin (60% > extract-nalidixic acid (50% > extract-erythromycin (40% > extract-metronidazole (20%. The checkerboard showed synergistic interaction (61.25%, additivity/indifference (23.75% and antagonistic (15% effects. The synergistic interaction was most expressed by combining the extract with tetracycline, metronidazole, amoxicillin, ciprofloxacin, chloramphenicol and nalidixic acid against <em>E. coliem> (ATCC 25922, erythromycin, metronidazole, amoxicillin, chloramphenicol and kanamycin<em> em>against <em>S. aureusem> (ATCC 6538, erythromycin, tetracycline, amoxicillin, nalidixic acid and chloramphenicol against <em>B.> <em>subtilis> KZN, erythromycin, metronidazole and amoxicillin against <em>E>. <em>faecalis> KZN, erythromycin, tetracycline, nalidixic acid and chloramphenicol against <em>K.> <em>pneumoniae> (ATCC 10031, erythromycin, tetracycline, metronidazole and chloramphenicol against <em>P.> <em>vulgaris> (ATCC 6830, erythromycin, tetracycline, amoxicillin and chloramphenicol against <em>S.> <em>sonnei> (ATCC 29930, metronidazole, amoxicillin and chloramphenicol against <em>E. faecalisem> (ATCC 29212 and ciprofloxacin and chloramphenicol<em

  6. Estudo comparativo entre contextos de brincadeiras em instituição de acolhimento infantil = Comparative study of contexts of play in the host institution for children = Estudio de comparación entre contextos de juegos en institución de acogida infantil

    OpenAIRE

    Oliveira, Luísa Sousa Monteiro

    2015-01-01

    O objetivo deste trabalho foi descrever e comparar as brincadeiras ocorridas em contextos: estruturado (CE) e semiestruturado (CSE) em uma instituição de acolhimento infantil. Participaram 10 crianças de cinco a seis anos, com tempo de acolhimento que variou de um a 12 meses. As sessões observacionais foram realizadas no CE (brinquedoteca) e no CSE (barracão, playground e piscina). Realizaram-se 117 registros de cinco minutos, totalizando 585 minutos de observação. Os resultados mostraram que...

  7. Ultrasound-Assisted Extraction of Syringin from the Bark of <em>Ilex em>rotunda> Thumb Using Response Surface Methodology

    Directory of Open Access Journals (Sweden)

    Hui Wang

    2012-06-01

    Full Text Available In this work, a rapid extraction method based on ultrasound-assisted extraction (UAE of syringin from the bark of <em>Ilex rotunda em>Thumb using response surface methodology (RSM is described. The syringin was analyzed and quantified by high performance liquid chromatography coupled with UV detection (HPLC-UV. The extraction solvent, extraction temperature and extraction time, the three main factors for UAE, were optimized with Box-Behnken design (BBD to obtain the highest extraction efficiency. The optimal conditions were the use of a sonication frequency of 40 kHz, 65% methanol as the solvent, an extraction time of 30 min and an extraction temperature of 40 °C. Using these optimal conditions, the experimental values agreed closely with the predicted values. The analysis of variance (ANOVA indicated a high goodness of model fit and the success of the RSM method for optimizing syringin extraction from the bark of <em>I>. em>rotunda>.

  8. Novel nanostructured CeO2 as efficient catalyst for energy and environmental applications

    Indian Academy of Sciences (India)

    Sumanta Kumar Meher; G Ranga Rao

    2014-03-01

    We report here versatile methods to engineer the microstructure and understand the fundamental physicochemical properties of CeO2 to improve its catalytic viability for practical applications. In this context, different morphologies of CeO2 are synthesized using tailored homogeneous precipitation methods and characterized by XRD, BET, SEM and TPR methods. The shuttle-shaped CeO2 prepared under hydrothermal condition shows higher surface area and low-temperature reducibility. The 0.5 wt% Pt-impregnated shuttle-shaped CeO2 shows lower-temperature CO oxidation behaviour as compared to its bulk-like CeO2 (with 0.5 wt% Pt) counterpart, synthesized by conventional-reflux method. Further, nanorod morphology of CeO2 prepared with Cl−as counter ion shows lower-temperature oxidation of soot as compared to the mesoflower morphology of CeO2, prepared with NO$^{−}_{3}$ as counter ion in the reaction medium. Further, linear sweep voltammetry, chronopotentiometry and CO-stripping voltammetry studies are performed to evaluate the promoting activity of CeO2 to Pt/C for ethanol electro-oxidation reaction in acidic media. Results show that CeO2 provides active triple-phase-interfacial sites for suitable adsorption of OH species which effectively oxidize the COads on Pt/C. The results presented here are significant in the context of understanding the physicochemical fine prints of CeO2 and CeO2 based hetero-nanocomposites for their suitability to important catalytic and energy-related applications.

  9. Classe social: conceitos e esquemas operacionais em pesquisa em saude

    Directory of Open Access Journals (Sweden)

    Rita Barradas Barata

    2013-08-01

    Full Text Available Discute-se a utilização do conceito de classe em pesquisas em saúde, as diferentes abordagens sociológicas de estratificação social e de estrutura de classes, o potencial explicativo do conceito em estudos de determinação social e desigualdades em saúde, os modelos de operacionalização elaborados para uso em pesquisas sociológicas, demográficas ou de saúde e os limites e possibilidades desses modelos. Foram destacados quatro modelos de operacionalização: de Singer para estudo da distribuição de renda no Brasil, adaptado por Barros para uso em pesquisas epidemiológicas; de Bronfman & Tuirán para o censo demográfico mexicano, adaptado por Lombardi et al para pesquisas epidemiológicas; de Goldthorpe para estudos socioeconômicos ingleses, adaptado pela Sociedade Espanhola de Epidemiologia; e o modelo de Wright para pesquisa em sociologia e ciência política, também usado em inquéritos populacionais em saúde. Em conclusão, conceitualmente cada um dos modelos apresentados é coerente com a concepção teórica que os embasam, mas não há como optar por qualquer deles, descartando os demais.

  10. CeO_2-supported vanadium oxide catalysts for soot oxidation:the roles of molecular structure and nanometer effect

    Institute of Scientific and Technical Information of China (English)

    刘坚; 赵震; 徐春明; 段爱军; 姜桂元

    2010-01-01

    The nanometer CeO2 powder was prepared by the method of microwave-assisted heating hydrolysis,and the nanometer CeO2-supported or ordinary CeO2-supported vanadia catalysts with different vanadium loadings(atomic ratios:100V/Ce=0.1,1,4,10,and 20) were prepared by an incipient-wetness impregnation method.Spectroscopic techniques(XRD,FT-IR,Raman and UV-Vis DRS) were utilized to characterize the structures of VOx/CeO2 catalysts.The results showed that the structures of CeO2-supported vanadium oxide catalysts de...

  11. On the Ce-Mn clustering in CaF2 in which the Ce3+ → Mn2+ energy transfer occurs

    International Nuclear Information System (INIS)

    Energy transfer from Ce3+ to Mn2+ ions in a single crystal of CaF2 co-doped with cerium and manganese ions has been analysed. The spectroscopic data obtained clearly indicate that sensitized luminescence with cerium ions as sensitizers and manganese ions as activators takes place between Ce3+ - Mn2+ clusters formed in the crystalline matrix. The number of such clusters was estimated using a simple model in which both ions are treated as two-energy-level systems. Some insight into the possible nature of the Ce3+ - Mn2+ complexes as well as of the Ce3+ → Mn2+ energy transfer mechanism taking place inside them were gathered using Dexter's theory for energy transfer phenomena

  12. Growth of Ce:LiYF{sub 4} bulk single crystal with high Ce concentration by Cz method and the scintillation properties

    Energy Technology Data Exchange (ETDEWEB)

    Yokota, Yuui; Yamaji, Akihiro; Kurosawa, Shunsuke [Institute for Materials Research, Tohoku University, Sendai, 9808577 Miyagi (Japan); Kawaguchi, Noriaki; Fukuda, Kentaro [Tokuyama Corp., Sendai, 9893204 Miyagi (Japan); Yoshikawa, Akira [Institute for Materials Research, Tohoku University, Sendai, 9808577 Miyagi (Japan); New Industry Creation Hatchery Center (NICHe), Tohoku University, Sendai, 9893204 Miyagi (Japan)

    2012-12-15

    Ce 2% doped LiYF4 [Ce:LYF] bulk single crystal was grown by Czochralski method and the structural phase, crystallinity, optical properties and scintillation properties were investigated. Grown Ce:LYF bulk single crystal included some cracks in the initial part of crystal and meanwhile there were no visible cracks in the center and end parts. Full width of half maximum of X-ray rocking curve on the plate crystal in center part of Ce:LYF bulk single crystal was 81.4 arcsec. Alpha-ray position in the pulse-height spectra under alpha-ray irradiation was almost quarter that of Li-glass(GS20). Decay times of the crystals in center and end parts were 69.9 and 58.3 ns, respectively (copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  13. CeO2空心微球的制备与表征%Preparation and Characterization of CeO2 Hollow Spheres

    Institute of Scientific and Technical Information of China (English)

    吴秀勇; 王巍; 吕伟丽; 仉丽; 朱立平

    2007-01-01

    以PSA-A乳胶粒为模板,通过硫酸高铈和尿素的水解反应得到PSA/水合CeO2的核/壳结构的复合微球,通过煅烧除去乳胶粒模板得到立方相CeO2空心微球.CeO2空心微球平均粒径为450 nm~500 nm,由11.76 nm的小粒子堆积而成.考察了Ce4+、尿素、PVP的浓度,反应温度,PSA-A乳胶粒的加入量等实验条件对包覆效果的影响,通过FT-IR、XRD、TEM、SEM对样品进行了表征.

  14. INVESTIGATION ON THE VALENCE STATE OF Ce ATOM IN BULK AND NANOCRYSTAL CeO2 BY X-RAY ABSORPTION AND PHOTOEMISSION

    Institute of Scientific and Technical Information of China (English)

    K. Ibrahim; Z.Y. Wu; J. Zhang; M.I. Abbas; F.Q. Liu; H.J. Qian

    2001-01-01

    Valence band photoemission spectra (PES) for both bulk and nanocrystal CeO2 have been measured on and off resonance of Ce 4d 4f absorption edge. The PES show that the bulk and nanocrystal CeO2 of diameter ranging from 8nm to 50nm exhibit a peak near Fermi edge with binding energy of about 1.8eV. The 1.8eVpeak shows a strong dependence on excitation energy, although it looks like the contribution of Ce3+ ion following the data reported in literatures. However, according to the results of resonance photoemission and X-ray absorption spectra at O 1s edge, this electronic structure may be associated to the intermediate state charge transfer effects.

  15. Influence of the Ce:YAG Amount on Structure and Optical Properties of Ce:YAG-PMMA Composites for White LED

    Science.gov (United States)

    Armetta, Francesco; Sibeko, Motshabi A.; Luyt, Adriaan S.; Chillura Martino, Delia F.; Spinella, Alberto; Saladino, Maria Luisa

    2016-09-01

    Ce:YAG-poly(methyl methacrylate) (PMMA) composites were prepared by using a melt compounding method, adding several amounts of Ce:YAG in the range 0.1-5 wt. %. The optical properties of the obtained composites and of the composites combined with a blue LED were measured to investigate the effect of the amount of Ce:YAG on the resulting emitted light in view of possible application in white LED manufacture. An increase in Ce:YAG amount caused an increase in the emission and a shift of 15 nm, influencing the white LED performance. The structure and morphology of the composites were studied. The results show that the interaction between the two components, observed by using solid state NMR experiments, are the responsible for the observed shift.

  16. 4d → 4f resonance in photoabsorption of cerium ion Ce3+ and endohedral cerium in fullerene complex {\\rm{Ce}}@{{{\\rm{C}}}_{82}}^{+}

    Science.gov (United States)

    Schrange-Kashenock, G.

    2016-09-01

    The theoretical investigation of the single-photoionization spectra in the 4d-resonance region (120-150 eV) for the ionic cerium Ce3+ and cerium in the endohedral complex {{Ce}}@{{{{C}}}82}+ (in practice, {{{Ce}}}3+@{{{{C}}}82}2-) is presented. The fullerene cage is modeled by ab initio spherical jellium shell with an accurate account for the real distribution of carbon electron density. The oscillator strengths are calculated within the multiconfiguration Dirac-Fock (MCDF) approach for phototransitions from the outermost shells of the ion Ce3+ with and without the influence of the potential generated by a fullerene cage. It is shown that the integrated oscillator strengths have the main contribution from the Ce3+ 4d → 4f (ten possible from the phototransitions {}2F{7/2,5/2}\\to {}2D{3/2,5/2},{}2F{5/2,7/2},{}2G{5/2,7/2}) resonance photoexcitations. The corresponding precise MCDF values for the oscillator strengths and the transition energies are presented for the first time. It is demonstrated that the resonance {f}4d\\to 4f oscillator strengths are slightly affected by the presence of the cage potential, despite the fact that the spectral levels structure is changed when the effect of this potential is included. The Auger 4d -1 decay from the cerium free ion Ce3+ and the encapsulated endohedral ion Ce3+@ are considered within the two-step model and the corresponding Lorentzian profiles are presented. This model clearly reveals the correspondence of the complex resonance profile in the Ce3+ photoabsorption to the fine structure of ion energy levels. The smoothing of the resonance profile in the photoabsorption of the endohedral system {{Ce}}@{{{{C}}}82}+ compared with the free ion Ce3+ is attributed to increasing the linewidths of the Auger transitions. This increase is estimated from the relevant experiment (Müller et al 2008 Phys. Rev. Lett. 101 133001) to be strong; as at least three times the value for an isolated ion. The presence of the confining fullerene

  17. 4d → 4f resonance in photoabsorption of cerium ion Ce3+ and endohedral cerium in fullerene complex {\\rm{Ce}}@{{{\\rm{C}}}_{82}}^{+}

    Science.gov (United States)

    Schrange-Kashenock, G.

    2016-09-01

    The theoretical investigation of the single-photoionization spectra in the 4d-resonance region (120–150 eV) for the ionic cerium Ce3+ and cerium in the endohedral complex {{Ce}}@{{{{C}}}82}+ (in practice, {{{Ce}}}3+@{{{{C}}}82}2-) is presented. The fullerene cage is modeled by ab initio spherical jellium shell with an accurate account for the real distribution of carbon electron density. The oscillator strengths are calculated within the multiconfiguration Dirac–Fock (MCDF) approach for phototransitions from the outermost shells of the ion Ce3+ with and without the influence of the potential generated by a fullerene cage. It is shown that the integrated oscillator strengths have the main contribution from the Ce3+ 4d → 4f (ten possible from the phototransitions {}2F{7/2,5/2}\\to {}2D{3/2,5/2},{}2F{5/2,7/2},{}2G{5/2,7/2}) resonance photoexcitations. The corresponding precise MCDF values for the oscillator strengths and the transition energies are presented for the first time. It is demonstrated that the resonance {f}4d\\to 4f oscillator strengths are slightly affected by the presence of the cage potential, despite the fact that the spectral levels structure is changed when the effect of this potential is included. The Auger 4d ‑1 decay from the cerium free ion Ce3+ and the encapsulated endohedral ion Ce3+@ are considered within the two-step model and the corresponding Lorentzian profiles are presented. This model clearly reveals the correspondence of the complex resonance profile in the Ce3+ photoabsorption to the fine structure of ion energy levels. The smoothing of the resonance profile in the photoabsorption of the endohedral system {{Ce}}@{{{{C}}}82}+ compared with the free ion Ce3+ is attributed to increasing the linewidths of the Auger transitions. This increase is estimated from the relevant experiment (Müller et al 2008 Phys. Rev. Lett. 101 133001) to be strong; as at least three times the value for an isolated ion. The presence of the confining

  18. CONTROLE DE LARVAS DE Diloboderus abderus COM INSETICIDAS EM TRIGO

    Directory of Open Access Journals (Sweden)

    Silva Mauro Tadeu Braga da

    2002-01-01

    Full Text Available A larva de Diloboderus abderus Sturm (Coleoptera: Melolonthidae é uma praga importante da cultura do trigo (Triticum aestivum L. em plantio direto na região Sul do Brasil. Este estudo teve como objetivo avaliar diferentes inseticidas aplicados nas sementes (fipronil e tiametoxam e via pulverização do solo (clorpirifós e lambdacialotrina para o controle dessa praga. A eficiência dos inseticidas foi determinada através do número de larvas vivas no solo aos 30, 60 e 90 dias após a emergência das plantas (DAE, da massa seca da parte aérea das plantas aos 90 DAE e da produção de grãos. Foram observadas correlações negativas significativas entre a dose dos inseticidas fipronil e tiametoxam e o número de larvas, e correlações positivas significativas entre estes inseticidas e a massa seca da parte aérea e a produtividade de grãos. Infestações de larvas nas testemunhas não tratadas reduziram a produtividade em relação às áreas tratadas com inseticidas. A produtividade incrementou à medida que aumentou a eficiência de controle do inseto pelos inseticidas. Concluiu-se que clorpirifós (960 e 1200g i.a./ha e lambdacialotrina a 25g i.a./ha (formulação CE, aplicados em pulverização do solo, são eficientes para reduzir a população de larvas de D. abderus, garantindo a produtividade de grãos. Sugerem-se novos testes com os inseticidas fipronil, tiametoxam e lambdacialotrina (formulação SC para determinar doses técnica e economicamente adequadas para o controle de larvas de D. abderus em trigo.

  19. Transtornos alimentares em escolares

    Directory of Open Access Journals (Sweden)

    Vilela João E. M

    2004-01-01

    Full Text Available OBJETIVO: Este trabalho investiga a freqüência de possíveis transtornos da alimentação e comportamentos alimentares inadequados em crianças e adolescentes de seis cidades do interior de Minas Gerais, uma vez que a maioria dos autores afirma uma prevalência maior em países desenvolvidos. MÉTODOS: Este é um estudo transversal onde foram aplicadas as auto-escalas BITE (Teste de Investigação Bulímica de Edinburgh, EAT (Teste de Atitudes Alimentares e Teste de Imagem Corporal em 1.807 estudantes de escolas públicas do Ensino Fundamental e Médio, com idade entre 7 e 19 anos. RESULTADOS: De acordo com a auto-escala EAT, 241 alunos (13,3% apresentaram possíveis transtornos de alimentação, com predominância significativa do sexo feminino. E, segundo a auto-escala BITE, 19 estudantes (1,1% apresentaram um escore compatível com bulimia nervosa. Encontramos 1.059 alunos (59% insatisfeitos com sua imagem corporal, 731 alunos (40% em uso de dieta para emagrecer e 1.014 alunos (56% que praticavam atividade física com a finalidade de perder peso. Os episódios bulímicos foram encontrados em 218 alunos (12%, e 175 alunos (10% utilizavam métodos purgativos para perder peso. CONCLUSÕES: Este estudo mostra uma alta prevalência de possíveis transtornos alimentares na população estudada, assim como comportamentos alimentares inadequados, principalmente em adolescentes do sexo feminino. Os resultados são semelhantes aos encontrados nos países considerados desenvolvidos. Concluímos que esses achados são relevantes para a clínica da criança e do adolescente e que podem proporcionar futuros trabalhos onde poderemos compreender melhor os possíveis fatores de risco para esses transtornos da alimentação.

  20. The EM Earthquake Precursor

    Science.gov (United States)

    Jones, K. B., II; Saxton, P. T.

