National Oceanic and Atmospheric Administration, Department of Commerce — The Cross-Calibrated Multi-Platform (CCMP) Ocean Surface Wind Vector Analyses (Atlas et al., 2011) provide a consistent, gap-free long-term time-series of monthly...
Distinct Signaling Roles of cIMP, cCMP, and cUMP.
Seifert, Roland
2016-10-04
The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.
2012-11-15
development of such an algal model system for basic discovery, we sequenced the genome and two sets of transcriptomes of N. oceanica CCMP1779, assembled...CCMP1779 has a gene encoding a highly conserved violax- anthin de-epoxidase ( VDE ) protein like that found in plants (Table S9). In Arabidopsis, VDE is...HLA3 or LCI1 were present. This result suggests that CCMP1779 might have a plastid Ci transport system similar to that of Chlamydomonas, but a distinct
Response of the Water Cycle of West Africa and Atlantic to Radiative Forcing by Saharan Dust
Lau, K. M.; Kim, Kyu-Myong; Sud, Yogesh C.; Walker, Gregory L.
2010-01-01
The responses of the atmospheric water cycle and climate of West Africa and the Atlantic to radiative forcing of Saharan dust are studied using the NASA finite volume general circulation model (fvGCM), coupled to a mixed layer ocean. We find evidence in support of the "elevated heat pump" (EHP) mechanism that underlines the responses of the atmospheric water cycle to dust forcing as follow. During the boreal summer, as a result of large-scale atmospheric feed back triggered by absorbing dust aerosols, rainfall and cloudiness are enhanced over the West Africa/Easter Atlantic ITCZ, and suppressed over the West Atlantic and Caribbean. region. Shortwave radiation absorption by dust warms the atmosphere and cools the surface, while long wave has the opposite response. The elevated dust layer warms the air over Nest Africa and the eastern Atlantic. The condensation heating associated with the induced deep convection drives and maintains an anomalous large-scale east-west overturning circulation with rising motion over West Africa/eastern Atlantic, and sinking motion over the Caribbean region. The response also includes a strengthening of the West African monsoon, manifested in northward shift of the West Africa precipitation over land, increased low-level westerlies flow over West Africa at the southern edge of the dust layer, and a near surface energy fluxes, resulting in cooling of the Nest African land and the eastern Atlantic, and a warming in the West Atlantic and Caribbean. The EHP effect is most effective for moderate to highly absorbing dusts, and becomes minimized for reflecting dust with single scattering albedo at 0.95 or higher.
Organic complexation of iron in the West Atlantic Ocean
Gerringa, L.J.A.; Rijkenberg, M.J.; Schoemann, V.; Laan, P.; de Baar, H.J.W.
2015-01-01
The characteristics of the dissolved iron (DFe) binding organic ligands were determined during 3 Dutch GEOTRACES cruises covering the length of the West Atlantic Ocean. Adsorptive Differential Pulse Cathodic Stripping Voltammetry (AdDPCSV) with TAC as competing ligand was used to measure Fe binding
Lau, K. M.; Kim, K. M.; Sud, Y. C.; Walker, G. K.
2009-01-01
The responses of the atmospheric water cycle and climate of West Africa and the Atlantic to radiative forcing of Saharan dust are studied using the NASA finite volume general circulation model (fvGCM), coupled to a mixed layer ocean. We find evidence of an "elevated heat pump" (EHP) mechanism that underlines the responses of the atmospheric water cycle to dust forcing as follow. During the boreal summerr, as a result of large-scale atmospheric feedback triggered by absorbing dust aerosols, rainfall and cloudiness are ehanIed over the West Africa/Eastern Atlantic ITCZ, and suppressed over the West Atlantic and Caribbean region. Shortwave radiation absorption by dust warms the atmosphere and cools the surface, while longwave has the opposite response. The elevated dust layer warms the air over West Africa and the eastern Atlantic. As the warm air rises, it spawns a large-scale onshore flow carrying the moist air from the eastern Atlantic and the Gulf of Guinea. The onshore flow in turn enhances the deep convection over West Africa land, and the eastern Atlantic. The condensation heating associated with the ensuing deep convection drives and maintains an anomalous large-scale east-west overturning circulation with rising motion over West Africa/eastern Atlantic, and sinking motion over the Caribbean region. The response also includes a strengthening of the West African monsoon, manifested in a northward shift of the West Africa precipitation over land, increased low-level westerlies flow over West Africa at the southern edge of the dust layer, and a near surface westerly jet underneath the dust layer overr the Sahara. The dust radiative forcing also leads to significant changes in surface energy fluxes, resulting in cooling of the West African land and the eastern Atlantic, and warming in the West Atlantic and Caribbean. The EHP effect is most effective for moderate to highly absorbing dusts, and becomes minimized for reflecting dust with single scattering albedo at0
Somatic growth dynamics of West Atlantic hawksbill sea turtles: a spatio-temporal perspective
Bjorndal, Karen A.; Chaloupka, Milani; Saba, Vincent S.; Diez, Carlos E.; van Dam, Robert P.; Krueger, Barry H.; Horrocks, Julia A.; Santos, Armando J.B.; Bellini, Cláudio; Marcovaldi, Maria A.G.; Nava, Mabel; Willis, Sue; Godley, Brendan J.; Gore, Shannon; Hawkes, Lucy A.; McGowan, Andrew; Witt, Matthew J.; Stringell, Thomas B.; Sanghera, Amdeep; Richardson, Peter B.; Broderick, Annette C.; Phillips, Quinton; Calosso, Marta C.; Claydon, John A.B.; Blumenthal, Janice; Moncada, Felix; Nodarse, Gonzalo; Medina, Yosvani; Dunbar, Stephen G.; Wood, Lawrence D.; Lagueux, Cynthia J.; Campbell, Cathi L.; Meylan, Anne B.; Meylan, Peter A.; Burns Perez, Virginia R.; Coleman, Robin A.; Strindberg, Samantha; Guzmán-H, Vicente; Hart, Kristen M.; Cherkiss, Michael S.; Hillis-Starr, Zandy; Lundgren, Ian; Boulon, Ralf H.; Connett, Stephen; Outerbridge, Mark E.; Bolten, Alan B.
2016-01-01
Somatic growth dynamics are an integrated response to environmental conditions. Hawksbill sea turtles (Eretmochelys imbricata) are long-lived, major consumers in coral reef habitats that move over broad geographic areas (hundreds to thousands of kilometers). We evaluated spatio-temporal effects on hawksbill growth dynamics over a 33-yr period and 24 study sites throughout the West Atlantic and explored relationships between growth dynamics and climate indices. We compiled the largest ever data set on somatic growth rates for hawksbills – 3541 growth increments from 1980 to 2013. Using generalized additive mixed model analyses, we evaluated 10 covariates, including spatial and temporal variation, that could affect growth rates. Growth rates throughout the region responded similarly over space and time. The lack of a spatial effect or spatio-temporal interaction and the very strong temporal effect reveal that growth rates in West Atlantic hawksbills are likely driven by region-wide forces. Between 1997 and 2013, mean growth rates declined significantly and steadily by 18%. Regional climate indices have significant relationships with annual growth rates with 0- or 1-yr lags: positive with the Multivariate El Niño Southern Oscillation Index (correlation = 0.99) and negative with Caribbean sea surface temperature (correlation = −0.85). Declines in growth rates between 1997 and 2013 throughout the West Atlantic most likely resulted from warming waters through indirect negative effects on foraging resources of hawksbills. These climatic influences are complex. With increasing temperatures, trajectories of decline of coral cover and availability in reef habitats of major prey species of hawksbills are not parallel. Knowledge of how choice of foraging habitats, prey selection, and prey abundance are affected by warming water temperatures is needed to understand how climate change will affect productivity of consumers that live in association with coral reefs. Main
West Nile virus in overwintering mosquitoes, central Europe
Czech Academy of Sciences Publication Activity Database
Rudolf, Ivo; Betášová, Lenka; Blažejová, Hana; Venclíková, Kristýna; Straková, Petra; Šebesta, Oldřich; Mendel, Jan; Bakonyi, T.; Schaffner, F.; Nowotny, N.; Hubálek, Zdeněk
2017-01-01
Roč. 10, č. 452 (2017), č. článku 452. ISSN 1756-3305 R&D Projects: GA ČR(CZ) GA16-20054S EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : West Nile fever * West Nile virus * Flavivirus * Hibernation * Overwintering * Culex pipiens * Anopheles maculipennis * Culiseta annulata * Czech Republic Subject RIV: EE - Microbiology, Virology OBOR OECD: Parasitology Impact factor: 3.080, year: 2016
Ecological regime shift drives declining growth rates of sea turtles throughout the West Atlantic
Bjorndal, Karen A.; Bolten, Alan B.; Chaloupka, Milani; Saba, Vincent S.; Bellini, Cláudio; Marcovaldi, Maria A.G.; Santos, Armando J.B.; Bortolon, Luis Felipe Wurdig; Meylan, Anne B.; Meylan, Peter A.; Gray, Jennifer; Hardy, Robert; Brost, Beth; Bresette, Michael; Gorham, Jonathan C.; Connett, Stephen; Crouchley, Barbara Van Sciver; Dawson, Mike; Hayes, Deborah; Diez, Carlos E.; van Dam, Robert P.; Willis, Sue; Nava, Mabel; Hart, Kristen M.; Cherkiss, Michael S.; Crowder, Andrew; Pollock, Clayton; Hillis-Starr, Zandy; Muñoz Tenería, Fernando A.; Herrera-Pavón, Roberto; Labrada-Martagón, Vanessa; Lorences, Armando; Negrete-Philippe, Ana; Lamont, Margaret M.; Foley, Allen M.; Bailey, Rhonda; Carthy, Raymond R.; Scarpino, Russell; McMichael, Erin; Provancha, Jane A.; Brooks, Annabelle; Jardim, Adriana; López-Mendilaharsu, Milagros; González-Paredes, Daniel; Estrades, Andrés; Fallabrino, Alejandro; Martínez-Souza, Gustavo; Vélez-Rubio, Gabriela M.; Boulon, Ralf H.; Collazo, Jaime; Wershoven, Robert; Hernández, Vicente Guzmán; Stringell, Thomas B.; Sanghera, Amdeep; Richardson, Peter B.; Broderick, Annette C.; Phillips, Quinton; Calosso, Marta C.; Claydon, John A.B.; Metz, Tasha L.; Gordon, Amanda L.; Landry, Andre M.; Shaver, Donna J.; Blumenthal, Janice; Collyer, Lucy; Godley, Brendan J.; McGowan, Andrew; Witt, Matthew J.; Campbell, Cathi L.; Lagueux, Cynthia J.; Bethel, Thomas L.; Kenyon, Lory
2017-01-01
Somatic growth is an integrated, individual-based response to environmental conditions, especially in ectotherms. Growth dynamics of large, mobile animals are particularly useful as bio-indicators of environmental change at regional scales. We assembled growth rate data from throughout the West Atlantic for green turtles, Chelonia mydas, which are long-lived, highly migratory, primarily herbivorous mega-consumers that may migrate over hundreds to thousands of kilometers. Our dataset, the largest ever compiled for sea turtles, has 9690 growth increments from 30 sites from Bermuda to Uruguay from 1973 to 2015. Using generalized additive mixed models, we evaluated covariates that could affect growth rates; body size, diet, and year have significant effects on growth. Growth increases in early years until 1999, then declines by 26% to 2015. The temporal (year) effect is of particular interest because two carnivorous species of sea turtles – hawksbills, Eretmochelys imbricata, and loggerheads, Caretta caretta – exhibited similar significant declines in growth rates starting in 1997 in the West Atlantic, based on previous studies. These synchronous declines in productivity among three sea turtle species across a trophic spectrum provide strong evidence that an ecological regime shift (ERS) in the Atlantic is driving growth dynamics. The ERS resulted from a synergy of the 1997/1998 El Niño Southern Oscillation (ENSO) – the strongest on record – combined with an unprecedented warming rate over the last two to three decades. Further support is provided by the strong correlations between annualized mean growth rates of green turtles and both sea surface temperatures (SST) in the West Atlantic for years of declining growth rates (r = -0.94) and the Multivariate ENSO Index (MEI) for all years (r = 0.74). Granger-causality analysis also supports the latter finding. We discuss multiple stressors that could reinforce and prolong the effect of the ERS. This study
Ecological regime shift drives declining growth rates of sea turtles throughout the West Atlantic.
Bjorndal, Karen A; Bolten, Alan B; Chaloupka, Milani; Saba, Vincent S; Bellini, Cláudio; Marcovaldi, Maria A G; Santos, Armando J B; Bortolon, Luis Felipe Wurdig; Meylan, Anne B; Meylan, Peter A; Gray, Jennifer; Hardy, Robert; Brost, Beth; Bresette, Michael; Gorham, Jonathan C; Connett, Stephen; Crouchley, Barbara Van Sciver; Dawson, Mike; Hayes, Deborah; Diez, Carlos E; van Dam, Robert P; Willis, Sue; Nava, Mabel; Hart, Kristen M; Cherkiss, Michael S; Crowder, Andrew G; Pollock, Clayton; Hillis-Starr, Zandy; Muñoz Tenería, Fernando A; Herrera-Pavón, Roberto; Labrada-Martagón, Vanessa; Lorences, Armando; Negrete-Philippe, Ana; Lamont, Margaret M; Foley, Allen M; Bailey, Rhonda; Carthy, Raymond R; Scarpino, Russell; McMichael, Erin; Provancha, Jane A; Brooks, Annabelle; Jardim, Adriana; López-Mendilaharsu, Milagros; González-Paredes, Daniel; Estrades, Andrés; Fallabrino, Alejandro; Martínez-Souza, Gustavo; Vélez-Rubio, Gabriela M; Boulon, Ralf H; Collazo, Jaime A; Wershoven, Robert; Guzmán Hernández, Vicente; Stringell, Thomas B; Sanghera, Amdeep; Richardson, Peter B; Broderick, Annette C; Phillips, Quinton; Calosso, Marta; Claydon, John A B; Metz, Tasha L; Gordon, Amanda L; Landry, Andre M; Shaver, Donna J; Blumenthal, Janice; Collyer, Lucy; Godley, Brendan J; McGowan, Andrew; Witt, Matthew J; Campbell, Cathi L; Lagueux, Cynthia J; Bethel, Thomas L; Kenyon, Lory
2017-11-01
Somatic growth is an integrated, individual-based response to environmental conditions, especially in ectotherms. Growth dynamics of large, mobile animals are particularly useful as bio-indicators of environmental change at regional scales. We assembled growth rate data from throughout the West Atlantic for green turtles, Chelonia mydas, which are long-lived, highly migratory, primarily herbivorous mega-consumers that may migrate over hundreds to thousands of kilometers. Our dataset, the largest ever compiled for sea turtles, has 9690 growth increments from 30 sites from Bermuda to Uruguay from 1973 to 2015. Using generalized additive mixed models, we evaluated covariates that could affect growth rates; body size, diet, and year have significant effects on growth. Growth increases in early years until 1999, then declines by 26% to 2015. The temporal (year) effect is of particular interest because two carnivorous species of sea turtles-hawksbills, Eretmochelys imbricata, and loggerheads, Caretta caretta-exhibited similar significant declines in growth rates starting in 1997 in the West Atlantic, based on previous studies. These synchronous declines in productivity among three sea turtle species across a trophic spectrum provide strong evidence that an ecological regime shift (ERS) in the Atlantic is driving growth dynamics. The ERS resulted from a synergy of the 1997/1998 El Niño Southern Oscillation (ENSO)-the strongest on record-combined with an unprecedented warming rate over the last two to three decades. Further support is provided by the strong correlations between annualized mean growth rates of green turtles and both sea surface temperatures (SST) in the West Atlantic for years of declining growth rates (r = -.94) and the Multivariate ENSO Index (MEI) for all years (r = .74). Granger-causality analysis also supports the latter finding. We discuss multiple stressors that could reinforce and prolong the effect of the ERS. This study demonstrates the
Lim, Young-Kwon
2014-01-01
Large-scale winter teleconnection of the East Atlantic - West Russia (EA-WR) over the Atlantic and surrounding regions is examined in order to quantify its impacts on temperature and precipitation and identify the physical mechanisms responsible for its existence. A rotated empirical orthogonal function (REOF) analysis of the upper-tropospheric monthly height field captures successfully the EA-WR pattern and its interannual variation, with the North Atlantic Oscillation as the first mode. EA-WRs climate impact extends from eastern North America to Eurasia. The positive (negative) EA-WR produces positive (negative) temperature anomalies over the eastern US, western Europe and Russia east of Caspian Sea, with negative (positive) anomalies over eastern Canada, eastern Europe including Ural Mountains and the Middle East. These anomalies are largely explained by lower-tropospheric temperature advections. Positive (negative) precipitation anomalies are found over the mid-latitude Atlantic and central Russia around 60E, where lower-level cyclonic (anticyclonic) circulation anomaly is dominant. The eastern Canada and the western Europe are characterized by negative (positive) precipitation anomalies.The EA-WR is found to be closely associated with Rossby wave propagation. Wave activity fluxes show that it is strongly tied to large-scale stationary waves. Furthermore, a stationary wave model (SWM) forced with vorticity transients in the mid-latitude Atlantic (approximately 40N) or diabatic heat source over the subtropical Atlantic near the Caribbean Sea produces well-organized EA-WR-like wave patterns, respectively. Sensitivity tests with the SWM indicate improvement in the simulation of the EA-WR when the mean state is modified to have a positive NAO component that enhances upper-level westerlies between 40-60N.
Tropical Atlantic Hurricanes, Easterly Waves, and West African Mesoscale Convective Systems
Directory of Open Access Journals (Sweden)
Yves K. Kouadio
2010-01-01
Full Text Available The relationship between tropical Atlantic hurricanes (Hs, atmospheric easterly waves (AEWs, and West African mesoscale convective systems (MCSs is investigated. It points out atmospheric conditions over West Africa before hurricane formation. The analysis was performed for two periods, June–November in 2004 and 2005, during which 12 hurricanes (seven in 2004, five in 2005 were selected. Using the AEW signature in the 700 hPa vorticity, a backward trajectory was performed to the African coast, starting from the date and position of each hurricane, when and where it was catalogued as a tropical depression. At this step, using the Meteosat-7 satellite dataset, we selected all the MCSs around this time and region, and tracked them from their initiation until their dissipation. This procedure allowed us to relate each of the selected Hs with AEWs and a succession of MCSs that occurred a few times over West Africa before initiation of the hurricane. Finally, a dipole in sea surface temperature (SST was observed with a positive SST anomaly within the region of H generation and a negative SST anomaly within the Gulf of Guinea. This SST anomaly dipole could contribute to enhance the continental convergence associated with the monsoon that impacts on the West African MCSs formation.
Unusual Δ7,12,19 C35:3 Alkenone Produced by the Mutant Emiliania huxleyi strain CCMP2758 in Culture
Zheng, Y.; Huang, Y.; Zhang, Y.; Dillon, J. T.
2015-12-01
Alkenones with chain length ranging from C37 to C40 are highly specific biomarkers for certain haptophyte algae in ocean and lake sediments and have been widely used for paleoclimate studies. Short chain alkenones (e.g., C35 and C36) have been found in environmental and culture samples but the origin and structures of these compounds are not fully understood. The benchmark marine alkenone producer, Emiliania huxleyi CCMP2758 strain (the mutant of strain CCMP1742, NEPCC55a) was reported to make 35:2 alkenone when cultured at 15 °C (Prahl et al., 2006). Here we show, when this strain is cultured at lower temperatures (e.g., 4°C), CCMP2758 produces large amount of 35:3 alkenone with unusual double bond positions of Δ7,12,19. We determined the double bond positions of the C35:3 methyl ketonee based on GC-MS analysis of cyclobutylimine derivatives and dimethyl disulfide derivatives respectively, and provide the first temperature calibrations based on the unsaturation ratios of C35 alkenones. Previous studies have found 35:2 alkenone with three methylene interruption in the Black Sea sediment, but it is the first time that an alkenone with a mixed three and five methylene interruption is found. The discovery of short chain alkenones with unusual double bond positions may shed new light to alkenone biosynthesis.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC452 (Link to dictyBase) - - - Contig-U08358-1 SLC452E (Link to Original site) SLC4...52F 537 SLC452Z 347 SLC452P 884 SLC452E 537 Show SLC452 Library SL (Link to library) Clone ID SLC4...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC452Q.Seq.d/ Representative seq. ID SLC4...52E (Link to Original site) Representative DNA sequence >SLC452 (SLC452Q) /CSM/SL/SLC4-C/SLC4...slvtpplffq*skk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC4
West Nile virus in overwintering mosquitoes, central Europe
Czech Academy of Sciences Publication Activity Database
Rudolf, I.; Betášová, L.; Blažejová, H.; Venclíková, Kristýna; Straková, P.; Šebesta, O.; Mendel, J.; Bakonyi, T.; Schaffner, F.; Nowotny, N.; Hubálek, Z.
2017-01-01
Roč. 10, 2 October (2017), s. 1-4, č. článku 452. ISSN 1756-3305 Institutional support: RVO:61389013 Keywords : West Nile fever * West Nile virus * Flavivirus Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 3.080, year: 2016
29 CFR 452.129 - Non-discrimination.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Non-discrimination. 452.129 Section 452.129 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT... DISCLOSURE ACT OF 1959 Election Procedures; Rights of Members § 452.129 Non-discrimination. Further...
29 CFR 452.97 - Secret ballot.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Secret ballot. 452.97 Section 452.97 Labor Regulations... OF 1959 Election Procedures; Rights of Members § 452.97 Secret ballot. (a) A prime requisite of elections regulated by title IV is that they be held by secret ballot among the members or in appropriate...
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Scope. 423.452 Section 423.452 Public Health... PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Coordination of Part D Plans With Other Prescription...; establishes waivers for MA-PD plans, employer-sponsored group prescription drug plans, cost plans, and PACE...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Photoprints. 4.52 Section 4.52 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE Requirements for Approval of Labels of Wine...
29 CFR 4.52 - Fringe benefit determinations.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Fringe benefit determinations. 4.52 Section 4.52 Labor... Procedures § 4.52 Fringe benefit determinations. (a) Wage determinations issued pursuant to the Service... differential, which are considered wages rather than fringe benefits under SCA). Pursuant to Section 4(b) of...
29 CFR 452.108 - Publication of results.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Publication of results. 452.108 Section 452.108 Labor... DISCLOSURE ACT OF 1959 Election Procedures; Rights of Members § 452.108 Publication of results. In any... one local, publication may be accomplished by posting on appropriate bulletin boards, or in a union...
29 CFR 452.79 - Opportunity to campaign.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Opportunity to campaign. 452.79 Section 452.79 Labor... DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.79 Opportunity to campaign. There must be a reasonable... prior to the election so that he was denied an equal opportunity to campaign. Similarly, in a mail...
43 CFR 4.452-7 - Reporter's fees.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Reporter's fees. 4.452-7 Section 4.452-7... Fact § 4.452-7 Reporter's fees. (a) The Government agency initiating the proceedings will pay all reporting fees in hearings in Government contest proceedings, in hearings under the Surface Resources Act of...
29 CFR 452.70 - Contents of literature.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Contents of literature. 452.70 Section 452.70 Labor... DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.70 Contents of literature. The Act does not and unions may not regulate the contents of campaign literature which candidates may wish to have distributed by the...
Garrido, José L; Brunet, Christophe; Rodríguez, Francisco
2016-12-01
Many studies on photoacclimation examine the pigment responses to changes in light intensity, but variations in light climate in the aquatic environment are also related to changes in spectral composition. We have employed a high-performance liquid chromatography method with improved resolution towards chlorophyll c and fucoxanthin-related xanthophylls to examine the pigment composition of Emiliania huxleyi CCMP 370 under different light intensities and spectral qualities. To maintain its photosynthetic performance, E. huxleyi CCMP370 promotes drastic pigment changes that can be either the interconversion of pigments in pools with the same basic chromophoric structure (Fucoxanthin type or chlorophyll c type), or the ex novo synthesis (Diatoxanthin). These changes are linked either to variations in light quality (Fucoxanthin related xanthophylls) or in light intensity (chlorophyll c 3 /Monovinyl chlorophyll c 3 , Diadinoxanthin/Diatoxanthin, β,ɛ-carotene/ β,β-carotene). Fucoxanthin and 19'-hexanoyloxyfucoxanthin proportions were highly dependent on spectral conditions. Whereas Fucoxanthin dominated in green and red light, 19'-hexanoyloxyfucoxanthin prevailed under blue spectral conditions. Our results suggest that the huge pigment diversity enhanced the photoacclimative capacities of E. huxleyi to efficiently perform under changing light environments. The ubiquity and success in the global ocean as well as the capacity of E. huxleyi to form large surface blooms might be associated to the plasticity described here. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
29 CFR 452.69 - Expenses of campaign literature.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Expenses of campaign literature. 452.69 Section 452.69... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.69 Expenses of campaign literature. Each... is no requirement that the union distribute the literature of the candidate free of charge. In the...
29 CFR 452.67 - Distribution of campaign literature.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Distribution of campaign literature. 452.67 Section 452.67... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.67 Distribution of campaign literature. The Act... distribute his campaign literature to the membership at his expense. When the organization or its officers...
29 CFR 452.82 - Reprisal for exercising rights.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Reprisal for exercising rights. 452.82 Section 452.82 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT... DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.82 Reprisal for exercising rights. A member has a right to...
29 CFR 452.41 - Working at the trade.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Working at the trade. 452.41 Section 452.41 Labor... DISCLOSURE ACT OF 1959 Candidacy for Office; Reasonable Qualifications § 452.41 Working at the trade. (a) It would ordinarily be reasonable for a union to require candidates to be employed at the trade or even to...
Turbidity distribution in the Atlantic Ocean
Eittreim, S.; Thorndike, E.M.; Sullivan, L.
1976-01-01
The regional coverage of Lamont nephelometer data in the North and South Atlantic can be used to map seawater turbidity at all depths. At the level of the clearest water, in the mid-depth regions, the turbidity distribution primarily reflects the pattern of productivity in the surface waters. This suggests that the 'background' turbidity level in the oceans is largely a function of biogenic fallout. The bottom waters of the western Atlantic generally exhibit large increases in turbidity. The most intense benthic nepheloid layers are in the southwestern Argentine basin and northern North American basin; the lowest bottom water turbidity in the western Atlantic is in the equatorial regions. Both the Argentine and North American basin bottom waters appear to derive their high turbidity largely from local resuspension of terrigenous input in these basins. In contrast to the west, the eastern Atlantic basins show very low turbidities with the exception of three regions: the Mediterranean outflow area, the Cape basin, and the West European basin. ?? 1976.
29 CFR 452.34 - Application of section 504, LMRDA.
2010-07-01
... Control Act of 1984, Public Law 98-473, (29 U.S.C. 504) are robbery, bribery, extortion, embezzlement... 29 Labor 2 2010-07-01 2010-07-01 false Application of section 504, LMRDA. 452.34 Section 452.34... AND DISCLOSURE ACT OF 1959 Candidacy for Office; Reasonable Qualifications § 452.34 Application of...
48 CFR 452.247-70 - Delivery Location.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delivery Location. 452.247-70 Section 452.247-70 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CLAUSES AND... Location. As prescribed in 447.302, insert a clause substantially as follows: Delivery Location (FEB 1988...
Dolan, James; Beck, Christian; Ogawa, Yujiro
1989-11-01
Terrigenous silt and sand turbidites recovered from the crest of the Tiburon Rise in the west-central Atlantic represent an unprecedented example of upslope turbidite deposition in an extremely distal setting. These Eocene-Oligocene beds, which were derived from South America more than 1000 km to the southeast, were probably deposited by extremely thick (>1500 m) turbidity currents that flowed parallel to the southern margin of the rise. We suggest that flow thickness was the dominant control on deposition of these beds, rather than true upslope flow. This interpretation points out the importance of local bathymetry on the behavior of even extremely distal turbidity currents.
29 CFR 452.131 - Casting of ballots; delegate elections.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Casting of ballots; delegate elections. 452.131 Section 452... REPORTING AND DISCLOSURE ACT OF 1959 Election Procedures; Rights of Members § 452.131 Casting of ballots; delegate elections. The manner in which the votes of the representatives are cast in the convention is not...
29 CFR 452.5 - Effect of violation on outcome.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Effect of violation on outcome. 452.5 Section 452.5 Labor... DISCLOSURE ACT OF 1959 General Considerations § 452.5 Effect of violation on outcome. Since the remedy under... affected the outcome of an election” 5 the Secretary as a matter of policy will not file suit to enforce...
48 CFR 452.216-74 - Ceiling Price.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Ceiling Price. 452.216-74... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-74 Ceiling Price. As prescribed in 416.670, insert the following clause: Ceiling Price (FEB 1988) The ceiling price of this...
Belmadani, A.; Palany, P.; Dalphinet, A.; Pilon, R.; Chauvin, F.
2017-12-01
Tropical cyclones (TCs) are a major environmental hazard in numerous small islands such as the French West Indies (Guadeloupe, Martinique, St-Martin, St-Barthélémy). The intense associated winds, which can reach 300 km/h or more, can cause serious damage in the islands and their coastlines. In particular, the combined action of waves, currents and low atmospheric pressure leads to severe storm surge and coastal flooding. Here we report on future changes in cyclonic wave climate for the North Atlantic basin, as a preliminary step for downscaled projections over the French West Indies at sub-kilometer-scale resolution. A new configuration of the Météo-France ARPEGE atmospheric general circulation model on a stretched grid with increased resolution in the tropical North Atlantic ( 15 km) is able to reproduce the observed distribution of maximum surface winds, including extreme events corresponding to Category 5 hurricanes. Ensemble historical simulations (1985-2014, 5 members) and future projections with the IPCC (Intergovernmental Panel on Climate Change) RCP8.5 scenario (2051-2080, 5 members) are used to drive the MFWAM (Météo-France Wave Action Model) over the North Atlantic basin. A lower 50-km resolution grid is used to propagate distant mid-latitude swells into a higher 10-km resolution grid over the cyclonic basin. Wave model performance is evaluated over a few TC case studies including the Sep-Oct 2016 Category 5 Hurricane Matthew, using an operational version of ARPEGE at similar resolution to force MFWAM together with wave buoy data. The latter are also used to compute multi-year wave statistics, which then allow assessing the realism of the MFWAM historical runs. For each climate scenario and ensemble member, a simulation of the cyclonic season (July to mid-November) is performed every year. The simulated sea states over the North Atlantic cyclonic basin over 150 historical simulations are compared to their counterparts over 150 future simulations
48 CFR 452.216-70 - Award Fee.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Award Fee. 452.216-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-70 Award Fee. As prescribed in 416.405, insert a clause substantially as follows: Award Fee (FEB 1988) The amount of award fee...
2012-08-21
..., West Atlantic sailfish, or North Atlantic swordfish in states (and the United States Virgin Islands and... Collection; Comment Request; Atlantic Highly Migratory Species Recreational Landings Reports AGENCY: National... provides important data used to monitor catches of Atlantic highly migratory species (HMS) and supplements...
NOAA/West coast and Alaska Tsunami warning center Atlantic Ocean response criteria
Whitmore, P.; Refidaff, C.; Caropolo, M.; Huerfano-Moreno, V.; Knight, W.; Sammler, W.; Sandrik, A.
2009-01-01
West Coast/Alaska Tsunami Warning Center (WCATWC) response criteria for earthquakesoccurring in the Atlantic and Caribbean basins are presented. Initial warning center decisions are based on an earthquake's location, magnitude, depth, distance from coastal locations, and precomputed threat estimates based on tsunami models computed from similar events. The new criteria will help limit the geographical extent of warnings and advisories to threatened regions, and complement the new operational tsunami product suite. Criteria are set for tsunamis generated by earthquakes, which are by far the main cause of tsunami generation (either directly through sea floor displacement or indirectly by triggering of sub-sea landslides).The new criteria require development of a threat data base which sets warning or advisory zones based on location, magnitude, and pre-computed tsunami models. The models determine coastal tsunami amplitudes based on likely tsunami source parameters for a given event. Based on the computed amplitude, warning and advisory zones are pre-set.
Mabragaña, E; Vazquez, D M; Gabbanelli, V; Sabadin, D; Barbini, S A; Lucifora, L O
2017-09-01
Egg cases of Bathyraja griseocauda were larger (140-142 mm in length) than those of Bathyraja scaphiops (88-90 mm in length) and their surface was relatively smooth, without denticles, prickles or any ornamentation. Egg cases of B. scaphiops had a relative coarse surface, covered with prickles of similar size. An identification key for the all described egg cases from Bathyraja occurring in the south-west Atlantic Ocean is provided. © 2017 The Fisheries Society of the British Isles.
28 CFR 45.2 - Disqualification arising from personal or political relationship.
2010-07-01
... political relationship. 45.2 Section 45.2 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) EMPLOYEE RESPONSIBILITIES § 45.2 Disqualification arising from personal or political relationship. (a) Unless authorized under paragraph (b) of this section, no employee shall participate in a criminal investigation or...
Macro and trace elements in Paracentrotus lividus gonads from South West Atlantic areas
DEFF Research Database (Denmark)
Camacho, Carolina; Rocha, A. Cristina; Barbosa, Vera L.