    2013-12-01

    Many attempts have been made to determine a sound forecasting method regarding earthquakes and warn the public in turn. Presently, the animal kingdom leads the precursor list alluding to a transmission related source. By applying the animal-based model to an electromagnetic (EM) wave model, various hypotheses were formed, but the most interesting one required the use of a magnetometer with a differing design and geometry. To date, numerous, high-end magnetometers have been in use in close proximity to fault zones for potential earthquake forecasting; however, something is still amiss. The problem still resides with what exactly is forecastable and the investigating direction of EM. After the 1989 Loma Prieta Earthquake, American earthquake investigators predetermined magnetometer use and a minimum earthquake magnitude necessary for EM detection. This action was set in motion, due to the extensive damage incurred and public outrage concerning earthquake forecasting; however, the magnetometers employed, grounded or buried, are completely subject to static and electric fields and have yet to correlate to an identifiable precursor. Secondly, there is neither a networked array for finding any epicentral locations, nor have there been any attempts to find even one. This methodology needs dismissal, because it is overly complicated, subject to continuous change, and provides no response time. As for the minimum magnitude threshold, which was set at M5, this is simply higher than what modern technological advances have gained. Detection can now be achieved at approximately M1, which greatly improves forecasting chances. A propagating precursor has now been detected in both the field and laboratory. Field antenna testing conducted outside the NE Texas town of Timpson in February, 2013, detected three strong EM sources along with numerous weaker signals. The antenna had mobility, and observations were noted for recurrence, duration, and frequency response. Next, two

  1. Yield and gross income of bunching onion and coriander in monocrop and intercrop systems/ Produção e renda bruta de cebolinha e de coentro, em cultivo solteiro e consorciado

    Directory of Open Access Journals (Sweden)

    Cleila Marcondes de Souza

    2005-06-01

    Full Text Available The objective of this work was to determine yield and income of ‘Todo ano’ bunching onion and ‘Asteca’ coriander, which were carried out in monocrop and intercrop systems with three (Ce3 and Co3 and four rows planted per plot. The work was developed in Dourados-MS, Brazil, between July 13th, and September 15th, 2004. Average yield of fresh mass of bunching onion plants under monocrop system had significative increase of 0.64 t ha-1 (92.75% in relation to those under intercrop system (0.69 t ha-1. For coriander, yield of fresh mass of plants under monocrop system and with four rows per plot had significative increase of 1.43 t ha-1 (41.21% in relation to those under three rows (3.47 t ha-1. Land Equivalant Ratio (LER for bunching onion and coriander intercropped were superior in 21% (Ce3Co4 and 56% (Ce4Co3 in relation to monocrop system. For bunching onion producer, both intercrops were economic viable, but Ce4Co3 could have induced a higher gain per hectare (R$ 3,243.30. By the other side, for coriander producer, Ce3Co4 intercrop was the worst, because, although LER had been superior to 1.00, it could induce loss per hectare of R$ 99.42. Ce4Co3 intercrop was the best because it could induce a gain of R$ 777.77.O objetivo do trabalho foi determinar a produtividade e o retorno econômico da cebolinha ‘Todo Ano’ e do coentro ‘Asteca’, conduzidos em cultivo solteiro e consorciado, com três (Ce3 e Co3 e quatro (Ce4 e Co4 linhas de plantas por canteiro. O trabalho foi desenvolvido em Dourados-MS, entre 13 de julho e 15 de setembro de 2004. A produção média de massa fresca das plantas de cebolinha sob cultivo solteiro teve aumento significativo de 0,64 t ha-1 (92,75% em relação àquela sob consórcio (0,69 t ha-1. No coentro, a produção de massa fresca das plantas sob cultivo solteiro e com quatro linhas por canteiro teve aumento significativo de 1,43 t ha-1 (41,21% em relação à produção sob três linhas (3,47 t ha-1. As

  2. COMPARISION OF THE COLOR PROPERTIES OF COMPOUNDS Ln2Ce2O7 AND Ln2CeZrO7

    Directory of Open Access Journals (Sweden)

    B. Hablovicova

    2015-09-01

    Full Text Available Pyrochlore type pigments Ln2Ce2O7 and Ln2CeZrO7 (Ln = Nd, Sm, Gd, Dy, Er, Yb and Y prepared by solid-state reaction were investigated. Effect of rare earths and zirconium ions and calcination temperature (1400, 1500 and 1600oC for Ln2Ce2O7 and 1400, 1450 and 1500 C for Ln2CeZrO7 on their color properties in organic matrix and ceramic glazes, particle size distribution and phase composition were evaluated. The most interesting shades achieve compounds with the highest calcination temperature. Their colors depend on used rare earth ions (shades change from green, cross yellow to pink in organic mass and from green, cross yellow-green to orange in ceramic glazes, while compounds without zirconium have better color properties. Pigments Ln2Ce2O7 calcined at 1600 C are single-phase (except Yb2Ce2O7.

  3. Active sites over CuO/CeO2 and inverse CeO2/CuO catalysts for preferential CO oxidation

    Science.gov (United States)

    Zeng, Shanghong; Wang, Yan; Ding, Suping; Sattler, Jesper J. H. B.; Borodina, Elena; Zhang, Lu; Weckhuysen, Bert M.; Su, Haiquan

    2014-06-01

    A series of CuO/CeO2 and inverse CeO2/CuO catalysts are prepared by the surfactant-templated method and characterized via XRD, HRTEM, H2-TPR, SEM, XPS, in situ XRD, in situ UV-Vis and N2 adsorption-desorption techniques. It is found that there are two kinds of surface sites in the CuO-CeO2 system, including CuO surface sites for CO chemisorption and CeO2 surface sites with oxygen vacancies for oxygen sorption. The active sites for CO oxidation are located on the contact interface of two-kind surface sites and the lattice oxygen can make a significant contribution to the CO-PROX reaction. The resistance to H2O and CO2 is related to BET surface area, the crystallite sizes of CuO and the reduction behavior of catalysts. The Ce4Cu4 and Ce4Cu1 catalysts exhibit the best resistance against H2O and CO2.

  4. The Interplay of Fe and Ce Magnetism in Ca0.71 Ce0.29(Fe1-xCox)As2 single crystals

    Science.gov (United States)

    Jiang, Shan; Liu, Lian; Cao, Huibo; Tian, Wei; Emmanuelidu, Eve; Shi, Aoshuang; Uemura, Yasutomo; Ni, Ni

    In this talk, we will present the synthesis and characterization of the Ca0.71 Ce0.29(Fe1-xCox)As2 single crystals. Elastic neutron scattering complemented by resistivity, susceptibility and heat capacity measurements has revealed a paramagnetic-to-antiferromagnetic phase transition of the Fe sublattice at 69K and a monoclinic-to-triclinic structural phase transition at 73 K in Ca0.71 Ce0.29FeAs2. In addition, Fe spin reorientation and Ce ordering at lower temperatures, reminiscent of the one in REFeAsO (RE=Ce, Pr, Nd) materials, exist. The Co substitution on the Fe sites completely suppresses the ordering of Fe sublattice at x=0.032. However, it only slightly affects the Ce ordering, which prevents the formation of superconductivity in Ca0.71 Ce0.29(Fe1-xCox)As2. Work at UCLA was supported by the NSF DMREF DMR-1435672. Work at Columbia and TRIUMF was supported by the NSF DMREF DMR- 1436095, PIRE project IIA 0968226 and DMR-1105961. Work at ORNL's High Flux Isotope Reactor was sponsored by DOE.

  5. Synthesis and luminescence of CePO4 and CePO4:Tb hollow and core-shell microspheres composed of single-crystal nanorods

    International Nuclear Information System (INIS)

    Lanthanide phosphate microspheres composed of single-crystal CePO4 and CePO4:Tb nanorods were successfully synthesized, respectively, using the functionalized composite aggregate as a template, which is composed of P123, H6P4O13 and Ce3+, and also as a resource of reaction species with high chemical potential. The shape and the phase structure of the CePO4 nanocrystal can be easily controlled via adjusting reaction temperature, monomer concentration and annealing temperature. SEM images show the spherical superstructure composed of nanorods. HRTEM and SAED images reveal the single-crystalline nature of nanorod and TEM images show the hollow interiors of the superstructure. XRD patterns indicate that the crystal structure of the nanorods is hexagonal before and monoclinic after annealing. The formation mechanism was proposed. Strong UV and green luminescence were observed for the CePO4 and CePO4:Tb microspheres, respectively. The synthesis method can be extended to the fabrication of NRHS and core-shell microspheres of other rare-earth or doped LnPO4 materials for wide applications

  6. "Ce que le langage ne peut pas faire"

    OpenAIRE

    Ramond, Charles

    2009-01-01

    La conférence remet en cause la spécificité des "actes de parole" et de leurs échecs ("ce que le langage ne peut pas faire") par rapport aux "actes" en général et à leurs échecs. De même en effet que l'on "fait" toujours autre chose en "disant" quelque chose, on "fait" aussi toujours autre chose en "faisant" quelque chose. En face du "locutoire", il y a donc le "factif", en face de "l'illocutoire", "l'infactif", et en face du "perlocutoire", le "perfactif". La démonstration s'appuie sur l'épi...

  7. Qu'est-ce que la relativité ?

    CERN Document Server

    Vannucci, François

    2005-01-01

    Publiée en 1905 par Albert Einstein, la théorie de la relativité marqua profondément le XXe siècle. Ce que tout un chacun sait… sans jamais avoir bien compris pourquoi ! François Vannucci commence donc par nous décrypter E=mc2. Car cette fameuse formule résume la révolution qu’apporta la théorie : énergie et masse ne sont plus des quantités indépendantes, elles sont reliées par la vitesse de la lumière. Il nous explique alors en quoi la théorie de la relativité, en établissant le cadre d’une théorie globale de l’univers - une cosmologie -, a révolutionné notre compréhension de l’univers…

  8. Level structure and transition probabilities in 140Ce

    International Nuclear Information System (INIS)

    The interplay of collective and non-collective modes in 140Ce is studied via comparison of available data with results of the quasiparticle-phonon model (QPM). Lifetime values have been checked in the 140La decay using delayed βγ coincidences. The half-life of the Jπ 41+ level is confirmed as T1/2(2083.6 keV) 3.3 ± 0.2 ns and upper limits of 0.1-0.2 ns are estimated for other levels. Extensive calculations within the QPM are carried out including one-, two-and three-phonon components in the wavefunctions. Comparisons to other N = 82 nuclei are also made as well. (author)

  9. File list: Oth.CeL.10.Epitope_tags.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.Epitope_tags.AllCell dm3 TFs and others Epitope tags Cell line SRX099635...099636 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.Epitope_tags.AllCell.bed ...

  10. Preparation and characterization of Ce-doped HfO{sub 2} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Gálvez-Barboza, S. [Centro de Investigación en Química Aplicada, Departamento de Materiales Avanzados, Blvd. Enrique Reyna Hermosillo #140, C.P. 25294 Saltillo, Coahuila (Mexico); Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional, Av. Industria Metalúrgica # 1062 Parque Industrial, C.P. 25900 Ramos Arizpe, Coahuila (Mexico); González, L.A. [Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional, Av. Industria Metalúrgica # 1062 Parque Industrial, C.P. 25900 Ramos Arizpe, Coahuila (Mexico); Puente-Urbina, B.A.; Saucedo-Salazar, E.M. [Centro de Investigación en Química Aplicada, Departamento de Materiales Avanzados, Blvd. Enrique Reyna Hermosillo #140, C.P. 25294 Saltillo, Coahuila (Mexico); García-Cerda, L.A., E-mail: luis.garcia@ciqa.edu.mx [Centro de Investigación en Química Aplicada, Departamento de Materiales Avanzados, Blvd. Enrique Reyna Hermosillo #140, C.P. 25294 Saltillo, Coahuila (Mexico)

    2015-09-15

    Highlights: • Ce-doped HfO{sub 2} nanoparticles were prepared by a modified solgel method. • Ce-doped HfO{sub 2} nanoparticles have a semispherical shape with sizes between 6 and 11.5 nm. • The samples doped with 10% in weight of Ce directly crystallized in a cubic structure. • A quick, straightforward and effective route for the preparation of Ce-doped nanoparticles. - Abstract: A modified solgel method to synthesize Ce-doped HfO{sub 2} nanoparticles was carried out using a precursor material prepared with cerium nitrate, hafnium chloride, citric acid and ethylene glycol. The obtained precursor material was calcined at 500 and 700 °C for 2 h in air. The influence of the concentration of Ce and the calcination temperature was studied to observe the structural and morphological changes of the obtained materials. For the characterization, X-ray diffraction (XRD), transmission electron microscopy (TEM) and Raman scattering (RS) were employed. The XRD patterns shown that the Ce-doped HfO{sub 2} undergoes a structural transformation from monoclinic to cubic phase, which is significantly dependent on the Ce content and calcination temperature. TEM images have also confirmed the existence of semispherical nanoparticles with sizes between 6 and 11.5 nm.

  11. File list: His.CeL.05.AllAg.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CeL.05.AllAg.AllCell dm3 Histone Cell line SRX193340,SRX193335,SRX193336,SRX201...RX143463,SRX017850 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/His.CeL.05.AllAg.AllCell.bed ...

  12. Electromagnetic and Microwave-Absorbing Properties of Plate-Like Nd-Ce-Fe Powder

    Science.gov (United States)

    Qiao, Ziqiang; Pan, Shunkang; Xiong, Jilei; Cheng, Lichun; Lin, Peihao; Luo, Jialiang

    2016-09-01

    Plate-like Ce x Nd2-x Fe17 (x = 0.0, 0.1, 0.2, 0.3, 0.4) powders have been synthesized by an arc melting and high-energy ball milling method. The structure of the Nd-Ce-Fe powders was investigated by x-ray diffraction analysis. Their morphology and particle size distribution were evaluated by scanning electron microscopy and laser particle analysis. The saturation magnetization and electromagnetic parameters of the powders were characterized using vibrating-sample magnetometry and vector network analysis, respectively. The results reveal that the Ce x Nd2-x Fe17 (x = 0.0, 0.1, 0.2, 0.3, 0.4) powders consisted of Nd2Fe17 single phase with different Ce contents. The particle size and saturation magnetization decreased with increasing Ce content. The resonant frequencies of ɛ″ and μ″ moved towards lower frequency with increasing Ce concentration. The minimum reflection loss value decreased as the Ce content was increased. The minimum reflection loss and absorption peak frequency of Ce0.2Nd1.8Fe17 with coating thickness of 1.8 mm were -22.5 dB and 7 GHz, respectively. Increasing the values of the complex permittivity and permeability could result in materials with good microwave absorption properties.

  13. CeO2-covered nanofiber for highly efficient removal of phosphorus from aqueous solution.

    Science.gov (United States)

    Ko, Young Gun; Do, Taegu; Chun, Youngsang; Kim, Choong Hyun; Choi, Ung Su; Kim, Jae-Yong

    2016-04-15

    The lowering phosphorus concentration of lakes or rivers using adsorbents has been considered to be the most effective way to prevent water eutrophication. However, the development of an adsorbent is still challenging because conventional adsorbents have not shown a sufficient phosphorus adsorption capacity (0.3-2.0mmol/g) to treat industrial, agricultural or domestic wastewater at a large scale. Herein, a novel and effective strategy to remove phosphorus efficiently with a CeO2-covered nanofiber is shown. The CeO2-covered nanofiber was synthesized through (1) amine group immobilization onto an electrospun polyacrylonitrile nanofiber and (2) adsorption of Ce(3+) on it. The CeO2-covered nanofiber played a role in catching phosphate ions in an aqueous solution by the oxidation, reduction, and ion-exchange of adsorbed Ce(3+) on the nanofiber from CeO2 to CePO4, and enabled remarkable phosphate adsorption capacity of the nanofiber (ca. 17.0mmol/g) at the range of ca. pH 2-6. Our strategy might be the most feasible method to efficiently lower the phosphorus concentration in lakes or rivers owing to the easy and inexpensive preparation of CeO2-covered nanofiber at an industrial scale, with a high phosphate adsorption capacity. PMID:26795705

  14. Magnetic Phase Transitions of CeSb. II: Effects of Applied Magnetic Fields

    DEFF Research Database (Denmark)

    Meier, G.; Fischer, P.; Hälg, W.;

    1978-01-01

    For pt.I see ibid., vol.11, p.345 (1978). The metamagnetic phase transition and the associated phase diagram of the anomalous antiferromagnet CeSb were determined in a neutron diffraction study of the magnetic ordering of CeSb single crystals in applied magnetic fields parallel to the (001) and (...

  15. Microstructure and oxygen evolution of Fe-Ce mixed oxides by redox treatment

    Science.gov (United States)

    Li, Kongzhai; Haneda, Masaaki; Ning, Peihong; Wang, Hua; Ozawa, Masakuni

    2014-01-01

    The relationship between structure and reduction/redox properties of Fe-Ce mixed oxides with a Fe content of 5, 10, 20 or 30 mol%, prepared by a coprecipitation method, were investigated by XRD, Raman, TEM, TPR and TPO techniques. It is found that all the iron ions can be incorporated into the ceria lattice to form a solid solution for the FeCe 5 (Fe 5%) sample, but amorphous or crystal Fe2O3 particles were found to be present on the Fe-Ce oxide samples with higher the iron content. The reducibility of single solid solution was much better than the pure CeO2, and the appearance of dispersed Fe2O3 particles improved the surface reducibility of materials. The iron ions incorporated into the CeO2 lattice accelerated the oxygen release from bulk to surface, and surface Fe2O3 particles in close contact to CeO2 acted as a catalyst for the reaction between solid solution and hydrogen. The microstructure of exposed Fe2O3 with Ce-Fe-O solid solution allows the Fe-Ce mixed oxides to own good reducibility and high OSC, which also counteracts the deactivation of the reducibility resulting from the sintering of materials in the redox cycling.

  16. Dielectric Properties of CeO2 -Doped Ba( Zr, Ti)O3 Ceramics

    Institute of Scientific and Technical Information of China (English)

    Huang Xinyou; Gao chunhua; Chen Xiangchong; Liu Huiping; Huang Guojun; Zheng Xialian

    2004-01-01

    The influence of additive amount of CeO2 on the properties of Ba(Ti, Zr)O3 (BTZ) capacitor ceramics prepared using conventional solid-state reaction method was investigated. The dielectric constant(ε) increases to a maximum when w( CeO2 ) is about 1.0% and then decreases again at higher doping concentration of CeO2. The dielectric constant gets a maximum while w ( CeO2 ) is about 1. 0%, and the dielectric loss is minimum while w ( CeO2 ) is0.5 %. CeO2 can decrease the curie temperature, widen the εr-T peak and decrease the absolute value of dielectric constant temperature coefficient. The influence mechanism of CeO2 additive on the properties of the BTZ ceramics was discussed. The results show that CeO2 additive influences the properties of BTZ ceramics by means of forming defect solid solution , shifting curie temperature peak effect, segregating in crystal boundary , and impeding grain growth.

  17. Data of evolutionary structure change: 1CE7A-3CTKA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available K A 3CTKA LFPGVTNRVTL ...bChain>A 3CTKA HGKTINGQEIA ...dbChain> 3CTKA HKSSPQCTTINP ure>HH ...1CE7A-3CTKA 1CE7 3CTK A A YERGDLDVTAQTTGAGYFSFITLLRDYVSSGSFSNAIPL...IETEVVDRGLY-GSFKPNFKVLNLENNWGDISDAIHKSSPQCTTINPALQLISPSNDPWVVNKVSQISPDMGILKFKS EEEEEEE HHHHHHH

  18. Luminescence from Ce in sol-gel SiO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kroon, R.E., E-mail: KroonRE@ufs.ac.za [Department of Physics, University of the Free State, IB51, Box 339, Bloemfontein 9300 (South Africa); Seed Ahmed, H.A.A.; Ntwaeaborwa, O.M. [Department of Physics, University of the Free State, IB51, Box 339, Bloemfontein 9300 (South Africa); Koao, L.F. [Department of Physics, University of the Free State (Qwaqwa Campus), Private Bag X13, Phuthaditjhaba 9866 (South Africa); Nagpure, I.M.; Gusowski, M.A. [Department of Physics, University of the Free State, IB51, Box 339, Bloemfontein 9300 (South Africa); Botha, J.R. [Department of Physics, Nelson Mandela Metropolitan University, Box 77000, Port Elizabeth 6031 (South Africa); Swart, H.C. [Department of Physics, University of the Free State, IB51, Box 339, Bloemfontein 9300 (South Africa)

    2012-05-15

    The sol-gel process provides an attractive low temperature alternative to the melt process for producing Ce-doped silica, but reports of the emission wavelength have not been consistent. In this paper, luminescence measurements using a variety of excitation methods, including cathodoluminescence not yet reported by other researchers, are compared and evaluated in the light of previously published data. Several papers report luminescence around 350 nm but emission near this wavelength was not found from our samples. This luminescence originates from Ce that has not yet been incorporated in the silica and is found in samples that have not undergone high temperature annealing. Our photoluminescence results from samples annealed in a reducing atmosphere suggest that emission from Ce incorporated in the silica lattice occurs near 455 nm, and some indication of the emission from Ce in amorphous clusters at 400 nm is also found. However, our results also confirm earlier indications that intrinsic defects in silica can create photoluminescence near both these wavelengths, which can make identification of the luminescence due to Ce difficult. Finally, it has been found that samples which have been annealed in air, and therefore display poor photoluminescence because most of the Ce occurs in the tetravalent form, are luminescent under electron beam excitation. It is suggested that during cathodoluminescence measurements Ce{sup 4+} ions capture electrons to form excited Ce{sup 3+} ions from which the luminescence originates.

  19. Icosahedral nano-phases in the Al-Mn-Ce system

    Energy Technology Data Exchange (ETDEWEB)

    Manaila, R.; Popescu, R.; Jianu, A.; Devenyi, A. [National Inst. for Physics of Materials, Bucharest (Romania)

    2000-07-01

    We report for the first time a new type of 6D hypercell decoration in icosahedral AlMnCe nanophases. Apparently it differs from the classical i-AlMn structure by a new atomic surface, where the strong scatterer Ce resides. This new structure could possibly be related to the low surface energy, characteristic for nano-particles-forming alloys. (orig.)

  20. Optical properties of pure and Ce3+ doped gadolinium gallium garnet crystals and epitaxial layers

    International Nuclear Information System (INIS)

    Results of X-ray diffraction and low temperature optical absorption measurements of cerium doped gadolinium gallium garnet single crystals and epitaxial layers are reported. In the region of intra-configurational 4f–4f transitions the spectra of the bulk crystals exhibit the signatures of several different Ce3+ related centers. Apart from the dominant center, associated with Ce substituting gadolinium, at least three other centers are found, some of them attributed to the so-called antisite locations of rare-earth ions in the garnet host, i.e., in the Ga positions. X-ray diffraction data prove lattice expansion of bulk GGG crystals due to the presence of rare-earth antisites. The concentration of the additional Ce-related centers in epitaxial layers is much lower than in the bulk crystals. However, the Ce-doped layers incorporate a large amount of Pb from flux, which is the most probable source of nonradiative quenching of Ce luminescence, not observed in crystals grown by the Czochralski method. - Highlights: • Ce3+ multicenters found in Gadolinium Gallium Garnet crystals and epitaxial layers. • High quality epitaxial layers of pure and Ce-doped GGG were grown. • Luminescence quenching of Ce3+ by Pb ions from flux detected in GGG epitaxial layers. • X-ray diffraction allows measuring the amount of the rare-earth antisites in GGG

  1. File list: Oth.CeL.10.dm.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.dm.AllCell dm3 TFs and others dm Cell line SRX160967,SRX160968,SRX335496...,SRX495787,SRX495790,SRX495786,SRX335495 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.dm.AllCell.bed ...

  2. File list: Oth.CeL.50.BEAF-32.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.50.BEAF-32.AllCell dm3 TFs and others BEAF-32 Cell line SRX749021,SRX085409...,SRX085408,SRX386677,SRX085407,SRX100252,SRX749020,SRX100253 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.50.BEAF-32.AllCell.bed ...

  3. File list: Oth.CeL.20.BEAF-32.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.20.BEAF-32.AllCell dm3 TFs and others BEAF-32 Cell line SRX749021,SRX085409...,SRX085408,SRX386677,SRX085407,SRX100252,SRX749020,SRX100253 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.20.BEAF-32.AllCell.bed ...

  4. File list: Oth.CeL.05.BEAF-32.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.05.BEAF-32.AllCell dm3 TFs and others BEAF-32 Cell line SRX386677,SRX085408...,SRX085409,SRX749020,SRX100252,SRX749021,SRX085407,SRX100253 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.05.BEAF-32.AllCell.bed ...

  5. File list: Oth.CeL.10.BEAF-32.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.BEAF-32.AllCell dm3 TFs and others BEAF-32 Cell line SRX386677,SRX085408...,SRX085409,SRX749021,SRX085407,SRX100252,SRX749020,SRX100253 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.BEAF-32.AllCell.bed ...

  6. Research on Public Signs and the Importance of this Research to C-E Translation

    Institute of Scientific and Technical Information of China (English)

    唐燕

    2012-01-01

    There is increasing recognition of the importance and usefulness of doing research in C-E translation of public signs. As bilingual signs are increasingly popular, considerable attention should be paid to the study of C-E translation of public signs. It is theoretically and practically urgent to make a further study and research on public signs systematically.

  7. Incommensurate antiferromagnetism and magnetic correlations in CeCu6-xAux

    DEFF Research Database (Denmark)

    Stockert, O.; Lohneysen, H. von; Schröder, A.;

    1997-01-01

    Magnetic ordering and correlations in single crystals of the heavy-fermion alloys CeCu5.8Au0.2 and CeCu5.9Au0.1 were investigated by elastic and inelastic neutron scattering. CeCu5.8Au0.2 orders with an incommensurate magnetic structure and a wave vector q = (+/- 0.79 0 0). Only dynamic antiferro......Magnetic ordering and correlations in single crystals of the heavy-fermion alloys CeCu5.8Au0.2 and CeCu5.9Au0.1 were investigated by elastic and inelastic neutron scattering. CeCu5.8Au0.2 orders with an incommensurate magnetic structure and a wave vector q = (+/- 0.79 0 0). Only dynamic...... antiferromagnetic correlations along a* are observed in CeCu5.9Au0.1 which evolve into a static sine modulation in CeCu5.8Au0.2....

  8. Anomalous compressive behavior in CeO2 nanocubes under high pressure

    DEFF Research Database (Denmark)

    Ge, M. Y.; Fang, Y. Z.; Wang, H.;

    2008-01-01

    is found to be 10 GPa for 4.7 nm and 16 GPa for 5.6 nm CeO2 nanocubes. The particle size dependence of the threshold pressure for the hardening of CeO2 nanoparticles is quite unusual. First-principles electronic calculations show that the increased bulk modulus of the nanocrystal is due...

  9. Assembly of large purely inorganic Ce-stabilized/bridged selenotungstates: from nanoclusters to layers.

    Science.gov (United States)

    Chen, Wei-Chao; Qin, Chao; Li, Yang-Guang; Zang, Hong-Ying; Shao, Kui-Zhan; Su, Zhong-Min; Wang, En-Bo

    2015-05-01

    A versatile one-pot strategy was used to synthesize two large, purely inorganic selenotungstates, nanocluster K(6)Na(16) [Ce(6)Se(6)W(67)O(230) (OH)(6) (H(2)O)(17)]⋅47 H(2)O (1) and layer K(9)Na(5) Ce(H(2)O)(4) [Ce(6)Se(10)W(51)O(187) (OH)(7) (H(2)O)(18)]⋅45H(2)O(2), by combining cerium centers and SeO(3) (2-) heteroanion templates. Compound 1 displays a Ce-stabilized hexameric nanocluster with one rhombus-like {W(4)O(15) (OH)(3)} unit in the center, whereas compound 2 is the first example of a Ce-bridged layer selenotungstate network based on linkage of the unusual {Ce(6)Se(10)W(51)O(187) (OH)(7) (H(2)O)(18)} clusters and additional Ce(H(2)O)(4) fragments via Ce-O-Se bridges. The compounds were characterized by elemental analyses, IR spectroscopy, thermogravimetric analyses, powder and single-crystal X-ray diffraction, and electrospray ionization mass spectrometry. Moreover, the electrochemical property of compound 1 was also investigated. PMID:25641950

  10. File list: Oth.CeL.10.Ice1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.Ice1.AllCell dm3 TFs and others Ice1 Cell line SRX306190,SRX306193,SRX30...6196,SRX097616 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.Ice1.AllCell.bed ...

  11. File list: Oth.CeL.50.Ice1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.50.Ice1.AllCell dm3 TFs and others Ice1 Cell line SRX097616,SRX306193,SRX30...6190,SRX306196 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.50.Ice1.AllCell.bed ...

  12. File list: Oth.CeL.20.Ice1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.20.Ice1.AllCell dm3 TFs and others Ice1 Cell line SRX306193,SRX306196,SRX30...6190,SRX097616 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.20.Ice1.AllCell.bed ...

  13. File list: Oth.CeL.05.Ice1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.05.Ice1.AllCell dm3 TFs and others Ice1 Cell line SRX097616,SRX306190,SRX30...6196,SRX306193 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.05.Ice1.AllCell.bed ...

  14. File list: Oth.CeL.50.Dref.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.50.Dref.AllCell dm3 TFs and others Dref Cell line SRX170984,SRX749042,SRX74...9043,SRX170983,SRX170985,SRX170986 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.50.Dref.AllCell.bed ...

  15. File list: Oth.CeL.20.Dref.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.20.Dref.AllCell dm3 TFs and others Dref Cell line SRX749042,SRX170984,SRX17...0983,SRX170985,SRX170986,SRX749043 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.20.Dref.AllCell.bed ...

  16. File list: Oth.CeL.05.Dref.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.05.Dref.AllCell dm3 TFs and others Dref Cell line SRX749042,SRX170984,SRX74...9043,SRX170983,SRX170986,SRX170985 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.05.Dref.AllCell.bed ...

  17. File list: Oth.CeL.10.Dref.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.Dref.AllCell dm3 TFs and others Dref Cell line SRX749042,SRX749043,SRX17...0984,SRX170983,SRX170986,SRX170985 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.Dref.AllCell.bed ...

  18. Preparation and characterization of Ce-doped ZnO nanofibers by an electrospinning method

    Directory of Open Access Journals (Sweden)

    Jong-Pil Kim

    2011-02-01

    Full Text Available ZnO and Ce-doped ZnO Nanofibers on (111 Pt/SiO2/Si substrates were produced using an electrospinning technique. The as-prepared composite fibres were subjected to high-temperature calcination to produce inorganic fibers. After calcining at a temperature of 500 °C, the average diameter of the ZnO and Ce-doped ZnO nanofibers were determined to be 170 nm and 225 nm, respectively. The average grain size of the ZnO and Ce-doped ZnO nanofibers were about 50 nm and 57 nm, respectively. The microstructure, chemical bonding state and photoluminescence of the produced ZnO and Ce-doped ZnO nanofibers were investigated. The Ce-doped ZnO nanofiber can be assigned to the presence of Ce ions on substitutional sites of Zn ions and the Ce3+ state from X-ray photoelectron spectra. Compared with PL spectra of ZnO nanofibers, the peak position of the UV emission of the Ce-doped ZnO nanofibers is sharply suppressed while the green emission band is highly enhanced.

  19. Microstructure and corrosion behavior of electroless deposited Ni-P/CeO2 coating

    Institute of Scientific and Technical Information of China (English)

    Hui Ming Jin; Shi Hang Jiang; Lin Nan Zhang

    2008-01-01

    Electroless Ni-P/nano-CeO2 composite coating was prepared in acidic condition,and its microstructure and corrosive property were compared with its CeO2-free counterpart.Scanning electronic microscopy (SEM) and X-ray diffraction (XRD) spectrometer were used to examine surface morphology and structure of the as-plated coating.Differential scanning calorimeter (DSC) and transmission electronic microscopy (TEM) were used to study the coating's phase change at high temperature.The coating's corrosive behavior in 3%NaCI + 5%H2SO4 solution was also investigated.The results showed that Ni-P coating had partial amorphous structure mixed with nano-crystals,while the Ni-P/CeO2 coating had perfect amorphous structure.In high-temperature condition,Ni3P precipitation and Ni crystallization took place in both coatings but at different temperatures,while the Ni-P/CeO2 coating had sintered phase of NiCe2O4 spinels.The anti-corrosion property was better in the CeO2-containing coating,and this was due to its less liability to undergo local-cell corrosion than its CeO2-free counterpart.Ni-P/CeO2 coating's pure amorphous structure was the result of Ni's hindered crystal-typed deposition and P's promoted deposition.

  20. Structural characterization and corrosive property of Ni-P/CeO2composite coating

    Institute of Scientific and Technical Information of China (English)

    JIN Huiming; JIANG Shihang; ZHANG Linnan

    2009-01-01

    Electroless Ni-P/nano-CeO2 composite coating was prepared in acidic condition, and its microstructure and corrosive property were compared with its CeO2-free counterpart. Scanning electronic microscopy (SEM), transmission electronic microscopy (TEM), X-ray diffraction spectrometer (XRD), and differential scanning calorimeter (DSC) were used to examine surface morphology and microstructure of the coating. Corrosive investigation was carried out in 3%NaCl+5%H2SO4 solution. The results showed that Ni-P coating had partial amorphous structure mixed with nanocrystals, whereas the Ni-P/CeO2 coating had perfect amorphous structure. In high temperature condition, Ni3P precipitation and Ni crystallization occurred in both coatings but at different temperatures, whereas the Ni-P/CeO2 coating had sintered phase of NiCe2O4 spinels. The anticorrosion property and passivity were improved in the CeO2-containing coating due to its less liability to undergo local-cell corrosion than its CeO2-free counterpart. During the co-deposition process, some Cen+ (n=3, 4) ions may be adsorbed to the metal/solution interface, hinder nickel's crystal-typed deposition and promote phosphorous deposition. The nano-CeO2 doping finally resulted in the coating' perfect amorphous structure and good anti-corrosive property.

  1. Energy resolution and related charge carrier mobility in LaBr3:Ce scintillators

    NARCIS (Netherlands)

    Khodyuk, I.V.; Quarati, F.G.A.; Alekhin, M.S.; Dorenbos, P.

    2013-01-01

    The scintillation response of LaBr3:Ce scintillation crystals was studied as function of temperature and Ce concentration with synchrotron X-rays between 9 keV and 100 keV. The results were analyzed using the theory of carrier transport in wide band gap semiconductors to gain new insights into charg

  2. A New Family of Ce6MoO15 as Fast Oxide Ion Conductor

    Institute of Scientific and Technical Information of China (English)

    Feng Jing; Meng Jian; Bo Qibing; Che Ping; Wang Jingping; Liu Jianfen; Lu Minfeng; Zhang Deping; Fang Daqing; Cao Xueqiang

    2004-01-01

    A novel solid solution Ce6MoO15 was achieved. Their structure and oxide ionic conductivity were studied.Based on Ce6MoO15, rare earth element substitution on cerium site shows that all resulting oxides enhance the conductivity further, and have high oxide-ion conductivity, which may be a kind of promising material for SOFCs.

  3. Chiral Separation of Erythromycin as a New Chiral Selector on CE

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Erythromycin as a new chiral selector was first used for chrial separation of four derivatives of biphenyldimethylester enantiomers on CE. The influence of pH, the chiral selector concentration and organic modifiers were preliminarily studied. Experiments show that the erythromycin as chiral selector is useful to CE.

  4. Influence of microgravity on Ce-doped Bi12SiO20 crystal defect

    Indian Academy of Sciences (India)

    Y F Zhou; J Y Xu; Y Liu; L D Chen; Y Y Huang; W X Huang

    2007-06-01

    Space grown BSO crystal doped with Ce was characterized by means of X-ray fluorescence spectra, X-ray topography, dislocation density etc. Influence of microgravity on Ce-doped BSO crystal defect was studied by comparing space grown BSO crystal with ground grown one. These results show that compositional homogeneity and structural perfection of crystal can be improved under microgravity conditions.

  5. File list: Oth.CeL.10.ash1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.ash1.AllCell dm3 TFs and others ash1 Cell line SRX128300,SRX084580,SRX08...4579,SRX128301 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.ash1.AllCell.bed ...

  6. File list: Oth.CeL.50.ash1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.50.ash1.AllCell dm3 TFs and others ash1 Cell line SRX128301,SRX084579,SRX08...4580,SRX128300 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.50.ash1.AllCell.bed ...

  7. File list: Oth.CeL.20.ash1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.20.ash1.AllCell dm3 TFs and others ash1 Cell line SRX128301,SRX084579,SRX08...4580,SRX128300 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.20.ash1.AllCell.bed ...

  8. File list: Oth.CeL.05.ash1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.05.ash1.AllCell dm3 TFs and others ash1 Cell line SRX084580,SRX128300,SRX12...8301,SRX084579 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.05.ash1.AllCell.bed ...

  9. File list: Pol.CeL.05.AllAg.Kc167 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.05.AllAg.Kc167 dm3 RNA polymerase Cell line Kc167 SRX331419,SRX331420,SRX31...8797,SRX318796,SRX749070,SRX749073,SRX749071,SRX331416,SRX331415,SRX749072 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.05.AllAg.Kc167.bed ...

  10. File list: Pol.CeL.05.AllAg.OSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.05.AllAg.OSC dm3 RNA polymerase Cell line OSC SRX201898,SRX201896,SRX201894...,SRX201897,SRX201899,SRX318811,SRX315134,SRX201895,SRX315132,SRX315133 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.05.AllAg.OSC.bed ...

  11. File list: Pol.CeL.50.AllAg.OSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.50.AllAg.OSC dm3 RNA polymerase Cell line OSC SRX201898,SRX201897,SRX201899...,SRX201894,SRX201895,SRX315132,SRX201896,SRX315134,SRX315133,SRX318811 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.50.AllAg.OSC.bed ...

  12. File list: Oth.CeL.50.Trl.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.50.Trl.AllCell dm3 TFs and others Trl Cell line SRX183520,SRX183521,SRX0254...89,SRX397055,SRX300931 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.50.Trl.AllCell.bed ...

  13. File list: Oth.CeL.20.Trl.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.20.Trl.AllCell dm3 TFs and others Trl Cell line SRX183520,SRX183521,SRX0254...89,SRX397055,SRX300931 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.20.Trl.AllCell.bed ...

  14. File list: Pol.CeL.20.AllAg.Kc167 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.20.AllAg.Kc167 dm3 RNA polymerase Cell line Kc167 SRX331416,SRX331415,SRX33...1420,SRX318796,SRX331419,SRX318797,SRX749070,SRX749072,SRX749071,SRX749073 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.20.AllAg.Kc167.bed ...

  15. File list: Pol.CeL.50.AllAg.Kc167 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.50.AllAg.Kc167 dm3 RNA polymerase Cell line Kc167 SRX331416,SRX331415,SRX33...1420,SRX318796,SRX331419,SRX318797,SRX749070,SRX749072,SRX749071,SRX749073 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.50.AllAg.Kc167.bed ...