2018-01-01
Sea urchin represents one of the most valuable seafood product being harvested and explored for their edible part, the gonads or roe. This species is generally considered a sentinel organism for ecotoxicological studies being widely used in monitoring programs to assess coastal aquatic environments...... quality, because is directly exposed to anthropogenic contaminants in their habitat. In this context, the aim of this study is to evaluate the concentrations of macro (Cl, K, P, Ca, S) and trace (Zn, Br, Fe, Sr, I, Se, Rb, Cu, Cr, Ni, As, iAs, Cd, Pb, Hg) elements in Paracentrotus lividus gonads from...... three South West Atlantic production areas subjected to distinct environmental and anthropogenic pressures. In all studied areas, the elements profile in sea urchin gonads was Cl > K > P > Ca > S > Zn > Br > Fe > Sr > I > Rb > Cu > Se > Cr > Ni, suggesting an element guide profile with special interest...
29 CFR 452.10 - Retaliation for exercising rights.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Retaliation for exercising rights. 452.10 Section 452.10... exercising rights. Section 609, which prohibits labor organizations or their officials from disciplining members for exercising their rights under the Act, and section 610, which makes it a crime for any person...
48 CFR 452.211-70 - Brand Name or Equal.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Brand Name or Equal. 452... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.211-70 Brand Name or Equal. As prescribed in 411.171, insert the following provision: Brand Name or Equal (NOV 1996...
Directory of Open Access Journals (Sweden)
Paulo P. G. Pachelle
Full Text Available The alpheid shrimp Athanas dimorphus Ortmann, 1894, common and widespread throughout the Indo-West Pacific, is reported for the first time from Brazil, representing the first invasive alpheid species in Brazil, and the first species of the genus Athanas Leach, 1816 introduced to the western Atlantic. The present record is based on several specimens collected at two localities in Ceará, Pedra Rachada beach near the town of Paracuru, and Meireles beach in Fortaleza. Athanas dimorphus is very common at the second site, suggesting that a population of this species is now established in northwestern Brazil. An updated list of marine and freshwater decapods accidentally or voluntarily introduced to Brazil is provided.
DEFF Research Database (Denmark)
Mouritsen, Kim N.; Hedeholm, Rasmus; Schack, Henriette B.
2010-01-01
Anisakid nematodes commonly infect gadids, and are of economic and aesthetic importance to the commercial fishing industry in Greenland as some species are pathogenic to humans. However, very little is known about the occurrence of these parasites and their impact on the hosts in Greenland waters....... During a survey in 2005, stomach sample of 227 Atlantic cod (Gadus morhua) and 64 Greenland cod (Gadus ogac) was collected in Godthaab and Sisimiut fiord systems in West Greenland waters. All cod were dissected for stomach contents and anisakid nematodes were removed from the visceral cavity. Third stage...... nematode species regarding prevalence of infection and mean infection intensity was evident, and there was no relationship between fish condition and the intensity of nematode infections. Standardised for size, capelin-eating cod were in better condition and more heavily infected than fish subsisting...
The Mediterranean Water content in the Northeast Atlantic
Nascimento, Angela; Bashmachnikov, Igor; Neves, Filipe
2014-05-01
slope, and further gradually decreased to the west and to the south. To the west it reached about 10% at 35-40º W, over the subptropical section of the Mid-Atlantic ridge, and to the south it totally disappeared around 25o N, south of the Canary islands. Following the values of the maximum percentage of the MW, we got that at 700 m depth its preferred path was to the north along the Iberian continental margin and further on, reaching 24% at 45 - 50o N. At 900- 1300 m depth the MW preferably moved west and west-south-west. Below 1500 m level the MW still had a significant percentage and moved south-west.
Karst of the Mid-Atlantic region in Maryland, West Virginia, and Virginia
Doctor, Daniel H.; Weary, David J.; Brezinski, David K.; Orndorff, Randall C.; Spangler, Lawrence E.; Brezinski, David K.; Halka, Jeffrey; Ortt, Richard A.
2015-01-01
The Mid-Atlantic region hosts some of the most mature karst landscapes in North America, developed in highly deformed rocks within the Piedmont and Valley and Ridge physiographic provinces. This guide describes a three-day excursion to examine karst development in various carbonate rocks by following Interstate 70 west from Baltimore across the eastern Piedmont, across the Frederick Valley, and into the Great Valley proper. The localities were chosen in order to examine the structural and lithological controls on karst feature development in marble, limestone, and dolostone rocks with an eye toward the implications for ancient landscape evolution, as well as for modern subsidence hazards. A number of caves will be visited, including two commercial caverns that reveal strikingly different histories of speleogenesis. Links between karst landscape development, hydrologic dynamics, and water resource sustainability will also be emphasized through visits to locally important springs. Recent work on quantitative dye tracing, spring water geochemistry, and groundwater modeling reveal the interaction between shallow and deep circulation of groundwater that has given rise to the modern karst landscape. Geologic and karst feature mapping conducted with the benefit of lidar data help reveal the strong bedrock structural controls on karst feature development, and illustrate the utility of geologic maps for assessment of sinkhole susceptibility.
Li, Mingming; Guo, Liang; Zhang, Heng; Yang, Sen; Chen, Xinghan; Lin, Haoran; Meng, Zining
2016-09-01
Previously morphological studies supported the division of the bullet tuna into the two subspecies, Auxis rochei rochei and A. rochei eudorax. As a cosmopolitan species, A. rochei rochei ranges in the Indo-West Pacific and Atlantic oceans, while A. rochei eudorax inhabits in eastern Pacific region. Here, we used the HiSeq next-generation sequencing technique to determine the mitochondrial genome (mitogenome) of A. rochei from Indo-West Pacific collection, and then compared our data with mitogenomic sequences of the Atlantic and eastern Pacific retrieved from NCBI database. Results showed the mitogenome of A. rochei from three geographic collections shared the same genes and gene order, similar to typical teleosts. Also, we examined a low level of nucleotide diversity among these mitogenomic sequences. Interestingly, nucleotide diversity of intra-subspecies (Atlantic versus Indo-West) was higher than that of inter-subspecies (Atlantic versus eastern Pacific, Indo-West versus eastern Pacific).
48 CFR 452.236-74 - Control of Erosion, Sedimentation, and Pollution.
2010-10-01
..., Sedimentation, and Pollution. 452.236-74 Section 452.236-74 Federal Acquisition Regulations System DEPARTMENT OF....236-74 Control of Erosion, Sedimentation, and Pollution. As prescribed in 436.574, insert the following clause: Control of Erosion, Sedimentation, and Pollution (NOV 1996) (a) Operations shall be...
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157236 includes Surface underway, chemical, meteorological and physical data collected from Atlantic Cartier in the Inner Sea - West Coast Scotland,...
The spatial distribution and evolution characteristics of North Atlantic cyclones
Dacre, H.; Gray, S.
2009-09-01
Mid-latitude cyclones play a large role in determining the day-to-day weather conditions in western Europe through their associated wind and precipitation patterns. Thus, their typical spatial and evolution characteristics are of great interest to meteorologists, insurance and risk management companies. In this study a feature tracking algorithm is applied to a cyclone database produced using the Hewson-method of cyclone identification, based on low-level gradients of wet-bulb potential temperature, to produce a climatology of mid-latitude cyclones. The aim of this work is to compare the cyclone track and density statistics found in this study with previous climatologies and to determine reasons for any differences. This method is found to compare well with other cyclone identification methods; the north Atlantic storm track is reproduced along with the major regions of genesis. Differences are attributed to cyclone lifetime and strength thresholds, dataset resolution and cyclone identification and tracking methods. Previous work on cyclone development has been largely limited to case studies as opposed to analysis of climatological data, and does not distinguish between the different stages of cyclone evolution. The cyclone database used in this study allows cyclone characteristics to be tracked throughout the cyclone lifecycle. This enables the evaluation of the characteristics of cyclone evolution for systems forming in different genesis regions and a calculation of the spatial distribution and evolution of these characteristics in composite cyclones. It was found that most of the cyclones that cross western Europe originate in the east Atlantic where the baroclinicity and sea surface temperature gradients are weak compared to the west Atlantic. East Atlantic cyclones also have higher low-level relative vorticity and lower mean sea level pressure at their genesis point than west Atlantic cyclones. This is consistent with the hypothesis that they are secondary
National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115226 includes chemical, meteorological, physical and underway - surface data collected from Atlantic Companion in the Inner Sea - West Coast...
LaJeunesse, Todd C.; Forsman, Zac H.; Wham, Drew C.
2016-06-01
Phylogenetic evidence indicates that Siderastrea glynni, a species of coral thought to be endemic to the Eastern Pacific, is actually more likely to be Si. siderea introduced from the Atlantic. Our analyses of the endosymbionts of Si. glynni ( Symbiodinium) substantiate this as an introduced species; attempts to conserve and list Si. glynni as an endangered species are probably unwarranted. The specimens we examined harbored Symbiodinium trenchii and some also contained Sy. goreaui, symbionts that occur with Si. siderea in the Atlantic. Moreover, the genotype of Sy. trenchii (a single strain defined by ten diallelic microsatellite loci) was genetically distinct from genotypes of Sy. ` glynni,' also in Clade D, found abundantly in colonies of Pocillopora throughout the region. Furthermore, the strain of Sy. trenchii grouped with genotypes from the Greater Caribbean, an inbred population that was recently introduced from the Indo-West Pacific. This secondary introduction suggests that strains of Caribbean Sy. trenchii are capable of dispersal into new reef coral communities where this symbiont does not presently exist.
29 CFR 452.40 - Prior office holding.
2010-07-01
... DISCLOSURE ACT OF 1959 Candidacy for Office; Reasonable Qualifications § 452.40 Prior office holding. A.... 26 26 Wirtz v. Hotel, Motel and Club Employees Union, Local 6, 391 U.S. 492 at 504. The Court stated...
Drift pumice in the Indian and South Atlantic oceans
International Nuclear Information System (INIS)
Frick, C.; Kent, L.E.
1984-01-01
Sixty-three samples of drift pumice, collected at the coasts of South Africa, East Africa, Madagascar, Mauritius, the Cocos Islands, Australia, Indonesia, Brazil, Marion Island and Bouvet Island, were investigated petrographically and geochemically with a view to establishing the possible source areas. Geochemically five distinct groups could be distinguished and some could be liked to specific eruptions in the Indian, Atlantic and Pacific oceans. Group A pumice originated from a submarine eruption off Zavodovski Island in the South Sandwich Island Group in 1962. The pumice in Group B occurs mainly on the beaches bordering the Atlantic Ocean, and was found on the west coast of South Africa, on the sea floor south-west of South Africa, and in Brazil. The source of this group is unknown, but all the evidence indicates that it must have been from the Mid-Atlantic Ridge in the South Atlantic Ocean. The Group C pumice was found in the southern Indian Ocean, probably from the Mid-Indian Ridge. The fourth group originated from a submarine eruption along the Tonga Trench in the Pacific Ocean. Group E, which is by far the most homogeneous, includes samples from Australia, the Indian Ocean islands, East and South Africa and samples of the undisputed Krakatoan origin. Specimens from the Krakatoan eruption are still the most abundant type of drift pumice that can be found
9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...
Stratified flows and internal waves in the Vema Fracture Zone of the Mid Atlantic Ridge
Makarenko, Nikolay; Morozov, Eugene; Tarakanov, Roman; Demidova, Tatiana; Frey, Dmitri; Grigorenko, Klim
2017-04-01
In this paper, we study stratified flows and internal waves in the Vema fracture zone of the Mid Atlantic Ridge. This fracture provides intense transportation of cold abyssal waters from the West Atlantic to the equatorial region of the East Atlantic [1]. The results of measurements [2,3] carried out in the cruises of RV Akademik Sergey Vavilov in 2014-2016 are presented. The structure of the near-bottom flow is studied experimentally on the basis of CTD- and LADCP profiling. Theoretical analysis involves mathematical formulation of stratified fluid flow which uses CTD-data obtained from field observation. Spectral properties and kinematic characteristics of internal waves are calculated and discussed. This work was supported by RFBR (grants No 15-01-03942, 16-35-50158). References [1] Morozov E., Demidov A., Tarakanov R. and Zenk W. Abyssal Channels in the Atlantic Ocean: Water Structure and Flows, Springer, Dordrecht, 2010. [2] Morozov E.G., Tarakanov R.Yu., and Makarenko N.I. Flows of Antarctic Bottom Water through fractures in the southern part of the North Mid Atlantic Ridge, Oceanology, 2015, 55, 796-800. [3] Grigorenko K.S., Makarenko N.I., Morozov E.G., Tarakanov R.Yu., and Frey D.I. Stratified flows and internal waves in the Central West Atlantic, J. Physics: Conf. Series, 2016, 722, 012011.
48 CFR 452.236-77 - Emergency Response.
2010-10-01
... contracts: Emergency Response (NOV 1996) (a) Contractor's Responsibility for Fire Fighting. (1) The... emergency work (anticipated to be restricted to fire fighting). An equitable adjustment for the temporary... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Emergency Response. 452...
An Atlantic influence on Amazon rainfall
Energy Technology Data Exchange (ETDEWEB)
Yoon, Jin-Ho [University of Maryland, Department of Atmospheric and Oceanic Science, College Park, MD (United States); Zeng, Ning [University of Maryland, Earth System Science Interdisciplinary Center, College Park, MD (United States); University of Maryland, Department of Atmospheric and Oceanic Science, College Park, MD (United States)
2010-02-15
Rainfall variability over the Amazon basin has often been linked to variations in Pacific sea surface temperature (SST), and in particular, to the El Nino/Southern Oscillation (ENSO). However, only a fraction of Amazon rainfall variability can be explained by ENSO. Building upon the recent work of Zeng (Environ Res Lett 3:014002, 2008), here we provide further evidence for an influence on Amazon rainfall from the tropical Atlantic Ocean. The strength of the North Atlantic influence is found to be comparable to the better-known Pacific ENSO connection. The tropical South Atlantic Ocean also shows some influence during the wet-to-dry season transition period. The Atlantic influence is through changes in the north-south divergent circulation and the movement of the ITCZ following warm SST. Therefore, it is strongest in the southern part of the Amazon basin during the Amazon's dry season (July-October). In contrast, the ENSO related teleconnection is through anomalous east-west Walker circulation with largely concentrated in the eastern (lower) Amazon. This ENSO connection is seasonally locked to boreal winter. A complication due to the influence of ENSO on Atlantic SST causes an apparent North Atlantic SST lag of Amazon rainfall. Removing ENSO from North Atlantic SST via linear regression resolves this causality problem in that the residual Atlantic variability correlates well and is in phase with the Amazon rainfall. A strong Atlantic influence during boreal summer and autumn is particularly significant in terms of the impact on the hydro-ecosystem which is most vulnerable during the dry season, as highlighted by the severe 2005 Amazon drought. Such findings have implications for both seasonal-interannual climate prediction and understanding the longer-term changes of the Amazon rainforest. (orig.)
Directory of Open Access Journals (Sweden)
Ana Mendes
2007-01-01
Full Text Available A simple and inexpensive procedure involving saponification and methylation in wet biomass, winterization and urea complexation in a sequential way has been developed in order to concentrate docosahexaenoic acid (DHA from Crypthecodinium cohnii CCMP 316 biomass. Different urea/fatty acid ratios and crystallization temperatures were tested in the urea complexation method. ANOVA test revealed that, in the studied range, the temperature had the most significant effect on the DHA concentration. The highest DHA fraction (99.2 % of total fatty acids was found at the urea/fatty acid ratio of 3.5 at the crystallization temperatures of 4 and 8 °C. The highest DHA recovery (49.9 % was observed at 24 °C at the urea/fatty acid ratio of 4.0, corresponding to 89.4 % DHA of total fatty acids. Considering the high proportions of DHA obtained in the non-urea complexing fractions, the current procedure was an appropriate way to concentrate and purify DHA from C. cohnii.
Evolutionary diversity among Atlantic coast mangroves
Dodd, Richard S.; Rafii, Zara A.; Fromard, François; Blasco, François
1998-06-01
Current knowledge of intraspecific variation of mangrove species is limited in terms of rangewide distributions and is mostly restricted to morphological analyses, which have indicated a high degree of homogeneity. However, our analyses of the aliphatic hydrocarbon and triterpenoid fraction of foliar waxes (by gas chromatography and mass spectroscopy) of mangrove species ( Rhizophora mangle, Avicennia germinans and Laguncularia racemosa) from Gabon in West Africa and French Guiana in South America show significant genetic differentiation between eastern and western Atlantic provenances. The greater diversity in lipid composition, and the tendency for longer carbon chain lengths in all taxa from Africa, may suggest that American mangroves exhibit derived characteristics. A consequence of this hypothesis would be that Atlantic mangroves are unlikely to have dispersed from the Tethys via the Pacific, as has been proposed by some authors. More widespread sampling within the Atlantic and east Pacific region is needed to support and confirm these results.
(Ceramiales, Rhodophyta) from the Canary Islands, eastern Atlantic
African Journals Online (AJOL)
The genus Osmundea is a strongly supported monophyletic group within the Laurencia complex and shows a disjunct distribution occurring in the North-East and South-West Pacific, the Indian and Atlantic oceans and the Mediterranean Sea. Its phenotypic plasticity on the Canary Islands may be the result of the high ...
Nursery areas and recruitment variation of Northeast Atlantic mackerel (Scomber scombrus)
DEFF Research Database (Denmark)
Jansen, Teunis; Kristensen, Kasper; Van der Kooij, Jeroen
2015-01-01
There are currently no dedicated recruitment survey data available in support of the assessment of the abundance and distribution of Northeast Atlantic (NEA) mackerel (Scomber scombrus), one of the most widespread and commercially important fish stocks in the North Atlantic. This is despite the f......, showing that the most important nursery areas are around Ireland, north and west of Scotland, in the northern North Sea north of 598Nand, to some extent, also in the Bay of Biscay....
Energy Technology Data Exchange (ETDEWEB)
Rohrer, F; Bruening, D; Grobler, E S; Koppmann, R; Kraus, A B; Schrimpf, W; Weber, M; Ehhalt, D H [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Atmosphaerische Chemie
1998-12-31
In June and December 1994, the concentrations of the nitrogen oxides NO, NO{sub 2} and NO{sub y} were measured together with ozone, photolysis frequency of NO{sub 2}, methane, CO, CO{sub 2}, PAN, and light hydrocarbons near the west coast of Europe above the Atlantic Ocean. Two vertical profiles for each season were obtained in the altitude range 1.5 to 12 km at four locations: near Prestwick (56 deg N, 9 deg W), Brest (49 deg N, 6 deg W), Faro (37 deg N, 12 deg W) and Tenerife (30 deg N, 18 deg W). The measured vertical profiles of NO are compared to the results of a low resolution 3-D chemical tracer model. (author)
Energy Technology Data Exchange (ETDEWEB)
Rohrer, F.; Bruening, D.; Grobler, E.S.; Koppmann, R.; Kraus, A.B.; Schrimpf, W.; Weber, M.; Ehhalt, D.H. [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Atmosphaerische Chemie
1997-12-31
In June and December 1994, the concentrations of the nitrogen oxides NO, NO{sub 2} and NO{sub y} were measured together with ozone, photolysis frequency of NO{sub 2}, methane, CO, CO{sub 2}, PAN, and light hydrocarbons near the west coast of Europe above the Atlantic Ocean. Two vertical profiles for each season were obtained in the altitude range 1.5 to 12 km at four locations: near Prestwick (56 deg N, 9 deg W), Brest (49 deg N, 6 deg W), Faro (37 deg N, 12 deg W) and Tenerife (30 deg N, 18 deg W). The measured vertical profiles of NO are compared to the results of a low resolution 3-D chemical tracer model. (author)
77 FR 64318 - Atlantic Highly Migratory Species; Advisory Panel
2012-10-19
... Fishery Management Plans (FMPs) or FMP amendments for Atlantic tunas, swordfish, sharks, and billfish... membership in the HMS AP (note that there are no Environmental/NGO terms expiring, so no nominations for that...: Jenni Wallace, Highly Migratory Species Management Division, NMFS, 1315 East-West Highway, Silver Spring...
50 CFR 452.03 - Threshold review and determinations.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE); ENDANGERED SPECIES COMMITTEE REGULATIONS ENDANGERED SPECIES EXEMPTION... in writing that the application qualifies for consideration by the Endangered Species Committee. (e....03 Section 452.03 Wildlife and Fisheries JOINT REGULATIONS (UNITED STATES FISH AND WILDLIFE SERVICE...
Dukhovskoy, Dmitry S.; Bourassa, Mark A.; Petersen, Gudrún Nína; Steffen, John
2017-03-01
Ocean surface vector wind fields from reanalysis data sets and scatterometer-derived gridded products are analyzed over the Nordic Seas and the northern North Atlantic for the time period from 2000 to 2009. The data sets include the National Center for Environmental Prediction Reanalysis 2 (NCEPR2), Climate Forecast System Reanalysis (CFSR), Arctic System Reanalysis (ASR), Cross-Calibrated Multiplatform (CCMP) wind product version 1.1 and recently released version 2.0, and QuikSCAT. The goal of the study is to assess discrepancies across the wind vector fields in the data sets and demonstrate possible implications of these differences for ocean modeling. Large-scale and mesoscale characteristics of winds are compared at interannual, seasonal, and synoptic timescales. A cyclone tracking methodology is developed and applied to the wind fields to compare cyclone characteristics in the data sets. Additionally, the winds are evaluated against observations collected from meteorological buoys deployed in the Iceland and Irminger Seas. The agreement among the wind fields is better for longer time and larger spatial scales. The discrepancies are clearly apparent for synoptic timescales and mesoscales. CCMP, ASR, and CFSR show the closest overall agreement with each other. Substantial biases are found in the NCEPR2 winds. Numerical sensitivity experiments are conducted with a coupled ice-ocean model forced by different wind fields. The experiments demonstrate differences in the net surface heat fluxes during storms. In the experiment forced by NCEPR2 winds, there are discrepancies in the large-scale wind-driven ocean dynamics compared to the other experiments.
The meteorological environment of the tropospheric ozone maximum over the tropical South Atlantic
Energy Technology Data Exchange (ETDEWEB)
Krishnamurti, T N; Fuelberg, H E; Bensman, E L; Sinha, M C; Oosterhof, D; Kumar, V B [Florida State University, Tallahassee, FL (United States). Department of Meteorology
1993-01-01
This paper examines atmospheric flow patterns over the Southern Atlantic Ocean, where a maximum of tropospheric ozone is observed just west of Southern Africa. The climatology of the South Atlantic basin is shown to favour flow off from South America and Africa converging into the area of high tropospheric ozone. This ozone is initially attributable to byproducts of biomass burning over both these continents. A case study, carried out over 6 days during October 1989, was used to determine the effect of a purely advective scheme (no photochemistry) on the distribution of ozone over the basin. The results showed a pattern in which ozone accumulated off the west coast of South Africa within 72 hours after beginning with an homogenous, zonally-symmetric distribution of ozone. 11 refs.
International Nuclear Information System (INIS)
Schlitzer, R.
1984-01-01
Radiocarbon (C-14) measurements proved to be an efficient means of determining the average, large-area deep water circulation in the Atlantic Ocean. The thesis under review explains and discusses measurements carried out in the equatorial West Atlantic and North Atlantic Ocean. The samples have been taken during mission 56 of the RS 'meteor' in spring 1981. The gas has been obtained by vacuum extraction and the measurements have been performed in proportional counter tubes, the error to be accounted for amounting to 2per mille. These measured data, together with measurements of the potential temperatures, the silicate and CO 2 concentrations, and measured data from the South-East Atlantic Ocean, have been used to calculate on the basis of a box model of the Atlantic Ocean the deep water flow from the West to the East Atlantic Ocean, the deep water circulation between the various East Atlantic basins, and the turbulent diffusion coefficients required to parameterize the deep water mixing processes. (orig./HP) [de
Dukhovskoy, D. S.; Bourassa, M. A.
2016-12-01
The study compares and analyses the characteristics of synoptic storms in the Subpolar North Atlantic over the time period from 2000 through 2009 derived from reanalysis data sets and scatterometer-based gridded wind products. The analysis is performed for ocean 10-m winds derived from the following wind data sets: NCEP/DOE AMIP-II reanalysis (NCEPR2), NCAR/CFSR, Arctic System Reanalysis (ASR) version 1, Cross-Calibrated Multi-Platform (CCMP) wind product versions 1.1 and recently released version 2.0 prepared by the Remote Sensing Systems, and QuikSCAT. A cyclone tracking algorithm employed in this study for storm identification is based on average vorticity fields derived from the wind data. The study discusses storm characteristics such as storm counts, trajectories, intensity, integrated kinetic energy, spatial scale. Interannal variability of these characteristics in the data sets is compared. The analyses demonstrates general agreement among the wind data products on the characteristics of the storms, their spatial distribution and trajectories. On average, the NCEPR2 storms are more energetic mostly due to large spatial scales and stronger winds. There is noticeable interannual variability in the storm characteristics, yet no obvious trend in storms is observed in the data sets.
Reproductive biology of the spotback skate Atlantoraja castelnaui in the south-west Atlantic Ocean.
Colonello, J C; García, M L; Lasta, C A; Menni, R C
2012-06-01
This study provides information on the reproduction of spotback skate Atlantoraja castelnaui. A total of 232 individuals (119 females and 113 males) were obtained from surveys carried out between 2003 and 2006, from the south-west Atlantic Ocean, between 34 and 42° S and <50 m deep; another 514 specimens (241 females and 273 males) were obtained between 2005 and 2007 from commercial fishery operations carried out in the same area and landings in the port of Mar del Plata, Argentina. Males ranged from 185 to 1250 mm total length (L(T) ) and females from 243 to 1368 mm L(T) . Length at maturity was estimated to be 980 mm for males and 1089 mm L(T) for females. Lack of variation of testis mass together with the continuous production of mature spermatocyst and spermatozoa in deferent ducts suggested that males can reproduce throughout the year. Females reproduced year-round with peaks of reproductive activity an integral part of a continuous cycle. This conclusion is corroborated by the seasonal variation of ovaries, oviducal gland and the occurrence of females with eggs in the uterus throughout the year. Results from this study indicate that A. castelnaui is very susceptible to fishery pressure. © 2012 The Authors. Journal of Fish Biology © 2012 The Fisheries Society of the British Isles.
Interannual-to-decadal air-sea interactions in the tropical Atlantic region
Ruiz-Barradas, Alfredo
2001-09-01
The present research identifies modes of atmosphere-ocean interaction in the tropical Atlantic region and the mechanisms by which air-sea interactions influence the regional climate. Novelties of the present work are (1)the use of relevant ocean and atmosphere variables important to identity coupled variability in the system. (2)The use of new data sets, including realistic diabatic heating. (3)The study of interactions between ocean and atmosphere relevant at interannual-to-decadal time scales. Two tropical modes of variability are identified during the period 1958-1993, the Atlantic Niño mode and the Interhemispheric mode. Those modes have defined structures in both ocean and atmosphere. Anomalous sea surface temperatures and winds are associated to anomalous placement of the Intertropical Convergence Zone (ITCZ). They develop maximum amplitude during boreal summer and spring, respectively. The anomalous positioning of the ITCZ produces anomalous precipitation in some places like Nordeste, Brazil and the Caribbean region. Through the use of a diagnostic primitive equation model, it is found that the most important terms controlling local anomalous surface winds over the ocean are boundary layer temperature gradients and diabatic heating anomalies at low levels (below 780 mb). The latter is of particular importance in the deep tropics in producing the anomalous meridional response to the surface circulation. Simulated latent heat anomalies indicate that a thermodynamic feedback establishes positive feedbacks at both sides of the equator and west of 20°W in the deep tropics and a negative feedback in front of the north west coast of Africa for the Interhemispheric mode. This thermodynamic feedback only establishes negative feedbacks for the Atlantic Niño mode. Transients establish some connection between the tropical Atlantic and other basins. Interhemispheric gradients of surface temperature in the tropical Atlantic influence winds in the midlatitude North
Directory of Open Access Journals (Sweden)
Guðbjörg Ásta Ólafsdóttir
Full Text Available Archaeological excavations of historical fishing sites across the North Atlantic have recovered high quantities of Atlantic cod (Gadus morhua bones. In the current study we use Atlantic cod otoliths from archaeological excavations of a historical fishing sites in north-west Iceland, dated to AD 970 -AD 1910 to examine historical growth trajectories of cod. No large scale growth variations or shifts in growth patterns were observed in the current chronologies, supporting the stability of historical Atlantic cod growth trajectories. The most significant variation in growth patterns was consistent with those that have been observed in recent times, for example, reduced early juvenile growth during periods of colder ocean temperature. The current results represent a high resolution chronological record of north-east Atlantic cod growth, greatly increasing the prior temporal range of such data, thereby providing a valuable baseline for a broad range of studies on Atlantic cod growth.
National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113525 includes chemical, discrete sample, physical and profile data collected from DARVIN in the Inner Sea - West Coast Scotland and North Atlantic...
27 CFR 40.452 - Release from customs custody.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Release from customs... § 40.452 Release from customs custody. Cigarette papers and tubes which were made in the United States, exported, and subsequently returned to the United States, may be removed from customs custody for transfer...
Tang, Hui; Zhang, Jianwen; Yu, Zhenyu; Ye, Linsen; Li, Kun; Ding, Fan; Feng, Xiao
2017-01-01
Purpose: We proposed to investigate the effects of miR-452-3p on the proliferation and mobility of hepatocellular carcinoma (HCC) cells by targeting cytoplasmic polyadenylation element binding protein 3/estimated glomerular filtration rate (CPEB3/EGFR) axis. Methods: Quantitative real-time polymerase chain reaction (qRT-PCR) was used to detect miR-452-3p expression in 84 pairs of HCC tissues and adjacent tissues. Luciferase reporter assay was employed to examine the relationship between miR-452-3p and CPEB3. Microculture tetrazolium (MTT) assay, colony formation assay, flow cytometry detection, wound healing assay, and transwell assay were used to detect cell proliferation, cycle arrest, apoptosis, and mobility, respectively, in HCC, HepG2, and Huh-7. Western blot was used to detect protein expression levels in EGFR signaling pathway. Kaplan-Meier survival analysis was conducted to analyze the correlation between the miR-452-3p and CPEB3 expression levels and the survival of patients with HCC. Results: MiRNA-452-3p was found significantly upregulated in 84 human HCC sample tissues and cells in comparison with adjacent tissues and normal liver epithelial cells (P < .01). Luciferase reporter assay demonstrated that CPEB3 was a direct target of miR-452-3p. Overexpression of miR-452-3p promoted cell proliferation and mobility and suppressed apoptosis. MiR-452-3p enhanced EGFR and phosphorylated AKT (pAKT) expression but inhibited p21 expression level. Conclusion: MiR-452-3p promoted HCC cell proliferation and mobility by directly targeting the CPEB3/EGFR axis. PMID:29332449
Distribution and population structure of North Atlantic harbour seals (Phoca vitulina
Directory of Open Access Journals (Sweden)
Liselotte Andersen
2010-09-01
Full Text Available A review of the known geographical distribution and current knowledge on the genetic population structure of harbour seals (Phoca vitulina in the North Atlantic is presented. Based on a synthesis of the results fromfive different studies of neutral geneticmarkers (mtDNAand nuclear microsatellites, mainly twelve genetically distinct populations were identified in the North Atlantic: USA/Canada, Iceland, west coast of Norway, Ireland-Scotland, English east coast, Channel area, Wadden Sea, Limfjord, Skagerrak, Kattegat, West Baltic, and East Baltic. Most of the studies addressed the population structure at the regional level, while only a few addressed the structuring at a local level, i.e. within countries. Due to the limited number of studies conducted, the identified population units were considered preliminary andmore detailed, local studieswould probably reveal structuring on a finer scale. The choice of genetic markers, their properties, resolution in time and applicability in population structure studies is shortly discussed and compared to ecological methods used to delineate populations.
43 CFR 4.452-5 - Conduct of hearing.
2010-10-01
... Questions of Fact § 4.452-5 Conduct of hearing. So far as not inconsistent with a prehearing order, the administrative law judge may seek to obtain stipulations as to material facts and the issues involved and may state any other issues on which he may wish to have evidence presented. He may exclude irrelevant issues...
Titus, Benjamin M.
2018-04-27
Aim The “sexy shrimp” Thor amboinensis is currently considered a single circumtropical species. However, the tropical oceans are partitioned by hard and soft barriers to dispersal, providing ample opportunity for allopatric speciation. Herein, we test the null hypothesis that T. amboinensis is a single global species, reconstruct its global biogeographical history, and comment on population‐level patterns throughout the Tropical Western Atlantic. Location Coral reefs in all tropical oceans. Methods Specimens of Thor amboinensis were obtained through field collection and museum holdings. We used one mitochondrial (COI) and two nuclear (NaK, enolase) gene fragments for global species delimitation and phylogenetic analyses (n = 83 individuals, 30 sample localities), while phylogeographical reconstruction in the TWA was based on COI only (n = 303 individuals, 10 sample localities). Results We found evidence for at least five cryptic lineages (9%–22% COI pairwise sequence divergence): four in the Indo‐West Pacific and one in the Tropical Western Atlantic. Phylogenetic reconstruction revealed that endemic lineages from Japan and the South Central Pacific are more closely related to the Tropical Western Atlantic lineage than to a co‐occurring lineage that is widespread throughout the Indo‐West Pacific. Concatenated and species tree phylogenetic analyses differ in the placement of an endemic Red Sea lineage and suggest alternate dispersal pathways into the Atlantic. Phylogeographical reconstruction throughout the Tropical Western Atlantic reveals little genetic structure over more than 3,000 km. Main conclusions Thor amboinensis is a species complex that has undergone a series of allopatric speciation events and whose members are in secondary contact in the Indo‐West Pacific. Nuclear‐ and mitochondrial‐ gene phylogenies show evidence of introgression between lineages inferred to have been separated more than 20 Ma. Phylogenetic discordance between
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157322 includes Surface underway, chemical, meteorological and physical data collected from Atlantic Cartier in the English Channel, Inner Sea - West...