  16. File list: Oth.CeL.10.Trl.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.10.Trl.AllCell dm3 TFs and others Trl Cell line SRX300931,SRX397055,SRX1835...20,SRX183521,SRX025489 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.10.Trl.AllCell.bed ...

  17. File list: Pol.CeL.10.AllAg.Kc167 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.10.AllAg.Kc167 dm3 RNA polymerase Cell line Kc167 SRX331419,SRX318797,SRX31...8796,SRX749070,SRX749071,SRX331416,SRX331415,SRX331420,SRX749072,SRX749073 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.10.AllAg.Kc167.bed ...

  18. File list: Oth.CeL.05.Trl.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.CeL.05.Trl.AllCell dm3 TFs and others Trl Cell line SRX300931,SRX397055,SRX1835...20,SRX183521,SRX025489 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.CeL.05.Trl.AllCell.bed ...

  19. File list: Pol.CeL.20.AllAg.OSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.20.AllAg.OSC dm3 RNA polymerase Cell line OSC SRX201898,SRX201897,SRX318811...,SRX201899,SRX201894,SRX201895,SRX315132,SRX201896,SRX315134,SRX315133 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.20.AllAg.OSC.bed ...

  20. File list: Pol.CeL.10.AllAg.OSC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CeL.10.AllAg.OSC dm3 RNA polymerase Cell line OSC SRX201896,SRX318811,SRX201898...,SRX201899,SRX201897,SRX201894,SRX201895,SRX315132,SRX315134,SRX315133 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.CeL.10.AllAg.OSC.bed ...

  1. Facile synthesis of ferromagnetic Ni doped CeO2 nanoparticles with enhanced anticancer activity

    Science.gov (United States)

    Abbas, Fazal; Jan, Tariq; Iqbal, Javed; Ahmad, Ishaq; Naqvi, M. Sajjad H.; Malik, Maaza

    2015-12-01

    NixCe1-xO2 (where x = 0, 0.01, 0.03, 0.05 and 0.07) nanoparticles were synthesized by soft chemical method and were characterized using X-ray diffraction (XRD), scanning electron microscopy (SEM), Raman, UV-vis absorption spectroscopy and vibrating sample magnetometer (VSM). XRD and Raman results indicated the formation of single phase cubic fluorite structure for the synthesized nanoparticles. Ni dopant induced excessive structural changes such as decrease in crystallite size as well as lattice constants and enhancement in oxygen vacancies in CeO2 crystal structure. These structural variations significantly influenced the optical and magnetic properties of CeO2 nanoparticles. The synthesized NixCe1-xO2 nanoparticles exhibited room temperature ferromagnetic behavior. Ni doping induced effects on the cytotoxicity of CeO2 nanoparticles were examined against HEK-293 healthy cell line and SH-SY5Y neuroblastoma cancer cell line. The prepared NixCe1-xO2 nanoparticles demonstrated differential cytotoxicity. Furthermore, anticancer activity of CeO2 nanoparticles observed to be significantly enhanced with Ni doping which was found to be strongly correlated with the level of reactive oxygen species (ROS) production. The prepared ferromagnetic NixCe1-xO2 nanoparticles with differential cytotoxic nature may be potential for future targeted cancer therapy.

  2. Photocatalytic and antibacterial properties of phytosynthesized CeO2 NPs using Moringa oleifera peel extract.

    Science.gov (United States)

    Surendra, T V; Roopan, Selvaraj Mohana

    2016-08-01

    Biosynthetic methods are alternative approaches which are much safer than the normal techniques (physical and chemical) used for the methods for synthesis of metal nanoparticles. The benefits are sample as it is economic and environment friendly. Herein present investigation, we have reported a microwave mediated eco-friendly synthetic approach for preparing cerium oxide (CeO2) nanoparticles. Here, we used Moringa oleifera peel as the stabilizing and reducing agent towards synthesize of Ce2O NPs via microwave irradiation. The NPs were further characterized using UV-Vis, FT-IR, XRD and HR-TEM techniques. The FTIR analysis confirmed the phytochemical involvement in NPs stabilization. The crystallinity of CeO2 nanoparticles are well demonstrated through X-ray Diffraction and HR-TEM. The TEM images reveal the spherical shape of the CeO2 NPs having an average size of 45nm. Additionally, these CeO2 NPs were used successfully as a catalyst in the degradation of the dye, crystal violet. Also the antibacterial activity of the synthesized CeO2 NPs was evaluated using Staphylococcus aureus (Gram positive bacteria) and Escherichia coli (Gram negative bacteria). CeO2 NPs showed better activity on E. coli than S. aureus. We have demonstrated an eco-friendly preparation of CeO2 nanoparticles, a good photocatalyst and having better antibacterial properties. PMID:27236047

  3. Effect of Ce on castability, mechanical properties and electric conductivity of commercial purity aluminum

    Institute of Scientific and Technical Information of China (English)

    Chang-lue LV; Heng-cheng Liao; Ye Liu; Qi-gui Wang

    2015-01-01

    Effects of Ce addition on microstructure, castability (lfuidity and hot tearing sensitivity), mechanical properties and electric conductivity of commercial purity aluminum (CP-Al) were investigated through microstructure observation and performance tests. Results show that adding Ce in a CP-Al can considerably reifne the grains, and has an important inlfuence on the amount, crystallographic forms, and distribution of secondary phases. Addition of Ce also has a large impact on the lfuidity and hot tearing sensitivity (HTS) of the CP-Al. With the addition of Ce from 0.1wt.%to 0.5wt.%, the lfuidity of CP-Al is ifrst increased remarkably and then decreased, and the HTS has an opposite response. The best castability of the studied alloys appears to be at 0.2wt.%-0.3wt.%Ce addition. The remarkable improvement in castability is attributed to the considerable reifnement of grain structure. Ce addition can also lead to a signiifcant rise in electric conductivity. The maximum conductivity of the as-cast CP-Al is 59.7% IACS with an addition of 0.2wt.%Ce. The T7 heat treatment can further improves the conductivity to 60.7% IACS. The Ce-induced evolution of the secondary phases is believed to be the mechanism for it.

  4. <em>Bacillus anthracisem> Factors for Phagosomal Escape

    Directory of Open Access Journals (Sweden)

    Irene Zornetta

    2012-07-01

    Full Text Available The mechanism of phagosome escape by intracellular pathogens is an important step in the infectious cycle. During the establishment of anthrax, <em>Bacillus anthracisem> undergoes a transient intracellular phase in which spores are engulfed by local phagocytes. Spores germinate inside phagosomes and grow to vegetative bacilli, which emerge from their resident intracellular compartments, replicate and eventually exit from the plasma membrane. During germination, <em>B. anthracisem> secretes multiple factors that can help its resistance to the phagocytes. Here the possible role of <em>B. anthracisem> toxins, phospholipases, antioxidant enzymes and capsules in the phagosomal escape and survival, is analyzed and compared with that of factors of other microbial pathogens involved in the same type of process.

  5. Vulnerabilidades presentes no percurso vivenciado pelos pacientes com HIV/AIDS em falha terapêutica

    Directory of Open Access Journals (Sweden)

    Petra Kelly Rabelo de Sousa

    2013-04-01

    Full Text Available Um grande avanço no tratamento da AIDS deu-se com o surgimento da terapia antiretroviral. Entretanto, diversas vulnerabilidades podem estar presentes no percurso vivenciado pelos pacientes durante o tratamento. Objetivou-se analisar as vulnerabilidades dos pacientes com HIV/AIDS em falha terapêutica. Estudo qualitativo realizado com sete usuários com AIDS considerados em falha terapêutica, em uma Unidade de Serviço Ambulatorial Especializado em HIV/AIDS, em Fortaleza-CE. Para interpretação dos dados, utilizou-se uma técnica de análise de conteúdo. Nos discursos, percebeu-se que os depoentes enfrentavam conflitos na família e, no ambiente de trabalho, dificuldades de relacionamento com as pessoas e estigma. Observou-se que os pacientes haviam vivenciado diversas situações que os tornaram mais suscetíveis à infecção por HIV e ao adoecimento.

  6. Investigation on the nature of active species in the CeCl{sub 3}-doped sodium alanate system

    Energy Technology Data Exchange (ETDEWEB)

    Fan Xiulin; Xiao Xuezhang [Department of Materials Science and Engineering, Zhejiang University, 38 Zheda Road, Hangzhou 310027 (China); Chen Lixin, E-mail: lxchen@zju.edu.cn [Department of Materials Science and Engineering, Zhejiang University, 38 Zheda Road, Hangzhou 310027 (China); Li Shouquan; Wang Qidong [Department of Materials Science and Engineering, Zhejiang University, 38 Zheda Road, Hangzhou 310027 (China)

    2011-09-15

    Research highlights: > The additive of CeCl{sub 3} is reduced in doping process, causing the formation of NaCl and highly dispersed Ce species. > After dehydrogenation, Al-Ce alloy with a structure of CeAl{sub 4} comes into being and remains almost unchanged in the following cycles. > Directly doping CeAl{sub 4} into the system results in much similar kinetics. - Abstract: CeCl{sub 3}-doped NaAlH{sub 4} was directly synthesized in hydrogenation process using NaH/Al with 2 mol% CeCl{sub 3} under ball-milling. X-ray diffraction was utilized to unveil the nature of cerium during NaAlH{sub 4} synthesis process and succedent cycling. It is found that, CeCl{sub 3} is reduced in the ball-milling process and following cycles, causing the formation of NaCl and Al-Ce alloy with a structure of CeAl{sub 4}. The catalytic enhancement arising upon doping the ball-milled CeAl{sub 4} alloy is quite similar to that achieved in the CeCl{sub 3}-doped sodium alanate. Because the CeAl{sub 4} dopant does not consume the effective hydrogen storage component, the CeAl{sub 4}-doped NaAlH{sub 4} exhibits more hydrogen storage capacity. Moreover, CeCl{sub 3}-doped NaAlH{sub 4} and CeAl{sub 4}-doped NaAlH{sub 4} exhibit similar apparent activation energies estimated from Kissinger's method, suggesting the reactions are all determined by the same rate-limiting step. These results clearly demonstrate that the in situ formed CeAl{sub 4} acts as active species to catalyze the reversible dehydriding/rehydriding of NaAlH{sub 4}.

  7. Trabalho em equipa

    OpenAIRE

    Antunes, Andreia Sofia Duarte

    2016-01-01

    O presente relatório de estágio tem como tema principal o trabalho em equipa. Aborda com mais pormenor o subtema dos momentos de reflexão na equipa pedagógica. Ao longo do estudo são vários os conceitos abordados e a interligação entre os mesmos. Pretendo dar a conhecer a temática em questão e conceções que lhe estão naturalmente associadas. Sendo um estudo investigativo são abordados os métodos utilizados ao longo de toda a investigação. Com este relatório pretende-se alcançar qual ...

  8. Valence fluctuation in CeMo{sub 2}Si{sub 2}C

    Energy Technology Data Exchange (ETDEWEB)

    Paramanik, U.B.; Anupam [Department of Physics, Indian Institute of Technology, Kanpur 208 016 (India); Burkhardt, U. [Max-Planck Institute for Chemical Physics of Solids, 01187 Dresden (Germany); Prasad, R. [Department of Physics, Indian Institute of Technology, Kanpur 208 016 (India); Geibel, C. [Max-Planck Institute for Chemical Physics of Solids, 01187 Dresden (Germany); Hossain, Z., E-mail: zakir@iitk.ac.in [Department of Physics, Indian Institute of Technology, Kanpur 208 016 (India)

    2013-12-15

    Highlights: •Evidence for valence fluctuation of Ce ions. •XAS provides average formal LIII valence of Ce. •Kadowaki Woods ratio and Sommerfeld Wilson ratio indicate Fermi-liquid behavior. •DFT calculations reveal strong hybridization between Ce 4f and Mo 4d states. -- Abstract: We report on the valence fluctuation of Ce in CeMo{sub 2}Si{sub 2}C as studied by means of magnetic susceptibility χ(T), specific heat C(T), electrical resistivity ρ(T) and X-ray absorption spectroscopy. Powder X-ray diffraction revealed that CeMo{sub 2}Si{sub 2}C crystallizes in CeCr{sub 2}Si{sub 2}C-type layered tetragonal crystal structure (space group P4/mmm). The unit cell volume of CeMo{sub 2}Si{sub 2}C deviates from the expected lanthanide contraction, indicating non-trivalent state of Ce ions in this compound. The observed weak temperature dependence of the magnetic susceptibility and its low value indicate that Ce ions are in valence fluctuating state. The formal L{sub III} Ce valence in CeMo{sub 2}Si{sub 2}C〈ν{sup ∼}〉=3.14 as determined from X-ray absorption spectroscopy measurement is well below the value 〈ν{sup ∼}〉≃3.4 in tetravalent Ce compound CeO{sub 2}. The temperature dependence of specific heat does not show any anomaly down to 1.8 K which rules out any magnetic ordering in the system. The Sommerfeld coefficient obtained from the specific heat data is γ = 23.4 mJ/mol K{sup 2}. The electrical resistivity follows the T{sup 2} behavior in the low temperature range below 35 K confirming a Fermi liquid behavior. Accordingly both the Kadowaki Woods ratio A/γ{sup 2} and the Sommerfeld Wilson ratio χ(0)/γ are in the range expected for Fermi-liquid systems. In order to get some information on the electronic states, we calculated the band structure within the density functional theory, eventhough this approach is not able to treat 4f electrons accurately. The non-f electron states crossing the Fermi level have mostly Mo 4d character. They provide the

  9. Ancylostoma duodenale em estrangeiros radicados em Botucatu, SP, Brasil

    Directory of Open Access Journals (Sweden)

    Florence F.S. Kerr

    1981-06-01

    Full Text Available Utilizando-se a técnica de Harada & Mori foi efetuada verificação das espécies de Ancylostomidae prevalentes entre imigrantes europeus, asiáticos e brasileiros residentes no município de Botucatu, Estado de São Paulo, Brasil. Ancylostoma duodenale foi encontrado em 8,5% dos imigrantes asiáticos e Necator americanus em 3,5% dos europeus e em 18% dos brasileiros examinados.

  10. Intermediate-valent CeCoAl. A commensurate modulated structure with short Ce-Co distances

    Energy Technology Data Exchange (ETDEWEB)

    Niehaus, Oliver; Hoffmann, Rolf-Dieter; Poettgen, Rainer [Univ. Muenster (Germany). Inst. fuer Anorganische und Analytische Chemie; Tence, Sophie; Chevalier, Bernard [CNRS Bordeaux Univ., Pessac (France). ICMCB, UPR 9048

    2015-11-01

    CeCoAl was synthesized by melting of the elements in a sealed niobium tube in an induction furnace. Annealing of the sample gave access to a single phase sample. Its structure was refined on the basis of single-crystal X-ray diffractometer data at different temperatures. Above 271 K CeCoAl crystallizes in its own structure type in the space group C2/m [a = 1107.4(2), b = 440.6(1) and c = 479.6(1) pm, β = 104.6(1) {sup circle} ]. Data obtained at 300 K lead to 511 F{sup 2} values with 20 variables and a residual of [I ≥ 3σ(I)] wR = 0.0539. Below 271 K satellites give rise to the superspace group C2/m(α0γ)00; α = 2/3, γ = 2/5 with a temperature independent q-vector. For the 90 K data (also for 180 and 220 K) the commensurate modulated structure could be refined with 4817 F{sup 2} values, 129 variables and residuals of wR = 0.0347 (main), wR = 0.1927 (satellites 1st order), wR = 0.1541 (satellites 2nd order) and wR = 0.1768 (satellites 3rd order) [a = 1107.5(1), b = 440.3(1) and c = 479.0(1) pm, β = 104.7(1) {sup circle} ]. For the three temperatures only minor variations of the modulation amplitudes are observed. The relation of the low temperature (3+1)D 3a x 5c approximant and the room temperature 3D structure is discussed on the basis of a group-subgroup relation. By investigation of the heat capacity, the phase transition could be identified as a second order one with a transition temperature of 271 K. Magnetic measurements clearly prove the intermediate cerium valence which is in line with the short Ce-Co distances.

  11. On subspecific taxonomy of <em>Microtus saviiem> (Rodentia, Arvicolidae

    Directory of Open Access Journals (Sweden)

    Longino Contoli

    2003-10-01

    Full Text Available Riassunto Sulla tassonomia sottospecifica di <em>Microtus saviiem> (Rodentia, Arvicolidae Viene riveduta e riassunta la situazione tassonomica sottospecifica di <em>Microtus (Terricola saviiem>, anche tramite la descrizione di due nuovi taxa: <em>Microtus (Terricola savii tolfetanusem>, dei Monti della Tolfa e <em>Microtus (Terricola savii niethammericusem>, del Gargano.

  12. CORANTES ARTIFICIAIS EM ALIMENTOS

    Directory of Open Access Journals (Sweden)

    Marcelo Alexandre PRADO

    2009-07-01

    Full Text Available

    O emprego de aditivos químicos é, sem dúvida, um dos mais polêmicos avanços alcançados pela indústria de alimentos. Os corantes artificiais pertencem a uma dessas classes de aditivos alimentares e têm sido objeto de muitas críticas, já que seu uso em muitos alimentos justifica-se apenas por questões de hábitos alimentares. Ainda existem diferentes opiniões quanto à inocuidade dos diversos corantes artificiais. Visando, principalmente, o controle no uso dos corantes sintéticos, mas tendo em vista que produtos coloridos artificialmente são exportados e importados, a análise desses aditivos requer métodos eficientes e rápidos para a detecção, identificação e quantificação. A cromatografia em papel e em camada delgada, apesar de serem técnicas relativamente rápidas, apresentam dados com baixa exatidão e precisão. Já na cromatografia líquida de alta eficiência (CLAE as maiores dificuldades encontram-se nas etapas de extração, mas principalmente no alto custo do equipamento. A eletroforese capilar apresenta os mesmos problemas da CLAE, aliados ao fato de se tratar de uma técnica relativamente recente para a análise desse tipo de substância e, portanto, existem poucos estudos a cerca da determinação e quantificação. PALAVRAS-CHAVE: Corantes artificiais; análise; legislação; CLAE; EC

  13. Preparation and Characterization of Graphite Powder Covered with CeO2

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    In order to improve the wetting properties of graphite with Al melt and reduce the oxidation of the graphite, by which the segregation of components during the liquid-stir-casting process could be prevented. In this paper, a uniform thin nano-film of CeO2, about 20 nm thick, was successfully prepared onto graphite powder surface by heterogeneous nucleation process. The results show that an obvious chemical reaction did exit between CeO2 film and graphite with the formation of Ce-O-C bond, leading to a shift of the binding energy of C and Ce. The cover with CeO2 film illustrates a distinct change of surface state of graphite with a decrease of angle of contact.

  14. LiZnPO4:Tb3+ ,Ce3+ green phosphors with high efficiency

    Institute of Scientific and Technical Information of China (English)

    OUYANG Chunmei; MA Shuai; RAO Yang; ZHOU Xinmu; ZHOU Xuezhen; LI Yongxiu

    2012-01-01

    Tb3+ and Ce3+ co-activated LiZnPO4 phosphors with high luminescence efficiency were synthesized by a high temperature solid-state reaction at 1000 C for 3 h.The XRD patterns,photoluminescence spectra and SEM were recorded and the effects of Tb3+ and Ce3+ concentration,sintering condition on the luminescent properties of as-synthesized phosphors were investigated.The emission spectra under ultraviolet (200-300 um) radiation showed a dominant peak at 543 nm attributed to the 5D4→7F5 transition of Tb3+,which was greatly enhanced by the co-doping of Ce3+,indicating that there occurred an efficient non-radiative energy transfer from Ce3+ to Tb3+.The optimal doping concentrations of Tb3+ and Ce3+ were determined to be 9% and 10%,respectively.

  15. CeO2-Co3O4 Catalysts for CO Oxidation

    Institute of Scientific and Technical Information of China (English)

    Xu Xiuyan; Li Jinjun; Hao Zhengping

    2006-01-01

    CeO2-Co3O4 catalysts for low-temperature CO oxidation were prepared by a co-precipitation method.In combination with the characterization methods of N2 adsorption/desorption, XRD, temperature-programmed reduction (TPR), and FT-IR, the influence of the cerium content on the catalytic performance of CeO2-Co3O4 was investigated.The results indicate that the prepared CeO2-Co3O4 catalysts exhibit a better activity than that of pure CeO2 or pure Co3O4.The catalyst with the Ce/Co atomic ratio 1:16 exhibits the best activity, which converts 77% of CO at room temperature and completely oxidizes CO at 45 ℃.

  16. Characterization and CO Catalytic Oxidation of CuO/Ce-Zr-La-O Catalyst

    Institute of Scientific and Technical Information of China (English)

    钟依均; 林瑞; 罗孟飞

    2003-01-01

    The Ce-Zr-La-O solid solution was prepared by the sol-gel method. The structure and the redox behavior of Ce-Zr-La-O solid solution and CuO/Ce-Zr-La-O catalysts were investigated by using XRD, Raman and TPR techniques. The result shows that the reduction capability of Ce0.7Zr0.3-yLayO solid solution is related to content of La. Appropriate content of La can enhance the redox capability of the solid solution. The oxidation activity of the CuO(6%)/Ce0.7Zr0.15La0.15O catalyst is the highest. CuO, which finely dispersed and interacted with the support, is the site of oxidation activity.

  17. Thermal Dihydrogen Activation by a Closed-Shell AuCeO2(+) Cluster.

    Science.gov (United States)

    Meng, Jing-Heng; He, Sheng-Gui

    2014-11-01

    Laser-ablation-generated AuCeO2(+) and CeO2(+) oxide clusters were mass-selected using a quadrupole mass filter and reacted with H2 in an ion trap reactor at ambient conditions. The reactions were characterized by mass spectrometry and density functional theory calculations. The gold-cerium bimetallic oxide cluster AuCeO2(+) is more reactive in H2 activation than the pure cerium oxide cluster CeO2(+). The gold atom is the active adsorption site and facilitates the heterolytic cleavage of H2 in collaboration with the separated O(2-) ion of the CeO2 support. To the best of our knowledge, this is the first example of thermal H2 activation by a closed-shell atomic cluster, which provides molecular-level insights into the single gold atom catalysis over metal oxide supports. PMID:26278765

  18. Effect of Ce3+ on membrane permeability of Escherichia coli cell

    Institute of Scientific and Technical Information of China (English)

    CHEN Aimei; SHI Qingshan; OUYANG Yousheng; CHEN Yiben

    2012-01-01

    This study aimed to delineate the antibacterial mechanism of rare-earth ion Ce3+ to the target organism Escherichia coli cell,and the most important purpose was to identify its biological effect of increasing the E.coli cell membrane permeability.The antibacterial activities of Ce3+ to E.coli cells were tested,and then the permeability of outer membrane (OM) and inner membrane (IM) were studied by N-phenyl-1-naphthylamine (NPN) and o-nitrophenyl-β-D-galactopyranoside (ONPG) methods separately.Through these experiments we concluded that the E.coli cells grown to log phage were more sensitive to Ce3+ than the ones not at this stage; the structure of membrane was destroyed and the permeability of both OM and IM was obviously increased by Ce3+; there should be certain interactions between Ce3+ and some proteins inside the cell,which impeded the physiological activities of bacteria.

  19. Solvothermal fabrication and luminescent properties of Eu2+/Ce3+ doped barium lithium fluoride

    Institute of Scientific and Technical Information of China (English)

    ZHU Guoxian; YANG Qu; SHI Xiaobo; ZHENG Wenzhi; LIU Yingliang

    2012-01-01

    Phosphors of BaLiF3 doped with Eu or/and Ce were solvothermally prepared at 200 ℃ for 5 d and characterized by means of X-ray powder diffraction (XRD) and environment scanning electron microscopy (ESEM).The excitation and emission spectra of the rare earth ions doped BaLiF3 were measured by fluorescence spectroscopy and the effects of Ce3+ions on the luminescence of Eu2+ions were investigated,In the co-doped Eu2+ and Ce3+ system,the emission intensity ofEu2+ ion gradually increased with the Ce3+ concentration increasing,and the enhancement ofEu2+ fluorescence was due to efficient energy transfer from Ce3+ to Eu2+ in the host.

  20. Preparation and performance of CeO2 hollow spheres and nanoparticles

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wenwen; CHEN Donghui

    2016-01-01

    CeO2 hollow spheres were synthesized by polystryrene sphere (PS) templates and CeO2 nanoparticles were prepared by a facile method. The as-obtained products were characterized by scanning electron microscopy (SEM), N2 adsorption-desorption, X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and UV-vis diffuse reflectance spectra. The results showed that the structure of the obtained CeO2 hollow spheres was hollow microsphere with a diameter of 380 nm and the average particle size of CeO2 nanoparticles was about 1700 nm. The two samples' Brunauer-Emmett-Teller (BET) surface area was 67.1 and 37.2 m2/g. The CeO2 hollow spheres had a better performance than nanoparticles at UV-shielding because of higher surface area and the structure of hollow sphere.

  1. Preparation of nanosized yttrium doped CeO2 catalyst used for photocatalytic application

    Directory of Open Access Journals (Sweden)

    A. Akbari-Fakhrabadi

    2015-09-01

    Full Text Available In the present work, the pure CeO2 and yttrium doped CeO2 nanopowders were synthesized by the nitrate-fuel self-sustaining combustion method and calcined at 700 °C for 2 h. X-ray diffraction (XRD and high resolution electron transmission microscopy (HRTEM results demonstrated a cubic fluorite with high purity and the crystallite sizes less than 20 nm calculated from Scherrer’s formula. The BET specific surface area of yttrium doped CeO2 samples showed high values than those of pure CeO2. The photocatalytic activity of yttrium doped CeO2 showed high degradation of Rhodamine B solution under visible light illumination.

  2. The magnetic properties of Ce/Pd surface alloys investigated using DFT

    KAUST Repository

    Shuttleworth, I.G.

    2014-06-01

    The surface alloys that form between Ce and Pd(1 1 1), Pd(1 0 0) and both unreconstructed and missing-row type Pd(1 1 0) at low Ce coverage ( θCe=19ML) have shown permanent magnetism that is mediated in part by an RKKY-like delocalized Ce 6s-Pd 5s interaction. The Pd 4d states are significantly affected by alloying and their behavior cannot be explained by a purely spin-dependent Hamiltonian. Experimental observations of changes to the Pd 4d states are explained and the implications of Ce/Pd magnetism in reforming catalysis are discussed. © 2014 Elsevier B.V. All rights reserved.

  3. Short-Range Order in Liquid Al-Cu-Ni-Ce Alloy

    Institute of Scientific and Technical Information of China (English)

    孙民华; 边秀房

    2002-01-01

    The liquid and amorphous structures of Al85Ni10Ce5 and Al85Cu5Ni5Ce5 alloy were studied by X-ray diffraction. The position of the first peak shifts to bigger Q-values as the concentration of Cu increases. Gaussian decomposition of first peak in radical distribution function (RDF) was applied to Al-Ni(Cu)-Ce system. The bond lengths of Al-Al, Al-TM(Transition metal) and TM-TM increase with the substitution of Ni by Cu. Viscosity measurement shows that viscosity of Al-Ni-Ce alloy increases faster than that of Al-Ni-Cu-Ce alloy. The addition of Cu can decrease the interaction between atoms, so it is unfavorable to Al-based glass formability.

  4. Bimetallic bonding and mixed oxide formation in the Ga-Pd-CeO2 system

    Science.gov (United States)

    Skála, Tomáš; Tsud, Nataliya; Prince, Kevin C.; Matolín, Vladimír

    2011-08-01

    The interaction of gallium and palladium with 2 nm CeO2(111) layers grown on Cu(111) was studied by core level photoelectron spectroscopy and resonant valence band spectroscopy. Palladium alone interacted weakly with ceria layers. Gallium deposited on cerium dioxide formed a mixed Ga2O3-Ce2O3 oxide of 1:1 stoichiometry (cerium gallate CeGaO3), with both metals in the M3+ oxidation state. Increasing Ga coverages led to the formation of lower oxidation states, i.e., Ga1+ in Ga2O oxide and metallic Ga0. Palladium deposited onto this complex system interacted with gallium leading to a breakage of Ga-ceria bonds, a decrease of the oxidation state of gallium, and formation of a Ga-Pd intermetallic alloy in which all components (CeO2, CeGaO3, Ga2O, Ga-Pd, and Pd) are in equilibrium.

  5. Self-template hydrothermal synthesis of CeO2 hollow nanospheres

    International Nuclear Information System (INIS)

    CeO2 hollow nanospheres were synthesized by a low-cost and environmentally benign one-pot hydrothermal route. Templates, surfactants, or other auxiliaries were not used in the route. X-ray diffraction, transmission electron microscopy, scanning electron microscopy, X-ray photoelectron spectroscopy, high-resolution transmission electron microscopy, and nitrogen adsorption–desorption measurements were used to characterize the products. The average diameter of hollow spheres, with shells of approximately 30 nm, was about 300 nm. The formation of these hollow spheres involved a transformation from Ce(OH)CO3 solid spheres to CeO2 hollow nanospheres. The CeO2 hollow nanospheres exhibited a higher catalytic activity on CO oxidation than CeO2 nano-octahedrons.

  6. Synthesis of Mn-doped CeO2 nanorods and their application as humidity sensors

    Indian Academy of Sciences (India)

    C H Hu; C H Xia; F Wang; M Zhou; P F Yin; X Y Han

    2011-08-01

    Mn-doped CeO2 nanorods have been prepared from CeO2 particles through a facile compositehydroxide-mediated (CHM) approach. The products were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The analysis from the X-ray photoelectron spectroscopy indicates that the manganese doped in CeO2 exists as Mn4+. The responses to humidity for static and dynamic testing proved dopingMn into CeO2 can improve the humidity sensitivity. For the sample with Mn% about 1.22, the resistance changes from 375.3 to 2.7M as the relative humidity (RH) increases from 25 to 90%, indicating promising applications of the Mn-doped CeO2 nanorods in environmental monitoring.

  7. Photoluminescence properties of color-tunable KLaSiO4:Ce3+,Mn2+phosphors

    Institute of Scientific and Technical Information of China (English)

    常文瑞; 王丹; 朋兴平; 王育华; 胡龄之; 王静

    2015-01-01

    A series of color-tunable KLaSiO4:Ce3+,Mn2+phosphors were successfully prepared and the luminescent properties were investigated. Upon excitation at 290 nm, the emission spectra of KLaSiO4:Ce3+,Mn2+phosphors included a blue emission band and a red emission band. Increasing the doping concentration of Mn2+ions, the red emission was strengthened considerably, and the blue emission of Ce3+ was reduced, owing to the efficient energy transfer. The composition optimized KLa0.96SiO4:0.02Ce3+,0.02Mn2+sample exhibited the white light emission brightly with the chromaticity coordinates of (0.331, 0.337). Therefore, KLaSiO4:Ce3+, Mn2+could be used as a white phosphor candidate for white light-emitting diodes devices.

  8. Synthesis and characterization of BaCeO3 nanocrystals viasolvothermal-based method

    Institute of Scientific and Technical Information of China (English)

    XU Chao; ZHU Junwu; YANG Xujie; LU Lude; WANG Xin

    2008-01-01

    A facile approach to preparing well-dispersed nanocrystals of BaCeO3 was developed by a combination of solvothermal and annealing processes. The precursor consisted of amorphous BaCO3 and CeO2, and the conversion of the precursor to crystalline BaCeO3 nanocrystals occurred upon heat treatment at a relatively low temperature. The as-processed BaCeO3 had an orthorhombic structure and the average size of such crystals was approximately 80 nm. The obtained products were characterized by Fourier Transform Infrared (FT-IR), X-Ray Diffraction (XRD), Laser Raman Spectroscopy (LRS), Scanning Electron Microscopy (SEM), Energy Dispersive X-Ray Spectrometry (EDS), and Transmission Electron Microscopy (TEM). This preparation process could also be used to synthesize doped barium cerate complex oxides BaCe0.95M0.05O3-d (M=Y, Nd, Gd, and Sm).

  9. Structural and elastic properties of Ce2O3 under pressure from LDA+ U method

    Science.gov (United States)

    Qi, Yuan-Yuan; Niu, Zhen-Wei; Cheng, Cai; Cheng, Yan

    2013-08-01

    We investigate the structural and elastic properties of hexagonal Ce2O3 under pressure using LDA+ U scheme in the frame of density functional theory (DFT). The obtained lattice constants and bulk modulus agree well with the available experimental and other theoretical data. The pressure dependences of normalized lattice parameters a/a 0 and c/c 0, ratio c/a, and normalized primitive volume V/V 0 of Ce2O3 are obtained. Moreover, the pressure dependences of elastic properties and three anisotropies of elastic waves of Ce2O3 are investigated for the first time. We find that the negative value of C 44 is indicative of the structural instability of the hexagonal structure Ce2O3 at zero temperature and 30 GPa. Finally, the density of states (DOS) of Ce2O3 under pressure is investigated.

  10. Luminescent properties of Al2O3:Ce single crystalline films under synchrotron radiation excitation

    Science.gov (United States)

    Zorenko, Yu.; Zorenko, T.; Gorbenko, V.; Savchyn, V.; Voznyak, T.; Fabisiak, K.; Zhusupkalieva, G.; Fedorov, A.

    2016-09-01

    The paper is dedicated to study the luminescent and scintillation properties of the Al2O3:Ce single crystalline films (SCF) grown by LPE method onto saphire substrates from PbO based flux. The structural quality of SCF samples was investigated by XRD method. For characterization of luminescent properties of Al2O3:Ce SCFs the cathodoluminescence spectra, scintillation light yield (LY) and decay kinetics under excitation by α-particles of Pu239 source were used. We have found that the scintillation LY of Al2O3:Ce SCF samples is relatively large and can reach up to 50% of the value realized in the reference YAG:Ce SCF. Using the synchrotron radiation excitation in the 3.7-25 eV range at 10 K we have also determined the basic parameters of the Ce3+ luminescence in Al2O3 host.

  11. How <em>Varroa> Parasitism Affects the Immunological and Nutritional Status of the Honey Bee, <em>Apis melliferaem>

    Directory of Open Access Journals (Sweden)

    Katherine A. Aronstein

    2012-06-01

    Full Text Available We investigated the effect of the parasitic mite <em>Varroa destructorem> on the immunological and nutritional condition of honey bees, <em>Apis melliferaem>, from the perspective of the individual bee and the colony. Pupae, newly-emerged adults and foraging adults were sampled from honey bee colonies at one site in S. Texas, USA. <em>Varroa>‑infested bees displayed elevated titer of Deformed Wing Virus (DWV, suggestive of depressed capacity to limit viral replication. Expression of genes coding three anti-microbial peptides (<em>defensin1, abaecin, hymenoptaecinem> was either not significantly different between <em>Varroa>-infested and uninfested bees or was significantly elevated in <em>Varroa>-infested bees, varying with sampling date and bee developmental age. The effect of <em>Varroa> on nutritional indices of the bees was complex, with protein, triglyceride, glycogen and sugar levels strongly influenced by life-stage of the bee and individual colony. Protein content was depressed and free amino acid content elevated in <em>Varroa>-infested pupae, suggesting that protein synthesis, and consequently growth, may be limited in these insects. No simple relationship between the values of nutritional and immune-related indices was observed, and colony-scale effects were indicated by the reduced weight of pupae in colonies with high <em>Varroa> abundance, irrespective of whether the individual pupa bore <em>Varroa>.

  12. Synthesis and properties of electrodeposited Ni–B–CeO2 composite coatings

    International Nuclear Information System (INIS)

    Highlights: • Alteration of metallic luster, chemical composition and crystal structure. • Remarkable improvement in mechanical properties. • A decent improvement in corrosion behavior. - Abstract: Ni–B coatings are extremely hard and wear resistant with decent anticorrosion properties which make them suitable for automotive, aerospace, petrochemical, plastic, optics, nuclear, electronics, computer, textile, paper, food and printing industries. However, further improvement in properties is essential to address more challenging requirements and new developments. In the present study, Ni–B and novel Ni–B–CeO2 composite coatings were electrodeposited (ED) on mild steel substrates using dimethylamine borane (DMAB) as a reducing agent. A comparison of properties of Ni–B and Ni–B–CeO2 coatings is presented to elucidate the useful role of CeO2 addition. The structural analyses indicate that Ni–B coatings are amorphous in their as deposited state. However, addition of CeO2 into Ni–B matrix considerably improves the crystallinity of the deposit. The surface morphology study reveals the formation of uniform, dense and fine-grained deposit in both Ni–B and Ni–B–CeO2 composite coatings. However, Ni–B–CeO2 composite coatings exhibit high surface roughness. The nano mechanical properties show that the addition of CeO2 particles into Ni–B matrix results in remarkable improvement in mechanical properties (hardness and modulus of elasticity) which may be attributed to dispersion hardening of Ni–B matrix by CeO2 particles. The electrochemical polarization tests confirm that the addition of CeO2 improves the corrosion resistance of Ni–B coatings. This improvement in corrosion behavior may be ascribed to the reduction in active area of Ni–B coatings by the presence of inactive CeO2 particles into Ni–B matrix

  13. Evidence for strong f -d hybridization in the intermetallic ferromagnet CePdIn2

    Science.gov (United States)

    Carleschi, E.; Doyle, B. P.; Snyman, J. L.; Magnano, E.; Nappini, S.; Pis, I.; Bondino, F.; Peratheepan, P.; Strydom, A. M.

    2015-12-01

    We have investigated the contribution of Ce 4 f states to the electronic structure of the intermetallic ferromagnet CePdIn2 by means of x-ray absorption spectroscopy and resonant and nonresonant photoemission spectroscopy. The line shape of the Ce M5 ,4 absorption edge reveals the localized nature of the 4 f states, and is consistent with a predominantly 3+ ionic state for Ce ions. Fitting of the Ce 3 d core level gives a Ce 4 f occupation number at room temperature of 0.92, which is in good agreement with the Ce effective magnetic moment of 2.20 μB (corresponding to ˜87 % of the free-electron moment) as calculated from the inverse magnetic susceptibility. Moreover, the hybridization strength between 4 f and conduction electrons is found to be ˜180 meV, revealing that CePdIn2 is a strongly hybridized system. This is consistent with the results from the analysis of the resonant valence band photoemission measurements at both the N5 ,4 and the M5 edges, showing that the Ce 4 f states are composed of the features predicted by the single-impurity Anderson model, i.e., a broad 4 f0 peak centered at 1.9 eV and two 4 f1 spin-orbit states much closer to the Fermi level. The same spectra also show that the Ce 4 f resonant spectral weight extends over a wide binding energy range, overlapping with that presumably occupied by the Pd 4 d ligand states. This energy overlap is interpreted as a signature of the strong hybridization governing the system, which could possibly favor the emergence of long-range ferromagnetism through the indirect exchange between localized 4 f states mediated by highly dispersive d electrons.