Deglacial History and Paleoceanography of the Umanak System, West Greenland
DEFF Research Database (Denmark)
Sheldon, Christina; Jennings, Anne; Andrews, John
2012-01-01
A record of Greenland Ice Sheet (GIS) and ice-stream history, ice-sheet ocean interactions and paleoclimate from the Last Glacial Maximum to present is preserved in the sediments of the Umanak fjord, shelf trough and trough mouth fan system of central West Greenland. The objective of this study....... This evidence of Atlantic Water carried in the WGC precedes lithological evidence of ice stream retreat from the shelf edge (an influx of coarse IRD beginning 62 cm above the first Atlantic Water assemblage) indicating the presence of the WGC at the shelf edge prior to initial deglaciation. Both the slope...... is to document the timing and rate of ice retreat and the role of the West Greenland Current (WGC) in initiating or sustaining ice retreat. During cruise JR175 of the UK ship RRS James Clark Ross in 2009, sediment cores and geophysical data were collected from the Umanak System to document the glacial history...
Plasticity in the proteome of Emiliania huxleyi CCMP 1516 to extremes of light is highly targeted.
McKew, Boyd A; Lefebvre, Stephane C; Achterberg, Eric P; Metodieva, Gergana; Raines, Christine A; Metodiev, Metodi V; Geider, Richard J
2013-10-01
Optimality principles are often applied in theoretical studies of microalgal ecophysiology to predict changes in allocation of resources to different metabolic pathways, and optimal acclimation is likely to involve changes in the proteome, which typically accounts for > 50% of cellular nitrogen (N). We tested the hypothesis that acclimation of the microalga Emiliania huxleyi CCMP 1516 to suboptimal vs supraoptimal light involves large changes in the proteome as cells rebalance the capacities to absorb light, fix CO2 , perform biosynthesis and resist photooxidative stress. Emiliania huxleyi was grown in nutrient-replete continuous culture at 30 (LL) and 1000 μmol photons m(-2) s(-1) (HL), and changes in the proteome were assessed by LC-MS/MS shotgun proteomics. Changes were most evident in proteins involved in the light reactions of photosynthesis; the relative abundance of photosystem I (PSI) and PSII proteins was 70% greater in LL, light-harvesting fucoxanthin-chlorophyll proteins (Lhcfs) were up to 500% greater in LL and photoprotective LI818 proteins were 300% greater in HL. The marked changes in the abundances of Lhcfs and LI818s, together with the limited plasticity in the bulk of the E. huxleyi proteome, probably reflect evolutionary pressures to provide energy to maintain metabolic capabilities in stochastic light environments encountered by this species in nature. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Tenarife Island, Canary Island Archipelago, Atlantic Ocean
1991-01-01
Tenarife Island is one of the most volcanically active of the Canary Island archipelago, Atlantic Ocean, just off the NW coast of Africa, (28.5N, 16.5W). The old central caldera, nearly filled in by successive volcanic activity culminating in two stratocones. From those two peaks, a line of smaller cinder cones extend to the point of the island. Extensive gullies dissect the west side of the island and some forests still remain on the east side.
Directory of Open Access Journals (Sweden)
Oscar Lasso-Alcalá
Full Text Available We examined 308 specimens of the Indo-Pacific blenniid Omobranchus punctatus deposited in four museum collections, and analyzed data on their collection locations to assess its invasion on the Atlantic coast of Central and South America. This species occurs in shoreline estuarine and marine habitats in the Indo-West Pacific. Previous sampling and recent records in the Tropical West Atlantic from 1930 to 2004 produced 20 records for: Panamá, Colombia, Venezuela, Trinidad and Brazil. In this work, we provide data on 17 new records for the Gulfs of Venezuela and Paria in Venezuela, as well as four records for Maranhão and Pará states in NE Brazil. The temporal pattern of collections (1930 - 2009 and the proximity of most localities to ports and zones of ship traffic indicate that O. punctatus was initially introduced to the Atlantic by ships travelling from India to Trinidad. Within Brazil the introduction is linked to shipping connected to petroleum platforms. In Maranhão and Pará the introduction may have occurred as a result of fish sheltering in fouling on hulls of ships moving between ports around the mouth of the Amazon River. Alternatively, the spread of this species along of the American coast may reflect the expansion of the range of O. puntactus through larval dispersal in northward flowing currents. We recommend monitoring of this introduced species, and studies of its ecology in West Atlantic areas.
Ocean array alters view of Atlantic conveyor
Kornei, Katherine
2018-02-01
Oceanographers have put a stethoscope on the coursing circulatory system of the Atlantic Ocean, and they have found a skittish pulse that's surprisingly strong in the waters east of Greenland—discoveries that should improve climate models. The powerful currents known as the Atlantic meridional overturning circulation (AMOC) are an engine in Earth's climate. The AMOC's shallower limbs—which include the Gulf Stream—move warm water from the tropics northward, warming Western Europe. In the north, the waters cool and sink, forming deeper limbs that transport the cold water back south—and sequester anthropogenic carbon in the process. Last week, at the American Geophysical Union's Ocean Sciences meeting, scientists presented the first data from an array of instruments moored in the subpolar North Atlantic, a $35 million, seven-nation project known as the Overturning in the Subpolar North Atlantic Program (OSNAP). Since 2004, researchers have gathered data from another array, at 26°N, stretching from Florida to Africa. But OSNAP is the first to monitor the circulation farther north, where a critical aspect of the overturning occurs. The observations reveal unexpected eddies and strong variability in the AMOC currents. They also show that the currents east of Greenland contribute the most to the total AMOC flow. Climate models, on the other hand, have emphasized the currents west of Greenland in the Labrador Sea.
2014 Mid-Atlantic Telehealth Resource Center Annual Summit
Directory of Open Access Journals (Sweden)
Katharine Hsu Wibberly
2013-12-01
Full Text Available The Mid-Atlantic Resource Center (MATRC; http://www.matrc.org/ advances the adoption and utilization of telehealth within the MATRC region and works collaboratively with the other federally funded Telehealth Resource Centers to accomplish the same nationally. MATRC offers technical assistance and other resources within the following mid-Atlantic states: Delaware, District of Columbia, Kentucky, Maryland, North Carolina, Pennsylvania, Virginia and West Virginia. The 2014 MATRC Summit “Adding Value through Sustainable Telehealth” will be held March 30-April 1, 2014, at the Fredericksburg Expo & Conference Center, Fredericksburg, VA. The Summit will explore how telehealth adds value to patients, practitioners, hospitals, health systems, and other facilities. Participants will experience a highly interactive program built around the case history of “Mr. Doe” as he progresses through the primary care, inpatient hospitalization, and post-discharge environments. The Summit will conclude with a session on financial and business models for providing sustainable telehealth services. For further information and registration, visit: http://matrc.org/component/content/article/2-uncategorised/80-mid-atlantic-telehealth-resource-summit-2014
2010-04-01
... earnings; wages; net earnings from self-employment. 404.452 Section 404.452 Employees' Benefits SOCIAL...; net earnings from self-employment. (a) Reporting requirements and conditions under which a report of earnings, that is, wages and/or net earnings from self-employment, is required. (1) If you have not reached...
38 CFR 18.452 - Health and other social services.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Health and other social...-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 Nondiscrimination on the Basis of Handicap Health and Social Services § 18.452 Health and other social services. (a) General. In providing health, or other...
Deep-water fisheries at the Atlantic Frontier
Gordon, J. D. M.
2001-05-01
The deep sea is often thought of as a cold, dark and uniform environment with a low-fish biomass, much of which is highly adapted for life in a food-poor environment. While this might be true of the pelagic fish living in the water column, it is certainly not true of the demersal fish which live on or close to the bottom on the continental slopes around the British Isles (the Atlantic Frontier). These fish are currently being commercially exploited. There is growing evidence to support the view that success of the demersal fish assemblages depends on the pelagic or benthopelagic food sources that impinge both vertically and horizontally onto the slope. There are several quite separate and distinct deep-water fisheries on the Atlantic Frontier. It is a physical barrier, the Wyville-Thomson Ridge, which results in the most significant division of the fisheries. The Ridge, which has a minimum depth of about 500 m, separates the warmer deep Atlantic waters from the much colder Norwegian Sea water and as a result, the deep-water fisheries to the west of the Hebrides and around the offshore banks are quite different from those of the Faroe-Shetland Channel (West of Shetland). The fisheries to the West of the Hebrides can be further divided by the fishing method used into bottom trawl, semipelagic trawl and longline. The bottom-trawl fisheries extend from the shelf-slope break down to about 1700 m and the target species varies with depth. The smallest vessels in the fleet fish on the upper slope, where an important target species is the anglerfish or monkfish ( Lophius spp.). On the mid-slope the main target species are blue ling ( Molva dypterygia) and roundnose grenadier ( Coryphaenoides rupestris), with bycatches of black scabbardfish ( Aphanopus carbo) and deep-water sharks. On the lower slope orange roughy ( Hoplostethus atlanticus) is an important target species. The major semipelagic trawl fishery is a seasonal fishery on spawning aggregations of blue whiting
Convective lofting links Indian Ocean air pollution to paradoxical South Atlantic ozone maxima
Chatfield, R. B.; Guan, H.; Thompson, A. M.; Witte, J. C.
2005-01-01
We describe a broad resolution of the Atlantic Parado concerning the seasonal and geographic distribution, of tropical tropospheric ozone. We highlight periods of significant maximum tropospheric O3 for Jan.- April, 1999, exploiting satellite estimates and SHADOZ (Southern Hemisphere Additional Ozonesondes). Trajectory analyses connecting sondes and Total Tropospheric Ozone (TTO) maps suggest a complex influence from the Indian Ocean: beginning with mixed combustion sources, then low level transport, cumulonimbus venting, possible stratospheric input, and finally high-level transport to the west, with possible mixing over Africa. For the Jan.-March highest column-O3 periods in the Atlantic, distinct sounding peaks trace to specific NO sources, especially lightning, while in the same episodes, recurring every 20-50 days, more diffuse buildups of Indian-to-Atlantic pollution make important contributions.
29 CFR 452.14 - Newly formed or merged labor organizations.
2010-07-01
... 452.14 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT STANDARDS GENERAL STATEMENT CONCERNING THE ELECTION PROVISIONS OF THE LABOR-MANAGEMENT... identity the terms of its officers may not be extended beyond the maximum period specified by the Act for...
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157280 includes Surface underway, chemical, meteorological and physical data collected from Atlantic Companion in the Inner Sea - West Coast...
Marine biodiversity in the Atlantic and Pacific coasts of South America: knowledge and gaps.
Miloslavich, Patricia; Klein, Eduardo; Díaz, Juan M; Hernández, Cristián E; Bigatti, Gregorio; Campos, Lucia; Artigas, Felipe; Castillo, Julio; Penchaszadeh, Pablo E; Neill, Paula E; Carranza, Alvar; Retana, María V; Díaz de Astarloa, Juan M; Lewis, Mirtha; Yorio, Pablo; Piriz, María L; Rodríguez, Diego; Yoneshigue-Valentin, Yocie; Gamboa, Luiz; Martín, Alberto
2011-01-31
The marine areas of South America (SA) include almost 30,000 km of coastline and encompass three different oceanic domains--the Caribbean, the Pacific, and the Atlantic--ranging in latitude from 12∘N to 55∘S. The 10 countries that border these coasts have different research capabilities and taxonomic traditions that affect taxonomic knowledge. This paper analyzes the status of knowledge of marine biodiversity in five subregions along the Atlantic and Pacific coasts of South America (SA): the Tropical East Pacific, the Humboldt Current,the Patagonian Shelf, the Brazilian Shelves, and the Tropical West Atlantic, and it provides a review of ecosystem threats and regional marine conservation strategies. South American marine biodiversity is least well known in the tropical subregions (with the exception of Costa Rica and Panama). Differences in total biodiversity were observed between the Atlantic and Pacific oceans at the same latitude. In the north of the continent, the Tropical East Pacific is richer in species than the Tropical West Atlantic, however, when standardized by coastal length, there is very little difference among them. In the south, the Humboldt Current system is much richer than the Patagonian Shelf. An analysis of endemism shows that 75% of the species are reported within only one of the SA regions, while about 22% of the species of SA are not reported elsewhere in the world. National and regional initiatives focusing on new exploration, especially to unknown areas and ecosystems, as well as collaboration among countries are fundamental to achieving the goal of completing inventories of species diversity and distribution.These inventories will allow accurate interpretation of the biogeography of its two oceanic coasts and latitudinal trends,and will also provide relevant information for science based policies.
Manganiferous minerals of the epidote group from the Archaean basement of West Greenland
DEFF Research Database (Denmark)
Katerinopoulou, Anna; Balic Zunic, Tonci; Kolb, Jochen
2014-01-01
The chemical compositions and crystal structures of Mn3+-containing minerals from the epidote group in Greenland rocks are investigated and described in detail. They occur in hydrothermally altered Archaean mafic sequences within the gneissic complex of the North Atlantic craton of West Greenland...
30 CFR 206.452 - Coal subject to royalties-general provisions.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Coal § 206.452 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM pursuant to 43 CFR group 3400...
Aerosol interactions with African/Atlantic climate dynamics
International Nuclear Information System (INIS)
Hosseinpour, F; Wilcox, E M
2014-01-01
Mechanistic relationships exist between variability of dust in the oceanic Saharan air layer (OSAL) and transient changes in the dynamics of Western Africa and the tropical Atlantic Ocean. This study provides evidence of possible interactions between dust in the OSAL region and African easterly jet–African easterly wave (AEJ–AEW) system in the climatology of boreal summer, when easterly wave activity peaks. Synoptic-scale changes in instability and precipitation in the African/Atlantic intertropical convergence zone are correlated with enhanced aerosol optical depth (AOD) in the OSAL region in response to anomalous 3D overturning circulations and upstream/downstream thermal anomalies at above and below the mean-AEJ level. Upstream and downstream anomalies are referred to the daily thermal/dynamical changes over the West African monsoon region and the Eastern Atlantic Ocean, respectively. Our hypothesis is that AOD in the OSAL is positively correlated with the downstream AEWs and negatively correlated with the upstream waves from climatological perspective. The similarity between the 3D pattern of thermal/dynamical anomalies correlated with dust outbreaks and those of AEWs provides a mechanism for dust radiative heating in the atmosphere to reinforce AEW activity. We proposed that the interactions of OSAL dust with regional climate mainly occur through coupling of dust with the AEWs. (paper)
Iglesias, Isabel; Lorenzo, M Nieves; Lázaro, Clara; Fernandes, M Joana; Bastos, Luísa
2017-12-31
Sea level anomaly (SLA), provided globally by satellite altimetry, is considered a valuable proxy for detecting long-term changes of the global ocean, as well as short-term and annual variations. In this manuscript, monthly sea level anomaly grids for the period 1993-2013 are used to characterise the North Atlantic Ocean variability at inter-annual timescales and its response to the North Atlantic main patterns of atmospheric circulation variability (North Atlantic Oscillation, Eastern Atlantic, Eastern Atlantic/Western Russia, Scandinavian and Polar/Eurasia) and main driven factors as sea level pressure, sea surface temperature and wind fields. SLA variability and long-term trends are analysed for the North Atlantic Ocean and several sub-regions (North, Baltic and Mediterranean and Black seas, Bay of Biscay extended to the west coast of the Iberian Peninsula, and the northern North Atlantic Ocean), depicting the SLA fluctuations at basin and sub-basin scales, aiming at representing the regions of maximum sea level variability. A significant correlation between SLA and the different phases of the teleconnection patterns due to the generated winds, sea level pressure and sea surface temperature anomalies, with a strong variability on temporal and spatial scales, has been identified. Long-term analysis reveals the existence of non-stationary inter-annual SLA fluctuations in terms of the temporal scale. Spectral density analysis has shown the existence of long-period signals in the SLA inter-annual component, with periods of ~10, 5, 4 and 2years, depending on the analysed sub-region. Also, a non-uniform increase in sea level since 1993 is identified for all sub-regions, with trend values between 2.05mm/year, for the Bay of Biscay region, and 3.98mm/year for the Baltic Sea (no GIA correction considered). The obtained results demonstrated a strong link between the atmospheric patterns and SLA, as well as strong long-period fluctuations of this variable in spatial and
W. Mark Ford; Steven B. Castleberry; Michael T. Mengak; Jane L. Rodrigue; Daniel J. Feller; Kevin R. Russell
2006-01-01
We examined a suite of macro-habitat and landscape variables around active and inactive Allegheny woodrat Neotoma magister colony sites in the Appalachian Mountains of the mid-Atlantic Highlands of Maryland, Virginia, and West Virginia using an information-theoretic modeling approach. Logistic regression analyses suggested that Allegheny woodrat presence was related...
Morris-Pocock, J. A.; Taylor, S.A.; Birt, T.P.; Damus, M.; Piatt, John F.; Warheit, K.I.; Friesen, Vicki L.
2008-01-01
Understanding the factors that influence population differentiation in temperate taxa can be difficult because the signatures of both historic and contemporary demographics are often reflected in population genetic patterns. Fortunately, analyses based on coalescent theory can help untangle the relative influence of these historic and contemporary factors. Common murres (Uria aalge) are vagile seabirds that breed in the boreal and low arctic waters of the Northern Hemisphere. Previous analyses revealed that Atlantic and Pacific populations are genetically distinct; however, less is known about population genetic structure within ocean basins. We employed the mitochondrial control region, four microsatellite loci and four intron loci to investigate population genetic structure throughout the range of common murres. As in previous studies, we found that Atlantic and Pacific populations diverged during the Pleistocene and do not currently exchange migrants. Therefore, Atlantic and Pacific murre populations can be used as natural replicates to test mechanisms of population differentiation. While we found little population genetic structure within the Pacific, we detected significant east-west structuring among Atlantic colonies. The degree that population genetic structure reflected contemporary population demographics also differed between ocean basins. Specifically, while the low levels of population differentiation in the Pacific are at least partially due to high levels of contemporary gene flow, the east-west structuring of populations within the Atlantic appears to be the result of historic fragmentation of populations rather than restricted contemporary gene flow. The contrasting results in the Atlantic and Pacific Oceans highlight the necessity of carefully considering multilocus nonequilibrium population genetic approaches when reconstructing the demographic history of temperate Northern Hemisphere taxa. ?? 2008 The Authors.
Sediment distribution in the oceans : the Atlantic between 10° and 19°N
Collette, B.J.; Ewing, J.I.; Lagaay, R.A.; Truchan, M.
Between 10° and 19°N the North Atlantic Ocean has been covered by four east-west crossings and one north-south section at 60°W, using a continuous seismic reflection recorder (air gun). The northernmost section extends to the Canary Islands. The region comprises a great variety of phenomena:
Long distance dispersal and connectivity in amphi-Atlantic corals at regional and basin scales.
Directory of Open Access Journals (Sweden)
Flavia L D Nunes
Full Text Available Among Atlantic scleractinian corals, species diversity is highest in the Caribbean, but low diversity and high endemism are observed in various peripheral populations in central and eastern Atlantic islands and along the coasts of Brazil and West Africa. The degree of connectivity between these distantly separated populations is of interest because it provides insight into processes at both evolutionary and ecological time scales, such as speciation, recruitment dynamics and the persistence of coral populations. To assess connectivity in broadly distributed coral species of the Atlantic, DNA sequence data from two nuclear markers were obtained for six coral species spanning their distributional ranges. At basin-wide scales, significant differentiation was generally observed among populations in the Caribbean, Brazil and West Africa. Concordance of patterns in connectivity among co-distributed taxa indicates that extrinsic barriers, such as the Amazon freshwater plume or long stretches of open ocean, restrict dispersal of coral larvae from region to region. Within regions, dispersal ability appears to be influenced by aspects of reproduction and life history. Two broadcasting species, Siderastrea siderea and Montastraea cavernosa, were able to maintain gene flow among populations separated by as much as 1,200 km along the coast of Brazil. In contrast, brooding species, such as Favia gravida and Siderastrea radians, had more restricted gene flow along the Brazilian coast.
Changes in the interannual SST-forced signals on West African rainfall. AGCM intercomparison
Energy Technology Data Exchange (ETDEWEB)
Mohino, Elsa [LOCEAN/IPSL, Universite Pierre et Marie Curie, Paris Cedex 05 (France); Universidad de Sevilla, Sevilla (Spain); Rodriguez-Fonseca, Belen [Universidad Complutense de Madrid, Dpto. Geofisica y Meteorologia, Madrid (Spain); Instituto de Geociencias (CSIC-UCM), Madrid (Spain); Losada, Teresa [Universidad Complutense de Madrid, Dpto. Geofisica y Meteorologia, Madrid (Spain); Gervois, Sebastien [LOCEAN/IPSL, Universite Pierre et Marie Curie, Paris Cedex 05 (France); Janicot, Serge [LOCEAN/IPSL, IRD, Universite Pierre et Marie Curie, Paris (France); Bader, Juergen [Bjerknes Centre for Climate Research, Bergen (Norway); Ruti, Paolo [Progetto Speciale Clima Globale, Ente Nazionale per le Nuove Tecnologie, l' Energia e l' Ambiente, Rome (Italy); Chauvin, Fabrice [GAME/CNRM, Meteo-France/CNRS, Toulouse (France)
2011-11-15
Rainfall over West Africa shows strong interannual variability related to changes in Sea Surface Temperature (SST). Nevertheless, this relationship seem to be non-stationary. A particular turning point is the decade of the 1970s, which witnessed a number of changes in the climatic system, including the climate shift of the late 1970s. The first aim of this study is to explore the change in the interannual variability of West African rainfall after this shift. The analysis indicates that the dipolar features of the rainfall variability over this region, related to changes in the Atlantic SST, disappear after this period. Also, the Pacific SST variability has a higher correlation with Guinean rainfall in the recent period. The results suggest that the current relationship between the Atlantic and Pacific El Nino phenomena is the principal responsible for these changes. A fundamental goal of climate research is the development of models simulating a realistic current climate. For this reason, the second aim of this work is to test the performance of Atmospheric General Circulation models in simulating rainfall variability over West Africa. The models have been run with observed SSTs for the common period 1957-1998 as part of an intercomparison exercise. The results show that the models are able to reproduce Guinean interannual variability, which is strongly related to SST variability in the Equatorial Atlantic. Nevertheless, problems in the simulation of the Sahelian interannual variability appear: not all models are able to reproduce the observed negative link between rainfall over the Sahel and El Nino-like anomalies in the Pacific, neither the positive correlation between Mediterranean SSTs and Sahelian rainfall. (orig.)
Bielli, Soline; Douville, Hervé; Pohl, Benjamin
2010-07-01
General circulation models still show deficiencies in simulating the basic features of the West African Monsoon at intraseasonal, seasonal and interannual timescales. It is however, difficult to disentangle the remote versus regional factors that contribute to such deficiencies, and to diagnose their possible consequences for the simulation of the global atmospheric variability. The aim of the present study is to address these questions using the so-called grid point nudging technique, where prognostic atmospheric fields are relaxed either inside or outside the West African Monsoon region toward the ERA40 reanalysis. This regional or quasi-global nudging is tested in ensembles of boreal summer simulations. The impact is evaluated first on the model climatology, then on intraseasonal timescales with an emphasis on North Atlantic/Europe weather regimes, and finally on interannual timescales. Results show that systematic biases in the model climatology over West Africa are mostly of regional origin and have a limited impact outside the domain. A clear impact is found however on the eddy component of the extratropical circulation, in particular over the North Atlantic/European sector. At intraseasonal timescale, the main regional biases also resist to the quasi-global nudging though their magnitude is reduced. Conversely, nudging the model over West Africa exerts a strong impact on the frequency of the two North Atlantic weather regimes that favor the occurrence of heat waves over Europe. Significant impacts are also found at interannual timescale. Not surprisingly, the quasi-global nudging allows the model to capture the variability of large-scale dynamical monsoon indices, but exerts a weaker control on rainfall variability suggesting the additional contribution of regional processes. Conversely, nudging the model toward West Africa suppresses the spurious ENSO teleconnection that is simulated over Europe in the control experiment, thereby emphasizing the relevance
Energy Technology Data Exchange (ETDEWEB)
Bielli, Soline; Douville, Herve; Pohl, Benjamin [CNRM/GMGEC/UDC, Meteo-France, Toulouse Cedex 01 (France)
2010-07-15
General circulation models still show deficiencies in simulating the basic features of the West African Monsoon at intraseasonal, seasonal and interannual timescales. It is however, difficult to disentangle the remote versus regional factors that contribute to such deficiencies, and to diagnose their possible consequences for the simulation of the global atmospheric variability. The aim of the present study is to address these questions using the so-called grid point nudging technique, where prognostic atmospheric fields are relaxed either inside or outside the West African Monsoon region toward the ERA40 reanalysis. This regional or quasi-global nudging is tested in ensembles of boreal summer simulations. The impact is evaluated first on the model climatology, then on intraseasonal timescales with an emphasis on North Atlantic/Europe weather regimes, and finally on interannual timescales. Results show that systematic biases in the model climatology over West Africa are mostly of regional origin and have a limited impact outside the domain. A clear impact is found however on the eddy component of the extratropical circulation, in particular over the North Atlantic/European sector. At intraseasonal timescale, the main regional biases also resist to the quasi-global nudging though their magnitude is reduced. Conversely, nudging the model over West Africa exerts a strong impact on the frequency of the two North Atlantic weather regimes that favor the occurrence of heat waves over Europe. Significant impacts are also found at interannual timescale. Not surprisingly, the quasi-global nudging allows the model to capture the variability of large-scale dynamical monsoon indices, but exerts a weaker control on rainfall variability suggesting the additional contribution of regional processes. Conversely, nudging the model toward West Africa suppresses the spurious ENSO teleconnection that is simulated over Europe in the control experiment, thereby emphasizing the relevance
49 CFR 195.452 - Pipeline integrity management in high consequence areas.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Pipeline integrity management in high consequence... Management § 195.452 Pipeline integrity management in high consequence areas. (a) Which pipelines are covered... that could affect a high consequence area, including any pipeline located in a high consequence area...
Energy situation in the Mid-Atlantic region
Energy Technology Data Exchange (ETDEWEB)
Munson, J S; Brainard, J P
1977-08-01
This report presents a review of the energy situation in the Mid-Atlantic Region. It describes the patterns of energy production, supply and demand by state and compares these to national and regional averages. It presents a picture of existing energy and environmental interactions and a view of potential energy and environmental conflicts. A review of the major issues by energy sector is included as is a description of the existing energy actors and major energy programs for Ohio, West Virginia, Virginia, Pennsylvania, New Jersey, New York, Delaware, Maryland, Puerto Rico, Virgin Islands, and Washington, DC.
Mandelblatt, Bertie
2011-01-01
Why did the production of rum in the French West Indies not achieve the same success within the French Atlantic as it did in the British Atlantic world? Surveying the history of rum production in the French Caribbean in the seventeenth and eighteenth centuries, this article contends that the reason why no regional trade in rum developed in French North America resulted from fierce industrial and institutional competition from brandy producers in metropolitan France. Rum, nevertheless, remained significant within the culture and economy of Native Americans and African Americans. This article seeks to add nuance to the wider debate of the ability of the trans-border diffusion of new ideas to stimulate and institutionalize industrial and economic growth in the Atlantic world. French entrepreneurs were no less ‘entrepreneurial’ than their British counterparts, but real constraints on consumption on both sides of the Atlantic created insufficient demand.
Rodgers, Edward B.; Adler, Robert F.; Pierce, Harold F.; Einaudi, Franco (Technical Monitor)
2000-01-01
The tropical cyclone rainfall climatology study that was performed for the North Pacific was extended to the North Atlantic. Similar to the North Pacific tropical cyclone study, mean monthly rainfall within 444 km of the center of the North Atlantic tropical cyclones (i.e., that reached storm stage and greater) was estimated from passive microwave satellite observations during, an eleven year period. These satellite-observed rainfall estimates were used to assess the impact of tropical cyclone rainfall in altering the geographical, seasonal, and inter-annual distribution of the North Atlantic total rainfall during, June-November when tropical cyclones were most abundant. The main results from this study indicate: 1) that tropical cyclones contribute, respectively, 4%, 3%, and 4% to the western, eastern, and entire North Atlantic; 2) similar to that observed in the North Pacific, the maximum in North Atlantic tropical cyclone rainfall is approximately 5 - 10 deg poleward (depending on longitude) of the maximum non-tropical cyclone rainfall; 3) tropical cyclones contribute regionally a maximum of 30% of the total rainfall 'northeast of Puerto Rico, within a region near 15 deg N 55 deg W, and off the west coast of Africa; 4) there is no lag between the months with maximum tropical cyclone rainfall and non-tropical cyclone rainfall in the western North Atlantic, while in the eastern North Atlantic, maximum tropical cyclone rainfall precedes maximum non-tropical cyclone rainfall; 5) like the North Pacific, North Atlantic tropical cyclones Of hurricane intensity generate the greatest amount of rainfall in the higher latitudes; and 6) warm ENSO events inhibit tropical cyclone rainfall.
Roberta de Jesus Santos; Elmo Borges Azevedo Koch; Clarissa Machado Pinto Leite; Tiago Jordão Porto; Jacques Hubert Charles Delabie
2017-01-01
The Brazilian Atlantic Forest has a rich biodiversity increasingly threatened by human activities. Since the colonial period, the coast of the state of Bahia is among the most affected regions of Brazil by anthropic pressure. Bahia encloses Atlantic Forest remnants distributed in an area reaching 100-200 km along the east-west axis, by 1,000 km along the north-south axis, parallel to the coast of the Atlantic Ocean. We report hereafter the results of an intensive field survey of leaf litter a...
29 CFR 452.50 - Disqualification as a result of disciplinary action.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Disqualification as a result of disciplinary action. 452.50... Disqualification as a result of disciplinary action. Section 401(e) was not intended to limit the right of a labor organization to take disciplinary action against members guilty of misconduct. So long as such action is...
A Review of ENSO Influence on the North Atlantic. A Non-Stationary Signal
Directory of Open Access Journals (Sweden)
Belén Rodríguez-Fonseca
2016-06-01
Full Text Available The atmospheric seasonal cycle of the North Atlantic region is dominated by meridional movements of the circulation systems: from the tropics, where the West African Monsoon and extreme tropical weather events take place, to the extratropics, where the circulation is dominated by seasonal changes in the jetstream and extratropical cyclones. Climate variability over the North Atlantic is controlled by various mechanisms. Atmospheric internal variability plays a crucial role in the mid-latitudes. However, El Niño-Southern Oscillation (ENSO is still the main source of predictability in this region situated far away from the Pacific. Although the ENSO influence over tropical and extra-tropical areas is related to different physical mechanisms, in both regions this teleconnection seems to be non-stationary in time and modulated by multidecadal changes of the mean flow. Nowadays, long observational records (greater than 100 years and modeling projects (e.g., CMIP permit detecting non-stationarities in the influence of ENSO over the Atlantic basin, and further analyzing its potential mechanisms. The present article reviews the ENSO influence over the Atlantic region, paying special attention to the stability of this teleconnection over time and the possible modulators. Evidence is given that the ENSO–Atlantic teleconnection is weak over the North Atlantic. In this regard, the multidecadal ocean variability seems to modulate the presence of teleconnections, which can lead to important impacts of ENSO and to open windows of opportunity for seasonal predictability.
Tsunami Forecasting in the Atlantic Basin
Knight, W. R.; Whitmore, P.; Sterling, K.; Hale, D. A.; Bahng, B.
2012-12-01
The mission of the West Coast and Alaska Tsunami Warning Center (WCATWC) is to provide advance tsunami warning and guidance to coastal communities within its Area-of-Responsibility (AOR). Predictive tsunami models, based on the shallow water wave equations, are an important part of the Center's guidance support. An Atlantic-based counterpart to the long-standing forecasting ability in the Pacific known as the Alaska Tsunami Forecast Model (ATFM) is now developed. The Atlantic forecasting method is based on ATFM version 2 which contains advanced capabilities over the original model; including better handling of the dynamic interactions between grids, inundation over dry land, new forecast model products, an optional non-hydrostatic approach, and the ability to pre-compute larger and more finely gridded regions using parallel computational techniques. The wide and nearly continuous Atlantic shelf region presents a challenge for forecast models. Our solution to this problem has been to develop a single unbroken high resolution sub-mesh (currently 30 arc-seconds), trimmed to the shelf break. This allows for edge wave propagation and for kilometer scale bathymetric feature resolution. Terminating the fine mesh at the 2000m isobath keeps the number of grid points manageable while allowing for a coarse (4 minute) mesh to adequately resolve deep water tsunami dynamics. Higher resolution sub-meshes are then included around coastal forecast points of interest. The WCATWC Atlantic AOR includes eastern U.S. and Canada, the U.S. Gulf of Mexico, Puerto Rico, and the Virgin Islands. Puerto Rico and the Virgin Islands are in very close proximity to well-known tsunami sources. Because travel times are under an hour and response must be immediate, our focus is on pre-computing many tsunami source "scenarios" and compiling those results into a database accessible and calibrated with observations during an event. Seismic source evaluation determines the order of model pre
2011-01-13
..., 2010, an explosion and subsequent fire damaged the Deepwater Horizon MC252 oil rig, which capsized and... Mediterranean stock. Therefore, management actions taken in the eastern Atlantic and Mediterranean are likely to... have significant effects on the West due to the fact that Eastern plus Mediterranean resource is much...