  14. CONTROLE DE PLANTAS DANINHAS EM CANA SOCA COM HERBICIDAS APLICADOS EM PRÉ-EMERGÊNCIA

    Directory of Open Access Journals (Sweden)

    SANDANIEL, Carlos Roberto

    2008-01-01

    Full Text Available In order to evaluate the effectiveness, the selectivity of herbicides, applied in pre-emergenceof sugarcane and productivity of sugar cane plantation, was conducted an experiment in Usina Helena Sugarand Alcohol S / A, located in Santa Helena de Goias - GO. The results gotten with treatments with herbicideshexazinone + clomazone 500 WP (2.5 kg ha-1, hexazinone + clomazone 500 WP (3.0 kg ha-1, sulfentrazone 500SC (1.8 L ha-1, clomazone ametrina EC + (6.0 L ha-1, clomazone (2.5 L ha-1 and sulfentrazone 500 SC (1.0 L ha-1+ clomazone (2.0 L ha-1, applied in pre-emergence of weeds and culture, demonstrated satisfactory selectivity to the sugar cane, causing no reduction in productivity stems or sugar (cana soca.Visando a avaliar a eficácia, a seletividade dos herbicidas, aplicados em pré-emergência de cana-socae a produtividade da cultura da cana-de-açúcar, foi realizado um experimento, na Usina Santa Helena de Açúcare Álcool S/A, localizada no município de Santa Helena de Goiás - GO. Os resultados obtidos com tratamentoscom herbicidas hexazinone + clomazone 500 WP (2,5 kg ha-1, hexazinone + clomazone 500 WP (3,0 kg ha-1,sulfentrazone 500 SC (1,8 L ha-1, clomazone + ametrina CE (6,0 L ha-1, clomazone (2,5 L ha-1 e sulfentrazone500 SC (1,0 L ha-1 + clomazone (2,0 L ha-1, aplicados em pré-emergência das plantas daninhas e da culturademonstraram seletividade satisfatória à cana-de-açúcar (cana-soca, não causando redução de produtividade de colmos ou de açúcar provável (cana-soca.

  15. Study on diesel soot oxidation over CeO2-containing catalysts%含CeO2催化剂用于柴油车尾气炭烟氧化的研究

    Institute of Scientific and Technical Information of China (English)

    陈瑜; 叶代启; 梁红; 付名利

    2008-01-01

    采用共沉淀法合成含CeO2催化剂M-Ce-O(M=Fe、Cu、Zn、Co、Ni、Mn)和纯CeO2,对催化剂进行TPO活性测试及BET、XRD、FT-IR和H2-TPR表征.结果表明,在Ce中添加过渡金属,改变了CeO2的晶相结构,比表面积增大,催化剂促进炭烟的燃烧,其促进炭烟氧化的活性顺序为:Ni-Ce-O>Mn-Ce-O>Cu-Ce-O>Fe-Ce-O>Ce-O>Co-Ce-O>Zn-Ce-O,其中,Ni-Ce-O表现出较高的活性,对应起燃温度降至340℃.TPR表明,催化活性与500 ℃以下的表面可还原氧量相关.

  16. Synthesis and Spectroscopic Analysis of Novel 1<em>H-Benzo[d>]imidazoles Phenyl Sulfonylpiperazines

    Directory of Open Access Journals (Sweden)

    Amjad M. Qandil

    2012-05-01

    Full Text Available A group of benzimidazole analogs of sildenafil, 3-benzimidazolyl-4-methoxy-phenylsulfonylpiperazines 2–4 and 3-benzimidazolyl-4-methoxy-<em>N,N>-dimethyl- benzenesulfonamide (5, were efficiently synthesized. Compounds 2–5 were characterized by NMR and MS and contrary to the reported mass spectra of sildenafil, the spectra of the piperazine-containing compounds 2–4 showed a novel fragmentation pattern leading to an <em>m/z> = 316. A mechanism for the formation of this fragment was proposed.

  17. Caracterização pós-colheita de figos (Ficus carica L. produzidos sob diferentes condições de cultivo na Chapada do Apodi – CE.

    Directory of Open Access Journals (Sweden)

    Raniely Nayanne da Silva Freitas

    2015-03-01

    Full Text Available A produção de figos para consumo in natura é limitada pelas chuvas, que causam elevadas perdas por podridão, o que pode dificultar o seu cultivo durante a estação chuvosa local (fevereiro a maio, época em que a fruta atinge a sua maior cotação. Essa dificuldade poderá ser contornada com o uso de ambiente protegido. Objetivou-se com o presente trabalho, realizar a caracterização da qualidade pós-colheita de figos produzidos sob cultivo protegido e a céu aberto na Chapada do Apodi- CE. Os frutos utilizados neste experimento foram colhidos em pomar experimental da Unidade de Ensino e Pesquisa (UEPE, pertencente ao Instituto Federal de Educação, Ciência e Tecnologia do Ceará (IFCE, localizada na Chapada do Apodi em Limoeiro do Norte – Ceará, onde os mesmos foram cultivados a céu aberto e em estufa.  Foram realizadas as seguintes análises: diâmetro do fruto, peso do fruto, firmeza da polpa, sólidos solúveis (SS, acidez titulável(AT, pH, RATIO e vitamina C. De acordo com os parâmetros analisados, os figos cultivados em estufa apresentaram melhores atributos físico-químicos em relação aos cultivados em céu aberto, concluindo-se que, o tipo de cultivo influencia na qualidade pós-colheita do fruto.

  18. Structure and photocatalytic activity studies of TiO2-supported over Ce-modified Al-MCM-41

    International Nuclear Information System (INIS)

    Ce-Al-MCM-41, TiO2/Al-MCM-41 and TiO2/Ce-Al-MCM-41 materials with varying contents of Ce (by impregnation) and TiO2 loaded (by solid-state dispersion) on Al-MCM-41 support are prepared. The Ce modified and TiO2 loaded composite systems are characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), UV-vis diffuse reflectance spectra (DRS) and X-ray photoelectron spectroscopy (XPS) techniques. The DRS and XPS of low Ce content (0.2-0.5 wt.%) modified Al-MCM-41 samples are showing more characteristic of Ce3+ species wherein cerium in interaction with Al-MCM-41 and that of high Ce (0.8, 3.0 wt.%) content modified samples are showing the characteristic of both Ce4+and Ce3+species. A series of Ce-modified Al-MCM-41 and TiO2 loaded composite catalysts are evaluated for photocatalytic degradation of phenol under UV irradiation. Low Ce content in Ce3+ state on Al-MCM-41 is showing good photoactivity in comparison with high Ce content samples and pure ceria. The composite TiO2/Ce-Al-MCM-41 is showing enhanced degradation activity due decreased rate of electron-hole recombination on TiO2 surface by the redox properties of cerium. The photocatalyst TiO2/Ce-Al-MCM-41 with an optimum of 10 wt.% TiO2 and 0.3 wt.% Ce is showing maximum phenol degradation activity. The possible mechanism of phenol degradation on the composite photocatalyst is proposed.

  19. Catalytic combustion study of soot on Ce0.7Zr0.3O2 solid solution

    Institute of Scientific and Technical Information of China (English)

    FANG Ping; LU Jiqing; XIAO Xiaoyan; LUO Mengfei

    2008-01-01

    The Ce0.7Zr0.3O2 solid solution and CeO2 were prepared using the sol-gel method. The phase structure, crystallite sizes and the reducibility of the catalysts were characterized by XRD and H2-TPR techniques. XRD results indicated that Zr4+ had replaced part of Ce4+ to form a fluorite-like solid solution, which was favorable to obtain ultrafine nanoparticles. The ratio of main H2 consumption for Ce0.7Zr0.3O2:CeO2 was 4.4:1.0, implying that the solid solution could improve the reducibility compared to the single CeO2. The Ce0.7Zr0.3O2 solid solution catalyst showed a sharp combustion peak at 397 oC, which was 200 oC lower than that of the single soot. The good catalytic activity of the Ce0.7Zr0.3O2 was attributed to the formation of nano-CeO2-based solid solution, which enhanced the reducibility and then improved the combustion activity. As Ce0.7Zr0.3O2 could be easily reduced to Ce0.7Zr0.3O2-x, meanwhile, after oxygenation, the Ce0.7Zr0.3O2-x was recovered to Ce0.7Zr0.3O2 completely. A catalytic combustion reaction mechanism was proposed: the Ce0.7Zr0.3O2 was reduced to Ce0.7Zr0.3O2-x by the reaction with carbon and then it was recovered to Ce0.7Zr0.3O2-x by the interaction with O2.

  20. Proximate Composition, Nutritional Attributes and Mineral Composition of <em>Peperomia> <em>pellucida> L. (Ketumpangan Air Grown in Malaysia

    Directory of Open Access Journals (Sweden)

    Maznah Ismail

    2012-09-01

    Full Text Available This study presents the proximate and mineral composition of <em>Peperomia> <em>pellucida> L., an underexploited weed plant in Malaysia. Proximate analysis was performed using standard AOAC methods and mineral contents were determined using atomic absorption spectrometry. The results indicated <em>Peperomia> <em>pellucida> to be rich in crude protein, carbohydrate and total ash contents. The high amount of total ash (31.22% suggests a high-value mineral composition comprising potassium, calcium and iron as the main elements. The present study inferred that <em>Peperomia> <em>pellucida> would serve as a good source of protein and energy as well as micronutrients in the form of a leafy vegetable for human consumption.

  1. 重组人促红细胞生成素的CE和CE-MS检测方法研究进展%Recent Advance in the CE and CE-MS Detection of Recombinant Human Erythropoietin in Doping Control

    Institute of Scientific and Technical Information of China (English)

    庞楠楠; 杨霞; 廖一平; 刘虎威

    2008-01-01

    促红细胞生成素(erythropoietin,EPO)是调控红血球细胞量的糖蛋白激素,近年来被滥用在一些耐力性比赛项目中.由于EPO在尿样或血样中的浓度低,代谢快以及结构复杂多变给检测带来了很大的难度.该文从毛细管电泳(capillary electrophoresis,CE)和毛细管电泳-质谱(CE-mass spectrometry,CE-MS)角度综述了近几年来兴奋剂重组人促红细胞生成素(recombinant human EPO,rhEPO)检测的研究进展.

  2. Ultrasound-Assisted Extraction of Syringin from the Bark of <em>Ilex em>rotunda> Thumb Using Response Surface Methodology

    OpenAIRE

    Hui Wang; Li-Chun Zhao; Wei Li; Xin Deng; Xiang-Hua Xia; Jian Liang; Geng-Liang Yang; Ying He

    2012-01-01

    In this work, a rapid extraction method based on ultrasound-assisted extraction (UAE) of syringin from the bark of <em>Ilex rotunda em>Thumb using response surface methodology (RSM) is described. The syringin was analyzed and quantified by high performance liquid chromatography coupled with UV detection (HPLC-UV). The extraction solvent, extraction temperature and extraction time, the three main factors for UAE, were optimized with Box-Behnken design (BBD) to obtain the highest ...

  3. Effect of CeO2 coupling on the structural, optical and photocatalytic properties of ZnO nanoparticle

    Science.gov (United States)

    Sherly, E. D.; Vijaya, J. Judith; Kennedy, L. John

    2015-11-01

    This research work presents the microwave assisted combustion synthesis, characterization and photocatalytic applications of ZnO-CeO2 coupled nano metal oxide. ZnO, CeO2 and the coupled oxides ZnCe, Zn2Ce and ZnCe2 with ZnO and CeO2 in the molar ratio 1:1, 2:1 and 1:2 respectively were fabricated by microwave assisted metal nitrate-urea solution combustion synthesis, without using any organic solvent or surfactant. As-prepared samples were characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), field emission scanning electron microscopy (FESEM), energy dispersive X-ray analysis (EDX), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR), diffuse reflectance spectroscopy (DRS) and photoluminescence spectroscopy(PL). The experiments of photocatalytic activity indicate that Zn2Ce nanoparticles exhibit excellent photocatalytic performance in the degradation of 2,4-dichlorophenol (2,4-DCP). 95% of 2,4-DCP molecules were decomposed by Zn2Ce in 240 min. The better photocatalytic degradation ability of Zn2Ce compared to ZnCe, ZnCe2 or single component ZnO and CeO2 nanoparticles is attributed to the improved separation of photogenerated electron-hole pairs.

  4. Luminescence quenching by photoionization and electron transport in a LaAlO3:Ce3+ crystal

    NARCIS (Netherlands)

    Van der Kolk, E.; De Haas, J.T.M.; Bos, A.J.J.; Van Eijk, C.W.E.; Dorenbos, P.

    2007-01-01

    A combined photoconductivity, absorption, and thermoluminescence study was performed to understand the absence of luminescence from Ce3+ in LaAlO3:Ce3+. It is demonstrated that the absence of luminescence is the result of Ce3+ ionization from the 5d excited states, which are all located in the condu

  5. Antioxidant Profile of <em>Trifolium pratenseem> L.

    Directory of Open Access Journals (Sweden)

    Heidy Schwartsova

    2012-09-01

    Full Text Available In order to examine the antioxidant properties of five different extracts of <em>Trifolium pratenseem> L. (Leguminosae leaves, various assays which measure free radical scavenging ability were carried out: 1,1-diphenyl-2-picrylhydrazyl, hydroxyl, superoxide anion and nitric oxide radical scavenger capacity tests and lipid peroxidation assay. In all of the tests, only the H2O and (to some extent the EtOAc extracts showed a potent antioxidant effect compared with BHT and BHA, well-known synthetic antioxidants. In addition, <em>in vivo em>experiments were conducted with antioxidant systems (activities of GSHPx, GSHR, Px, CAT, XOD, GSH content and intensity of LPx in liver homogenate and blood of mice after their treatment with extracts of <em>T. pratenseem> leaves, or in combination with CCl4. Besides, in the extracts examined the total phenolic and flavonoid amounts were also determined, together with presence of the selected flavonoids: quercetin, luteolin, apigenin, naringenin and kaempferol, which were studied using a HPLC-DAD technique. HPLC-DAD analysis showed a noticeable content of natural products according to which the examined <em>Trifolium pratenseem> species could well be regarded as a promising new source of bioactive natural compounds, which can be used both as a food supplement and a remedy.

  6. Casca de soja em dietas para coelhos em crescimento

    Directory of Open Access Journals (Sweden)

    Ana Carolina Kohlrausch Klinger

    2015-01-01

    Full Text Available O presente trabalho teve como objetivo avaliar efeitos da inclusão de casca de soja em substituição ao feno de alfafa sobre o desempenho, características da carcaça e trato gastrointestinal e parâmetros bioquímicos de coelhos em fase de crescimento. Foram utilizados 30 coelhos da raça Nova Zelândia Branca, divididos igualmente em três tratamentos, compostos pela dieta experimental padrão (sem inclusão de casca de soja; e pelas dietas com 50% e 100% de substituição de alfafa por casca de soja nas respectivas rações experimentais. Concluiu-se que a casca de soja pode ser incluída em dietas para coelhos em crescimento, em substituição ao feno de alfafa em até 100% sem causar danos no desempenho nas características de carcaça e do trato gastrointestinal e parâmetros bioquímicos dos animais, durante a fase de crescimento. Porém, a utilização deste co-produto exige a necessidade de estudos mais aprofundados em virtude da escassez de dados.

  7. Effects of <em>Citrus aurantiumem> (Bitter Orange Fruit Extracts and <em>p>-Synephrine on Metabolic Fluxes in the Rat Liver

    Directory of Open Access Journals (Sweden)

    Rosane Marina Peralta

    2012-05-01

    Full Text Available The fruit extracts of <em>Citrus aurantiumem> (bitter orange are traditionally used as weight-loss products and as appetite supressants. An important fruit component is <em>p>-synephrine, which is structurally similar to the adrenergic agents. Weight-loss and adrenergic actions are always related to metabolic changes and this work was designed to investigate a possible action of the <em>C. aurantiumem> extract on liver metabolism. The isolated perfused rat liver was used to measure catabolic and anabolic pathways, including oxygen uptake and perfusion pressure. The <em>C. aurantiumem> extract and <em>p>-synephrine increased glycogenolysis, glycolysis, oxygen uptake and perfusion pressure. These changes were partly sensitive to a- and b-adrenergic antagonists. <em>p>-Synephrine (200 mM produced an increase in glucose output that was only 15% smaller than the increment caused by the extract containing 196 mM <em>p>-synephrine. At low concentrations the <em>C. aurantiumem> extract tended to increase gluconeogenesis, but at high concentrations it was inhibitory, opposite to what happened with <em>p>-synephrine. The action of the <em>C. aurantiumem> extract on liver metabolism is similar to the well known actions of adrenergic agents and can be partly attributed to its content in <em>p>-synephrine. Many of these actions are catabolic and compatible with the weight-loss effects usually attributed to <em>C. aurantiumem>.

  8. Chemical Composition, Antimicrobial and Antitumor Activities of the Essential Oils and Crude Extracts of<em> Euphorbiaem>> macrorrhizaem>

    Directory of Open Access Journals (Sweden)

    Haji Akber Aisa

    2012-05-01

    Full Text Available The present study aimed to examine the chemical composition and biological activity of essential oils extracted from <em>Euphorbia macrorrhizaem> collected from Northwest China. The major constituents of the essential oils of aerial parts and roots of <em>E. macrorrhizaem> are acorenone B (16.72% and 25.80%, (+-cycloisosativene (14.94% and 12.40%, 3a-hydroxy-5b-androstane (10.62% and 5.52%, copaene (7.37% and 6.29%, l-calamenene (4.13% and 4.65% and β-cedrene (8.40% and 7.98%, respectively. The minor components of them are thymene, γ-terpinene, thymecamphor, α-cedrene, zingiberene, trans-caryophyllene, β-chamigrene, curcumene, pentadecane, (−-α-muurolene, cuparene, γ-cadinene, (<em>Z>-3-heptadecene, 1,3,7,7-tetramethyl-2-oxabicyclo(4.4.0dec-5-en-4-one, hexahydrofarnesyl acetone, γ-elixene and palmitinic acid. The antimicrobial and antitumor activitiy of the <em>E. macrorrhizaem> essential oil against <em>Staphyloccocus aureusem>, <em>Escherichia coliem>, <em>Canidia Albicansem> and Caco-2 cells were evaluated. Among all the tested microorganisms and Caco-2 cells, the essential oils showed the strongest inhibitory effect on <em>Staphyloccocus aureus em>(MIC = 2.8 μg/mL and Caco-2 cell (IC50 = 11.86 μg/mL, whereas no effect on <em>Escherichia coliem> and <em>Candida em>albicans>. The data of this study suggested that the <em>E. macrorrhizaem> essential oils have great potential as a natural medicine for microbial infections and cancers.

  9. Impacto de herbicidas em isolados de Trichoderma spp. Impact of herbicides on strains of Trichoderma spp.

    Directory of Open Access Journals (Sweden)

    M.R. Reis

    2013-06-01

    Full Text Available O uso de microrganismos é uma alternativa para o controle de doenças em plantas. Todavia, é prudente verificar a interação desse com os demais métodos de controle empregados em determinada cultura. Dessa forma, objetivou-se avaliar a fungitoxicidade dos herbicidas sobre o crescimento e desenvolvimento dos isolados de Trichoderma spp. Utilizou-se o delineamento inteiramente casualizado, em esquema fatorial 6 x 6 x 4, com quatro repetições. O fator A correspondeu aos herbicidas pendimethalin, clomazone, carfentrazone-ethyl, oxadiazon, thiobencarb + propanil e byspiribac-sodium; o fator B, às doses dos herbicidas - 0, 25, 50, 75, 100 e 200% da dose recomendada; e o fator C, aos isolados de Trichoderma spp. AJAM 18, CE 66, TRI 01 e TRI 02. O ensaio foi realizado em condições in vitro; avaliaram-se o crescimento micelial radial (CMR e a esporulação dos isolados após aplicação dos herbicidas. Observaram-se diferenças de sensibilidade dos isolados para o mesmo produto testado. O oxadiazon reduziu o CMR dos isolados AJAM 18 e TRI 01 em 66 e 35%, respectivamente. No entanto, reduziu apenas 16% do CMR do isolado TRI 02 e não alterou o CMR do isolado CE 66 mesmo em 200% da dose recomendada. Verificaram-se diferentes efeitos dos produtos em cada isolado. A mistura comercial de thiobencarb+propanil foi altamente tóxica aos isolados de Trichoderma spp., com reduções em torno de 85% no CMR e no número de esporos. Por outro lado, o byspiribac-sodium pouco afetou os isolados, apresentando reduções inferiores a 10% no CMR e na esporulação. O carfentrazone-ethyl e byspiribac-sodium demonstraram ser compatíveis com os isolados de Trichoderma spp. estudados.The use of microorganisms is an alternative for the control of plant diseases. However, one should verify its interaction with other methods of control used for a particular crop. The objective of this work was to evaluate the effect of herbicide fungitoxicity on the growth and

  10. Bio diesel synthesis from pongamia pinnata oil over modified CeO2 catalysts

    International Nuclear Information System (INIS)

    This study investigates the use of CeO2, ZrO2, Mg O and CeO2-ZrO2, CeO2-Mg O, CeO2-ZrO2-Mg O mixed oxides as solid base catalysts for the transesterification of Pongamia pinnata oil with methanol to produce bio diesel. SO42-/CeO2 and SO42-/CeO2-ZrO2 were also prepared and used as solid acid catalysts for esterification of Pongamia pinnata oil (P-oil) to reduce the % of free fatty acid (FFA) in P-oil. The oxide catalysts were prepared by an incipient wetness impregnation method and characterized by techniques such as NH3-Tpd for surface acidity, CO2-Tpd for surface basicity and powder X-ray diffraction for crystallinity. The effect of nature of the catalyst, methanol to P-oil molar ratio and reaction time in esterification as well as in transesterification was investigated. The catalytic materials were reactive d and reused for five reaction cycles and the results showed that the ceria based catalysts have reasonably good reusability both in esterification and transesterification reaction. The test results also revealed that the CeO2-ZrO2 modified with Mg O could have potential for use in the large scale bio diesel production. (Author)

  11. Energy migration processes in undoped and Ce-doped multicomponent garnet single crystal scintillators

    International Nuclear Information System (INIS)

    Multicomponent garnets (Y3−xGdxAl5−yGayO12) doped with Ce3+ ions are promising scintillators with a high density, fast response time and high light yield. To deepen the knowledge about the transfer stage of scintillation mechanism we discuss the energy migration and energy transfer processes in the set of undoped and Ce3+ activated multicomponent garnet single crystals. Temperature dependence of Gd3+ emission intensities as well as decay kinetics in Y3−xGdxAl5−yGayO12 (x,y=1,2,3) crystals point to the Gd3+→Gd3+ nonradiative energy migration, which is diffusion limited. Concentration quenching of Gd3+ emission occurs by energy migration to accidental impurities and/or structure defects. Temperature dependence of photoluminescence emission intensities and decay time measurements of Gd3+ as well as Ce3+ ions in Gd3Ga3Al2O12:Ce3+ single crystal reveal nonradiative energy transfer Gd3+→Ce3+ (including migration through Gd3+ sublattice) which is responsible for slow Ce3+ fluorescence decay component. - Highlights: • Gd3+and Ce3+ luminescence features in Y3−xGdxAl5−yGayO12 measured. • Temperature dependence of emission spectra and decays studied. • Concentration dependence of Gd3+ emission and decay time features investigated. • Energy migration and transfer processes in Gd-sublattice discussed

  12. Role of vacancies, light elements and rare-earth metals doping in CeO2

    Science.gov (United States)

    Shi, H.; Hussain, T.; Ahuja, R.; Kang, T. W.; Luo, W.

    2016-08-01

    The magnetic properties and electronic structures of pure, doped and defective cerium oxide (CeO2) have been studied theoretically by means of ab initio calculations based on the density function theory (DFT) with the hybrid HF/DFT technique named PBE0. Carbon (C), nitrogen (N), phosphorus (P), sulphur (S), lanthanum (La) and praseodymium (Pr) doped in CeO2 and CeO2 containing oxygen vacancies (Ov) were considered. Our spin-polarized calculations show that C, N, Pr dopants and Ov defects magnetize the non-magnetic CeO2 in different degree. The optical band gap related to photocatalysis for pure CeO2, corresponding to the ultraviolet region, is reduced obviously by C, N, S, Pr impurities and oxygen vacancies, shifting to the visible region and even further to the infrared range. Especially, N-, S- and Pr-doped CeO2 could be used to photocatalytic water splitting for hydrogen production. As the concentration of Ov increasing up to 5%, the CeO2 exhibits a half-metallic properties.

  13. Ce-MXRF: the power of separation with bench top element sensitive detection

    Energy Technology Data Exchange (ETDEWEB)

    Miller, T. C. (Thomasin C.); Joseph, M. R. (Martha R.); Havrilla, G. J. (George J.)

    2002-01-01

    Capillary electrophoresis (CE) is a proven separation technique that offers highly efficient separation, rapid analysis, and minute sample consumption. When combined with a element specific detection scheme, it can be used for chemical speciation of biologically and environmentally relevant species such as metal containing proteins. In this study, a new tool was developed for separation and elemental detection. Specifically, a simple CE apparatus was constructed using a thin-walled fused Si capillary and interfaced with a bench top micro x-ray fluorescence (MXRF) system. X-ray excitation and detection of the separated sample volumes was performed using an EDAX Eagle II micro x-ray fluorescence system equipped with a Rh target excitation source and a SiLi detector. It was demonstrated that the system could be used for the separation and detection of two metals from one another, specifically Cu{sup 2+} and Co{sup 2+}. Free Co{sup 2+} could also be isolated from Co{sup 2+} bound to cyanocobalamin (Vitamin B-12). Other systems that were explored were the separation of two organics, ferritin from cyanocobalamin as well as the separation of the different Cu and Zn isoforms of metallothinein. CE-MXRF was also used to separate the important serum isoforms of transferrin. Direct comparisons were made between CE-MXRF system and other elemental separation techniques such as CE-PIXE, CE-synchrotron-XRF, and CE-ICPMS.

  14. Effects of Surfactants on the Performance of CeO2 Humidity Sensor

    Directory of Open Access Journals (Sweden)

    Chunjie Wang

    2014-01-01

    Full Text Available Nanosized CeO2 powders were synthesized via hydrothermal method with different types of surfactants (polyethylene glycol (PEG, cetyltrimethylammonium bromide (CTAB, and sodium dodecylbenzenesulfonate (SDBS. X-ray diffraction, Raman spectroscopy, and transmission electron microscopy were utilized to characterize the phase structures and morphologies of the products. The sample with CTAB as surfactant (CeO2-C has the largest specific surface area and the smallest particle size among these three samples. The humidity sensor fabricated by CeO2-C shows higher performance than those used CeO2-P and CeO2-S. The impedance of the CeO2-C sensor decreases by about five orders of magnitude with relative humidity (RH changing from 15.7 to 95%. The response and recovery time are 7 and 7 s, respectively. These results indicate that the performance of CeO2 humidity sensors can be improved effectively by the addition of cationic surfactant.

  15. Co/CeO2 for ethanol steam reforming: effect of ceria morphology

    Institute of Scientific and Technical Information of China (English)

    WANG Hong; ZHANG Lijuan; LI Miao; LIU Yuan; BAI Xue

    2013-01-01

    Nanorods (NR) and nanoparticles (NP) of ceria were prepared by hydrothermal synthesis method and used as catalyst support to load cobalt for steam reforming of ethanol (SRE).The catalysts were characterized by using temperature programmed reduction,X-ray diffraction,transmission electron microscopy and thermal analysis techniques.CeO2 NP had relatively smaller particle size and larger surface area,and CeO2 NR could form more oxygen vacancies.For SRE reaction,Co/CeO2 NP was more active and exhibited a little better anti-sintering ability,while Co/CeO2 NR showed obviously better anti-carbon deposition ability.The larger surface area and higher dispersion of cobalt oxide resulted in the higher activity for Co/CeO2 NP catalyst.Meanwhile,the stronger interaction between cobalt species and ceria was attributed to the better anti-sintering ability for Co/CeO2 NP.The improvement of the anti-carbon deposition for Co/CeO2 NR was owing to the generation of oxygen vacancies from the ceria nanorods.

  16. Luminescence and scintillation properties of BaF2sbnd Ce transparent ceramic

    Science.gov (United States)

    Luo, Junming; Sahi, Sunil; Groza, Michael; Wang, Zhiqiang; Ma, Lun; Chen, Wei; Burger, Arnold; Kenarangui, Rasool; Sham, Tsun-Kong; Selim, Farida A.

    2016-08-01

    Cerium doped Barium Fluoride (BaF2sbnd Ce) transparent ceramic was fabricated and its luminescence and scintillation properties were studied. The photoluminescence shows the emission peaks at 310 nm and 323 nm and is related to the 5d-4f transitions in Ce3+ ion. Photo peak at 511 keV and 1274 keV were obtained with BaF2sbnd Ce transparent ceramic for Na-22 radioisotopes. Energy resolution of 13.5% at 662 keV is calculated for the BaF2sbnd Ce transparent ceramic. Light yield of 5100 photons/MeV was recorded for BaF2sbnd Ce(0.2%) ceramic and is comparable to its single crystal counterpart. Scintillation decay time measurements shows fast component of 58 ns and a relatively slow component of 434 ns under 662 keV gamma excitation. The slower component in BaF2sbnd Ce(0.2%) ceramic is about 200 ns faster than the STE emission in BaF2 host and is associated with the dipole-dipole energy transfer from the host matrix to Ce3+ luminescence center.

  17. Studies on Ca2+-Doped CeBr3 Scintillating Materials

    Energy Technology Data Exchange (ETDEWEB)

    Guss, P. [NSTec; Foster, M. E. [SNL; Wong, B. M. [SNL; Doty, F. P. [SNL; Shah, K. [RMD; Squillante, M. R. [RMD; Shirwadkar, U. [RMD; Hawrami, R. [RMD; Tower, J. [RMD; Yuan, D. [NSTec

    2013-09-01

    Despite the outstanding scintillation performance characteristics of cerium tribromide (CeBr3) and cerium-activated lanthanum tribromide (LaBr3:Ce), their commercial availability and application is limited due to the difficulties of growing large, crack-free single crystals from these fragile materials. The objective of this investigation was to employ aliovalent doping to increase crystal strength while maintaining the optical properties of the crystal. One divalent dopant (Ca2+) was investigated as a dopant to strengthen CeBr3 without negatively impacting scintillation performance. Ingots containing nominal concentrations of 1.9% of the Ca2+ dopant were grown. Preliminary scintillation measurements are presented for this aliovalently doped scintillator. Ca2+-doped CeBr3 exhibited little or no change in the peak fluorescence emission for 371 nm optical excitation for CeBr3. The structural, electronic, and optical properties of CeBr3 crystals were investigated using the density functional theory within generalized gradient approximation. The calculated lattice parameters are in good agreement with the experimental data. The energy band structures and density of states were obtained. The optical properties of CeBr3, including the dielectric function, were calculated.

  18. Studies on Ca2+-Doped CeBr3 Scintillating Materials

    Energy Technology Data Exchange (ETDEWEB)

    Guss, P. [NSTec; Foster, M. E. [SNL; Wong, B. M. [SNL; Doty, F. P. [SNL; Shah, K. [RMD; Squillante, M. [RMD; Glodo, J. [RMD; Yuan, D. [NSTec

    2013-07-03

    Despite the outstanding scintillation performance characteristics of cerium tribromide (CeBr3) and cerium-activated lanthanum tribromide (LaBr3:Ce), their commercial availability and application is limited due to the difficulties of growing large, crack-free single crystals from these fragile materials. The objective of this investigation was to employ aliovalent doping to increase crystal strength while maintaining the optical properties of the crystal. One divalent dopant (Ca2+) was investigated as a dopant to strengthen CeBr3 without negatively impacting scintillation performance. Ingots containing nominal concentrations of 1.9% of the Ca2+ dopant were grown. Preliminary scintillation measurements are presented for this aliovalently doped scintillator. Ca2+-doped CeBr3 exhibited little or no change in the peak fluorescence emission for 371 nm optical excitation for CeBr3. The structural, electronic, and optical properties of CeBr3 crystals were investigated using the density functional theory within generalized gradient approximation. The calculated lattice parameters are in good agreement with the experimental data. The energy band structures and density of states were obtained. The optical properties of CeBr3, including the dielectric function, were calculated.

  19. Imaging the atomic surface structures of CeO2 nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Yuyuan [Northwestern University, Evanston; Wu, Zili [ORNL; Wen, Jianguo [Argonne National Laboratory (ANL); Poeppelmeier, Kenneth R [Northwestern University, Evanston; Marks, Laurence D [Northwestern University, Evanston

    2014-01-01

    Atomic surface structures of CeO2 nanoparticles are under debate owing to the lack of clear experimental determination of the positions of the surface oxygen atoms. Particularly controversial is the (100) surface structure of this material. In this study, with oxygen atoms clearly observed using aberration corrected high resolution electron microscopy, we determined the atomic structures of the (100), (110) and (111) surfaces of CeO2 nanocubes. The predominantly exposed (100) surface has a mixture of Ce, O, and reduced CeO terminations, underscoring the complex structures of this polar surface that previously was often oversimplified. The (110) surface shows saw-like (111) nanofacets and flat CeO2-x terminations with oxygen vacancies. The (111) surface has an O termination. As these three low index surfaces are the most often exposed facets in the majority of CeO2 nanoparticles, these findings can be extended to the surfaces of differently shaped CeO2 nanoparticles as well as provide insight about face-selective catalysis.

  20. Role of vacancies, light elements and rare-earth metals doping in CeO2

    Science.gov (United States)

    Shi, H.; Hussain, T.; Ahuja, R.; Kang, T. W.; Luo, W.

    2016-01-01

    The magnetic properties and electronic structures of pure, doped and defective cerium oxide (CeO2) have been studied theoretically by means of ab initio calculations based on the density function theory (DFT) with the hybrid HF/DFT technique named PBE0. Carbon (C), nitrogen (N), phosphorus (P), sulphur (S), lanthanum (La) and praseodymium (Pr) doped in CeO2 and CeO2 containing oxygen vacancies (Ov) were considered. Our spin-polarized calculations show that C, N, Pr dopants and Ov defects magnetize the non-magnetic CeO2 in different degree. The optical band gap related to photocatalysis for pure CeO2, corresponding to the ultraviolet region, is reduced obviously by C, N, S, Pr impurities and oxygen vacancies, shifting to the visible region and even further to the infrared range. Especially, N-, S- and Pr-doped CeO2 could be used to photocatalytic water splitting for hydrogen production. As the concentration of Ov increasing up to 5%, the CeO2 exhibits a half-metallic properties. PMID:27554285

  1. Enhanced transport of CeO2 nanoparticles in porous media by macropores.

    Science.gov (United States)

    Fang, Jing; Wang, Min-hao; Lin, Dao-hui; Shen, Bing

    2016-02-01

    This is the first study to investigate the effect of macropores on the transport of CeO2 nanoparticles (nCeO2) in quartz sand and soil. The artificial macropore types are the vertical continuous macropore (O-O), and the vertical discontinuous macropore (O-C). The results indicated that the mobility of nCeO2 was significantly enhanced by the macropore in both quartz sand and soil, and the enhancement was greater in the continuous macropore than in the discontinuous macropore. Compared with the homogeneous column, both the O-O and O-C macropores in quartz sand favored an earlier breakthrough and a larger initial effluent recovery rate of nCeO2. However, there was little influence on the plateau concentration and the total effluent recovery rate. In soil, both types of macropores significantly shortened nCeO2 breakthrough time, and favored a higher plateau concentration, and a larger initial and total effluent recovery rate. The O-O macropore which accounted for only 1% of the total pore volume had doubly increased the total mobility of nCeO2 in soil; even the mobility was increased by 30% with the O-C macropore. It was found that the effect of preferential flow on nCeO2 transport was greater in soil than it was in quartz sand. PMID:26584072

  2. Cerium-Iron Magnetic Coupling in Single Crystal CeFeAsO at Low Temperatures

    Science.gov (United States)

    Zhang, Qiang; Tian, Wei; Li, H.-F.; Yan, J.-Q.; Lograsso, T. A.; McCallum, R. W.; Zarestky, J. L.; Vaknin, David; Kim, J. W.; Cao, H.

    2012-02-01

    Neutron and synchrotron resonant X-ray scattering techniques have been used to determine the intricate magnetic structure of single crystal CeFeAsO at low temperatures, way below the spin-density wave (SDW) transition around 130 K associated with Fe moments ordering. Our synchrotron X-ray scattering results at the Ce LII-edge clearly show a magnetic transition that is specific to the Ce ordering at TCe = 4 K, whereas neutron diffraction data indicate a transition at T* = 12 K with unusual order parameter. Detailed order parameter measurements on the (100) & (101) magnetic reflections by neutrons show an anomaly at T = 4 K which we associate with the Ce ordering. The successive transitions at TCe and T* can also be clearly identified by two anomalies in heat capacity measurements. We argue that the higher transition temperature observed in neutron measurements reflects Fe-Ce combined rearrangement prior to the complete ordering of the Ce. The effect of the weak Ce-Fe coupling on the rearrangement of Fe ordering is yet another example of the vulnerability of the Fe-SDW as influenced by minute doping or by relatively low applied pressures.

  3. On the luminescence properties of CaSO{sub 4}:Ce

    Energy Technology Data Exchange (ETDEWEB)

    Lapraz, D.; Prevost, H.; Iacconi, P.; Guigues, C.; Benabdesselam, M.; Briand, D

    2002-07-01

    The luminescent properties of cerium doped calcium sulphate are studied: fluorescence and excitation spectra, optical absorption and thermoluminescence (TSL). It is know that, in rare earth doped CaSO{sub 4}, only cerium induces a strong 400 deg. C TSL peak readout, as mentioned by Nair et al. In CaSO{sub 4}:0.2% Ce samples synthesised under oxidising conditions, the recovery step of Ce{sup 3+} fluorescence is correlated with the 400 deg. C TSL peak readout. Our results indicate that an oxidation of Ce{sup 3+} ion does occur under X-irradiation (Ce{sup 3+} R Ce{sup 4+}), followed by a complete return to the trivalent state after thermal annealing at about 500 deg. C; our results confirm the hypothesis of Nair et al that Ce{sup 3+} ions are oxidised by ionising irradiation. So, a pure redox reaction seems the most probable for the 400 deg. C TSL peak of CaSO{sub 4}:Ce. Moreover, the use of the 400 deg. C TSL peak for high temperature dosimetry applications is discussed. (author)

  4. Interaction behavior between binary xCe-yNd alloy and HT9

    Science.gov (United States)

    Kim, Jun Hwan; Cheon, Jin Sik; Lee, Byoung Oon; Kim, June Hyung

    2016-10-01

    Studies were carried out to investigate the role of Ce and Nd, contained inside metal fuel during reactor operation, and their effect on the Fuel-Cladding Chemical Interaction (FCCI) phenomenon, which limits fuel performance in the Sodium-cooled Fast Reactor (SFR). Binary model alloys of xCe-yNd were manufactured, and then diffusion couple tests with HT9 (12Cr-1MoWV) ferritic-martensitic cladding material were carried out at a temperature of 660 °C for up to 25 h. The results showed that both Ce and Nd reacted with Fe in the cladding material to form an interaction layer. Analysis of the microstructure and reaction kinetics revealed that Fe in the cladding material rapidly migrates into Ce to form eutectic reaction, leaving a Fe depleted zone, in which Ce substitutes. In the case of Nd element, a typical solid-solid diffusion process governed to form a Fe17Nd2 type intermetallic compound. Synergism between Ce and Nd occurred so that the reaction thickness was increased, reaching the maximum reaction thickness in the case of the xCe-yNd alloy, whose composition was nearly 1:1.