Leung, L. R.; Balaguru, K.; Foltz, G. R.
2017-12-01
During the 2017 Atlantic hurricane season, several hurricanes underwent rapid intensification (RI) in the central-eastern Atlantic. This motivates an analysis of trends in the strength of hurricane RI during the 30-year post-satellite period of 1986-2015. Our results show that in the eastern tropical Atlantic, to the east of 60W, the mean RI magnitude averaged during 2001-2015 was 3.8 kt per 24 hr higher than during 1986-2000. However, in the western tropical Atlantic, to the west of 60W, changes in RI magnitude over the same period were not statistically significant. We examined the large-scale environment to understand the causes behind these changes in RI magnitude and found that various oceanic and atmospheric parameters that play an important role in RI changed favorably in the eastern tropical Atlantic. More specifically, changes in SST, Potential Intensity, upper-ocean heat content, wind shear, relative humidity and upper-level divergence enhanced the ability for hurricanes to undergo RI in the eastern tropical Atlantic. In contrast, changes in the same factors are inconsistent in the western tropical Atlantic. While changes in SST and Potential Intensity were positive, changes in upper-ocean heat content, wind shear and upper-level divergence were either insignificant or unfavorable for RI. Finally, we examined the potential role of various climate phenomena, which are well-known to impact Atlantic hurricane activity, in causing the changes in the large-scale environment. Our analysis reveals that changes in the Atlantic Multidecadal Oscillation over the 30-year period are predominantly responsible. These results provide important aspects of the large-scale context to understand the Atlantic hurricane season of 2017.
Adefurin, O.; Hamdy, M; Zwart, S.J.
2016-01-01
Rice is one of the major staple foods consumed in Africa and its demand continues to increase as a result of population growth, urbanization and changing diets. Mangrove rice cultivation is of importance along the West-African Atlantic coast from Senegal and Gambia down to Guinea-Bissau,
Directory of Open Access Journals (Sweden)
Qin Zhou
2013-05-01
Full Text Available Atlantic Water, with its origin in the western Atlantic, enters the Nordic Seas partly as a barotropic current following the continental slope. This water mass is carried across the Atlantic by the baroclinic North Atlantic Current (NAC. When the NAC meets the continental slope at the east side of the Atlantic, some of the transport is converted to barotropic transport over the slope before continuing northward. Here, we show that this baroclinic to barotropic conversion is in agreement with geostrophic theory. Historical observations show that the transport of the slope current increases significantly from the Rockall Channel (RC to the Faroe–Shetland Channel (FSC. Geostrophy predicts that with a northward decreasing buoyancy, baroclinic currents from the west will be transferred into northward topographically steered barotropic flow. We use hydrographic data from two sections crossing the continental slope, one located in the RC and another in the FSC, to estimate baroclinic and barotropic transport changes over the slope, within the framework of geostrophic dynamics. Our results indicate that ~1 Sv of the cross-slope baroclinic flow is mainly converted to northward barotropic transport above the 200–500m isobaths, which is consistent with observed transport changes between the RC and the FSC. Similar processes are also likely to occur further south, along the eastern Atlantic margin. This shows that AW within the slope current in the FSC is derived from both the eastern and the western Atlantic, in agreement with earlier studies of AW inflow to the Nordic Seas.
Lionfish (Pterois spp.) invade the upper-bathyal zone in the western Atlantic.
Gress, Erika; Andradi-Brown, Dominic A; Woodall, Lucy; Schofield, Pamela J; Stanley, Karl; Rogers, Alex D
2017-01-01
Non-native lionfish have been recorded throughout the western Atlantic on both shallow and mesophotic reefs, where they have been linked to declines in reef health. In this study we report the first lionfish observations from the deep sea (>200 m) in Bermuda and Roatan, Honduras, with lionfish observed to a maximum depth of 304 m off the Bermuda platform, and 250 m off West End, Roatan. Placed in the context of other deeper lionfish observations and records, our results imply that lionfish may be present in the 200-300 m depth range of the upper-bathyal zone across many locations in the western Atlantic, but currently are under-sampled compared to shallow habitats. We highlight the need for considering deep-sea lionfish populations in future invasive lionfish management.
Lionfish (Pterois spp. invade the upper-bathyal zone in the western Atlantic
Directory of Open Access Journals (Sweden)
Erika Gress
2017-08-01
Full Text Available Non-native lionfish have been recorded throughout the western Atlantic on both shallow and mesophotic reefs, where they have been linked to declines in reef health. In this study we report the first lionfish observations from the deep sea (>200 m in Bermuda and Roatan, Honduras, with lionfish observed to a maximum depth of 304 m off the Bermuda platform, and 250 m off West End, Roatan. Placed in the context of other deeper lionfish observations and records, our results imply that lionfish may be present in the 200–300 m depth range of the upper-bathyal zone across many locations in the western Atlantic, but currently are under-sampled compared to shallow habitats. We highlight the need for considering deep-sea lionfish populations in future invasive lionfish management.
Post-Glacial Development of Western North Atlantic - Labrador Sea Oceanographic Circulation
DEFF Research Database (Denmark)
Sheldon, Christina
2015-01-01
The subpolar North Atlantic Ocean – Labrador Sea region is an important site for both oceanographic and atmospheric circulation. The convergence of ocean currents causes downwelling of cold, saline water in the subpolar gyre, helping to drive the world-wide thermohaline circulation system. The main......, the subpolar gyre weakened, which carried less Gulf Stream-derived water to the western North Atlantic Ocean via the West Greenland Current and the Slopewater Current, south of Newfoundland. Changes in the subpolar gyre circulation had developed to be analogous to the modern climate by approximately 2 cal kyr...... surface currents involved in the gyre are the south-flowing, cold and relatively fresh Labrador Current and the north-flowing, warm and relatively saline Gulf Stream. The oceanic front between these two major currents moves north and south, dependent on the relative strengths of the currents, impacting...
International Nuclear Information System (INIS)
Anon.
1988-01-01
The centroid of proton-antiproton physics is moving west across the Atlantic concluded Luigi Di Leila of CERN in his summary talk at the Topical Workshop on Proton-Antiproton Collider Physics, held at Fermilab in June. Previous meetings in this series had been dominated by results from CERN's big proton-antiproton collider, dating back to 1981. However last year saw the first physics run at Fermilab's collider, and although the number of collisions in the big CDF detector was only about one thirtieth of the score so far at CERN, the increased collision energy at Fermilab of 1.8 TeV (1800 GeV, compared to the routine 630 GeV at CERN) is already paying dividends
The Yermak Pass Branch: A Major Pathway for the Atlantic Water North of Svalbard?
Koenig, Zoé; Provost, Christine; Sennéchael, Nathalie; Garric, Gilles; Gascard, Jean-Claude
2017-12-01
An upward-looking Acoustic Doppler Current Profiler deployed from July 2007 to September 2008 in the Yermak Pass, north of Svalbard, gathered velocity data from 570 m up to 90 m at a location covered by sea ice 10 months out of 12. Barotropic diurnal and semidiurnal tides are the dominant signals in the velocity (more than 70% of the velocity variance). In winter, baroclinic eddies at periods between 5 and 15 days and pulses of 1-2 month periodicity are observed in the Atlantic Water layer and are associated with a shoaling of the pycnocline. Mercator-Ocean global operational model with daily and 1/12° spatial resolution is shown to have skills in representing low-frequency velocity variations (>1 month) in the West Spitsbergen Current and in the Yermak Pass. Model outputs suggest that the Yermak Pass Branch has had a robust winter pattern over the last 10 years, carrying on average 31% of the Atlantic Water volume transport of the West Spitsbergen Current (36% in autumn/winter). However, those figures have to be considered with caution as the model neither simulates tides nor fully resolves eddies and ignores residual mean currents that could be significant.
ProAtlantic - The Atlantic Checkpoint - Data Availability and Adequacy in the Atlantic Basin
McGrath, F.
2017-12-01
DG MAREs Atlantic Checkpoint is a basin scale wide monitoring system assessment activity based upon targeted end-user applications. It is designed to be a benchmark for the assessment of hydrographic, geological, habitat, climate and fisheries data existence and availability in the Atlantic basin. DG MAREs Atlantic Checkpoint service will be delivered by the ProAtlantic project. The objective of this project is to investigate, through appropriate methodologies in the framework of 11 key marine challenges, how current international and national data providers - e.g. EMODNet, Copernicus - meet the requirements of the stakeholders and deliver fit for purpose data. By so doing, the main thematic and geographic gaps will be readily identified in the Atlantic basin for future consideration by DG MARE. For each challenge, specific web products in the form of maps, metadata, spreadsheets and reports will be delivered. These products are not an end by themselves but rather a means of showing whether data were available, let alone accessible. For example, the Fisheries Impact Challenge outputs include data grids (VMS/Seabed) and data adequacy reports. Production of gridded data layers in order to show the extent of fisheries impact on the seafloor involved the identification, acquisition and collation of data sources for the required data types (VMS/Seabed/Habitats Data) in the Atlantic basin. The resulting spatial coverage of these grids indicates the relatively low level of data availability and adequacy across the Atlantic basin. Aside from the data delivered by programmes such as EMODNet and Copernicus, there are a lot of initiatives by regional bodies such as OSPAR and ICES that consist of assembling and disseminating data to address specific issues. Several international projects have delivered research, data collection, and networking around several of the Atlantic Checkpoint challenge topics, namely MPAs, renewable energy assessment, seabed mapping, oil spill
Elands, B.H.M.; Bell, S.; Blok, J.
2010-01-01
Chapter 2 explores recreation and tourism practices in forest areas in the Atlantic region, which refers to the geographical area close to the North Sea and the Atlantic Ocean. The Atlantic countries described in this section are Belgium (Flanders and Wallonia), Denmark, Iceland, Ireland, the
48 CFR 452.232-70 - Reimbursement for Bond Premiums-Fixed-Price Construction Contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reimbursement for Bond... Provisions and Clauses 452.232-70 Reimbursement for Bond Premiums—Fixed-Price Construction Contracts. As prescribed in 432.111, insert the following clause: Reimbursement for Bond Premiums—Fixed-Price Construction...
Regionally and seasonally differentiated primary production in the North Atlantic
Sathyendranath, Shubha; Longhurst, Alan; Caverhill, Carla M.; Platt, Trevor
1995-10-01
A bio-geochemical classification of the N. Atlantic Basin is presented according to which the basin is first divided into four primary algal domains: Polar, West-Wind, Trades and Coastal. These are in turn sub-divided into smaller provinces. The classification is based on differences in the physical environment which are likely to influence regional algal dynamics. The seasonally-differentiated parameters of the photosynthesis-light curve ( P-I curve) and parameters that define the vertical structure in chlorophyll profile are then established for each province, based on an analysis of an archive of over 6000 chlorophyll profiles, and over 1800 P-I curves. These are then combined with satellite-derived chlorophyll data for the N. Atlantic, and information on cloud cover, to compute primary production at the annual scale. using a model that computes spectral transmission of light underwater, and spectral, photosynthetic response of phytoplankton to available light. The results are compared with earlier, satellite-derived, estimates of basin-scale primary production.
76 FR 72383 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures
2011-11-23
...-BA17 Atlantic Highly Migratory Species; Atlantic Shark Management Measures AGENCY: National Marine... plan (FMP) amendment that would consider catch shares for the Atlantic shark fisheries. The comment... potential catch shares programs in the Atlantic shark fisheries. Additionally, NMFS is extending the comment...
Cenozoic uplift and subsidence in the North Atlantic region
DEFF Research Database (Denmark)
Anell, Ingrid Anna Margareta; Thybo, Hans; Artemieva, Irina
2009-01-01
and the surrounding areas. (2) A regional increase in subsidence in the offshore marginal areas of Norway, the northern North Sea, the northern British Isles and west Greenland took place in the Eocene (ca 57-35 Ma). (3) The Oligocene and Miocene (35-5 Ma) were characterized by regional tectonic quiescence, with only...... localised uplift, probably related to changes in plate dynamics. (4) The second major phase of regional uplift that affected all marginal areas of the North Atlantic occurred in the Plio-Pleistocene (5-0 Ma). Its amplitude was enhanced by erosion-driven glacio-isostatic compensation. Despite inconclusive...
78 FR 54195 - Atlantic Highly Migratory Species; Atlantic Commercial Shark Fisheries
2013-09-03
.... 110831548-3536-02] RIN 0648-XC836 Atlantic Highly Migratory Species; Atlantic Commercial Shark Fisheries...) dressed weight (dw) of non-blacknose small coastal shark (SCS) quota from the Atlantic region to the Gulf... Atlantic shark permitted vessels. DATES: The quota transfer is effective from September 2, 2013 until...
History and the West Indian nation
Directory of Open Access Journals (Sweden)
Frank Birbalsingh
1998-07-01
Full Text Available [First paragraph] The Art of Kamau Brathwaite. STEWART BROWN (ed.. Bridgend, Wales: Seren/Poetry Wales Press, 1995. 275 pp. (Cloth US$ 50.00, Paper US$ 22.95 Atlantic Passages: History, Community, and Language in the Fiction of Sam Selvon. MARK LOOKER. New York: Peter Lang, 1996. x + 243 pp. (Cloth n.p. Caliban's Curse: George Lamming and the Revisioning of History. SUPRIYA NAIR. Ann Arbor: University of Michigan Press, 1996. viii + 171 pp. (Cloth US$ 34.50 Phyllis Shand Allfrey: A Caribbean Life. LlZABETH PARAVISINI-GEBERT. New Brunswick NJ: Rutgers University Press, 1996. xii + 335 pp. (Cloth US$ 55.00, Paper US$ 18.95 Of the four books to be considered here, those on Brathwaite, Selvon, and Lamming fit snugly together into a natural category of literature that has to do with the emergence of a Creole or African-centered Caribbean culture, and related issues of race, color, class, history, and nationality. The fourth is a biography of Phyllis Shand Allfrey, a white West Indian, who is of an altogether different race, color, and class than from the other three. Yet the four books are linked together by nationality, for Allfrey and the others are all citizens of one region, the English-speaking West Indies, which, as the Federation of the West Indies between 1958 and 1962, formed a single nation.
International Nuclear Information System (INIS)
Aarkrog, A.; Boelskifte, S.; Buch, E.; Christensen, G.C.; Dahlgaard, H.; Hallstadius, L.; Hansen, H.; Holm, E.; Mattsson, S.; Meide, A.
1984-12-01
Measurements of fallout radioactivity in the North Atlantic region including the Faroe Islands and Greenland are reported. Strontium-90 and cesium-137 was determined in samples of precipitation, sea water, vegetation, various foodstuffs (including milk in the Faroes) and drinking water. Estimates are given of the mean contents of 90 Sr and 137 Cs in human diet in the Faroes and Greenland in 1983. Results from samplings of surface sea water and seaweed in the Norwegian and Greenland Seas and along the Norwegian and Greenland west coasts are reported. Beside radiocesium and 90 Sr some of these samples have also been anlysed for tritium,plutonium and americium. Finally technetium-99 data on seaweed samples collected in the North Atlantic region since the beginning of the sixties are presented. (author)
International Nuclear Information System (INIS)
Aarkrog, A.; Boelskifte, S.; Buch, E.; Christensen, G.C.; Dahlgaard, H.; Hallstadius, L.; Hansen, H.; Holm, E.
1985-12-01
Measurements of fallout radioactivity in the North Atlantic region including the Faroe Islands and Greenland are reported. Strontium-90 and cesium-137 was determined in samples of precipitation, sea water, vegetation, various foodstuffs (including milk in the Faroes) and drinking water. Estimates are given of the mean contents of 90 Sr and 137 Cs in human diet in the Faroes and Greenland in 1984. Results from samplings of surface sea water and seaweed in the Norwegian and Greenland Seas and along the Norwegian and Greenland west coasts are reported. Beside radiocesium and 90 Sr some of these samples have also been anlysed for tritium, polonium, plutonium and americium. Finally technetium-99 data on seaweed samples collected in the North Atlantic region since the beginning of the sixties are presented. (author)
DEFF Research Database (Denmark)
Mahe, Kélig; Oudard, Clémence; Mille, Tiphaine
2016-01-01
Atlantic using 1693 samples from mature fish collected between 37°N and 75°N and 20°W and 25°E. The results indicated two stocks located north and south of ICES Divisions VIa and VIb (54°5N to 60°5N, 4°W to 11°W). The central area corresponds to the spawning area west of Scotland. Sampling year effects...
Cabral, Wayne A; Barnes, Aileen M; Adeyemo, Adebowale; Cushing, Kelly; Chitayat, David; Porter, Forbes D; Panny, Susan R; Gulamali-Majid, Fizza; Tishkoff, Sarah A; Rebbeck, Timothy R; Gueye, Serigne M; Bailey-Wilson, Joan E; Brody, Lawrence C; Rotimi, Charles N; Marini, Joan C
2012-05-01
Deficiency of prolyl 3-hydroxylase 1, encoded by LEPRE1, causes recessive osteogenesis imperfecta (OI). We previously identified a LEPRE1 mutation exclusively in African Americans and contemporary West Africans. We hypothesized that this allele originated in West Africa and was introduced to the Americas with the Atlantic slave trade. We aimed to determine the frequency of carriers for this mutation among African Americans and West Africans, and the mutation origin and age. Genomic DNA was screened for the mutation using PCR and restriction digestion, and a custom TaqMan genomic single-nucleotide polymorphism assay. The mutation age was estimated using microsatellites and short tandem repeats spanning 4.2 Mb surrounding LEPRE1 in probands and carriers. Approximately 0.4% (95% confidence interval: 0.22-0.68%) of Mid-Atlantic African Americans carry this mutation, estimating recessive OI in 1/260,000 births in this population. In Nigeria and Ghana, 1.48% (95% confidence interval: 0.95-2.30%) of unrelated individuals are heterozygous carriers, predicting that 1/18,260 births will be affected with recessive OI, equal to the incidence of de novo dominant OI. The mutation was not detected in Africans from surrounding countries. All carriers shared a haplotype of 63-770 Kb, consistent with a single founder for this mutation. Using linkage disequilibrium analysis, the mutation was estimated to have originated between 650 and 900 years before present (1100-1350 CE). We identified a West African founder mutation for recessive OI in LEPRE1. Nearly 1.5% of Ghanians and Nigerians are carriers. The estimated age of this allele is consistent with introduction to North America via the Atlantic slave trade (1501-1867 CE).
Varela-Á lvarez, Elena; Balau, Ana C.; Marbà , Nú rià N.; Afonso-Carrillo, Julio; Duarte, Carlos M.; Serrã o, Ester Á lvares
2015-01-01
Knowledge of spatial patterns of genetic differentiation between populations is key to understanding processes in evolutionary history of biological species. Caulerpa is a genus of marine green algae, which has attracted much public attention, mainly because of the impacts of invasive species in the Mediterranean. However, very little is known about the ecological and evolutionary history of the Mediterranean native Caulerpa prolifera, a species which is currently found at sites distributed worldwide. C. prolifera provides a good model to explore the patterns of genetic diversity at different scales across the Mediterranean and Atlantic area. This study aims to investigate the biogeographical patterns of diversity and differentiation of C. prolifera in the Mediterranean, with special focus on the Mediterranean/Atlantic transition zone. We used two nuclear (ITS rDNA and the hypervariable microsatellite locus CaPr_J2) and one chloroplast (tufA) DNA markers on samples of C. prolifera from its entire range. Analyses of 51 sequences of the cpDNA tufA of C. prolifera, 87 ITS2 sequences and genotypes of 788 ramets of C. prolifera for the locus CaPr_J2 revealed three different biogeographical areas: West Atlantic, East Atlantic and a larger area representing the Mediterranean, the Mediterranean/Atlantic transition zone and a Pacific site (Bali). It was found out that the Mediterranean/Atlantic transition zone is a biogeographical boundary for C. prolifera. A lack of connectivity was revealed between Atlantic and Mediterranean types, and identical sequences found in the Mediterranean and Indo-Pacific suggest either recent gene flow along the Red Sea connection or a possible ancient Indo-Pacific origin.
Varela-Álvarez, Elena
2015-01-11
Knowledge of spatial patterns of genetic differentiation between populations is key to understanding processes in evolutionary history of biological species. Caulerpa is a genus of marine green algae, which has attracted much public attention, mainly because of the impacts of invasive species in the Mediterranean. However, very little is known about the ecological and evolutionary history of the Mediterranean native Caulerpa prolifera, a species which is currently found at sites distributed worldwide. C. prolifera provides a good model to explore the patterns of genetic diversity at different scales across the Mediterranean and Atlantic area. This study aims to investigate the biogeographical patterns of diversity and differentiation of C. prolifera in the Mediterranean, with special focus on the Mediterranean/Atlantic transition zone. We used two nuclear (ITS rDNA and the hypervariable microsatellite locus CaPr_J2) and one chloroplast (tufA) DNA markers on samples of C. prolifera from its entire range. Analyses of 51 sequences of the cpDNA tufA of C. prolifera, 87 ITS2 sequences and genotypes of 788 ramets of C. prolifera for the locus CaPr_J2 revealed three different biogeographical areas: West Atlantic, East Atlantic and a larger area representing the Mediterranean, the Mediterranean/Atlantic transition zone and a Pacific site (Bali). It was found out that the Mediterranean/Atlantic transition zone is a biogeographical boundary for C. prolifera. A lack of connectivity was revealed between Atlantic and Mediterranean types, and identical sequences found in the Mediterranean and Indo-Pacific suggest either recent gene flow along the Red Sea connection or a possible ancient Indo-Pacific origin.
Gan, Xiao-Ning; Luo, Jie; Tang, Rui-Xue; Wang, Han-Lin; Zhou, Hong; Qin, Hui; Gan, Ting-Qing; Chen, Gang
2017-05-01
The role and mechanism of miR-452-5p in lung adenocarcinoma remain unclear. In this study, we performed a systematic study to investigate the clinical value of miR-452-5p expression in lung adenocarcinoma. The expression of miR-452-5p in 101 lung adenocarcinoma patients was detected by quantitative real-time polymerase chain reaction. The Cancer Genome Atlas and Gene Expression Omnibus databases were joined to verify the expression level of miR-452-5p in lung adenocarcinoma. Via several online prediction databases and bioinformatics software, pathway and network analyses of miR-452-5p target genes were performed to explore its prospective molecular mechanism. The expression of miR-452-5p in lung adenocarcinoma in house was significantly lower than that in adjacent tissues (p < 0.001). Additionally, the expression level of miR-452-5p was negatively correlated with several clinicopathological parameters including the tumor size (p = 0.014), lymph node metastasis (p = 0.032), and tumor-node-metastasis stage (p = 0.036). Data from The Cancer Genome Atlas also confirmed the low expression of miR-452 in lung adenocarcinoma (p < 0.001). Furthermore, reduced expression of miR-452-5p in lung adenocarcinoma (standard mean deviations = -0.393, 95% confidence interval: -0.774 to -0.011, p = 0.044) was validated by a meta-analysis. Five hub genes targeted by miR-452-5p, including SMAD family member 4, SMAD family member 2, cyclin-dependent kinase inhibitor 1B, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon, and tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta, were significantly enriched in the cell-cycle pathway. In conclusion, low expression of miR-452-5p tends to play an essential role in lung adenocarcinoma. Bioinformatics analysis might be beneficial to reveal the potential mechanism of miR-452-5p in lung adenocarcinoma.
Genome-wide physical activity interactions in adiposity - A meta-analysis of 200,452 adults
Graff, Mariaelisa; Scott, Robert A; Justice, Anne E; Young, Kristin L; Feitosa, Mary F; Barata, Llilda; Winkler, Thomas W; Chu, Audrey Y; Mahajan, Anubha; Hadley, David; Xue, Luting; Workalemahu, Tsegaselassie; Heard-Costa, Nancy L; den Hoed, Marcel; Ahluwalia, Tarunveer S; Qi, Qibin; Ngwa, Julius S; Renström, Frida; Quaye, Lydia; Eicher, John D; Hayes, James E; Cornelis, Marilyn; Kutalik, Zoltan; Lim, Elise; Luan, Jian'an; Huffman, Jennifer E; Zhang, Weihua; Zhao, Wei; Griffin, Paula J; Haller, Toomas; Ahmad, Shafqat; Marques-Vidal, Pedro M; Bien, Stephanie; Yengo, Loic; Teumer, Alexander; Smith, Albert Vernon; Kumari, Meena; Harder, Marie Neergaard; Justesen, Johanne Marie; Kleber, Marcus E; Hollensted, Mette; Lohman, Kurt; Rivera, Natalia V; Whitfield, John B; Zhao, Jing Hua; Stringham, Heather M; Lyytikäinen, Leo-Pekka; Huppertz, Charlotte; Willemsen, Gonneke; Peyrot, Wouter J; Wu, Ying; Kristiansson, Kati; Demirkan, Ayse; Fornage, Myriam; Hassinen, Maija; Bielak, Lawrence F; Cadby, Gemma; Tanaka, Toshiko; Mägi, Reedik; van der Most, Peter J; Jackson, Anne U; Bragg-Gresham, Jennifer L; Vitart, Veronique; Marten, Jonathan; Navarro, Pau; Bellis, Claire; Pasko, Dorota; Johansson, Åsa; Snitker, Søren; Cheng, Ching-Yu; Eriksson, Joel; Lim, Unhee; Aadahl, Mette; Adair, Linda S; Amin, Najaf; Balkau, Beverley; Auvinen, Juha; Beilby, John; Bergman, Richard N; Bergmann, Sven; Bertoni, Alain G; Blangero, John; Bonnefond, Amélie; Bonnycastle, Lori L; Borja, Judith B; Brage, Søren; Busonero, Fabio; Buyske, Steve; Campbell, Harry; Chines, Peter S; Collins, Francis S; Corre, Tanguy; Smith, George Davey; Delgado, Graciela E; Dueker, Nicole; Dörr, Marcus; Ebeling, Tapani; Eiriksdottir, Gudny; Esko, Tõnu; Faul, Jessica D; Fu, Mao; Færch, Kristine; Gieger, Christian; Gläser, Sven; Gong, Jian; Gordon-Larsen, Penny; Grallert, Harald; Grammer, Tanja B; Grarup, Niels; van Grootheest, Gerard; Harald, Kennet; Hastie, Nicholas D; Havulinna, Aki S; Hernandez, Dena G; Hindorff, Lucia; Hocking, Lynne J; Holmens, Oddgeir L; Holzapfel, Christina; Hottenga, Jouke Jan; Huang, Jie; Huang, Tao; Hui, Jennie; Huth, Cornelia; Hutri-Kähönen, Nina; James, Alan L; Jansson, John-Olov; Jhun, Min A; Juonala, Markus; Kinnunen, Leena; Koistinen, Heikki A; Kolcic, Ivana; Komulainen, Pirjo; Kuusisto, Johanna; Kvaløy, Kirsti; Kähönen, Mika; Lakka, Timo A; Launer, Lenore J; Lehne, Benjamin; Lindgren, Cecilia M; Lorentzon, Mattias; Luben, Robert; Marre, Michel; Milaneschi, Yuri; Monda, Keri L; Montgomery, Grant W; De Moor, Marleen H M; Mulas, Antonella; Müller-Nurasyid, Martina; Musk, A.W.; Männikkö, Reija; Männistö, Satu; Narisu, Narisu; Nauck, Matthias; Nettleton, Jennifer A; Nolte, Ilja M; Oldehinkel, Albertine J; Olden, Matthias; Ong, Ken K; Padmanabhan, Sandosh; Paternoster, Lavinia; Perez, Jeremiah; Perola, Markus; Peters, Annette; Peters, Ulrike; Peyser, Patricia A; Prokopenko, Inga; Puolijoki, Hannu; Raitakari, Olli T; Rankinen, Tuomo; Rasmussen-Torvik, Laura J; Rawal, Rajesh; Ridker, Paul M; Rose, Lynda M; Rudan, Igor; Sarti, Cinzia; Sarzynski, Mark A; Savonen, Kai; Scott, William R; Sanna, Serena; Shuldiner, Alan R; Sidney, Steve; Silbernagel, Günther; Smith, Blair H; Smith, Jennifer A; Snieder, Harold; Stančáková, Alena; Sternfeld, Barbara; Swift, Amy J; Tammelin, Tuija; Tan, Sian-Tsung; Thorand, Barbara; Thuillier, Dorothée; Vandenput, Liesbeth; Vestergaard, Henrik; van Vliet-Ostaptchouk, Jana V; Vohl, Marie-Claude; Völker, Uwe; Waeber, Gérard; Walker, Mark; Wild, Sarah; Wong, Andrew; Wright, Alan F; Zillikens, M Carola; Zubair, Niha; Haiman, Christopher A; Lemarchand, Loic; Gyllensten, Ulf; Ohlsson, Claes; Hofman, Albert; Rivadeneira, Fernando; Uitterlinden, André G; Pérusse, Louis; Wilson, James F; Hayward, Caroline; Polasek, Ozren; Cucca, Francesco; Hveem, Kristian; Hartman, Catharina A; Tönjes, Anke; Bandinelli, Stefania; Palmer, Lyle J; Kardia, Sharon L R; Rauramaa, Rainer; Sørensen, Thorkild I A; Tuomilehto, Jaakko; Salomaa, Veikko; Penninx, Brenda W J H; de Geus, Eco J C; Boomsma, Dorret I; Lehtimäki, Terho; Mangino, Massimo; Laakso, Markku; Bouchard, Claude; Martin, Nicholas G; Kuh, Diana; Liu, YongMei; Linneberg, Allan; März, Winfried; Strauch, Konstantin; Kivimäki, Mika; Harris, Tamara B; Gudnason, Vilmundur; Völzke, Henry; Qi, Lu; Järvelin, Marjo-Riitta; Chambers, John C; Kooner, Jaspal S; Froguel, Philippe; Kooperberg, Charles; Vollenweider, Peter; Hallmans, Göran; Hansen, Torben; Pedersen, Oluf; Metspalu, Andres; Wareham, Nicholas J; Langenberg, Claudia; Weir, David R; Porteous, David J; Boerwinkle, Eric; Chasman, Daniel I; Abecasis, Gonçalo R; Barroso, Inês; McCarthy, Mark I; Frayling, Timothy M; O'Connell, Jeffrey R; van Duijn, Cornelia M; Boehnke, Michael; Heid, Iris M; Mohlke, Karen L; Strachan, David P; Fox, Caroline S; Liu, Ching-Ti; Hirschhorn, Joel N; Klein, Robert J; Johnson, Andrew D; Borecki, Ingrid B; Franks, Paul W; North, Kari E; Cupples, L Adrienne; Loos, Ruth J F; Kilpeläinen, Tuomas O
Physical activity (PA) may modify the genetic effects that give rise to increased risk of obesity. To identify adiposity loci whose effects are modified by PA, we performed genome-wide interaction meta-analyses of BMI and BMI-adjusted waist circumference and waist-hip ratio from up to 200,452 adults
Phylogeographic structure and demographic patterns of brown trout in North-West Africa.
Snoj, Aleš; Marić, Saša; Bajec, Simona Sušnik; Berrebi, Patrick; Janjani, Said; Schöffmann, Johannes
2011-10-01
The objectives of the study were to determine the phylogeographic structure of brown trout (Salmo trutta) in Morocco, elucidate their colonization patterns in North-West Africa and identify the mtDNA lineages involved in this process. We also aimed to resolve whether certain brown trout entities are also genetically distinct. Sixty-two brown trout from eleven locations across the Mediterranean and the Atlantic drainages in Morocco were surveyed using sequence analysis of the mtDNA control region and nuclear gene LDH, and by genotyping twelve microsatellite loci. Our study confirms that in Morocco both the Atlantic and Mediterranean basins are populated by Atlantic mtDNA lineage brown trout only, demonstrating that the Atlantic lineage (especially its southern clade) invaded initially not only the western part of the Mediterranean basin in Morocco but also expanded deep into the central area. Atlantic haplotypes identified here sort into three distinct groups suggesting Morocco was colonized in at least three successive waves (1.2, 0.4 and 0.2-0.1 MY ago). This notion becomes more pronounced with the finding of a distinct haplotype in the Dades river system, whose origin appears to coalesce with the nascent stage of the basal mtDNA evolutionary lineages of brown trout. According to our results, Salmo akairos, Salmo pellegrini and "green trout" from Lake Isli do not exhibited any character states that distinctively separate them from the other brown trout populations studied. Therefore, their status as distinct species was not confirmed. Copyright © 2011 Elsevier Inc. All rights reserved.
Connecting Atlantic temperature variability and biological cycling in two earth system models
Gnanadesikan, Anand; Dunne, John P.; Msadek, Rym
2014-05-01
Connections between the interdecadal variability in North Atlantic temperatures and biological cycling have been widely hypothesized. However, it is unclear whether such connections are due to small changes in basin-averaged temperatures indicated by the Atlantic Multidecadal Oscillation (AMO) Index, or whether both biological cycling and the AMO index are causally linked to changes in the Atlantic Meridional Overturning Circulation (AMOC). We examine interdecadal variability in the annual and month-by-month diatom biomass in two Earth System Models with the same formulations of atmospheric, land, sea ice and ocean biogeochemical dynamics but different formulations of ocean physics and thus different AMOC structures and variability. In the isopycnal-layered ESM2G, strong interdecadal changes in surface salinity associated with changes in AMOC produce spatially heterogeneous variability in convection, nutrient supply and thus diatom biomass. These changes also produce changes in ice cover, shortwave absorption and temperature and hence the AMO Index. Off West Greenland, these changes are consistent with observed changes in fisheries and support climate as a causal driver. In the level-coordinate ESM2M, nutrient supply is much higher and interdecadal changes in diatom biomass are much smaller in amplitude and not strongly linked to the AMO index.