  5. Nanostructured Ce{sub x}Zn{sub 1−x}O thin films: Influence of Ce doping on the structural, optical and electrical properties

    Energy Technology Data Exchange (ETDEWEB)

    Mariappan, R., E-mail: marijpr@gmail.com [Department of Physics, Sri Ramakrishna Mission Vidyalaya College of Arts and Science, Coimbatore 641 020, Tamil Nadu (India); Department of Physics, Adhiyamaan College of Engineering, Hosur 635 109, Tamil Nadu (India); Ponnuswamy, V. [Department of Physics, Sri Ramakrishna Mission Vidyalaya College of Arts and Science, Coimbatore 641 020, Tamil Nadu (India); Suresh, P. [Materials Research Centre, Indian Institute of Science, Bangalore 560 012 (India); Suresh, R. [Department of Physics, Sri Ramakrishna Mission Vidyalaya College of Arts and Science, Coimbatore 641 020, Tamil Nadu (India); Ragavendar, M. [Department of Physics, KPR Institute of Engineering and Technology, Coimbatore 641 407, Tamil Nadu (India); Chandra Bose, A. [Department of Physics, National Institute of Technology, Tiruchirappalli 620 015, Tamil Nadu (India)

    2014-03-05

    Highlights: • Thin films of Ce doped ZnO were prepared by nebulizer spray pyrolysis technique. • Films were deposited at different cerium concentrations 2.5%, 5.0%, 7.5% and 10%. • Ce doped ZnO films are found to have more grains along [0 0 2] direction. • The band gap energy was found to be decreased with the increase of Ce doping. • Ce{sub x}Zn{sub 1−x}O films ensure their stability and suitability for gas sensors. -- Abstract: Thin films of Ce{sub x}Zn{sub 1−x}O thin films were deposited on glass substrates at 400 °C by nebulizer spray pyrolysis technique. Ce doping concentration (x) was varied from 0 to 10%, in steps of 2.5%. X-ray diffraction reveals that all the films have polycrystalline nature with hexagonal crystal structure and high preferential orientation along (0 0 2) plane. Optical parameters such as; transmittance, band gap energy, refractive index (n), extinction coefficient (k), complex dielectric constants (ε{sub r}, ε{sub i}) and optical conductivity (σ{sup r}, σ{sup i}) have been determined and discussed with respect to Ce concentration. All the films exhibit transmittance above 80% in the wavelength range from 330 to 2500 nm. Optical transmission measurements indicate the decrease of direct band gap energy from 3.26 to 3.12 eV with the increase of Ce concentration. Photoluminescence spectra show strong near band edge emission centered ∼398 nm and green emission centered ∼528 nm with excitation wavelength ∼350 nm. High resolution scanning electron micrographs indicate the formation of vertical nano-rod like structures on the film surface with average diameter ∼41 nm. Electrical properties of the Ce doped ZnO film have been studied using ac impedance spectroscopy in the frequency range from 100 Hz–1 MHz at different temperatures.

  6. Precise timing resolution measurements of GSO scintillators with different Ce concentrations combined with silicon photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Okumura, Satoshi, E-mail: okumura.satoshi@c.mbox.nagoya-u.ac.jp [Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine, Nagoya (Japan); Yamamoto, Seiichi [Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine, Nagoya (Japan); Yeol Yeom, Jung [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of); Shimura, Naoaki; Ishibashi, Hiroyuki [Hitachi Chemical, Ibaraki (Japan)

    2015-10-11

    Ce doped Gd{sub 2}SiO{sub 5} (GSO) is a scintillator which has relatively fast decay time, high density, high light output, and is used for commercial PET systems. However as time-of-flight (TOF) PET systems become more popular in clinical diagnostic, GSO seems less attractive, because its performance is thought to be insufficient for use in TOF-PET application. Although the timing resolution of the GSO combined with photomultiplier tube (PMT) is known to be inappropriate for TOF-PET system, the performance of GSO coupled to silicon photomultipliers (Si-PM) has not been reported to date. In addition, GSO possesses a variety of decay times depending on its Ce concentration. We measured basic performance of GSOs with different Ce concentrations and then coupled them to Si-PMs to measure the precise timing resolution using a high bandwidth digital oscilloscope. The decay time of GSO with 0.4 mol% Ce were longer (63±4 ns) compared with those with 1.0 mol% (40±2 ns) and 1.5 mol% (33±1 ns). With a Si-PM, the photo-peak channels were almost the same for GSOs with 0.4 mol% Ce and those with 1.5 mol% Ce, but the GSO with 1.0 mol% Ce was ~25% higher. Energy resolutions of these three GSOs were ~13% full-width at half-maximum (FWHM) for 662 keV gamma photons without correcting for saturation effects. When coupled to Si-PMs, the timing resolution for GSO with 1.5 mol% Ce (decay time 33 ns) was 549 ps FWHM, almost good enough to use for TOF-PET system. The combination of GSO with 1.5 mol% Ce with Si-PM will be an interesting combination to realize low cost TOF-PET systems.

  7. Characterizations of electrodeposited Ni–CeO{sub 2} nanocomposite coatings

    Energy Technology Data Exchange (ETDEWEB)

    Kasturibai, S., E-mail: s.kasturibai@yahoo.co.in [Department of Chemistry, Alagappa Government Arts College, Karaikudi 630 003, Tamilnadu (India); Advanced Nanocomposite Coatings Laboratory, Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamilnadu (India); Kalaignan, G. Paruthimal, E-mail: pkalaignan@yahoo.com [Advanced Nanocomposite Coatings Laboratory, Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamilnadu (India)

    2014-10-15

    The expansion of current machinery requires metallic materials with better surface properties. In the present investigation, CeO{sub 2} reinforced nickel nanocomposite coatings were deposited on mild steel substrate by direct current electrodeposition process employing nickel acetate bath. The effect of incorporation of CeO{sub 2} particles in the Ni nanocomposite coatings on the micro hardness and corrosion behaviour has been evaluated. Smooth and compact nanocomposite deposits containing well-distributed cerium oxide particles were obtained. The crystallite structure was fcc for electrodeposited nickel and Ni–CeO{sub 2} nanocomposite coatings. It has been observed that, the presence of CeO{sub 2} nanoparticles favours the [111] and [200] texture of nickel matrix. The co-deposition of CeO{sub 2} nanoparticles with nickel was found to be favoured at applied current density of 8 A dm{sup −2}. The micro hardness values of the nickel nanocomposite coatings (725 HV) was higher than that of pure nickel (265 HV).The decrease in I{sub corr} values and increase in Constant Phase Element values were investigated in 3.5% NaCl solution which showed the higher corrosion resistant nature of Ni–CeO{sub 2} coatings. - Highlights: • Ni–CeO{sub 2} composite coatings have electrodeposited from eco-friendly acetate bath. • Inclusion of CeO{sub 2} in the composite coating has refined the crystallite size. • Micro hardness values have increased with CeO{sub 2} content in the composite coatings. • The negative shift of E{sub corr} confirming cathodic protective nature of coatings.

  8. Intermediate Ce{sup 3+} defect level induced photoluminescence and third-order nonlinear optical effects in TiO{sub 2}-CeO{sub 2} nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Divya, S.; Nampoori, V.P.N.; Radhakrishnan, P.; Mujeeb, A. [Cochin University of Science and Technology, International School of Photonics, Cochin, Kerala (India)

    2014-02-15

    We report on the linear and nonlinear optical studies of TiO{sub 2}-CeO{sub 2} nanocomposites. It was found that the band gap of the nanocomposite can be tuned by varying Ce/Ti content. Nonlinear absorption characteristics of these samples were studied by employing open aperture Z-scan technique using an Nd:YAG laser (532 nm, 7 ns, 10 Hz). It has been observed that as the CeO{sub 2} amount increases, band gap of the nanocomposites decreases and the reason proposed for the change in band gap is the smudging of localised states of Ce{sup 3+} into the forbidden energy gap, thus acting as the intermediate state. Fluorescence studies confirmed the above argument. Nonlinear investigation revealed that with increase in the CeO{sub 2} amount, the two-photon absorption coefficient increased due to the modification of TiO{sub 2} dipole symmetry. Suitable candidature of the nanocomposites for the fabrication of nonlinear optical devices was proved by determining the optical limiting threshold. (orig.)

  9. Theoretical study on Ce-N codoped anatase titanium dioxide%Ce-N共掺杂锐钛矿型二氧化钛的理论研究

    Institute of Scientific and Technical Information of China (English)

    魏志钢; 陈世荣; 文梦葵; 潘湛昌; 钟雪春; 徐艳阳

    2011-01-01

    [目的]研究Ce-N共掺杂对锐钛矿TiO2晶体可见光区催化活性的影响.[方法]采用基于密度泛函理论(DFT)框架下的第一性原理平面波赝势(PWPP)方法,研究掺杂对锐钛矿TiO2晶体的晶体结构、能带、态密度的改变,推断Ce-N共掺杂对锐钛矿TiO2晶体可见光区催化活性的影响.[结果]Ce-N共掺杂TiO2后,晶体的对称性和点群没有改变.通过对比纯TiO2,N掺杂TiO2,Ce掺杂TiO2和Ce-N共掺杂TiO2的能带和态密度可以得出:纯TiO2的能隙较宽,价带顶主要为O-2p轨道的贡献,导带底主要为Ti-3d轨道的贡献;N掺杂后,由于N-2p轨道的作用会使导带底向低能端移动,价带顶向高能端移动;Ce掺杂后,由于Ce-4f轨道进入导带,会使导带底向低能端移动:Ce-N共掺杂后,由于N和Ce的共同作用,使导带底向低能端移动,价带顶向高能端移动,同时Ce-4f轨道进入导带底,从而使禁带宽度进一步变小,会拓展该晶体的可见光响应范围.这一结果与我们在实验中获得的紫外-可见光谱相一致.[结论]通过我们的计算和实验,说明Ce-N共掺杂可以改善和提高Ti02在可见光区的活性,这种材料具有很好的应用前景,值得做进一步的实验研究.%[objective] To investigate the optical catalytic property of Ce-N codoped TiO2 crystal. [method] Using density function theory (DFT), the geometry, the band structure and the electronic density of states of pure TiO2, N doped TiO2, Ce doped TiO2 and Ce-N codeped TiO2 were calculated at plane wave ultra-soft pseudo-Potential level (PWPP). Based on the calculated results, the optical catalytic properties of them can be predicted and compared. [result] It shows that the symmetry of Ce-N codoped anatase TiO2 maintains the same as pure TiO2's, while the lattice parameters a and c become larger. For pure TiO2, the top of the value bands mainly involves O-2p electrons and the bottom of conduction bands contains Ti-3d electrons.For N doped TiO2, the

  10. Effect of substitution of Ce on superconducting properties of Bi1.7Pb0.3Sr2Ca2-CeCu3O10+ system

    Indian Academy of Sciences (India)

    R R Kothawale; B N Dole; S S Shah

    2002-05-01

    We have investigated the superconducting properties of the Bi1.7Pb0.3Sr2Ca2-CeCu3O10+ system with = 0.00, 0.02, 0.04, 0.08 and 0.1 by X-ray diffraction and magnetic susceptibility. The substitution of Ce for Ca has been found to drastically change the superconducting properties of the system. X-ray diffraction studies on these compounds indicate decrease in the -parameter with increased substitution of Ce at Ca site and volume fraction of high c(2 : 2 : 2 : 3) phase decreases and low c phase increases. The magnetic susceptibility of this compound shows that the diamagnetic on set superconducting transition temperature (onset) varies from 109 K to 51 K for =0.00, 0.02, 0.04, 0.08 and 0.1. These results suggest the possible existence of Ce in a tetravalent state rather than a trivalent state in this system; that is, Ca2+ → Ce4+ replacement changes the hole carrier concentration. Hole filling is the cause of lowering c of the system.

  11. Photoluminescent properties of Sr2CeO4 : Eu3+ and Sr2CeO4 : Eu2+ phosphors suitable for near ultraviolet excitation

    Indian Academy of Sciences (India)

    K Suresh; N V Poornachandra Rao; K V R Murthy

    2014-10-01

    Powder phosphors of 1 mol% Eu3+- and Eu2+-doped strontium cerium oxide (Sr2CeO4) were synthesized by standard solid-state reaction method. Eu3+- and Eu2+-doped Sr2CeO4 phosphors fired at 1100 °C for 2 h were analysed by X-ray diffraction (XRD) and photoluminescence (PL) techniques. The XRD patterns confirm that the obtained phosphors are a single phase of Sr2CeO4 composed of orthorhombic structure. Room temperature PL excitation spectrum of air-heated Sr2CeO4 : Eu phosphor has exhibited bands at 260, 280 and 350 nm. Whereas the excitation spectrum of Sr2CeO4 : Eu phosphor heated under reducing (carbon) atmosphere exhibited single broadband range from 260 to 390 nm. The (PL) emission peaks of both the phosphors at 467 (blue), 537 (green) and 616 nm (red) generate white light under 260, 280 and 350 nm excitation wavelengths. The Commission International de l’Eclairage (CIE) colour coordinates conforms that these phosphors emitting white light. The results reveal that these phosphors are multifunctional phosphors which emit white light under these excitations that they could be used as white components for display and lamp devices and as well as possible good light-conversion phosphor LEDs under near-ultraviolet (nUV) chip.

  12. CORANTES ARTIFICIAIS EM ALIMENTOS

    OpenAIRE

    Prado, Marcelo Alexandre; Helena Teixeira GODOY

    2009-01-01

    O emprego de aditivos químicos é, sem dúvida, um dos mais polêmicos avanços alcançados pela indústria de alimentos. Os corantes artificiais pertencem a uma dessas classes de aditivos alimentares e têm sido objeto de muitas críticas, já que seu uso em muitos alimentos justifica-se apenas por questões de hábitos alimentares. Ainda existem diferentes opiniões quanto à inocuidade dos diversos corantes artificiais. Visando, principalmente, o controle no uso dos corantes si...

  13. A guerra em Pessoa

    OpenAIRE

    Frias, Joana Matos

    2014-01-01

    Leitura e comentário crítico do poema "Os jogadores de xadrez", do heterónimo pessoano Ricardo Reis, com vista a uma proposta de sistematização da natureza da relação que o poeta manteve com os eventos em curso nos anos decisivos da sua formação e consolidação artísticas e literárias. Reading and critical review of the poem "The chess players", by Fernando Pessoaapos;s heteronym Ricardo Reis, aiming to propose a systematization of the kind of relationship the poet has maintained with the o...

  14. Envolvimento parental em creche

    OpenAIRE

    Oliveira, Marta Isabel da Silva e

    2014-01-01

    Dissertação de mestrado em Educação de Infância A família e a creche são os dois primeiros ambientes sociais que proporcionam à criança estímulos e condutas, sendo, consequentemente, instituições fundamentais no seu crescimento. É importante promover uma boa comunicação entre a creche e os pais, incentivando-os a participarem na educação dos seus filhos, demonstrando o quanto é importante para as crianças este seu envolvimento. Cabe, também, aos educadores/profissionais criar c...

  15. CRIPTOCOCOSE EM GATOS

    OpenAIRE

    Gilson Luiz Borges Corrêa

    1994-01-01

    RESUMO A criptococose é uma enfermidade micótica, causada pela levedura denominada Cryptococcus neoformans, que tem distribuição cosmopolita. O agente etiológico já foi isolado de diversos materiais, incluindo: frutas, amostras de solo, fezes de aves principalmente de pombos. Apesar de ser encontrado como saprófita na natureza, o Cryptococcus neoformans pode produzir doença no homem e várias espécies de animais domésticos ou silvestres. Em gatos, essa levedura pode ser encontrada provocando i...

  16. Burnout em Cuidadores Formais

    OpenAIRE

    Silva, Juliana Marisa Fernandes

    2016-01-01

    Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Este estudo é sobre a Síndrome de Burnout e teve como objetivo geral compreender se o Burnout está presente nos cuidadores formais da Santa Casa da Misericórdia de Castelo de Paiva e quais as variáveis socioprofissionais que poderão exercer influência no seu aparecimento. Pretendeu-se avaliar o Burnout dos cuidadores a tr...

  17. Frenectomia em foco

    OpenAIRE

    Vieira, Joana Isabel Monteiro de Paiva

    2012-01-01

    O freio é uma estrutura anatómica oral classificada em freio labial (médio maxilar ou mandibular, lateral maxilar ou mandibular) ou lingual que se pode tornar num problema quando a sua inserção cria impedimentos estruturais e dificuldades a vários níveis. Um freio labial anormal pode causar algumas anomalias ou problemas, tais como um diastema interincisal, problemas protéticos, doença periodontal relacionada com a retenção de alimentos, dificuldades na higiene oral e na mobilidade labial. Na...

  18. Perspectives on EM metamaterials

    Directory of Open Access Journals (Sweden)

    Christophe Caloz

    2009-03-01

    Full Text Available Electromagnetic (EM metamaterials have become a field of intense research activities. This paper presents a critical perspective of the field, with emphasis on fundamental concepts and practical applications. Metamaterials are explained in the general context of periodic structures. Resonant particle type and transmission line type metamaterials are compared, and their fundamental connection is established. Exotic phenomena recently reported and associated challenges are briefly reviewed. Practical applications are enumerated and illustrated by an example. The paper concludes with an optimistic outlook regarding the future of metamaterials.

  19. Ce que la mixité fait aux élèves

    OpenAIRE

    Duru-Bellat, Marie

    1994-01-01

    L’article présente une synthèse de ce que dévoile la recherche en éducation sur le fonctionnement des classes mixtes, et sur ce que ce mode de fonctionnement doit à la mixité en tant que telle. Il mobilise les travaux centrés sur les interactions entre enseignants et élèves, entre élèves, ainsi que ceux, plus rares, qui comparent le fonctionnement des classes mixtes et non mixtes. Il en interroge ensuite les incidences sur les attitudes et les comportements des garçons et des filles, en mobil...

  20. Magnetic properties of the layered oxypnictides (LnOMnAs (Ln = La, Ce, Pr, Nd

    Directory of Open Access Journals (Sweden)

    Morosawa Y.

    2014-07-01

    Full Text Available We have investigated the rare earth elements dependence on the magnetism to understand the contribution to physical properties of the 4f electrons of (LnOMnAs (Pn = La, Ce, Pr, Nd. (CeOMnAs, (PrOMnAs and (NdOMnAs shows the antiferromagnetic behaviors at low temperature. (CeOMnAs and (NdOMnAs have the magnetic anomalies around 34 K and 24 K, respectively. So, it is speculated that the anomalies depend on the Mn -Mn distance directly