75 FR 57235 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures
2010-09-20
.... 100825390-0431-01] RIN 0648-BA17 Atlantic Highly Migratory Species; Atlantic Shark Management Measures... on potential adjustments to the regulations governing the U.S. Atlantic shark fishery to address several specific issues currently affecting management of the shark fishery and to identify specific goals...
75 FR 30483 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures; Amendment 3
2010-06-01
... and 635 Atlantic Highly Migratory Species; Atlantic Shark Management Measures; Amendment 3; Final Rule... and 635 [Docket No. 080519678-0217-02] RIN 0648-AW65 Atlantic Highly Migratory Species; Atlantic Shark... available to rebuild blacknose sharks and end overfishing of blacknose and shortfin mako sharks, consistent...
76 FR 67121 - Atlantic Highly Migratory Species; 2012 Atlantic Shark Commercial Fishing Season
2011-10-31
.... 110913585-1625-01] RIN 0648-BB36 Atlantic Highly Migratory Species; 2012 Atlantic Shark Commercial Fishing... establish opening dates and adjust quotas for the 2012 fishing season for the Atlantic commercial shark... 2011 Atlantic commercial shark fishing seasons. In addition, NMFS proposes season openings based on...
77 FR 61562 - Atlantic Highly Migratory Species; 2013 Atlantic Shark Commercial Fishing Season
2012-10-10
.... 120706221-2481-01] RIN 0648-XC106 Atlantic Highly Migratory Species; 2013 Atlantic Shark Commercial Fishing... establish opening dates and adjust quotas for the 2013 fishing season for the Atlantic commercial shark... the 2011 and 2012 Atlantic commercial shark fishing seasons. We propose to keep the porbeagle shark...
Directory of Open Access Journals (Sweden)
Bowman Sharen
2008-05-01
Full Text Available Abstract Background Cryptophytes are an enigmatic group of unicellular eukaryotes with plastids derived by secondary (i.e., eukaryote-eukaryote endosymbiosis. Cryptophytes are unusual in that they possess four genomes–a host cell-derived nuclear and mitochondrial genome and an endosymbiont-derived plastid and 'nucleomorph' genome. The evolutionary origins of the host and endosymbiont components of cryptophyte algae are at present poorly understood. Thus far, a single complete mitochondrial genome sequence has been determined for the cryptophyte Rhodomonas salina. Here, the second complete mitochondrial genome of the cryptophyte alga Hemiselmis andersenii CCMP644 is presented. Results The H. andersenii mtDNA is 60,553 bp in size and encodes 30 structural RNAs and 36 protein-coding genes, all located on the same strand. A prominent feature of the genome is the presence of a ~20 Kbp long intergenic region comprised of numerous tandem and dispersed repeat units of between 22–336 bp. Adjacent to these repeats are 27 copies of palindromic sequences predicted to form stable DNA stem-loop structures. One such stem-loop is located near a GC-rich and GC-poor region and may have a regulatory function in replication or transcription. The H. andersenii mtDNA shares a number of features in common with the genome of the cryptophyte Rhodomonas salina, including general architecture, gene content, and the presence of a large repeat region. However, the H. andersenii mtDNA is devoid of inverted repeats and introns, which are present in R. salina. Comparative analyses of the suite of tRNAs encoded in the two genomes reveal that the H. andersenii mtDNA has lost or converted its original trnK(uuu gene and possesses a trnS-derived 'trnK(uuu', which appears unable to produce a functional tRNA. Mitochondrial protein coding gene phylogenies strongly support a variety of previously established eukaryotic groups, but fail to resolve the relationships among higher
Synoptic Scale North American Weather Tracks and the Formation of North Atlantic Windstorms
Baum, A. J.; Godek, M. L.
2014-12-01
Each winter, dozens of fatalities occur when intense North Atlantic windstorms impact Western Europe. Forecasting the tracks of these storms in the short term is often problematic, but long term forecasts provide an even greater challenge. Improved prediction necessitates the ability to identify these low pressure areas at formation and understand commonalities that distinguish these storms from other systems crossing the Atlantic, such as where they develop. There is some evidence that indicates the majority of intense windstorms that reach Europe have origins far west, as low pressure systems that develop over the North American continent. This project aims to identify the specific cyclogenesis regions in North America that produce a significantly greater number of dangerous storms. NOAA Ocean Prediction Center surface pressure reanalysis maps are used to examine the tracks of storms. Strong windstorms are characterized by those with a central pressure of less than 965 hPa at any point in their life cycle. Tracks are recorded using a coding system based on source region, storm track and dissipation region. The codes are analyzed to determine which region contains the most statistical significance with respect to strong Atlantic windstorm generation. The resultant set of codes also serves as a climatology of North Atlantic extratropical cyclones. Results indicate that a number of windstorms favor cyclogenesis regions off the east coast of the United States. A large number of strong storms that encounter east coast cyclogenesis zones originate in the central mountain region, around Colorado. These storms follow a path that exits North America around New England and subsequently travel along the Canadian coast. Some of these are then primed to become "bombs" over the open Atlantic Ocean.
Turmel, Monique; de Cambiaire, Jean-Charles; Otis, Christian; Lemieux, Claude
2016-01-01
The Chlorodendrophyceae is a small class of green algae belonging to the core Chlorophyta, an assemblage that also comprises the Pedinophyceae, Trebouxiophyceae, Ulvophyceae and Chlorophyceae. Here we describe for the first time the chloroplast genomes of chlorodendrophycean algae (Scherffelia dubia, 137,161 bp; Tetraselmis sp. CCMP 881, 100,264 bp). Characterized by a very small single-copy (SSC) region devoid of any gene and an unusually large inverted repeat (IR), the quadripartite structures of the Scherffelia and Tetraselmis genomes are unique among all core chlorophytes examined thus far. The lack of genes in the SSC region is offset by the rich and atypical gene complement of the IR, which includes genes from the SSC and large single-copy regions of prasinophyte and streptophyte chloroplast genomes having retained an ancestral quadripartite structure. Remarkably, seven of the atypical IR-encoded genes have also been observed in the IRs of pedinophycean and trebouxiophycean chloroplast genomes, suggesting that they were already present in the IR of the common ancestor of all core chlorophytes. Considering that the relationships among the main lineages of the core Chlorophyta are still unresolved, we evaluated the impact of including the Chlorodendrophyceae in chloroplast phylogenomic analyses. The trees we inferred using data sets of 79 and 108 genes from 71 chlorophytes indicate that the Chlorodendrophyceae is a deep-diverging lineage of the core Chlorophyta, although the placement of this class relative to the Pedinophyceae remains ambiguous. Interestingly, some of our phylogenomic trees together with our comparative analysis of gene order data support the monophyly of the Trebouxiophyceae, thus offering further evidence that the previously observed affiliation between the Chlorellales and Pedinophyceae is the result of systematic errors in phylogenetic reconstruction.
AtlantOS - Optimizing and Enhancing the Integrated Atlantic Ocean Observing System
Reitz, Anja; Visbeck, Martin; AtlantOS Consortium, the
2016-04-01
Atlantic Ocean observation is currently undertaken through loosely-coordinated, in-situ observing networks, satellite observations and data management arrangements of heterogeneous international, national and regional design to support science and a wide range of information products. Thus there is tremendous opportunity to develop the systems towards a fully integrated Atlantic Ocean Observing System consistent with the recently developed 'Framework of Ocean Observing'. The vision of AtlantOS is to improve and innovate Atlantic observing by using the Framework of Ocean Observing to obtain an international, more sustainable, more efficient, more integrated, and fit-for-purpose system. Hence, the AtlantOS initiative will have a long-lasting and sustainable contribution to the societal, economic and scientific benefit arising from this integrated approach. This will be delivered by improving the value for money, extent, completeness, quality and ease of access to Atlantic Ocean data required by industries, product supplying agencies, scientist and citizens. The overarching target of the AtlantOS initiative is to deliver an advanced framework for the development of an integrated Atlantic Ocean Observing System that goes beyond the state-of -the-art, and leaves a legacy of sustainability after the life of the project. The legacy will derive from the following aims: i) to improve international collaboration in the design, implementation and benefit sharing of ocean observing, ii) to promote engagement and innovation in all aspects of ocean observing, iii) to facilitate free and open access to ocean data and information, iv) to enable and disseminate methods of achieving quality and authority of ocean information, v) to strengthen the Global Ocean Observing System (GOOS) and to sustain observing systems that are critical for the Copernicus Marine Environment Monitoring Service and its applications and vi) to contribute to the aims of the Galway Statement on Atlantic
2013-09-30
... Coastal Shark (LCS), Atlantic Hammerhead Shark, Atlantic Blacknose Shark, and Atlantic Non-Blacknose Small Coastal Shark (SCS) Management Groups AGENCY: National Marine Fisheries Service (NMFS), National Oceanic... closing the commercial management groups for aggregated LCS and hammerhead sharks in the Atlantic region...
Effect of Warm Atlantic Waters on the Climate Anomalies in the West Arctic
Directory of Open Access Journals (Sweden)
A. N. Zolotokrylin
2015-01-01
Full Text Available Significant climatic changes of oceanic and atmospheric elements and a relation of them to the ocean surface winter anomalies in North Atlantic are analyzed in the paper. Periods of «warm» ocean (2002–2012 and «cold» ocean (1960–1970 were determined. Positive anomalies of the ocean surface temperature increase the ice-free water area and, correspondingly, decrease the ice-field area. As a result of such changes in a state of the ocean surface (open water and ice, surface air temperature rises, and, consequently, atmospheric pressure in central part of a given Arctic sector drops.
Directory of Open Access Journals (Sweden)
Sabrina Lo Brutto
2018-04-01
Full Text Available Ptilohyale explorator (formerly Parhyale explorator, described by Arresti (1989, can be considered to be a synonym of west-Atlantic Ptilohyale littoralis (Stimpson, 1853, based on morphological observations of paratypes and specimens recently collected in the type locality of Ptilohyale explorator. The first collections of Ptilohyale littoralis, from the eastern Atlantic were from the port of Rotterdam (The Netherlands in 2009 and later in Wimereux, Opal Coast (France in 2014; however, the synonymy of Ptilohyale explorator with Ptilohyale littoralis backdates to the first European record of Ptilohyale littoralis in 1985 at La Vigne, Bay of Arcachon (France. This indicates that Ptilohyale littoralis has been established along European Atlantic coast for many years. An assessment of the nominal valid species belonging to the genus Ptilohyale was carried out and a comparison between the Atlantic Ptilohyale littoralis and the very similar Mediterranean hyalid species, Parhyale plumicornis, is presented based on morphological features and distribution. Due to the invasive ability of Ptilohyale littoralis, a comparison between the two species is necessary.
McKew, Boyd A; Davey, Phillip; Finch, Stewart J; Hopkins, Jason; Lefebvre, Stephane C; Metodiev, Metodi V; Oxborough, Kevin; Raines, Christine A; Lawson, Tracy; Geider, Richard J
2013-10-01
Mechanistic understanding of the costs and benefits of photoacclimation requires knowledge of how photophysiology is affected by changes in the molecular structure of the chloroplast. We tested the hypothesis that changes in the light dependencies of photosynthesis, nonphotochemical quenching and PSII photoinactivation arises from changes in the abundances of chloroplast proteins in Emiliania huxleyi strain CCMP 1516 grown at 30 (Low Light; LL) and 1000 (High Light; HL) μmol photons m(-2) s(-1) photon flux densities. Carbon-specific light-saturated gross photosynthesis rates were not significantly different between cells acclimated to LL and HL. Acclimation to LL benefited cells by increasing biomass-specific light absorption and gross photosynthesis rates under low light, whereas acclimation to HL benefited cells by reducing the rate of photoinactivation of PSII under high light. Differences in the relative abundances of proteins assigned to light-harvesting (Lhcf), photoprotection (LI818-like), and the photosystem II (PSII) core complex accompanied differences in photophysiology: specifically, Lhcf:PSII was greater under LL, whereas LI818:PSII was greater in HL. Thus, photoacclimation in E. huxleyi involved a trade-off amongst the characteristics of light absorption and photoprotection, which could be attributed to changes in the abundance and composition of proteins in the light-harvesting antenna of PSII. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Genome-wide physical activity interactions in adiposity ― A meta-analysis of 200,452 adults
DEFF Research Database (Denmark)
Graff, Mariaelisa; Scott, Robert A.; Justice, Anne E.
2017-01-01
Physical activity (PA) may modify the genetic effects that give rise to increased risk of obesity. To identify adiposity loci whose effects are modified by PA, we performed genome-wide interaction meta-analyses of BMI and BMI-adjusted waist circumference and waist-hip ratio from up to 200,452 adu...
Climate variability in West Greenland during the past 1500 years
DEFF Research Database (Denmark)
dos Santos Ribeiro, Sofia Isabel; Moros, Matthias; Ellegaard, Marianne
2012-01-01
-surface temperatures in Disko Bay are out-of-phase with Greenland ice-core reconstructed temperatures and marine proxy data from South and East Greenland. This is probably governed by an NAO-type pattern, which results in warmer sea-surface conditions with less extensive sea ice in the area for the later part....... Sea ice cover and primary productivity were identified as the two main factors driving dinoflagellate cyst community changes through time. Our data provide evidence for an opposite climate trend in West Greenland relative to the NE Atlantic region from c. AD 500 to 1050. For the same period, sea...
Tsunami Warning Services for the U.S. and Canadian Atlantic Coasts
Whitmore, P. M.; Knight, W.
2008-12-01
In January 2005, the National Oceanic and Atmospheric Administration (NOAA) developed a tsunami warning program for the U.S. Atlantic and Gulf of Mexico coasts. Within a year, this program extended further to the Atlantic coast of Canada and the Caribbean Sea. Warning services are provided to U.S. and Canadian coasts (including Puerto Rico and the Virgin Islands) by the NOAA/West Coast and Alaska Tsunami Warning Center (WCATWC) while the NOAA/Pacific Tsunami Warning Center (PTWC) provides services for non-U.S. entities in the Caribbean Basin. The Puerto Rico Seismic Network (PRSN) is also an active partner in the Caribbean Basin warning system. While the nature of the tsunami threat in the Atlantic Basin is different than in the Pacific, the warning system philosophy is similar. That is, initial messages are based strictly on seismic data so that information is provided to those at greatest risk as fast as possible while supplementary messages are refined with sea level observations and forecasts when possible. The Tsunami Warning Centers (TWCs) acquire regional seismic data through many agencies, such as the United States Geological Survey, Earthquakes Canada, regional seismic networks, and the PRSN. Seismic data quantity and quality are generally sufficient throughout most of the Atlantic area-of-responsibility to issue initial information within five minutes of origin time. Sea level data are mainly provided by the NOAA/National Ocean Service. Coastal tide gage coverage is generally denser along the Atlantic coast than in the Pacific. Seven deep ocean pressure sensors (DARTs), operated by the National Weather Service (NWS) National Data Buoy Center, are located in the Atlantic Basin (5 in the Atlantic Ocean, 1 in the Caribbean, and 1 in the Gulf of Mexico). The DARTs provide TWCs with the means to verify tsunami generation in the Atlantic and provide critical data with which to calibrate forecast models. Tsunami warning response criteria in the Atlantic Basin
Roque, C.; Simões, M.; Lourenço, N.; Pinto de Abreu, M.
2009-04-01
The West Madeira Abyssal Plain is located in the eastern North Atlantic off Madeira Islands, forming part of the Canary Basin and reaching a mean water depth of 5300 m. This region is also located within Africa plate at about 500 km southwards from the Açores-Gibraltar plate boundary, and for that reason lacks seismic activity. Although this region being located in an intraplate setting, the presence of faulted sediments was reported in several works published during the eighties of last century following a study conducted in late 1970s to evaluate the feasibility of disposal of high-level radioactive wastes in the ocean. According these works, the Madeira Abyssal Plain sediments are cut by many normal growth faults and this deformation is a result of compaction and dewatering of the sediments. Evidences of tectonic deformation of oceanic sediments in intraplate settings are uncommon, but folded sediments and reverse faults extending into the basement, were recognized in the equatorial Indian Ocean and in the West African continental margin. Recently, during 2006 multi-channel seismic reflection and multibeam swath bathymetry surveys were carried out in the West Madeira Abyssal Plain by EMEPC in order to prepare the Portuguese proposal for the extension of the continental shelf. The seismic lines were acquired onboard R/V Akademik Shatskiy using a source of 5720 cu in bolt gun array, cable length of 7950 m and shot interval of 50.00 m. The multibeam swath bathymetry was acquired onboard NRP Gago Coutinho, and allowed a high resolution mapping of the main geomorphological features. The multichannel seismic lines, oriented WNW-ESE, image the Madeira island lower slope located at about 4000 m water depth and the almost flat abyssal plain at about 5300 m water depth. These seismic lines show a thick sedimentary succession that reaches a maximum thickness of about 1.5 sec twt in the deepest parts of the West Madeira Abyssal Plain, overlying an irregular diffractive
Refining the learning process in Newfoundland : E-learning innovation at North Atlantic
Energy Technology Data Exchange (ETDEWEB)
Murray, D.
2001-11-01
The Learning Technologies in the Workplace Awards were launched by the Conference Board of Canada in April 2001 with funding from Human Resources Development Canada's Office of Learning Technologies. This paper described the innovative and outstanding efforts made by the winner, North Atlantic. The North Atlantic refinery is located on an inlet on the Avalon Peninsula approximately 135 kilometres west of St. John's, Newfoundland. Each day, 105,000 barrels of oil are processed for export to 25 countries. In 1998, the company recognized that better training was required in the areas of improved safety, performance, and employee innovation and capacity. The isolation faced by the employees was a key driver behind the decision to implement the TRAQS training program in 1999 for e-learning developed by Illuminatus. This on-line training program also features testing through CHALLENGE, a software package compatible with TRAQS learning management system. Process emergency simulation exercises were developed by North Atlantic which are now being used externally. Job-specific technical information is delivered through the local area network (LAN). The keys to success were identified as being: innovative organizational culture; vision and action; executive management support, commitment to learning and employee development; positive work life balance; union cooperation; technology intensive workplace; linking learning with work process and performance management; and, tracking and certification.
Convective Lofting Links Indian Ocean Air Pollution to Recurrent South Atlantic Ozone Maxima
Chatfield, R. B.; Guan, H.; Thompson, A. M.; Witte, J.
2003-12-01
We extend on our analysis of equatorial tropospheric ozone to illustrate the contributions of South Asian pollution export in forming episodes of high O3 over the Atlantic Ocean. We amplify on an earlier description of a broad resolution of the "Atlantic Paradox," for the Jan-Feb-March period, which included initial indications of a very long-distance contribution from South Asia. The approach has been to describe typical periods of significant maximum and minimum tropospheric ozone for early 1999, exploiting TOMS tropospheric ozone estimates jointly with characteristic features of the SHADOZ (Southern Hemisphere Additional Ozonesondes) ozone soundings. Further investigation of the Total Tropospheric Ozone (TTO) record for all of 1999 suggests that there are repeated periods of very long-distance Asian influence crossing Africa, with an apparent effect on those portions of the Atlantic Equatorial troposphere which are downwind. Trajectory analyses suggest that the pattern over the Indian Ocean is complex: a sequence invoving multiple or mixed combustion sources, low level transport, cumulonimbus venting, and high-level transport to the west seem to be indicated by the TTO record. Biomass burning, fossil and biofuel combustion, and lighting seem to all contribute. For the Atlantic, burning and lighting on adjacent continents as well as episodes of this cross-Africa long-distance transport are all linked in a coordinated seasonal march: all are related by movement of the sun. However, interseasonal tropical variability related to the Madden-Julian oscillation allows intermittent ozone buildups that depart from the seasonal norm.
Pérez-Roda, Amparo; Delord, Karine; Boué, Amélie; Arcos, José Manuel; García, David; Micol, Thierry; Weimerskirch, Henri; Pinaud, David; Louzao, Maite
2017-07-01
Marine protected areas (MPAs) are considered one of the main tools in both fisheries and conservation management to protect threatened species and their habitats around the globe. However, MPAs are underrepresented in marine environments compared to terrestrial environments. Within this context, we studied the Atlantic non-breeding distribution of the southern population of Balearic shearwaters (Puffinus mauretanicus) breeding in Eivissa during the 2011-2012 period based on global location sensing (GLS) devices. Our objectives were (1) to identify overall Important Atlantic Areas (IAAs) from a southern population, (2) to describe spatio-temporal patterns of oceanographic habitat use, and (3) to assess whether existing conservation areas (Natura 2000 sites and marine Important Bird Areas (IBAs)) cover the main IAAs of Balearic shearwaters. Our results highlighted that the Atlantic staging (from June to October in 2011) dynamic of the southern population was driven by individual segregation at both spatial and temporal scales. Individuals ranged in the North-East Atlantic over four main IAAs (Bay of Biscay: BoB, Western Iberian shelf: WIS, Gulf of Cadiz: GoC, West of Morocco: WoM). While most individuals spent more time on the WIS or in the GoC, a small number of birds visited IAAs at the extremes of their Atlantic distribution range (i.e., BoB and WoM). The chronology of the arrivals to the IAAs showed a latitudinal gradient with northern areas reached earlier during the Atlantic staging. The IAAs coincided with the most productive areas (higher chlorophyll a values) in the NE Atlantic between July and October. The spatial overlap between IAAs and conservation areas was higher for Natura 2000 sites than marine IBAs (areas with and without legal protection, respectively). Concerning the use of these areas, a slightly higher proportion of estimated positions fell within marine IBAs compared to designated Natura 2000 sites, with Spanish and Portuguese conservation
Coupled ocean-atmosphere surface variability and its climate impacts in the tropical Atlantic region
Fontaine, B.; Janicot, Serge; Roucou, P.
processes at the ocean/atmosphere interface that create anomaly gradients in the meridional plane in a way which tends to alter the north-south movement of the seasonal cycle. This appears to be consistent with the intrinsic non-dipole character of the tropical Atlantic surface variability at the interannual time step and over the recent period, but produces abnormal amplitude and/or delayed excursions of the intertropical convergence zone (ITCZ). Connections with continental rainfall are approached through three (NCEP/NCAR and observed) rainfall indexes over the Nordeste region in Brazil, and the Guinea and Sahel zones in West Africa. These indices appear to be significantly linked to the SST component of the coupled modes only when the two Atlantic modes+the ENSO-like Nino3 index are taken into account in the regressions. This suggests that thermal forcing of continental rainfall is particularly sensitive to the linear combinations of some basic SST patterns, in particular to those that create meridional thermal gradients. The first mode in the Atlantic is associated with transequatorial pressure, moist static energy and precipitable water anomaly patterns which can explain abnormal location of the ITCZ particularly in northern winter, and hence rainfall variations in Nordeste. The second mode is more associated with in-phase variations of the same variables near the southern edge of the ITCZ, particularly in the Gulf of Guinea during the northern spring and winter. It is primarily linked to the amplitude and annual phase of the ITCZ excursions and thus to rainfall variations in Guinea. Connections with Sahel rainfall are less clear due to the difficulty for the model to correctly capture interannual variability over that region but the second Atlantic mode and the ENSO-like Pacific variability are clearly involved in the Sahel climate interannual fluctuations: anomalous dry (wet) situations tend to occur when warmer (cooler) waters are present in the eastern Pacific and
Rothman, Mark D; Mattio, Lydiane; Anderson, Robert J; Bolton, John J
2017-08-01
The genus Laminaria has a wide distribution range compared with other kelp genera because it is found in both the North and the South Atlantic, on both sides of the North Pacific, as well as in the Mediterranean. Hypotheses behind this biogeographical pattern have been discussed by several authors but have not yet been fully evaluated with time-calibrated phylogenies. Based on the analysis of four molecular markers (ITS2, rbcL, atp8 and trnWI), our goal was to reassess the Laminaria species diversity in South Africa, assess its relationship with the other species distributed in the South Atlantic and reconstruct the historical biogeography of the genus. Our results confirm the occurrence of a single species, L. pallida, in southern Africa, and its sister relationship with the North Atlantic L. ochroleuca. Both species belonged to a clade containing the other South Atlantic species: L. abyssalis from Brazil, and the Mediterranean L. rodriguezii. Our time-calibrated phylogenies suggest that Laminaria originated in the northern Pacific around 25 mya, followed by at least two migration events through the Bering Strait after its opening (~5.32 mya). Today, the first is represented by L. solidungula in the Arctic, while the second gave rise to the rest of the Atlantic species. The colonization of the North Atlantic was followed by a gradual colonization southward along the west coast of Europe, into the Mediterranean (~2.07 mya) and two recent, but disconnected, migrations (~1.34 and 0.87 mya) across the equator, giving rise to L. abyssalis in Brazil and L. pallida in southern Africa, respectively. © 2017 Phycological Society of America.
Directory of Open Access Journals (Sweden)
Mauricio Hostim-Silva
2013-06-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n3p153 Estuarine demersal fish assemblage from a transition region between the tropics and the subtropics of the South Atlantic. The coastal state of Espírito Santo is in the central region of Brazil, where biological productivity is considered low. The objective of this work is to present a current list of demersal, estuarine fish from northern Espírito Santo. This work is based on the compilation of data collected monthly using trawl nets. The ichthyofauna comprises 57 species, within 10 orders and 32 families. The family Sciaenidae has the largest number of species (8, followed by Carangidae (4 and Gerreidae (4. This coincides with what has been found for the Brazilian coast and for the coast of the South Atlantic. It is important to note that the total species richness in the estuaries of northern Espírito Santo is lower than other estuaries of the South West Atlantic coast. Most of the species are widely distributed in the Western Atlantic. Only a small part (14% of the fauna of northern Espírito Santo was evaluated in regards to risk of extinction, but conservation should be prioritized in the area due to overexploitation of species.
78 FR 52487 - Atlantic Highly Migratory Species; 2014 Atlantic Shark Commercial Fishing Season
2013-08-23
.... 130402317-3707-01] RIN 0648-XC611 Atlantic Highly Migratory Species; 2014 Atlantic Shark Commercial Fishing... establish opening dates and adjust quotas for the 2014 fishing season for the Atlantic commercial shark... management measures to provide, to the extent practicable, fishing opportunities for commercial shark...
Directory of Open Access Journals (Sweden)
Mauricio Hostim-Silva
2013-09-01
Full Text Available The coastal state of Espírito Santo is in the central region of Brazil, where biological productivity is considered low. The objective of this work is to present a current list of demersal, estuarine fish from northern Espírito Santo. This work is based on the compilation of data collected monthly using trawl nets. The ichthyofauna comprises 57 species, within 10 orders and 32 families. The family Sciaenidae has the largest number of species (8, followed by Carangidae (4 and Gerreidae (4. This coincides with what has been found for the Brazilian coast and for the coast of the South Atlantic. It is important to note that the total species richness in the estuaries of northern Espírito Santo is lower than other estuaries of the South West Atlantic coast. Most of the species are widely distributed in the Western Atlantic. Only a small part (14% of the fauna of northern Espírito Santo was evaluated in regards to risk of extinction, but conservation should be prioritized in the area due to overexploitation of species.
29 CFR 452.32 - Persons who may be candidates and hold office; secret ballot elections.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Persons who may be candidates and hold office; secret... Qualifications § 452.32 Persons who may be candidates and hold office; secret ballot elections. Section 401(e) provides that in any election of officers required by the Act which is held by secret ballot, every member...
2010-07-30
... Coastal Fisheries Cooperative Management Act Provisions; Atlantic Coastal Shark Fishery AGENCY: National... moratorium on fishing for Atlantic coastal sharks in the State waters of New Jersey. NMFS canceled the... Fisheries Commission's (Commission) Interstate Fishery Management Plan for Atlantic Coastal Sharks (Coastal...
CA-45(2+) MOVEMENTS INDUCED BY CA2+ CHLORIDE IN ISOLATED RAT AORTA UNDER K+-FREE CONDITIONS
WERMELSKIRCHEN, D; NEBEL, U; WIRTH, A; WILFFERT, B
1991-01-01
Increasing the extracellular Ca2+ concentration induced a dihydropyridine-insensitive contraction in the isolated rat aorta bathed in K+-free solution. To obtain further insight into the mechanism of this contraction Ca-45(2+) uptake measurements were carried out with isolated rat aorta. Increasing
Teixeira, António; Venâncio, Rui; Brito, Cristina
2014-01-01
The former occurrence of the North Atlantic right whale Eubalaena glacialis on the Portuguese coast may be inferred from the historical range of that species in Europe and in NW Africa. It is generally accepted that it was the main prey of coastal whaling in the Middle Ages and in the pre-modern period, but this assumption still needs firming up based on biological and archaeological evidence. We describe the skeletal remains of right whales excavated at Peniche in 2001–2002, in association with archaeological artefacts. The whale bones were covered by sandy sediments on the old seashore and they have been tentatively dated around the 16th to 17th centuries. This study contributes material evidence to the former occurrence of E. glacialis in Portugal (West Iberia). Some whale bones show unequivocal man-made scars. These are associated to wounds from instruments with a sharp-cutting blade. This evidence for past human interaction may suggest that whaling for that species was active at Peniche around the early 17th century. PMID:24505251
Directory of Open Access Journals (Sweden)
António Teixeira
Full Text Available The former occurrence of the North Atlantic right whale Eubalaena glacialis on the Portuguese coast may be inferred from the historical range of that species in Europe and in NW Africa. It is generally accepted that it was the main prey of coastal whaling in the Middle Ages and in the pre-modern period, but this assumption still needs firming up based on biological and archaeological evidence. We describe the skeletal remains of right whales excavated at Peniche in 2001-2002, in association with archaeological artefacts. The whale bones were covered by sandy sediments on the old seashore and they have been tentatively dated around the 16th to 17th centuries. This study contributes material evidence to the former occurrence of E. glacialis in Portugal (West Iberia. Some whale bones show unequivocal man-made scars. These are associated to wounds from instruments with a sharp-cutting blade. This evidence for past human interaction may suggest that whaling for that species was active at Peniche around the early 17th century.
Directory of Open Access Journals (Sweden)
Dieter Kelletat
2005-01-01
Full Text Available Field evidence of visible tsunami impacts in Europe is scarce. This research focused on an analysis of large littoral debris and accompanying geomorphic features and their rela- tionship to a tsunami event at Cabo de Trafalgar, located on the southern Spanish Atlantic coast. Relative dating of weathering features as well as minor bioconstructive forms in the littoral zone suggest the Lisbon tsunami of 1755 AD as the event responsible for the large deposits described. This tsunami had run up heights of more than 19 m and was generated at the Gorringe Bank, located 500 km west off the Cape. Tsunami deposits at Cabo de Tra- falgar are the first boulder deposits identified on the southern Spanish Atlantic coast and are located approximately 250 km southeast of the Algarve coast (Portugal, where other geo- morphic evidence for the Lisbon tsunami has been reported.
Directory of Open Access Journals (Sweden)
Fred Kucharski
2016-02-01
Full Text Available In this paper, the teleconnections from the tropical Atlantic to the Indo-Pacific region from inter-annual to centennial time scales will be reviewed. Identified teleconnections and hypotheses on mechanisms at work are reviewed and further explored in a century-long pacemaker coupled ocean-atmosphere simulation ensemble. There is a substantial impact of the tropical Atlantic on the Pacific region at inter-annual time scales. An Atlantic Niño (Niña event leads to rising (sinking motion in the Atlantic region, which is compensated by sinking (rising motion in the central-western Pacific. The sinking (rising motion in the central-western Pacific induces easterly (westerly surface wind anomalies just to the west, which alter the thermocline. These perturbations propagate eastward as upwelling (downwelling Kelvin-waves, where they increase the probability for a La Niña (El Niño event. Moreover, tropical North Atlantic sea surface temperature anomalies are also able to lead La Niña/El Niño development. At multidecadal time scales, a positive (negative Atlantic Multidecadal Oscillation leads to a cooling (warming of the eastern Pacific and a warming (cooling of the western Pacific and Indian Ocean regions. The physical mechanism for this impact is similar to that at inter-annual time scales. At centennial time scales, the Atlantic warming induces a substantial reduction of the eastern Pacific warming even under CO2 increase and to a strong subsurface cooling.
Isotope analysis reveals foraging area dichotomy for atlantic leatherback turtles.
Directory of Open Access Journals (Sweden)
Stéphane Caut
Full Text Available BACKGROUND: The leatherback turtle (Dermochelys coriacea has undergone a dramatic decline over the last 25 years, and this is believed to be primarily the result of mortality associated with fisheries bycatch followed by egg and nesting female harvest. Atlantic leatherback turtles undertake long migrations across ocean basins from subtropical and tropical nesting beaches to productive frontal areas. Migration between two nesting seasons can last 2 or 3 years, a time period termed the remigration interval (RI. Recent satellite transmitter data revealed that Atlantic leatherbacks follow two major dispersion patterns after nesting season, through the North Gulf Stream area or more eastward across the North Equatorial Current. However, information on the whole RI is lacking, precluding the accurate identification of feeding areas where conservation measures may need to be applied. METHODOLOGY/PRINCIPAL FINDINGS: Using stable isotopes as dietary tracers we determined the characteristics of feeding grounds of leatherback females nesting in French Guiana. During migration, 3-year RI females differed from 2-year RI females in their isotope values, implying differences in their choice of feeding habitats (offshore vs. more coastal and foraging latitude (North Atlantic vs. West African coasts, respectively. Egg-yolk and blood isotope values are correlated in nesting females, indicating that egg analysis is a useful tool for assessing isotope values in these turtles, including adults when not available. CONCLUSIONS/SIGNIFICANCE: Our results complement previous data on turtle movements during the first year following the nesting season, integrating the diet consumed during the year before nesting. We suggest that the French Guiana leatherback population segregates into two distinct isotopic groupings, and highlight the urgent need to determine the feeding habitats of the turtle in the Atlantic in order to protect this species from incidental take by
75 FR 33531 - Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries
2010-06-14
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 635 RIN 0648-XW79 Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries AGENCY: National Marine..., recent Large Pelagics Survey estimates indicate that charter/headboat BFT landings constitute...
The relationship between cadmium and phosphate in the Atlantic Ocean unravelled
Middag, Rob; van Heuven, Steven M. A. C.; Bruland, Kenneth W.; de Baar, Hein J. W.
2018-06-01
Cadmium (Cd) is not generally considered a nutrient element, but behaves like a nutrient in the oceans and might play an important role in ocean biology after all. The relationship between Cd and the nutrient phosphate (PO4) has been studied for over 40 yrs, but the debate on the driving mechanism and reason behind the 'kink', a change in the steepness of the slope is ongoing. Using new data of high accuracy and spatial resolution covering the West-Atlantic Ocean from north to south, in combination with a robust extended optimum multiparameter (eOMP) water mass model, we show that mixing between different water masses is the dominant factor explaining the observed correlation and its kink. Regeneration of Cd via remineralisation explains the smaller scale variability, notably in the surface ocean. Observations imply the availability of Cd in surface waters determines the Cd-uptake and thus the Cd:PO4 remineralisation ratio. This ratio is variable between different ocean regions, notably between the northern and southern high latitude oceans. Due to their role in deep water formation, both the northern and southern high latitude oceans are a driving factor in the Atlantic and global Cd and PO4 relation. Outside the Atlantic Ocean, the classical kink is not expected, but the relationship is by no means linear. Most likely, this is due to the interaction between low latitude surface waters and subsurface waters from high latitude origin, but more data are required to assess this in detail.
Kurath, Gael; Winton, James R.; Dale, Ole B.; Purcell, Maureen K.; Falk, Knut; Busch, Robert D.
2016-01-01
Beginning in 1992, three epidemic waves of infectious hematopoietic necrosis, often with high mortality, occurred in farmed Atlantic salmon Salmo salar L. on the west coast of North America. We compared the virulence of eleven strains of infectious hematopoietic necrosis virus (IHNV), representing the U, M and L genogroups, in experimental challenges of juvenile Atlantic salmon in freshwater. All strains caused mortality and there was wide variation within genogroups: cumulative mortality for five U-group strains ranged from 20 to 100%, four M-group strains ranged 30-63% and two L-group strains varied from 41 to 81%. Thus, unlike Pacific salmonids, there was no apparent correlation of virulence in a particular host species with virus genogroup. The mortality patterns indicated two different phenotypes in terms of kinetics of disease progression and final per cent mortality, with nine strains having moderate virulence and two strains (from the U and L genogroups) having high virulence. These phenotypes were investigated by histopathology and immunohistochemistry to describe the variation in the course of IHNV disease in Atlantic salmon. The results from this study demonstrate that IHNV may become a major threat to farmed Atlantic salmon in other regions of the world where the virus has been, or may be, introduced.
Dermody, B. J.; de Boer, H. J.; Bierkens, M. F. P.; Weber, S. L.; Wassen, M. J.; Dekker, S. C.
2012-03-01
We present a reconstruction of the change in climatic humidity around the Mediterranean between 3000-1000 yr BP. Using a range of proxy archives and model simulations we demonstrate that climate during this period was typified by a millennial-scale seesaw in climatic humidity between Spain and Israel on one side and the Central Mediterranean and Turkey on the other, similar to precipitation anomalies associated with the East Atlantic/West Russia pattern in current climate. We find that changes in the position and intensity of the jet stream indicated by our analysis correlate with millennial changes in North Atlantic sea surface temperature. A model simulation indicates the proxies of climatic humidity used in our analysis were unlikely to be influenced by climatic aridification caused by deforestation during the Roman Period. That finding is supported by an analysis of the distribution of archaeological sites in the Eastern Mediterranean which exhibits no evidence that human habitation distribution changed since ancient times as a result of climatic aridification. Therefore we conclude that changes in climatic humidity over the Mediterranean during the Roman Period were primarily caused by a modification of the jet stream linked to sea surface temperature change in the North Atlantic. Based on our findings, we propose that ocean-atmosphere coupling may have contributed to regulating Atlantic Meridional Overturning Circulation intensity during the period of analysis.
76 FR 23935 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures
2011-04-29
.... 110120049-1144-01] RIN 0648-BA69 Atlantic Highly Migratory Species; Atlantic Shark Management Measures... retention, transshipping, landing, storing, or selling of hammerhead sharks in the family Sphyrnidae (except for Sphyrna tiburo) and oceanic whitetip sharks (Carcharhinus longimanus) caught in association with...
2011-10-24
.... Virgin Islands and Puerto Rico, and each of the constituent interstate commissions: the Atlantic States... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA776 Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast Data, Assessment...
2012-02-15
.... 120201086-2085-01] RIN 0648-XA904 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... comments. SUMMARY: NMFS proposes specifications for the 2012 Atlantic bluefish fishery, including an annual...
2012-04-27
.... The Council will consider input from the workgroup and workshops during its June meeting in Orlando... Atlantic; South Atlantic Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries... public meeting and public workshop. SUMMARY: The South Atlantic Fishery Management Council (Council) will...
2012-04-27
.... 120201086-2418-02] RIN 0648-XA904 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... specifications for the 2012 Atlantic bluefish fishery, including an annual catch limit, total allowable landings...
2013-02-20
.... 130104009-3099-01] RIN 0648-XC432 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013-2014 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... comments. SUMMARY: NMFS proposes specifications for the 2013 and 2014 Atlantic bluefish fishery, including...
77 FR 21015 - Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries
2012-04-09
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 635 [Docket No. 110210132-1275-02] RIN 0648-XB116 Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries AGENCY... to their ability to attract customers. In addition, 2011 Large Pelagics Survey estimates indicate...
76 FR 18416 - Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries
2011-04-04
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 635 [Docket No. 100317152-0176-01] RIN 0648-XA327 Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries AGENCY... ability to attract customers. In addition, recent Large Pelagics Survey estimates indicate that charter...
2013-11-04
... Management Councils, the 18 states in the Atlantic and Gulf of Mexico, both the U.S. Virgin Islands and... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XC935 Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast Data, Assessment...
2011-03-16
... the South Atlantic; South Atlantic Fishery Management Council; Public Meeting AGENCY: National Marine... the Coastal Migratory Pelagics Fishery Management Plan (FMP) for the South Atlantic and Gulf of Mexico... AP will also review Amendment 19 to the Coastal Migratory Pelagics FMP regarding alternatives for bag...
Overflow Water Pathways in the Subpolar North Atlantic Observed with Deep Floats
Bower, Amy; Furey, Heather; Lozier, Susan
2017-04-01
As part of the Overturning in the Subpolar North Atlantic Program (OSNAP), a total of 135 acoustically tracked RAFOS floats have been deployed in the deep boundary currents of the Iceland, Irminger and Labrador Basins, and in the Charlie-Gibbs Fracture Zone, to investigate the pathways of Iceland-Scotland Overflow Water (ISOW) and Denmark Strait Overflow Water (DSOW). Floats were released annually in 2014, 2015 and 2016 at depths between 1800 and 2800 m for two-year missions. The array of sound sources used for tracking was expanded from 10 to 13 moorings in 2016 when it was discovered that wintertime surface roughness was negatively impacting acoustic ranges. The floats from the first setting reveal several examples of persistent , deep coherent eddy motion, including a cyclonic eddy spinning off the tip of Eirik Ridge (southwest of Cape Farewell), a cyclonic eddy in the northeastern Labrador Basin near where anticyclonic Irminger Rings are formed, and an anticyclonic eddy under the North Atlantic Current (NAC) in the central Iceland Basin. A consistent region of boundary-interior exchange was observed near Hamilton Bank on the western boundary of the Labrador Sea. Deep cyclonic recirculation gyres are revealed in all three basins. Floats released in the southward-flowing deep boundary current over the eastern flank of the Reykjanes Ridge show that shallower layers of ISOW peel off to the west and cross the Ridge into the Irminger Basin through various gaps south of 60°N, including the Bight Fracture Zone. These floats tend to turn northward and continue along the slope in the Irminger Basin. Interestingly, floats released at the ISOW level in the CGFZ did not turn into the Irminger Basin as often depicted in deep circulation schematics, but rather drifted west-northwestward toward the Labrador Sea, or eddied around west of the CGFZ and (in some cases) turned southward. This result is consistent with some previous hydrographic and high-resolution model results
Radium-226 and barium as tracers of water masses in the North Atlantic (GA01-GEOTRACES)
Le Roy, Emilie; Sanial, Virginie; Charette, Matthew; Henderson, Paul; Jacquet, Stéphanie; García-Ibáñez, Maribel; Pérez, Fiz; Lherminer, Pascale; Souhaut, Marc; Jeandel, Catherine; Lacan, François; van Beek, Pieter
2017-04-01
In this study, we report concentrations of radium-226 (226Ra, t1/2=1602 y) and barium determined along the GEOVIDE section conducted in the North Atlantic (May-July 2014; Portugal-Greenland-Canda) in the framework of the international GEOTRACES program. A high vertical resolution (up to 22 depths per station) was achieved by analyzing small volumes (˜10 L) of seawater for 226Ra using a radon emanation technique. We will present the distribution of 226Ra activities and barium concentrations in contrasting biogeochemical regions of the North Atlantic (Iberian margin, West European Basin, Reykjanes Ridge, Irminger Sea, Greenland margin and Labrador Sea). These regions strongly differ in terms of boundary inputs, biogeochemistry and deep water formation. We observe a linear correlation between 226Ra and barium along the GEOVIDE section, which results from the dominantly conservative behavior of the two tracers. However, deviations from the linear correlation between 226Ra and Ba are found in several places. The potential causes for such deviations are investigated. Optimum multi-parameter (OMP) analysis was thus used to distinguish the relative importance of physical transport (i.e., water mass mixing) from non-conservative processes (sedimentary, river or hydrothermal inputs; uptake by particles) on the 226Ra and Ba distribution in the North Atlantic.
Directory of Open Access Journals (Sweden)
Beatriz Rodrigues Bessa Mattos
Full Text Available Abstract Over the past five years, the South Atlantic region has become a central element of Brazilian security policy, with Brazil actively supporting the notion of a trans-oceanic security consciousness involving African littoral states. It has invested in diplomatic initiatives such as the Zone of Peace and Cooperation of the South Atlantic (ZPCSA, or ZOPACAS, and extensive military co-operation with West African states such as São Tomé e Príncipe, Namibia and Cape Verde. Its internal security and defence policy documents have repeatedly been updated to reflect this dimension, and now provide the foundation for advancing these initiatives. This policy thrust is directed at securing Brazil’s offshore oil assets, and limiting the influence of what it has termed ‘extra-regional powers’ such as the P-5. This article highlights these initiatives and reviews the prospects for this policy by examining the plausibility of the South Atlantic region as a regional security complex in the sense coined by Buzan and Wæver. The analysis is based on the role of geographical and linguistic proximity in international relations, and the impact of multilateral bodies on building support for a regional approach to security governance.
78 FR 20258 - Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries
2013-04-04
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 635 [Docket No. 120306154-2241-02] RIN 0648-XC593 Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries AGENCY... retention limit is vital to their ability to attract customers. In addition, 2012 Large Pelagics Survey...
DEFF Research Database (Denmark)
Sheldon, Christina; Seidenkrantz, Marit-Solveig; Frandsen, Paul
2015-01-01
This multi-proxy study of marine sediment gravity core AI07-06G from Trinity Bay, Newfoundland, recorded changes in the strength of the Labrador Current (LC) during the Holocene. From ca. 8-5 cal kyr BP, Trinity Bay's seafloor was influenced by cooled Atlantic water derived from the West Greenland...
Influence of Atlantic SST anomalies on the atmospheric circulation in the Atlantic-European sector
Directory of Open Access Journals (Sweden)
E. Kestenare
2003-06-01
Full Text Available Recent studies of observational data suggest that Sea Surface Temperature (SST anomalies in the Atlantic Ocean have a significant influence on the atmospheric circulation in the Atlantic-European sector in early winter and in spring. After reviewing this work and showing that the spring signal is part of a global air-sea interaction, we analyze for comparison an ensemble of simulations with the ECHAM4 atmospheric general circulation model in T42 resolution forced by the observed distribution of SST and sea ice, and a simulation with the ECHAM4/OPA8 coupled model in T30 resolution. In the two cases, a significant influence of the Atlantic on the atmosphere is detected in the Atlantic-European sector. In the forced mode, ECHAM4 responds to SST anomalies from early spring to late summer, and also in early winter. The forcing involves SST anomalies not only in the tropical Atlantic, but also in the whole tropical band, suggesting a strong ENSO influence. The modeled signal resembles that seen in the observations in spring, but not in early winter. In the coupled mode, the Atlantic SST only has a significant influence on the atmosphere in summer. Although the SST anomaly is confined to the Atlantic, the summer signal shows some similarity with that seen in the forced simulations. However, there is no counterpart in the observations.
Directory of Open Access Journals (Sweden)
Roberta de Jesus Santos
2017-11-01
Full Text Available The Brazilian Atlantic Forest has a rich biodiversity increasingly threatened by human activities. Since the colonial period, the coast of the state of Bahia is among the most affected regions of Brazil by anthropic pressure. Bahia encloses Atlantic Forest remnants distributed in an area reaching 100-200 km along the east-west axis, by 1,000 km along the north-south axis, parallel to the coast of the Atlantic Ocean. We report hereafter the results of an intensive field survey of leaf litter and epigaeic ants realized in forest remnants of the Atlantic Forest landscapes within the original extension of the biome in 11 localities distributed along four degrees of latitude in the state of Bahia. In each site, 16 plots were collected using pitfall and eight using Winkler traps. We identified 391 ant species belonging to 71 genera and nine subfamilies. Among all species recorded, 21 were common to the whole 11 localities, while 98 species were recorded in a single locality. This study highlights the richness and diversity of epigaeic and leaf-litter ants living in the northern part of the Brazilian Atlantic Forest, and is one of the most representative soil ants’ inventories ever done in this biome for a single state of Brazil.
Links between North Atlantic atmospheric blocking and recent trends in European winter precipitation
Ummenhofer, Caroline; Seo, Hyodae; Kwon, Young-Oh; Joyce, Terrence
2015-04-01
European precipitation has sustained robust trends during wintertime (January - March) over recent decades. Central, western, and northern Europe have become wetter by an average 0.1-0.3% per annum for the period 1901-2010, while southern Europe, including the Iberian Peninsula, much of Italy and the Balkan States, has sustained drying of -0.2% per annum or more over the same period. The overall pattern is consistent across different observational precipitation products, while the magnitude of the precipitation trends varies amongst data sets. Using cluster analysis, which identifies recurrent states (or regimes) of European winter precipitation by grouping them according to an objective similarity criterion, changes in the frequency of dominant winter precipitation patterns over the past century are evaluated. Considerable multi-decadal variability exists in the frequency of dominant winter precipitation patterns: more recent decades are characterised by significantly fewer winters with anomalous wet conditions over southern, western, and central Europe. In contrast, winters with dry conditions in western and southern Europe, but above-average rainfall in western Scandinavia and the northern British Isles, have been more common recently. We evaluate the associated multi-decadal large-scale circulation changes across the broader extratropical North Atlantic region, which accompany the observed wintertime precipitation variability using the 20th Century reanalysis product. Some influence of the North Atlantic Oscillation (NAO) is apparent in modulating the frequency of dominant precipitation patterns. However, recent trends in the characteristics of atmospheric blocking across the North Atlantic sector indicate a change in the dominant blocking centres (near Greenland, the British Isles, and west of the Iberian Peninsula). Associated changes in sea level pressure, storm track position and strength, and oceanic heat fluxes across the North Atlantic region are also
Cardoso, Irene A; Burukovsky, Rudolf N
2014-11-26
The deep sea shrimp genus Nematocarcinus Milne Edwards, 1881 includes 47 species, ten of them have been recorded from the Atlantic Ocean. Herein, material sampled during three scientific projects (REVIZEE Central Fishery project; Campos Basin Deep Sea Environmental Project; Evaluation of Environmental Heterogeneity in the Campos Basin) made in the Southwestern Atlantic, off Brazil, is examined. In addition, material sampled from the South Mid Atlantic Ridge (MAR-ECO Project) was also examined. Four species are recorded for the first time to the southwestern Atlantic Ocean including Mid Atlantic Ridge area: Nematocarcinus faxoni Burukovsky, 2001; N. gracilipes Filhol, 1884; N. rotundus Crosnier & Forest, 1973 and N. tenuipes Spence-Bate, 1888.
Unexpected East-West effect in mesopause region SABER temperatures over El Leoncito
Reisin, Esteban R.; Scheer, Jürgen
2017-05-01
We find that mesopause region temperatures determined by the SABER instrument on the TIMED satellite during nocturnal overpasses at El Leoncito (31.8°S, 69.3°W) are several kelvins higher when SABER observes from the East than when it observes from the West. We distinguish between altitudes corresponding to the nominal emission heights of the OH and O2 airglow layers. The East-West temperature differences of 4.5 K obtained for OH-equivalent height, and of 3.5 K for O2-equivalent height are surprising, because an effect of the South Atlantic Anomaly on SABER temperature is unexpected. However, the ground-based data obtained with our airglow spectrometer at El Leoncito show that such a SABER artifact can be ruled out. Rather, the phenomenon is explained as a consequence of the temporal sampling of the nocturnal variation, which is mostly due to the semidiurnal tide. The monthly mean tide is strongest from April to September with a mean amplitude of 6.9 K for OH, and of 10.5 K for O2 rotational temperature, but the contribution to the East-West effect varies strongly from month to month because of differences in the temporal sampling. This mechanism should be active at other sites, as well.
Kwasniewski, Slawomir; Gluchowska, Marta; Jakubas, Dariusz; Wojczulanis-Jakubas, Katarzyna; Walkusz, Wojciech; Karnovsky, Nina; Blachowiak-Samolyk, Katarzyna; Cisek, Malgorzata; Stempniewicz, Lech
2010-10-01
Composition and abundance of zooplankton were studied simultaneously with feeding ecology of planktivorous Little Auks ( Alle alle) in two different sea shelf areas of West Spitsbergen, Norway, in summer 2007. Zooplankton was collected adjacent to bird colonies in Magdalenefjorden (influenced by Atlantic West Spitsbergen Current) and Hornsund (dominated by the Arctic Sørkapp Current). In spite of different hydrological situations, the abundance of prey preferred by Little Auks, Arctic Calanus glacialis copepodids stage V, among zooplankton was similar in both localities. However, there was much more of Atlantic Calanus finmarchicus on the shelf outside Magdalenefjorden compared to Hornsund, resulting in different abundance ratios of Arctic to Atlantic copepods in the two areas (1:14 and 1:1, respectively). Even greater differences between the two areas occurred in the ratio of C. glacialis CV to other zooplankters, amounting to 1:40 in Magdalenefjorden and 1:6 in Hornsund. In both Little Auk colonies food brought by parents to their chicks contained mainly C. glacialis CV, albeit the proportion of this copepod in meals was significantly higher in Hornsund. Meals delivered to Little Auk chicks in Hornsund had also higher zooplankton numbers, biomass and energy content. In Magdalenefjorden, on the other hand, a higher number of feedings and longer duration of foraging trips were recorded. These differences became more apparent with increasing energy requirements of the fast growing nestlings. This was probably a consequence of lower relative abundance of the Little Auks’ preferred prey in the sea adjacent to Magdalenefjorden colony. It seems that searching for the preferred food items, such as C. glacialis, among abundant but less favored C. finmarchicus, may require more time and energy demanding foraging behavior. As a consequence, foraging effort of the Little Auk parents from Magdalenefjorden was higher, and feeding efficiency lower, than those of birds from
2005 Atlantic Hurricanes Poster
National Oceanic and Atmospheric Administration, Department of Commerce — The 2005 Atlantic Hurricanes poster features high quality satellite images of 15 hurricanes which formed in the Atlantic Basin (includes Gulf of Mexico and Caribbean...
Northeast Atlantic blue whiting
Heino, Mikko
2010-01-01
Heino, M. 2010. Northeast Atlantic blue whiting. In Life cycle spatial patterns of small pelagic fish in the Northeast Atlantic, pp. 59-64. Ed by P. Petitgas. ICES Cooperative Research Report 306. ICES, Copenhagen.
Prevalence of West Nile virus in migratory birds during spring and fall migration
Dusek, Robert J.; McLean, R.G.; Kramer, L.D.; Ubico, S.R.; Dupuis, A.P.; Ebel, G.D.; Guptill, S.C.
2009-01-01
To investigate the role of migratory birds in the dissemination of West Nile virus (WNV), we measured the prevalence of infectious WNV and specific WNV neutralizing antibodies in birds, principally Passeriformes, during spring and fall migrations in the Atlantic and Mississippi flyways from 2001-2003. Blood samples were obtained from 13,403 birds, representing 133 species. Specific WNV neutralizing antibody was detected in 254 resident and migratory birds, representing 39 species, and was most commonly detected in northern cardinals (Cardinalis cardinalis) (9.8%, N = 762) and gray catbirds (Dumetella carolinensis) (3.2%,N = 3188). West Nile virus viremias were detected in 19 birds, including 8 gray catbirds, and only during the fall migratory period. These results provide additional evidence that migratory birds may have been a principal agent for the spread of WNV in North America and provide data on the occurrence of WNV in a variety of bird species. Copyright ?? 2009 by The American Society of Tropical Medicine and Hygiene.
2010-09-08
... Atlantic, and Caribbean Fishery Management Councils, in conjunction with NOAA Fisheries and the Atlantic... are appointed by the Gulf of Mexico, South Atlantic, and Caribbean Fishery Management Councils; the..., environmentalists, and NGO's; International experts; and staff of Councils, Commissions, and state and federal...
2013-05-07
.... 130104009-3416-02] RIN 0648-XC432 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2013 and 2014 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS... final specifications for the 2013 and 2014 Atlantic bluefish fishery, including annual catch limits...
Økland, Arnfinn Lodden; Skoge, Renate Hvidsten; Nylund, Are
2018-06-01
We have determined the complete genome sequence of a new rhabdovirus, tentatively named Caligus rogercresseyi rhabdovirus Ch01 (CrRV-Ch01), which was found in the parasite Caligus rogercresseyi, present on farmed Atlantic salmon (Salmo salar) in Chile. The genome encodes the five canonical rhabdovirus proteins in addition to an unknown protein, in the order N-P-M-U (unknown)-G-L. Phylogenetic analysis showed that the virus clusters with two rhabdoviruses (Lepeophtheirus salmonis rhabdovirus No9 and Lepeophtheirus salmonis rhabdovirus No127) obtained from another parasitic caligid, Lepeophtheirus salmonis, present on farmed Atlantic salmon on the west coast of Norway.
Atlantic walrus (Odobenus rosmarus rosmarus): A literature survey and status report
Reeves, Randall R.
1978-01-01
It is generally agreed that the genus Odobenus includes only one species, O. rosmarus. At least two subspecies are widely recognized: O. r. rosmarus, the Atlantic walrus, and O. r. divergens, the Pacific walrus. A third nominal subspecies, O. r. laptevi, the Laptev walrus, is designated by some Soviet researchers; and the taxonomic status of the Kara Sea walrus is undetermined. The range and abundance of nearly all walrus stocks have been seriously reduced by intensive human exploitation.The Atlantic walrus, the principal subject of this study, remains plentiful in only three known areas of concentration: northern Hudson Bay and northern Foxe Basin in the eastern Canadian Arctic, and the Thule district of northwest Greenland. This animal is no longer the object of large-scale commercial hunting, but is still subject to heavy subsistence hunting by native groups in some areas.The status of the walrus population in Canada was investigated in the 1950's and is believed to have changed little since that time. There are probably no more than about 10,000 walruses in Canadian waters, virtually all of them in the eastern arctic. The biology, ecology, and exploitation of walruses in the Thule district were studied during the 1940's, and some information is available concerning recent catch levels and hunting practices. The Polar Eskimos of north Greenland continue to organize much of their cultural and economic life around the hunting of walruses, and the species remains abundant in their area, numbering at least a few thousand. The walrus stocks off west Greenland and in the Greenland, Barents, and Kara seas are the most critically depleted. No systematic field investigations of walruses east of Greenland have been made since the Kara Sea and Franz Josef Land populations were studied in the mid-1930's. Opportunistic sighting records and compilations of historical catch information indicate that the herds of many tens of thousands that once inhabited Svalbard, Bear Island
Aka, Festus Tongwa; Hasegawa, Takeshi; Nche, Linus Anye; Asaah, Asobo Nkengmatia Elvis; Mimba, Mumbfu Ernestine; Teitchou, Isidore; Ngwa, Caroline; Miyabuchi, Yasuo; Kobayashi, Tetsuo; Kankeu, Boniface; Yokoyama, Tetsuya; Tanyileke, Gregory; Ohba, Takeshi; Hell, Joseph Victor; Kusakabe, Minoru
2018-05-01
The hydrodynamic fragmentation that formed Lake Nyos in northwest Cameroon did not only make it the most unpopular lake in the world from a gas disaster perspective, it also opened a rare and formidable window through which much of the geology of Cameroon can be studied in a single locality. The Cambrian quartz monzonite cliff excavated by the maar-forming explosion and exposed in its northeastern shore is intruded by mafic dykes, two of which we dated. Even though close to one another, the dykes are different in composition. The alkaline dyke yields a slightly older (Carnian) K-Ar fedspar age of 231.1 ± 4.8 Ma, while the sub alkaline dyke yields an age of 224.8 ± 4.7 Ma (Norian). Based on radioisotopic age data available over the last 48 years (347 data) for the Cameroon Line magmatism comprising eruptives and volcano-plutonic complexes, the Nyos dykes are way older than the Cameroon Line, and even pre-date the Lower Cretaceous initiation of west Gondwana fragmentation in Equatorial Atlantic domain. They would therefore not have been directly linked to the formation of the Cameroon Line. Alternatively, they might be associated with the development of intra-continental rift systems in West Central Africa that pre-dated west Gondwana breakup to form the Atlantic Ocean.
33 CFR 167.452 - In the Santa Barbara Channel: Between Point Conception and Point Arguello.
2010-07-01
....452 In the Santa Barbara Channel: Between Point Conception and Point Arguello. (a) A separation zone... 120°30.16′ W. 34°18.90′ N 120°30.96′ W. 34°25.70′ N 120°51.81′ W. 34°23.75′ N 120°52.51′ W. (b) A traffic lane for westbound traffic is established between the separation zone and a line connecting the...
Directory of Open Access Journals (Sweden)
J. Park
2010-06-01
Full Text Available An energy-conservative metric based on the discrete wavelet transform is applied to assess the relative energy distribution of extreme sea level events across different temporal scales. The metric is applied to coastal events at Key West and Pensacola Florida as a function of two Atlantic Multidecadal Oscillation (AMO regimes. Under AMO warm conditions there is a small but significant redistribution of event energy from nearly static into more dynamic (shorter duration timescales at Key West, while at Pensacola the AMO-dependent changes in temporal event behaviour are less pronounced. Extreme events with increased temporal dynamics might be consistent with an increase in total energy of event forcings which may be a reflection of more energetic storm events during AMO warm phases. As dynamical models mature to the point of providing regional climate index predictability, coastal planners may be able to consider such temporal change metrics in planning scenarios.
Directory of Open Access Journals (Sweden)
Alle A Y Lie
Full Text Available Ochromonas spp. strains CCMP1393 and BG-1 are phagotrophic phytoflagellates with different nutritional strategies. Strain CCMP1393 is an obligate phototroph while strain BG-1 readily grows in continuous darkness in the presence of bacterial prey. Growth and gene expression of strain CCMP1393 were investigated under conditions allowing phagotrophic, mixotrophic, or phototrophic nutrition. The availability of light and bacterial prey led to the differential expression of 42% or 45-59% of all genes, respectively. Data from strain CCMP1393 were compared to those from a study conducted previously on strain BG-1, and revealed notable differences in carbon and nitrogen metabolism between the 2 congeners under similar environmental conditions. Strain BG-1 utilized bacterial carbon and amino acids through glycolysis and the tricarboxylic acid cycle, while downregulating light harvesting and carbon fixation in the Calvin cycle when both light and bacteria were available. In contrast, the upregulation of genes related to photosynthesis, light harvesting, chlorophyll synthesis, and carbon fixation in the presence of light and prey for strain CCMP1393 implied that this species is more phototrophic than strain BG-1, and that phagotrophy may have enhanced phototrophy. Cellular chlorophyll a content was also significantly higher in strain CCMP1393 supplied with bacteria compared to those without prey. Our results thus point to very different physiological strategies for mixotrophic nutrition in these closely related chrysophyte species.
The role of Atlantic-Arctic exchange in North Atlantic multidecadal climate variability
Frankcombe, L.M.; Dijkstra, H.A.
2011-01-01
It has recently been suggested that multidecadal variability in North Atlantic sea surface temperature occurs with two dominant periods. In this paper we investigate the origin of these two time scales in a 500 year control run of the GFDL CM2.1 model. We focus on the exchange between the Atlantic
Hong, C. C.
2015-12-01
The western North Pacific subtropical high (WNPSH) in boreal summer shows a remarkable enhancement after the late 1970s. Whereas the sea surface temperature (SST) in the North Indian Ocean (NIO) and the equatorial eastern Pacific (EEP) had been noted to have remarkable local or remote effects on enhancing the WNPSH, the influence of the Atlantic SST, so far, is hardly explored. This article reports a new finding: enhanced relationship between the tropical Atlantic (TA)-SST and the WNPSH after the late 1970s. Regression study suggests that the warm TA-SST produced a zonally overturning circulation anomaly, with descending over the central equatorial Pacific and ascending over the tropical Atlantic/eastern Pacific. The anomalous descending over the central equatorial Pacific likely induced low-level anticyclonic anomaly to the west and therefore enhanced the WNPSH. One implication of this new finding is for predictability. The well-known "spring predictability barrier" (i.e., the influence of El Niño and Southern Oscillation (ENSO) falls dramatically during boreal spring) does not apply to the TA-SST/WNPSH relationship. Conversely, the TA-SST shows consistently high correlation starting from boreal spring when the ENSO influence continues declining. The TA-SST pushes the predictability of the WNPSH in boreal summer approximately one season earlier to boreal spring.
2012-03-16
... the South Atlantic and Gulf of Mexico; South Atlantic Fishery Management Council; Public Meeting...), Commerce. ACTION: Notice of a public meeting. SUMMARY: The South Atlantic Fishery Management Council (SAFMC... Biological Catch (ABC) values for managed stocks including the effect of revised recreational catch estimates...
Northward advection of Atlantic water in the eastern Nordic Seas over the last 3000 yr
Directory of Open Access Journals (Sweden)
C. V. Dylmer
2013-07-01
Full Text Available Three marine sediment cores distributed along the Norwegian (MD95-2011, Barents Sea (JM09-KA11-GC, and Svalbard (HH11-134-BC continental margins have been investigated in order to reconstruct changes in the poleward flow of Atlantic waters (AW and in the nature of upper surface water masses within the eastern Nordic Seas over the last 3000 yr. These reconstructions are based on a limited set of coccolith proxies: the abundance ratio between Emiliania huxleyi and Coccolithus pelagicus, an index of Atlantic vs. Polar/Arctic surface water masses; and Gephyrocapsa muellerae, a drifted coccolith species from the temperate North Atlantic, whose abundance changes are related to variations in the strength of the North Atlantic Current. The entire investigated area, from 66 to 77° N, was affected by an overall increase in AW flow from 3000 cal yr BP (before present to the present. The long-term modulation of westerlies' strength and location, which are essentially driven by the dominant mode of the North Atlantic Oscillation (NAO, is thought to explain the observed dynamics of poleward AW flow. The same mechanism also reconciles the recorded opposite zonal shifts in the location of the Arctic front between the area off western Norway and the western Barents Sea–eastern Fram Strait region. The Little Ice Age (LIA was governed by deteriorating conditions, with Arctic/Polar waters dominating in the surface off western Svalbard and western Barents Sea, possibly associated with both severe sea ice conditions and a strongly reduced AW strength. A sudden short pulse of resumed high WSC (West Spitsbergen Current flow interrupted this cold spell in eastern Fram Strait from 330 to 410 cal yr BP. Our dataset not only confirms the high amplitude warming of surface waters at the turn of the 19th century off western Svalbard, it also shows that such a warming was primarily induced by an excess flow of AW which stands as unprecedented over the last 3000 yr.
Raising the profile of Gender and Generation: The role of Climate Change Media Partnership
Energy Technology Data Exchange (ETDEWEB)
Herzhoff, Natalie; Shanahan, Mike
2010-07-01
The paper details the initiatives taken by the Climate Change Media Partnership to strengthen journalists' understanding of the importance of gender and generation when reporting on climate change. Journalists from the world's wealthiest countries were well represented at the December 2007 UN Framework Convention on Climate change in Bali. In contrast only 9 percent of the journalists at the conference were from non-industrialised countries and there was zero media representation for nearly the entire UN list of 50 Least Developed Countries. To address this gap IIED Panos and Internews formed the Climate Change Media Partnership (CCMP). This initiative brought 37 journalists from developing countries to Bali and provided them with a 10 day programme of support. Since 2007, the CCMP has run three programmes each supporting nearly 40 journalists from developing nations to attend the UN climate change negotiations in Bali, Poznan and Copenhagen. Among the many refinements that the CCMP team has made to its programme over the years, is a greater focus on gender and generation. CCMP research has shown that although most male and female CCMP fellows were likely to acknowledge a need to include women's views in their reports, they lacked the resources, tools and knowledge to do so. In addition there is a disparate level of awareness amongst the CCMP journalists about how men and women of all ages are affected by climate change in different ways and about the need to report these differences. Through its work the CCMP identified several key areas that can improve the way that climate change, gender and generation are covered by the media.
Raising the profile of Gender and Generation: The role of Climate Change Media Partnership
Energy Technology Data Exchange (ETDEWEB)
Herzhoff, Natalie; Shanahan, Mike
2010-07-01
The paper details the initiatives taken by the Climate Change Media Partnership to strengthen journalists' understanding of the importance of gender and generation when reporting on climate change. Journalists from the world's wealthiest countries were well represented at the December 2007 UN Framework Convention on Climate change in Bali. In contrast only 9 percent of the journalists at the conference were from non-industrialised countries and there was zero media representation for nearly the entire UN list of 50 Least Developed Countries. To address this gap IIED Panos and Internews formed the Climate Change Media Partnership (CCMP). This initiative brought 37 journalists from developing countries to Bali and provided them with a 10 day programme of support. Since 2007, the CCMP has run three programmes each supporting nearly 40 journalists from developing nations to attend the UN climate change negotiations in Bali, Poznan and Copenhagen. Among the many refinements that the CCMP team has made to its programme over the years, is a greater focus on gender and generation. CCMP research has shown that although most male and female CCMP fellows were likely to acknowledge a need to include women's views in their reports, they lacked the resources, tools and knowledge to do so. In addition there is a disparate level of awareness amongst the CCMP journalists about how men and women of all ages are affected by climate change in different ways and about the need to report these differences. Through its work the CCMP identified several key areas that can improve the way that climate change, gender and generation are covered by the media.
2010-02-19
.... 100105009-0053-01] RIN 0648-AY51 Fisheries of the Northeastern United States; Atlantic Deep-Sea Red Crab Fisheries; 2010 Atlantic Deep-Sea Red Crab Specifications AGENCY: National Marine Fisheries Service (NMFS... comments. SUMMARY: NMFS proposes 2010 specifications for the Atlantic deep-sea red crab fishery, including...
2010-08-13
.... 100513223-0289-02] RIN 0648-AY88 Fisheries of the Northeastern United States; Atlantic Deep-Sea Red Crab Fisheries; 2010 Atlantic Deep-Sea Red Crab Specifications In- season Adjustment AGENCY: National Marine...-sea (DAS) allocation for the Atlantic deep- sea red crab fishery that were implemented in May 2010...
Directory of Open Access Journals (Sweden)
José C. Báez
2011-04-01
Full Text Available The aim of this study was to explore the possible link between variations in the North Atlantic Oscillation (NAO and sea surface temperature (SST and the abundance of loggerhead turtles around the Strait of Gibraltar, using stranding data for the Andalusian coastal area as a proxy for abundance. The annual average SST (from November to October in the Gulf of Cadiz was negatively associated with the total number of loggerhead strandings each year from November 1997 to October 2006 in the Gulf of Cadiz and the Alboran Sea. The average NAO index was positively associated with the number of strandings in the Gulf of Cadiz in the following year. Prevailing westerly winds during positive NAO phases and the subsequent delayed decrease in SST may lead to turtles from the west Atlantic accumulating in the Gulf of Cadiz and unsuccessfully attempting to return. Secondary causes, such as buoyancy, cold stunning, longline fisheries, net fisheries, debilitated turtle syndrome, and trauma may also increase the number of turtle strandings.
Energy Technology Data Exchange (ETDEWEB)
Dahl, Kristina A [Massachusetts Institute of Technology/Woods Hole Oceanographic Institution Joint Program, Woods Hole, MA (United States); Broccoli, Anthony J [Rutgers University, Department of Environmental Sciences, New Brunswick, NJ (United States); Stouffer, Ronald J [Geophysical Fluid Dynamics Laboratory, Princeton, NJ (United States)
2005-03-01
This study analyzes a three-member ensemble of experiments, in which 0.1 Sv of freshwater was applied to the North Atlantic for 100 years in order to address the potential for large freshwater inputs in the North Atlantic to drive abrupt climate change. The model used is the GFDL R30 coupled ocean-atmosphere general circulation model. We focus in particular on the effects of this forcing on the tropical Atlantic region, which has been studied extensively by paleoclimatologists. In response to the freshwater forcing, North Atlantic meridional overturning circulation is reduced to roughly 40% by the end of the 100 year freshwater pulse. Consequently, the North Atlantic region cools by up to 8 C. The extreme cooling of the North Atlantic increases the pole-to-equator temperature gradient and requires more heat be provided to the high latitude Atlantic from the tropical Atlantic. To accommodate the increased heat requirement, the ITCZ shifts southward to allow for greater heat transport across the equator. Accompanying this southward ITCZ shift, the Northeast trade winds strengthen and precipitation patterns throughout the tropical Atlantic are altered. Specifically, precipitation in Northeast Brazil increases, and precipitation in Africa decreases slightly. In addition, we find that surface air temperatures warm over the tropical Atlantic and over Africa, but cool over northern South America. Sea-surface temperatures in the tropical Atlantic warm slightly with larger warm anomalies developing in the thermocline. These responses are robust for each member of the ensemble, and have now been identified by a number of freshwater forcing studies using coupled OAGCMs. The model responses to freshwater forcing are generally smaller in magnitude, but have the same direction, as paleoclimate data from the Younger Dryas suggest. In certain cases, however, the model responses and the paleoclimate data directly contradict one another. Discrepancies between the model simulations
Directory of Open Access Journals (Sweden)
J. P. Helmke
2008-09-01
Full Text Available Proxy records from a core site off Northwest Africa were generated and compared with data from the subpolar Northeast Atlantic to unravel some main climatic features of interglacial marine isotope stage (MIS 11 (423–362 ka. The records point to an almost 25 kyr lasting full interglacial period during stage 11 that was preceded by a considerably long glacial-interglacial transition (Termination V. Off NW Africa, a strong reduction of terrestrially derived iron input is noted after 420 ka suggesting a pronounced increase in continental humidity and vegetation cover over Northwest Africa. In analogy to the Holocene climate of the region, this early wet phase of MIS 11 was likely associated with enhanced influence of the West African monsoon system on the Saharan-Sahel region which led to both a reduction in trade wind intensity off NW Africa and the formation of sapropel S11 in the Mediterranean Sea. A detailed comparison with data from the subpolar North Atlantic indicates a remarkable coherent timing for the main environmental changes in both regions giving evidence for strong interglacial climate connection between the low and high latitude North Atlantic. Although our records of MIS 11 compare well with the Holocene in terms of some major climate characteristics there are distinct differences in the temporal evolution of each peak warm interval. This suggests that care should be taken when using MIS 11 as analogue to forecast future interglacial conditions.
Atlantic menhaden adult tagging study
National Oceanic and Atmospheric Administration, Department of Commerce — Atlantic menhaden are a schooling forage fish species, which are subject to a large commercial purse seine fishery. Atlantic menhaden are harvested for reduction...
Semenov, V. A.; Cherenkova, E. A.
2018-02-01
The influence of the Atlantic Multidecadal Oscillation (AMO) on large-scale atmospheric circulation in the Atlantic region in summer for the period of 1950-2015 is investigated. It is shown that the intensification of the summer North Atlantic Oscillation (NAO) with significant changes in sea level pressure anomalies in the main centers of action (over Greenland and the British Isles) occurred while the North Atlantic was cooler. Sea surface temperature anomalies, which are linked to the AMO in the summer season, affect both the NAO index and fluctuations of the Eastern Atlantic/Western Russia (EAWR) centers of action. The positive (negative) phase of the AMO is characterized by a combination of negative (positive) values of the NAO and EAWR indices. The dominance of the opposite phases of the teleconnection indices in summer during the warm North Atlantic and in its colder period resulted in differences in the regional climate in Europe.
Robinson, Gilpin R.; Brown, William M.
2002-01-01
The United States uses large quantities of natural aggregate to build and maintain a continuously expanding infrastructure. In recent years, per capita demand for aggregate in the United States has grown to about 9.7 metric tons (10.7 tons) per person per year. Over the next 25 years, the aggregate industry expects to mine quantities equivalent to all aggregate mined in the United States over the past 100 years. The issues surrounding supply and demand for aggregate in the mid-Atlantic states of Maryland, Pennsylvania, Virginia, and West Virginia illustrate competing requirements for industrial minerals and many simultaneous social and environmental objectives.
Dual annual spawning races in Atlantic sturgeon.
Directory of Open Access Journals (Sweden)
Matthew T Balazik
Full Text Available Atlantic sturgeon (Acipenser oxyrinchus oxyrinchus, Acipenseridae populations in the United States were listed as either endangered or threatened under the Endangered Species Act in 2012. Because of the endangered/threatened status, a better understanding of Atlantic sturgeon life-history behavior and habitat use is important for effective management. It has been widely documented that Atlantic sturgeon reproduction occurs from late winter to early summer, varying clinally with latitude. However, recent data show Atlantic sturgeon also spawn later in the year. The group that spawns later in the year seems to be completely separate from the spring spawning run. Recognition of the later spawning season has drastically modified estimates of the population status of Atlantic sturgeon in Virginia. With the combination of new telemetry data and historical documentation we describe a dual spawning strategy that likely occurs in various degrees along most, if not all, of the Atlantic sturgeon's range. Using new data combined with historical sources, a new spawning strategy emerges which managers and researchers should note when determining the status of Atlantic sturgeon populations and implementing conservation measures.
75 FR 50715 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures; Amendment 3
2010-08-17
... [Docket No. 080519678-0313-03] RIN 0648-AW65 Atlantic Highly Migratory Species; Atlantic Shark Management... for adjusting annual shark quotas based on over- and underharvests. This correction makes a change to...), instruction 12a revised 50 CFR 635.27 (b)(1)(i) through (v), relating to, among other things, pelagic shark...
Harrison, W. G.; Arístegui, J.; Head, E. J. H.; Li, W. K. W.; Longhurst, A. R.; Sameoto, D. D.
Three trans-Atlantic oceanographic surveys (Nova Scotia to Canary Islands) were carried out during fall 1992 and spring 1993 to describe the large-scale variability in hydrographic, chemical and biological properties of the upper water column of the subtropical gyre and adjacent waters. Significant spatial and temporal variability characterized a number of the biological pools and rate processes whereas others were relatively invariant. Systematic patterns were observed in the zonal distribution of some properties. Most notable were increases (eastward) in mixed-layer temperature and salinity, depths of the nitracline and chlorophyll- a maximum, regenerated production (NH 4 uptake) and bacterial production. Dissolved inorganic carbon (DIC) concentrations, phytoplankton biomass, mesozooplankton biomass and new production (NO 3 uptake) decreased (eastward). Bacterial biomass, primary production, and community respiration exhibited no discernible zonal distribution patterns. Seasonal variability was most evident in hydrography (cooler/fresher mixed-layer in spring), and chemistry (mixed-layer DIC concentration higher and nitracline shallower in spring) although primary production and bacterial production were significantly higher in spring than in fall. In general, seasonal variability was greater in the west than in the east; seasonality in most properties was absent west of Canary Islands (˜20°W). The distribution of autotrophs could be reasonably well explained by hydrography and nutrient structure, independent of location or season. Processes underlying the distribution of the microheterophs, however, were less clear. Heterotrophic biomass and metabolism was less variable than autotrophs and appeared to dominate the upper ocean carbon balance of the subtropical North Atlantic in both fall and spring. Geographical patterns in distribution are considered in the light of recent efforts to partition the ocean into distinct "biogeochemical provinces".
DEFF Research Database (Denmark)
Pitois, Sophie G.; Jansen, Teunis; Pinnegar, John
2015-01-01
in the North Sea. We used a similar approach in the west and southwest area of the UK shelf and applied a principal component analysis (PCA) using 7 biotic and abiotic parameters, combined with Hierarchical Cluster Analysis (HCA), to investigate the impact of environmental changes in the west and southwest...... that documents statistical correlations between environment and mackerel needs to be supplemented by local process studies, to gain more insight and to be able to predict mackerel response to climate change scenarios. Utilising the strength of the CPR dataset, namely its unique temporal coverage, in an analysis...
Directory of Open Access Journals (Sweden)
Mohammad Moniruzzaman
2018-04-01
Full Text Available While viruses with distinct phylogenetic origins and different nucleic acid types can infect and lyse eukaryotic phytoplankton, “giant” dsDNA viruses have been found to be associated with important ecological processes, including the collapse of algal blooms. However, the molecular aspects of giant virus–host interactions remain largely unknown. Aureococcus anophagefferens virus (AaV, a giant virus in the Mimiviridae clade, is known to play a critical role in regulating the fate of brown tide blooms caused by the pelagophyte Aureococcus anophagefferens. To understand the physiological response of A. anophagefferens CCMP1984 upon AaV infection, we studied the transcriptomic landscape of this host–virus pair over an entire infection cycle using a RNA-sequencing approach. A massive transcriptional response of the host was evident as early as 5 min post-infection, with modulation of specific processes likely related to both host defense mechanism(s and viral takeover of the cell. Infected Aureococcus showed a relative suppression of host-cell transcripts associated with photosynthesis, cytoskeleton formation, fatty acid, and carbohydrate biosynthesis. In contrast, host cell processes related to protein synthesis, polyamine biosynthesis, cellular respiration, transcription, and RNA processing were overrepresented compared to the healthy cultures at different stages of the infection cycle. A large number of redox active host-selenoproteins were overexpressed, which suggested that viral replication and assembly progresses in a highly oxidative environment. The majority (99.2% of annotated AaV genes were expressed at some point during the infection cycle and demonstrated a clear temporal–expression pattern and an increasing relative expression for the majority of the genes through the time course. We detected a putative early promoter motif for AaV, which was highly similar to the early promoter elements of two other Mimiviridae members
Directory of Open Access Journals (Sweden)
Kaiyue Sun
Full Text Available Mutated mouse lipoprotein lipase (LPL containing a leucine (L to histidine (H substitution at position 452 was transferred into mouse liver by hydrodynamics-based gene delivery (HD. Mutated-LPL (MLPL gene transfer significantly increased the concentrations of plasma MLPL and triglyceride (TG but significantly decreased the activity of plasma LPL. Moreover, the gene transfer caused adiposis hepatica and significantly increased TG content in mouse liver. To understand the effects of MLPL gene transfer on energy metabolism, we investigated the expression of key functional genes related to energy metabolism in the liver, epididymal fat, and leg muscles. The mRNA contents of hormone-sensitive lipase (HSL, adipose triglyceride lipase (ATGL, fatty acid-binding protein (FABP, and uncoupling protein (UCP were found to be significantly reduced. Furthermore, we investigated the mechanism by which MLPL gene transfer affected fat deposition in the liver, fat tissue, and muscle. The gene expression and protein levels of forkhead Box O3 (FOXO3, AMP-activated protein kinase (AMPK, and peroxisome proliferator-activated receptor-gamma coactivator 1 alpha (PGC-1α were found to be remarkably decreased in the liver, fat and muscle. These results suggest that the Leu452His mutation caused LPL dysfunction and gene transfer of MLPL in vivo produced resistance to the AMPK/PGC-1α signaling pathway in mice.
Burmeister, Kristin; Lübbecke, Joke F.
2017-04-01
Oxygen minimum zones (OMZs) exist in the upwelling regions of the eastern tropical Atlantic and Pacific at intermediate depth. They are a consequence of high biological productivity in combination with weak ventilation. The flow fields in the tropical Atlantic is characterized by Latitudinally Alternating Zonal Jets (LAZJs) with a large vertical scale. It has been suggested that LAZJs play an important role for the ventilation of the OMZ as eastward currents advect oxygen-rich waters from the western boundary towards the OMZ. In the Eastern Tropical North Atlantic (ETNA), the eastward flowing North Equatorial Undercurrent and North Equatorial Countercurrent (NECC) provide the main oxygen supply into the OMZ. Variability in the strength and location of the LAZJs is associated with oxygen variability in the ETNA OMZ. We here want to address the question whether the variability in the zonal current field can be partly attributed to the large-scale climate modes of the tropical Atlantic, namely the Atlantic zonal and meridional mode. An influence of these modes on the NECC has been found in previous studies. For the analysis we are using the output of a global ocean circulation model, in which a 1/10° nest covering the tropical Atlantic is embedded into a global 1/2° model, as well as reanalysis products and satellite data. The zonal current field and oxygen distribution from the high resolution model is compared to observational data. The location and intensity of the current bands during positive and negative phases of the Atlantic climate modes are compared by focusing on individual events and via composite analysis. Based on the results, the potential impact of the Atlantic climate modes on the ventilation of the ETNA OMZ is discussed.
A Detailed Assessment of the Wave Energy Resource at the Atlantic Marine Energy Test Site
Directory of Open Access Journals (Sweden)
Reduan Atan
2016-11-01
Full Text Available Wave characteristic assessments of wave energy test sites provide a greater understanding of prevailing wave conditions and are therefore extremely important to both wave energy test site operators and clients as they can inform wave energy converter design, optimisation, deployment, operation and maintenance. This research presents an assessment of the wave resource at the Atlantic Marine Energy Test Site (AMETS on the west coast of Ireland based on 12-years of modelled data from January 2004 to December 2015. The primary aim is to provide an assessment of annual and seasonal wave characteristics and resource variability at the two deployment berths which comprise the site. A nested model has been developed using Simulating WAves Nearshore (SWAN to replicate wave propagations from regional to local scale with a 0.05° resolution model covering the northeast Atlantic and a 0.0027° resolution model covering AMETS. The coarse and fine models have been extensively validated against available measured data within Irish waters. 12-year model outputs from the high resolution model were analysed to determine mean and maximum conditions and operational, high and extreme event conditions for significant wave height, energy period and power. Annual and seasonal analyses are presented. The 12-year annual mean P were 68 kW/m at Berth A (BA and 57 kW/m at Berth B (BB. The resource shows strong seasonal and annual variations and the winter mean power levels were found to be strongly correlated with the North Atlantic Oscillation (NAO.
2012-06-13
... Highly Migratory Species; Commercial Atlantic Region Non-Sandbar Large Coastal Shark Fishery Opening Date... commercial Atlantic region non-sandbar large coastal shark fishery. This action is necessary to inform... large coastal shark fishery will open on July 15, 2012. FOR FURTHER INFORMATION CONTACT: Karyl Brewster...
Garcia-Rodriguez, A I; Bowen, B W; Domning, D; Mignucci-Giannoni, A; Marmontel, M; Montoya-Ospina, A; Morales-Vela, B; Rudin, M; Bonde, R K; McGuire, P M
1998-09-01
To resolve the population genetic structure and phylogeography of the West Indian manatee (Trichechus manatus), mitochondrial (mt) DNA control region sequences were compared among eight locations across the western Atlantic region. Fifteen haplotypes were identified among 86 individuals from Florida, Puerto Rico, the Dominican Republic, Mexico, Columbia, Venezuela, Guyana and Brazil. Despite the manatee's ability to move thousands of kilometers along continental margins, strong population separations between most locations were demonstrated with significant haplotype frequency shifts. These findings are consistent with tagging studies which indicate that stretches of open water and unsuitable coastal habitats constitute substantial barriers to gene flow and colonization. Low levels of genetic diversity within Florida and Brazilian samples might be explained by recent colonization into high latitudes or bottleneck effects. Three distinctive mtDNA lineages were observed in an intraspecific phylogeny of T. manatus, corresponding approximately to: (i) Florida and the West Indies; (ii) the Gulf of Mexico to the Caribbean rivers of South America; and (iii) the northeast Atlantic coast of South America. These lineages, which are not concordant with previous subspecies designations, are separated by sequence divergence estimates of d = 0.04-0.07, approximately the same level of divergence observed between T. manatus and the Amazonian manatee (T. inunguis, n = 16). Three individuals from Guyana, identified as T. manatus, had mtDNA haplotypes which are affiliated with the endemic Amazon form T. inunguis. The three primary T. manatus lineages and the T. inunguis lineage may represent relatively deep phylogeographic partitions which have been bridged recently due to changes in habitat availability (after the Wisconsin glacial period, 10 000 B P), natural colonization, and human-mediated transplantation.
Garcia-Rodriguez, A. I.; Bowen, B.W.; Domning, D.; Mignucci-Giannoni, A. A.; Marmontel, M.; Montoya-Ospina, R. A.; Morales-Vela, B.; Rudin, M.; Bonde, R.K.; McGuire, P.M.
1998-01-01
To resolve the population genetic structure and phylogeography of the West Indian manatee (Trichechus manatus), mitochondrial (mt) DNA control region sequences were compared among eight locations across the western Atlantic region. Fifteen haplotypes were identified among 86 individuals from Florida, Puerto Rico, the Dominican Republic, Mexico, Colombia, Venezuela, Guyana and Brazil. Despite the manatee's ability to move thousands of kilometres along continental margins, strong population separations between most locations were demonstrated with significant haplotype frequency shifts. These findings are consistent with tagging studies which indicate that stretches of open water and unsuitable coastal habitats constitute substantial barriers to gene flow and colonization. Low levels of genetic diversity within Florida and Brazilian samples might be explained by recent colonization into high latitudes or bottleneck effects. Three distinctive mtDNA lineages were observed in an intraspecific phylogeny of T. manatus, corresponding approximately to: (i) Florida and the West Indies; (ii) the Gulf of Mexico to the Caribbean rivers of South America; and (iii) the northeast Atlantic coast of South America. These lineages, which are not concordant with previous subspecies designations, are separated by sequence divergence estimates of d = 0.04-0.07, approximately the same level of divergence observed between T. manatus and the Amazonian manatee (T. inunguis, n = 16). Three individuals from Guyana, identified as T. manatus, had mtDNA haplotypes which are affiliated with the endemic Amazon form T. inunguis. The three primary T. manatus lineages and the T. inunguis lineage may represent relatively deep phylogeographic partitions which have been bridged recently due to changes in habitat availability (after the Wisconsin glacial period, 10 000 BP), natural colonization, and human-mediated transplantation.
The transfer of reprocessing wastes from north-west Europe to the Arctic
Kershaw, Peter; Baxter, Amanda
The discharge of radioactive waste, from nuclear fuel reprocessing facilities, into the coastal waters of north-west Europe has resulted in a significant increase in the inventories of a number of artificial radionuclides in the North Atlantic. Radiocaesium, 90Sr and 99Tc, which behave conservatively in seawater, have been used widely as tracers of water movement through the North Sea, Norwegian Coastal Current, Barents Sea, Greenland Sea, Fram Strait, Eurasian Basin, East Greenland Current and Denmark Strait overflow. These studies are summarised in the present paper. It has been estimated that 22% of the 137Cs Sellafield discharge has passed into the Barents Sea, en route to the Nansen Basin, via the Bjomoya-Fugloya Section, with another 13% passing through the Fram Strait. This amounts to 14 PBq 137Cs. Quantifying the influx of other radionuclides has been more problematic. The inflowing Atlantic water now appears to be diluting waters in the Arctic Basin, which were contaminated in the late 1970s and early 1980s as a result of the substantial decrease in the discharge of reprocessing wastes. Sellafield (U.K.) has dominated the supply of 134Cs, 137Cs, 90Sr, 99Tc and Pu, whereas La Hague (France) has contributed a larger proportion of 129I and 125Sb.
2011-06-28
... meeting of its Law Enforcement AP in Orlando, FL. DATES: The meeting will take place July 20, 2011. See SUPPLEMENTARY INFORMATION. ADDRESSES: The meeting will be held at the Marriott Renaissance Orlando Hotel, 5445... the South Atlantic; South Atlantic Fishery Management Council; Public Meeting AGENCY: National Marine...
Friedland, Kevin D.; Shank, Burton V.; Todd, Christopher D.; McGinnity, Philip; Nye, Janet A.
2014-05-01
Atlantic salmon, Salmo salar, in the North Atlantic are managed as a set of population complexes distributed in North America and Europe. In recent years, these complexes have experienced reduced marine survival and many populations within the complexes are at risk, especially those at the southern ends of the species amphi-Atlantic range. Atlantic salmon is an anadromous fish dividing its life history between residence in freshwater and the marine environment. The freshwater portion of the life history includes spawning and the rearing of juveniles where in-river production has tended to be relatively stable, whereas the first year at sea, termed the post-smolt year, is characterized by more variable rates of mortality. Although their habitats are widely separated geographically along the North Atlantic seaboards, strong recruitment coherence exists between North American and European stock complexes. This recruitment coherence is correlated with ocean temperature variation associated with the Atlantic Multidecadal Oscillation (AMO). The North Atlantic Oscillation (NAO) appears to be relatively unimportant as a driver of salmon abundance. The mechanism determining the link between AMO-related thermal variation and abundance appears to differ fundamentally for the two continental stock groupings. Whereas ocean climate variability during the first springtime months of juvenile salmon migration to sea appears to be important to the survival of North American stocks, summer climate variation appears to be central to adult recruitment variation for European stocks. This contrast in seasonal effects appears to be related to the varying roles of predation pressure and size-related mortality on the continental stock complexes. The anticipated warming due to global climate change will impose thermal conditions on salmon populations outside historical context and challenge the ability of many populations to persist.
Utilisation of ophthalmic services by foreign nationals in Johor: a review of 452 patients.
Hooi, S H; Hooi, S T
2003-10-01
Between 1st January 1999 and 31st December 2000, 452 foreign nationals were treated at the Department of Ophthalmology, Hospital Sultanah Aminah, Johor Bahru. Eighty-five percent were male. The peak age range was from 21 to 30 years old. The patients were predominantly Indonesians (61%). A history of trauma was present in 63% of patients. Eight percent of eyes had severe visual impairment. Six patients (1.3%) were blind by WHO standards. Traumatic eye conditions, inflammatory/allergic eye conditions and degenerative eye conditions comprised 66%, 13% and 10% respectively of ocular pathology seen. The commonest ocular findings were corneal foreign body, corneal abrasion and subconjunctival haemorrhage.
Lohmann, Katja; Drange, Helge; Jungclaus, Johann
2010-05-01
The extent and strength of the North Atlantic subpolar gyre (SPG) changed rapidly in the mid-1990s, going from large and strong in 1995 to substantially weakened in the following years. The abrupt change in the intensity of the SPG is commonly linked to the reversal of the North Atlantic Oscillation (NAO) index, changing from strong positive to negative values, in the winter 1995/96. In this study we investigate the impact of the initial SPG state on its subsequent behavior by means of an ocean general circulation model driven by NCEP-NCAR reanalysis fields. Our sensitivity integrations suggest that the weakening of the SPG cannot be explained by the change in the atmospheric forcing alone. Rather, for the time period around 1995, the SPG was about to weaken, irrespective of the actual atmospheric forcing, due to the ocean state governed by the persistently strong positive NAO during the preceding seven years (1989 to 1995). Our analysis indicates that it was this preconditioning of the ocean, in combination with the sudden drop in the NAO in 1995/96, that lead to the strong and rapid weakening of the SPG in the second half of the 1990s. In the second part, the sensitivity of the low-frequency variability of the Atlantic meridional overturning circulation to changes in the subpolar North Atlantic is investigated using a 2000 year long control integration as well as sensitivity experiments with the MPI-M Earth System Model. Two 1000 year long sensitivity experiments will be performed, in which the low-frequency variability in the overflow transports from the Nordic Seas and in the subpolar deep water formation rates is suppressed respectively. This is achieved by nudging temperature and salinity in the GIN Sea or in the subpolar North Atlantic (up to about 1500m depth) towards a monthly climatology obtained from the last 1000 years of the control integration.
Lin, Chih-Yang; Tzeng, Huey-En; Li, Te-Mao; Chen, Hsien-Te; Lee, Yi; Yang, Yi-Chen; Wang, Shih-Wei; Yang, Wei-Hung; Tang, Chih-Hsin
2017-06-13
Chondrosarcoma is the second most prevalent general primary tumor of bone following osteosarcoma. Chondrosarcoma development may be linked to angiogenesis, which is principally elicited by vascular endothelial growth factor-A (VEGF-A). VEGF-A level has been recognized as a prognostic marker in angiogenesis. WNT1-inducible signaling pathway protein-3 (WISP)-3/CCN6 belongs to the CCN family and is involved in regulating several cellular functions, including cell proliferation, differentiation, and migration. Nevertheless, the effect of WISP-3 on VEGF-A production and angiogenesis in human chondrosarcoma remains largely unknown. This current study shows that WISP-3 promoted VEGF-A production and induced angiogenesis of human endothelial progenitor cells. Moreover, WISP-3-enhanced VEGF-A expression and angiogenesis involved the c-Src and p38 signaling pathways, while miR-452 expression was negatively affected by WISP-3 via the c-Src and p38 pathways. Our results illustrate the clinical significance of WISP-3, VEGF-A and miR-452 in human chondrosarcoma patients. WISP-3 may illustrate a novel therapeutic target in the metastasis and angiogenesis of chondrosarcoma.
An Anatomy of the 1960s Atlantic Cooling.
Hodson, Dan; Robson, Jon; Sutton, Rowan
2014-05-01
North Atlantic Sea Surface Temperatures (SSTs) exhibited pronounced multidecadal variability during the 20th Century. In particular, the North Atlantic SSTs exhibited a rapid warming between 1920 and 1940 followed by a rapid cooling between 1960 and 1980. SSTs outside the North Atlantic display a much smaller level of decadal variability over the 20th Century. This pattern of North Atlantic warming and cooling has been linked to subsequent changes in rainfall over the Sahel and Nordeste Brazil, Summertime North American Climate and Atlantic Hurricane Genesis. Several hypotheses for the rapid 1960s Atlantic cooling have been proposed, including a reduction in northward ocean heat transport due to a reduced Atlantic Meridional Overturning Circulation (AMOC) and the significant rise in anthropogenic sulphur dioxide emissions during the latter half of the 20th century. Here we examine the observed 1960s Atlantic cooling in more detail. We describe the evolution of the rapid cooling by constructing a detailed multivariate anatomy of the cooling period in order to illuminate the possible explanations and mechanisms involved. We show that the observed 1960s cooling began around 1964-68 in the Greenland-Iceland-Norway (GIN) seas, later spreading to the Atlantic Sub Polar Gyre and much of the subtropical Atlantic. This initial cooling of the Sub Polar Gyre is associated with a marked reduction in salinity (the Great Salinity Anomaly). The cooling peaked between 1972-76, extending into the Tropical North Atlantic. This period also saw the development of a significant Winter North-South Dipole Mean Sea Level Pressure dipole pattern reminiscent of a positive NAO (High over the Azores, Low over Iceland). The cooling then retreated back to higher latitudes during 1976:80. Our analysis demonstrates that the cooling of the North Atlantic during the 1960s cannot be understood as a simple thermodynamic response to aerosol induced reductions in shortwave radiation. Dynamical changes
West Nile Virus in the United States — A Historical Perspective
Directory of Open Access Journals (Sweden)
John T. Roehrig
2013-12-01
Full Text Available Prior to 1999, West Nile virus (WNV was a bit player in the screenplay of global vector-borne viral diseases. First discovered in the West Nile District of Uganda in 1937, this Culex sp.-transmitted virus was known for causing small human febrile outbreaks in Africa and the Middle East. Prior to 1995, the last major human WNV outbreak was in the 1950s in Israel. The epidemiology and ecology of WNV began to change in the mid-1990s when an epidemic of human encephalitis occurred in Romania. The introduction of WNV into Eastern Europe was readily explained by bird migration between Africa and Europe. The movement of WNV from Africa to Europe could not, however, predict its surprising jump across the Atlantic Ocean to New York City and the surrounding areas of the United States (U.S.. This movement of WNV from the Eastern to Western Hemisphere in 1999, and its subsequent dissemination throughout two continents in less than ten years is widely recognized as one of the most significant events in arbovirology during the last two centuries. This paper documents the early events of the introduction into and the spread of WNV in the Western Hemisphere.
The 226Ra-Ba relationship in the North Atlantic during GEOTRACES-GA01
Le Roy, Emilie; Sanial, Virginie; Charette, Matthew A.; van Beek, Pieter; Lacan, François; Jacquet, Stéphanie H. M.; Henderson, Paul B.; Souhaut, Marc; García-Ibáñez, Maribel I.; Jeandel, Catherine; Pérez, Fiz F.; Sarthou, Géraldine
2018-05-01
We report detailed sections of radium-226 (226Ra, T1/2 = 1602 years) activities and barium (Ba) concentrations determined in the North Atlantic (Portugal-Greenland-Canada) in the framework of the international GEOTRACES program (GA01 section - GEOVIDE project, May-July 2014). Dissolved 226Ra and Ba are strongly correlated along the section, a pattern that may reflect their similar chemical behavior. Because 226Ra and Ba have been widely used as tracers of water masses and ocean mixing, we investigated their behavior more thoroughly in this crucial region for thermohaline circulation, taking advantage of the contrasting biogeochemical patterns existing along the GA01 section. We used an optimum multiparameter (OMP) analysis to distinguish the relative importance of physical transport (water mass mixing) from nonconservative processes (sedimentary, river or hydrothermal inputs, uptake by particles and dissolved-particulate dynamics) on the 226Ra and Ba distributions in the North Atlantic. Results show that the measured 226Ra and Ba concentrations can be explained by conservative mixing for 58 and 65 % of the samples, respectively, notably at intermediate depth, away from the ocean interfaces. 226Ra and Ba can thus be considered conservative tracers of water mass transport in the ocean interior on the space scales considered here, namely, on the order of a few thousand kilometers. However, regions in which 226Ra and Ba displayed nonconservative behavior and in some cases decoupled behaviors were also identified, mostly at the ocean boundaries (seafloor, continental margins and surface waters). Elevated 226Ra and Ba concentrations found in deepwater in the West European Basin suggest that lower Northeast Atlantic Deep Water (NEADWl) accumulates 226Ra and Ba from sediment diffusion and/or particle dissolution during transport. In the upper 1500 m of the West European Basin, deficiencies in 226Ra and Ba are likely explained by their incorporation in planktonic calcareous
Hátún, H.; Payne, M. R.; Beaugrand, G.; Reid, P. C.; Sandø, A. B.; Drange, H.; Hansen, B.; Jacobsen, J. A.; Bloch, D.
2009-03-01
Pronounced changes in fauna, extending from the English Channel in the south to the Barents Sea in the north-east and off Greenland in the north-west, have occurred in the late 1920s, the late 1960s and again in the late 1990s. We attribute these events to exchanges of subarctic and subtropical water masses in the north-eastern North Atlantic Ocean, associated with changes in the strength and extent of the subpolar gyre. These exchanges lead to variations in the influence exerted by the subarctic or Lusitanian biomes on the intermediate faunistic zone in the north-eastern Atlantic. This strong and persistent bottom-up bio-physical link is demonstrated using a numerical ocean general circulation model and data on four trophically connected levels in the food chain - phytoplankton, zooplankton, blue whiting, and pilot whales. The plankton data give a unique basin-scale depiction of these changes, and a long pilot whale record from the Faroe Islands offers an exceptional temporal perspective over three centuries. Recent advances in simulating the dynamics of the subpolar gyre suggests a potential for predicting the distribution of the main faunistic zones in the north-eastern Atlantic a few years into the future, which might facilitate a more rational management of the commercially important fisheries in this region.
Atlantic energy and the strategic outlook
Directory of Open Access Journals (Sweden)
Paul Isbell
2013-09-01
Full Text Available Sweeping changes are beginning to transform energy scenarios around the world. The gas revolution, a renaissance in petroleum technology and exploration, and a chaotic but powerful movement toward the goal of low-carbon economies are three of the principal energy trends currently interacting with structural changes in the geo-economics of the Atlantic world to present new perspectives and opportunitiesfor the diverse actors in the ‘Atlantic Basin’. This article explores how changes in the energy landscape are contributing to a reassessment of the strategic horizon. The potential impacts of the shale revolution, deep-offshore oil, biofuels and other modern renewable energies on the geopolitics of the Atlantic Basin will be assessed, and the hypothesis that an Atlantic Basin energy system is now taking shape will be evaluated, along with an analysis of anticipated impacts.
International Nuclear Information System (INIS)
Heddleson, F.A.
1975-03-01
Design data, safety features, and site characteristics are summarized for 36 nuclear power units in 18 power stations in the United States. Six pages of data are presented for each plant consisting of thermal-hydraulic and nuclear factors, containment features, emergency-core-cooling systems, site features, circulating water system data, and miscellaneous factors. An aerial perspective is also presented for each plant. The volume covers reactors with dockets 50-452 through 50-503. (U.S.)
Pacheco-Almanzar, Eloísa; Simons, James; Espinosa-Pérez, Héctor; Chiappa-Carrara, Xavier; Ibáñez, Ana L
2016-05-09
Menezes et al. (2010) show that Mugil cephalus Linnaeus, 1758 is different from Mugil liza Valenciennes 1836, the latter being the mullet found along the Atlantic coast of South America. They also suggest that individuals identified as M. cephalus from the northwest Atlantic could represent a population of M. liza in this region, since they doubt the presence of M. cephalus in waters colder than the ones of the West Indies. In order to clarify the presence of M. cephalus in the northwest Atlantic, this study compares meristic and morphometric measurements of M. cephalus and M. liza from the Gulf of Mexico with those obtained by Menezes et al. (2010) for M. liza from South America and for M. cephalus in the Mediterranean Sea. Results show that there are differences in both morphometric and meristic data between the two species. The morphometric measure that differentiates these species is the distance from the snout to the dorsal fin, which is positioned backwards in M. liza compared with M. cephalus. The body width is consistently greater in M. cephalus than M. liza. The meristic character that discriminates between both species is the number of scales in the longitudinal series that, in M. cephalus, ranges from 38 to 43 while in M. liza between 32 to 39. The information presented in this work confirms the presence of M. cephalus in the Gulf of Mexico and the sympatric presence of M. liza is established, even if its abundance is quite low.
Energy Technology Data Exchange (ETDEWEB)
Jung, T
2000-07-01
The North Atlantic oscillation (NAO) represents the dominant mode of atmospheric variability in the North Atlantic region and describes the strengthening and weakening of the midlatitude westerlies. In this study, variability of the NAO during wintertime and its relationship to the North Atlantic ocean and Arctic sea ice is investigated. For this purpose, observational data are analyzed along with integrations of models for the Atlantic ocean, Arctic sea ice, and the coupled global climate system. From a statistical point of view, the observed NAO index shows unusually high variance on interdecadal time scales during the 20th century. Variability on other time scales is consistent with realizations of random processes (''white noise''). Recurrence of wintertime NAO anomalies from winter-to-winter with missing signals during the inbetween nonwinter seasons is primarily associated with interdecadal variability of the NAO. This recurrence indicates that low-frequency changes of the NAO during the 20th century were in part externally forced. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Jung, T.
2000-07-01
The North Atlantic oscillation (NAO) represents the dominant mode of atmospheric variability in the North Atlantic region and describes the strengthening and weakening of the midlatitude westerlies. In this study, variability of the NAO during wintertime and its relationship to the North Atlantic ocean and Arctic sea ice is investigated. For this purpose, observational data are analyzed along with integrations of models for the Atlantic ocean, Arctic sea ice, and the coupled global climate system. From a statistical point of view, the observed NAO index shows unusually high variance on interdecadal time scales during the 20th century. Variability on other time scales is consistent with realizations of random processes (''white noise''). Recurrence of wintertime NAO anomalies from winter-to-winter with missing signals during the inbetween nonwinter seasons is primarily associated with interdecadal variability of the NAO. This recurrence indicates that low-frequency changes of the NAO during the 20th century were in part externally forced. (orig.)
Lee, Yun-Young
2017-04-01
West Pacific (WP) teleconnection pattern is one of the well-known primary modes of boreal winter low-frequency variability (LFV) resolved in 500 hPa geopotential height and its phase and amplitude strongly influence regional weather conditions including temperature and rainfall extremes [Baxter and Nigam, 2015; Hsu and Wallace, 1985; Linkin and Nigam, 2008; Mo and Livezey, 1986; Thompson and Wallace, 1998; Wallace and Gutzler, 1981]. This study primary aims to evaluate individual 11 GCMs seasonal hindcasts employed as members of multi-model ensemble (MME) produced in APEC Climate Center (APCC) in representing WP. For the extensive and comprehensive evaluation, this study applied seven verification metrics in three scopes: (a) temporal representation of observed indices, (b) spatial mode separation in the Northern Hemisphere (NH), and (c) regional mode isolated in the preset longitudinal domain. Verification results display quite large inter-model spread. Some models mimic observed index variability while others display large bias of index variability compared to climatology. Basic north-south dipole pattern is mostly well reproduced in both rotated and unrotated loading modes. However, each individual seasonal forecast model exhibits slightly different behavior (e.g. amplification/weakening, zonal and meridional shift, downstream extension and so forth) in representing spatial structure of WP. When taking all 7 metrics into account, one Europe (CMCC) model, one Oceania (POAMA) model and two North America (NASA and NCEP) models are classified as relatively good performers while PNU is classified as a matchless poor performer out of 11. Least WP representing skill of PNU is sort of consistent with the largest bias of NH total variability. This study further tries to examine winter mean biases of individual models and figure out how mean bias is linked to WP representation in model world. Model bias of winter climatology is investigated focusing on six large scale
PBDEs in the atmosphere over the Asian marginal seas, and the Indian and Atlantic oceans
Li, Jun; Li, Qilu; Gioia, Rosalinda; Zhang, Yanlin; Zhang, Gan; Li, Xiangdong; Spiro, Baruch; Bhatia, Ravinder S.; Jones, Kevin C.
2011-12-01
Air samples were collected from Jan 16 to Mar 14, 2008 onboard the Oceanic II- The Scholar Ship which navigated an east-west transect from Shanghai to Cape Verde, and polybrominated diphenyl ethers (PBDEs) were analyzed in these samples. PBDE concentrations in the atmosphere over the open seas were influenced by proximity to source areas and land, and air mass origins. The concentrations of Σ 21PBDEs over the East and South China Seas, the Bay of Bengal and the Andaman Sea, the Indian Ocean, and the Atlantic Ocean were 10.8 ± 6.13, 3.22 ± 1.57, 5.12 ± 3.56, and 2.87 ± 1.81 pg m -3, respectively. BDE-47 and -99 were the dominant congeners in all the samples, suggesting that the widely used commercial penta-BDE products were the original sources. Over some parts of Atlantic and Indian Ocean, daytime concentrations of BDE-47 and BDE-99 were higher than the concentrations at night. The strong atmospheric variability does not always coincide with a diurnal cycle, but the variability in air concentrations in such remote areas of the ocean remains strong. No significant trends were found for each of PBDE congener with latitude.
Geologic and operational summary, COST No. G-2 well, Georges Bank area, North Atlantic OCS
Amato, Roger V.; Simonis, Edvardas K.
1980-01-01
The Continental Offshore Stratigraphic Test (COST) No. G-2 well is the second deep well to be drilled in the Georges Bank Basin and the third in a series of COST wells on the Atlantic Outer Continental Shelf (OCS). The G-2 was drilled by Ocean Production Company, acting as the operator for 19 participating companies between January 6 and August 30, 1977. The semisubmersible rig Ocean Victory was used to drill the well to a depth of 21,874 feet at a location 132 statute miles east-southeast of Nantucket Island in 272 feet of water. An earlier deep Stratigraphic test, the COST No. G-l well, was drilled 42 statute miles west of the G-2 well, to a depth of 16,071 feet in 1976 (fig. 1). Geological and engineering data obtained from the well were used by companies and the U.S. Geological Survey (USGS) for evaluating the petroleum potential and possible drilling problems in the U.S. North Atlantic OCS area in preparation for lease sale 42 held on December 18, 1979. The Stratigraphic test was intentionally drilled away from any potential petroleum-bearing feature, but in a block bordering several tracts that were included in the sale area.
The Red Atlantic: Transoceanic Cultural Exchanges
Weaver, Jace
2011-01-01
The development of David Armitage's "white Atlantic" history parallels the Cold War origins of American studies with its mission to define and promote "American culture" or "American civilization." British scholar Paul Gilroy's "The Black Atlantic" served as a necessary corrective. Armitage's statement leads…
Restoration practicesin Brazil's Atlantic rainforest.
Jorge Correa de Lima Palidon; Maisa dos Santos Guapyassu
2005-01-01
The atlantic Rain Forst (Mata Atlantica) extends along the southern coast of Brazil and inland into Argentina and Paraguay. Originally covering 15% of the land area of Brazil, it was a region of an estimated 1.3 million km2 (MMA 2000). Today, remnants of the Atlantic Forest represents about 8% of the original area, or some 94,000 km2...
Impact of dynamical regionalization on precipitation biases and teleconnections over West Africa
Gómara, Iñigo; Mohino, Elsa; Losada, Teresa; Domínguez, Marta; Suárez-Moreno, Roberto; Rodríguez-Fonseca, Belén
2018-06-01
West African societies are highly dependent on the West African Monsoon (WAM). Thus, a correct representation of the WAM in climate models is of paramount importance. In this article, the ability of 8 CMIP5 historical General Circulation Models (GCMs) and 4 CORDEX-Africa Regional Climate Models (RCMs) to characterize the WAM dynamics and variability is assessed for the period July-August-September 1979-2004. Simulations are compared with observations. Uncertainties in RCM performance and lateral boundary conditions are assessed individually. Results show that both GCMs and RCMs have trouble to simulate the northward migration of the Intertropical Convergence Zone in boreal summer. The greatest bias improvements are obtained after regionalization of the most inaccurate GCM simulations. To assess WAM variability, a Maximum Covariance Analysis is performed between Sea Surface Temperature and precipitation anomalies in observations, GCM and RCM simulations. The assessed variability patterns are: El Niño-Southern Oscillation (ENSO); the eastern Mediterranean (MED); and the Atlantic Equatorial Mode (EM). Evidence is given that regionalization of the ENSO-WAM teleconnection does not provide any added value. Unlike GCMs, RCMs are unable to precisely represent the ENSO impact on air subsidence over West Africa. Contrastingly, the simulation of the MED-WAM teleconnection is improved after regionalization. Humidity advection and convergence over the Sahel area are better simulated by RCMs. Finally, no robust conclusions can be determined for the EM-WAM teleconnection, which cannot be isolated for the 1979-2004 period. The novel results in this article will help to select the most appropriate RCM simulations to study WAM teleconnections.
Seasonal predictability of the North Atlantic Oscillation
Vellinga, Michael; Scaife, Adam
2015-04-01
Until recently, long-range forecast systems showed only modest levels of skill in predicting surface winter climate around the Atlantic Basin and associated fluctuations in the North Atlantic Oscillation at seasonal lead times. Here we use a new forecast system to assess seasonal predictability of winter North Atlantic climate. We demonstrate that key aspects of European and North American winter climate and the surface North Atlantic Oscillation are highly predictable months ahead. We demonstrate high levels of prediction skill in retrospective forecasts of the surface North Atlantic Oscillation, winter storminess, near-surface temperature, and wind speed, all of which have high value for planning and adaptation to extreme winter conditions. Analysis of forecast ensembles suggests that while useful levels of seasonal forecast skill have now been achieved, key sources of predictability are still only partially represented and there is further untapped predictability. This work is distributed under the Creative Commons Attribution 3.0 Unported License together with an author copyright. This license does not conflict with the regulations of the Crown Copyright.
Water mass distribution in Fram Strait and over the Yermak Plateau in summer 1997
Directory of Open Access Journals (Sweden)
B. Rudels
Full Text Available The water mass distribution in northern Fram Strait and over the Yermak Plateau in summer 1997 is described using CTD data from two cruises in the area. The West Spitsbergen Current was found to split, one part recirculated towards the west, while the other part, on entering the Arctic Ocean separated into two branches. The main inflow of Atlantic Water followed the Svalbard continental slope eastward, while a second, narrower, branch stayed west and north of the Yermak Plateau. The water column above the southeastern flank of the Yermak Plateau was distinctly colder and less saline than the two inflow branches. Immediately west of the outer inflow branch comparatively high temperatures in the Atlantic Layer suggested that a part of the extraordinarily warm Atlantic Water, observed in the boundary current in the Eurasian Basin in the early 1990s, was now returning, within the Eurasian Basin, toward Fram Strait. The upper layer west of the Yermak Plateau was cold, deep and comparably saline, similar to what has recently been observed in the interior Eurasian Basin. Closer to the Greenland continental slope the salinity of the upper layer became much lower, and the temperature maximum of the Atlantic Layer was occasionally below
0.5 °C, indicating water masses mainly derived from the Canadian Basin. This implies that the warm pulse of Atlantic Water had not yet made a complete circuit around the Arctic Ocean. The Atlantic Water of the West Spitsbergen Current recirculating within the strait did not extend as far towards Greenland as in the 1980s, leaving a broader passage for waters from the Atlantic and intermediate layers, exiting the Arctic Ocean. A possible interpretation is that the circulation pattern alternates between a strong recirculation of the West Spitsbergen Current in the strait, and a larger exchange of Atlantic Water between the Nordic Seas and the inner parts of the Arctic Ocean.
Key words: Oceanography: general
Atlantic menhaden processing plant test tagging data
National Oceanic and Atmospheric Administration, Department of Commerce — Atlantic menhaden are a schooling forage fish species, which are subject to a large commercial purse seine fishery. Atlantic menhaden are harvested for reduction...
Spectroscopic study of the elusive globular cluster ESO452-SC11 and its surroundings
Koch, Andreas; Hansen, Camilla Juul; Kunder, Andrea
2017-08-01
Globular clusters (GCs) have long been recognized as being amongst the oldest objects in the Galaxy. As such, they have the potential of playing a pivotal role in deciphering the Milky Way's early history. Here we present the first spectroscopic study of the low-mass system ESO452-SC11 using the AAOmega multifibre spectrograph at medium resolution. Given the stellar sparsity of this object and the high degree of foreground contamination due to its location toward the Galactic bulge, very few details are known for this cluster - there is no consensus, for instance, about its age, metallicity, or its association with the disk or bulge. We identify five member candidates based on common radial velocity, calcium-triplet metallicity, and position within the GC. Using spectral synthesis, the measurement of accurate Fe-abundances from Fe-lines, and abundances of several α-, Fe-peak, and neutron-capture elements (Si, Ca, Ti,Cr, Co, Ni, Sr, and Eu) is carried out, albeit with large uncertainties. We find that two of the five cluster candidates are likely non-members, as they have deviating iron abundances and [α/Fe] ratios. The cluster mean heliocentric velocity is 19 ± 2 km s-1 with a velocity dispersion of 2.8 ± 3.4 km s-1, a low value in line with its sparse nature and low mass. The mean Fe-abundance from spectral fitting is -0.88 ± 0.03 dex, where the spread is driven by observational errors. Furthermore, the α-elements of the GC candidates are marginally lower than expected for the bulge at similar metallicities. As spectra of hundreds of stars were collected in a 2-degree field centered on ESO452-SC11, a detailed abundance study of the surrounding field was also enabled. The majority of the non-members have slightly higher [α/Fe] ratios, in line with the typical nearby bulge population. A subset of the spectra with measured Fe-peak abundance ratios shows a large scatter around solar values, albeit with large uncertainties. Furthermore, our study provides the
Dusek, Robert J.; Hallgrimsson, Gunnar T.; Ip, Hon S.; Jónsson, Jón E.; Sreevatsan, Srinand; Nashold, Sean W.; TeSlaa, Joshua L.; Enomoto, Shinichiro; Halpin, Rebecca A.; Lin, Xudong; Federova, Nadia; Stockwell, Timothy B.; Dugan, Vivien G.; Wentworth, David E.; Hall, Jeffrey S.
2014-01-01
Avian influenza virus (AIV) in wild birds has been of increasing interest over the last decade due to the emergence of AIVs that cause significant disease and mortality in both poultry and humans. While research clearly demonstrates that AIVs can move across the Pacific or Atlantic Ocean, there has been no data to support the mechanism of how this occurs. In spring and autumn of 2010 and autumn of 2011 we obtained cloacal swab samples from 1078 waterfowl, gulls, and shorebirds of various species in southwest and west Iceland and tested them for AIV. From these, we isolated and fully sequenced the genomes of 29 AIVs from wild caught gulls (Charadriiformes) and waterfowl (Anseriformes) in Iceland. We detected viruses that were entirely (8 of 8 genomic segments) of American lineage, viruses that were entirely of Eurasian lineage, and viruses with mixed American-Eurasian lineage. Prior to this work only 2 AIVs had been reported from wild birds in Iceland and only the sequence from one segment was available in GenBank. This is the first report of finding AIVs of entirely American lineage and Eurasian lineage, as well as reassortant viruses, together in the same geographic location. Our study demonstrates the importance of the North Atlantic as a corridor for the movement of AIVs between Europe and North America.
2011-03-14
... address concerns raised in a recent decision by a NOAA Administrative Law Judge (see Atlantic Tunas Transfer at Sea section for case reference). NMFS has prepared a draft Environmental Assessment (EA... subtraction of these allocations directly from the TAC, the recommendation allocates the remainder to the UK...
International Nuclear Information System (INIS)
MacKenzie, A.B.; Stewart, A.; Cook, G.T.; Mitchell, L.; Ellet, D.J.; Griffiths, C.R.
2006-01-01
Results are presented for a study of manmade and natural radionuclides in north east Atlantic continental shelf and slope sediments to the west of Scotland. The data are interpreted in the context of sediment mixing and accumulation processes and are used to establish the westward extent of contamination of the sediment system. Offshore shelf and slope sediments were found to have post-glacial sedimentation rates of the order of 1 cm ky -1 but nearshore sediments had much higher accumulation rates of the order of 0.1 cm y -1 . Surface mixed layer depths of up to 6 cm were observed and non-local mixing affected most of the slope sediments, resulting in advective transport of surface sediment to depths of up to 10 cm. Biodiffusion coefficients for offshore shelf and slope sediments were dominantly in the range 10 -8 to 10 -9 cm 2 s -1 . The study confirmed that seawater contaminated with Sellafield waste radionuclides is dominantly entrained to the east of 7 deg. W and, consistent with this, higher levels of Sellafield derived radionuclides were confined to nearshore sediments, with lower levels to the west of 7 deg. W. 238 Pu/ 239,24 Pu data indicated that Sellafield contributed 75-91% of the total plutonium in coastal sediment but only about 4-8% of the total in slope sediments. By analogy, it can be concluded that a similar situation will apply to other contaminants in seawater entering the north east Atlantic via the North Channel
Handiani, D.; Paul, A.; Dupont, L.
2012-07-01
The Bølling-Allerød (BA, starting ~ 14.5 ka BP) is one of the most pronounced abrupt warming periods recorded in ice and pollen proxies. The leading explanation of the cause of this warming is a sudden increase in the rate of deepwater formation in the North Atlantic Ocean and the resulting effect on the heat transport by the Atlantic Meridional Overturning Circulation (AMOC). In this study, we used the University of Victoria (UVic) Earth System-Climate Model (ESCM) to run simulations, in which a freshwater perturbation initiated a BA-like warming period. We found that under present climate conditions, the AMOC intensified when freshwater was added to the Southern Ocean. However, under Heinrich event 1 (HE1, ~ 16 ka BP) climate conditions, the AMOC only intensified when freshwater was extracted from the North Atlantic Ocean, possibly corresponding to an increase in evaporation or a decrease in precipitation in this region. The intensified AMOC led to a warming in the North Atlantic Ocean and a cooling in the South Atlantic Ocean, resembling the bipolar seesaw pattern typical of the last glacial period. In addition to the physical response, we also studied the simulated vegetation response around the Atlantic Ocean region. Corresponding with the bipolar seesaw hypothesis, the rainbelt associated with the Intertropical Convergence Zone (ITCZ) shifted northward and affected the vegetation pattern in the tropics. The most sensitive vegetation area was found in tropical Africa, where grass cover increased and tree cover decreased under dry climate conditions. An equal but opposite response to the collapse and recovery of the AMOC implied that the change in vegetation cover was transient and robust to an abrupt climate change such as during the BA period, which is also supported by paleovegetation data. The results are in agreement with paleovegetation records from Western tropical Africa, which also show a reduction in forest cover during this time period. Further
75 FR 74004 - Atlantic Highly Migratory Species; Advisory Panel
2010-11-30
... Atlantic Regional Fishery Management Councils, each of the 18 constituent states, both the U.S. Virgin... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA059 Atlantic... nominations for the Advisory Panel (AP) for Atlantic Highly Migratory Species (HMS) Southeast Data, Assessment...
Water type quantification in the Skagerrak, the Kattegat and off the Jutland west coast
Directory of Open Access Journals (Sweden)
Trond Kristiansen
2015-04-01
Full Text Available An extensive data series of salinity, nutrients and coloured dissolved organic material (CDOM was collected in the Skagerrak, the northern part of the Kattegat and off the Jutland west coast in April each year during the period 1996–2000, by the Institute of Marine Research in Norway. In this month, after the spring bloom, German Bight Water differs from its surrounding waters by a higher nitrate content and higher nitrate/phosphate and nitrate/silicate ratios. The spreading of this water type into the Skagerrak is of special interest with regard to toxic algal blooms. The quantification of the spatial distributions of the different water types required the development of a new algorithm for the area containing the Norwegian Coastal Current, while an earlier Danish algorithm was applied for the rest of the area. From the upper 50 m a total of 2227 observations of salinity and CDOM content have been used to calculate the mean concentration of water from the German Bight, the North Sea (Atlantic water, the Baltic Sea and Norwegian rivers. The Atlantic Water was the dominant water type, with a mean concentration of 79%, German Bight Water constituted 11%, Baltic Water 8%, and Norwegian River Water 2%. At the surface the mean percentages of these water types were found to be 68%, 15%, 15%, and 3%, respectively. Within the northern part of the Skagerrak, closer to the Norwegian coast, the surface waters were estimated to consist of 74% Atlantic Water, 20% Baltic Water, and 7% Norwegian River Water. The analysis indicates that the content of German Bight Water in this part is less than 5%.
2010-06-22
.... 100513223-0254-01] RIN 0648-AY88 Fisheries of the Northeastern United States; Atlantic Deep-Sea Red Crab Fisheries; 2010 Atlantic Deep-Sea Red Crab Specifications In- season Adjustment AGENCY: National Marine... deep-sea red crab fishery, including a target total allowable catch (TAC) and a fleet-wide days-at-sea...
Duvel, Jean Philippe; Camargo, Suzana; Sobel, Adam
2016-04-01
Modifications of the large-scale environment related to intraseasonal (MJO) and interannual (ENSO) time-scale variability or to global climate warming may have important impacts on the tropical cyclonic activity. This sensitivity of tropical cyclones (TC) on environmental changes can now be studied using General Circulation Models (GCM). Before doing sensitivity studies with a GCM, it is interesting to assess the representation of the TC activity for different configurations (resolution, parameterization) of the GCM in present climate conditions and to trace possible causes of bias in TC number, location or strength. A possible approach to do this assessment is to separate initiation and intensification processes. By using either GCM output, or meteorological analysis combined to TC observation databases, it is possible to study the condition of formation of tropical depressions vortices (TDV) at an early stage and their possible intensification into a TC (say the Tropical Storm stage). We use the LMDZ GCM to study the sensitivity of TDV characteristics to different entrainment and closure formulations of the convective scheme. The study focuses on the Tropical North Atlantic using the "zoom" capability of the LMDZ GCM. The horizontal resolution of the model is set to 0.75° over a large region of the North Atlantic and West Africa. The GCM is free to run in this region and is tied to ERA-Interim reanalysis outside that region, with intermediate relaxation times in-between. We use the Tiedtke convective scheme with entrainment and closure based on the moisture convergence, or with an entrainment based on the relative humidity of the environment, and additionally a closure based on CAPE. Each configuration is run for 10 years between 2000 and 2009 with prescribed SST. In summary, the convective entrainment based on the relative humidity in the environment deepens the TDV in LMDZ, resulting in more TDV and TC. The convective closure mitigates this tendency and
Modes of winter precipitation variability in the North Atlantic
Energy Technology Data Exchange (ETDEWEB)
Zorita, E. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Hydrophysik; Saenz, J.; Fernandez, J.; Zubillaga, J. [Bilbao Univ. (Spain)
2001-07-01
The modes of variability of winter precipitation in the North Atlantic sector are identified by Empirical Orthogonal Functions Analysis in the NCEP/NCAR global reanalysis data sets. These modes are also present in a gridded precipitation data set over the Western Europe. The large-scale fields of atmospheric seasonal mean circulation, baroclinic activity, evaporation and humidity transport that are connected to the rainfall modes have been also analyzed in order to investigate the physical mechanisms that are causally linked to the rainfall modes. The results indicate that the leading rainfall mode is associated to the North Atlantic oscillation and represents a meridional redistribution of precipitation in the North Atlantic through displacements of the storm tracks. The second mode is related to evaporation anomalies in the Eastern Atlantic that precipitate almost entirely in the Western Atlantic. The third mode seems to be associated to meridional transport of water vapor from the Tropical Atlantic. (orig.)
Tropical Atlantic biases and their relation to surface wind stress and terrestrial precipitation
Richter, Ingo; Xie, Shang-Ping; Wittenberg, Andrew T.; Masumoto, Yukio
2012-03-01
Most coupled general circulation models (GCMs) perform poorly in the tropical Atlantic in terms of climatological seasonal cycle and interannual variability. The reasons for this poor performance are investigated in a suite of sensitivity experiments with the Geophysical Fluid Dynamics Laboratory (GFDL) coupled GCM. The experiments show that a significant portion of the equatorial SST biases in the model is due to weaker than observed equatorial easterlies during boreal spring. Due to these weak easterlies, the tilt of the equatorial thermocline is reduced, with shoaling in the west and deepening in the east. The erroneously deep thermocline in the east prevents cold tongue formation in the following season despite vigorous upwelling, thus inhibiting the Bjerknes feedback. It is further shown that the surface wind errors are due, in part, to deficient precipitation over equatorial South America and excessive precipitation over equatorial Africa, which already exist in the uncoupled atmospheric GCM. Additional tests indicate that the precipitation biases are highly sensitive to land surface conditions such as albedo and soil moisture. This suggests that improving the representation of land surface processes in GCMs offers a way of improving their performance in the tropical Atlantic. The weaker than observed equatorial easterlies also contribute remotely, via equatorial and coastal Kelvin waves, to the severe warm SST biases along the southwest African coast. However, the strength of the subtropical anticyclone and along-shore winds also play an important role.
Tropical Atlantic biases and their relation to surface wind stress and terrestrial precipitation
Energy Technology Data Exchange (ETDEWEB)
Richter, Ingo [Research Institute for Global Change, JAMSTEC, Yokohama (Japan); University of Hawaii at Manoa, International Pacific Research Center, Honolulu, HI (United States); Xie, Shang-Ping [University of Hawaii at Manoa, International Pacific Research Center, Honolulu, HI (United States); University of Hawaii at Manoa, Department of Meteorology, Honolulu, HI (United States); Wittenberg, Andrew T. [NOAA/Geophysical Fluid Dynamics Laboratory, Princeton, NJ (United States); Masumoto, Yukio [Research Institute for Global Change, JAMSTEC, Yokohama (Japan)
2012-03-15
Most coupled general circulation models (GCMs) perform poorly in the tropical Atlantic in terms of climatological seasonal cycle and interannual variability. The reasons for this poor performance are investigated in a suite of sensitivity experiments with the Geophysical Fluid Dynamics Laboratory (GFDL) coupled GCM. The experiments show that a significant portion of the equatorial SST biases in the model is due to weaker than observed equatorial easterlies during boreal spring. Due to these weak easterlies, the tilt of the equatorial thermocline is reduced, with shoaling in the west and deepening in the east. The erroneously deep thermocline in the east prevents cold tongue formation in the following season despite vigorous upwelling, thus inhibiting the Bjerknes feedback. It is further shown that the surface wind errors are due, in part, to deficient precipitation over equatorial South America and excessive precipitation over equatorial Africa, which already exist in the uncoupled atmospheric GCM. Additional tests indicate that the precipitation biases are highly sensitive to land surface conditions such as albedo and soil moisture. This suggests that improving the representation of land surface processes in GCMs offers a way of improving their performance in the tropical Atlantic. The weaker than observed equatorial easterlies also contribute remotely, via equatorial and coastal Kelvin waves, to the severe warm SST biases along the southwest African coast. However, the strength of the subtropical anticyclone and along-shore winds also play an important role. (orig.)
Directory of Open Access Journals (Sweden)
Orian E. Tzadik
2015-06-01
Full Text Available The Atlantic Goliath Grouper, Epinephelus itajara, is critically endangered throughout its range but has begun to show initial signs of recovery in Florida state waters. As the population continues to rebound, researchers face a pressing need to fill the knowledge gaps about this iconic species. Here, we examined the δ15N isotopic records in fin rays collected from Atlantic Goliath Grouper, and related changes of isotopic ratios over time to life history characteristics. Fin-ray analysis was used as a non-lethal technique to sample individuals from two locations at similar latitudes from the west and east coasts of Florida, USA. δ15N data were acquired by mechanically separating the annuli of each fin ray and then analyzing the material in an Irradiance Elemental Analyzer Mass Spectrometer. The δ15N values were consistent among individuals within populations from each coast of Florida, and mirrored the expected changes over the lives of the fish. Overall, differences were found between δ15N values at juvenile life history phases versus adult phases, but the patterns associated with these differences were unique to each coastal group. We demonstrated, for the first time, that δ15N values from fin rays can be used to assess the life histories of Atlantic Goliath Grouper. The non-lethal strategies outlined here can be used to acquire information essential to the management of species of concern, such as those that are threatened or endangered.
Energy Technology Data Exchange (ETDEWEB)
Richter, Ingo [University of Hawaii at Manoa, International Pacific Research Center, Honolulu, HI (United States); Xie, Shang-Ping [University of Hawaii at Manoa, Department of Meteorology, Honolulu, HI (United States)
2010-08-15
Atmospheric moisture transport from the Atlantic to the Pacific basin plays an important role in regulating North Atlantic salinity and thus the strength of the thermohaline circulation. Potential changes in the strength of this moisture transport are investigated for two different climate-change scenarios: North Atlantic cooling representative of Heinrich events, and increased greenhouse gas (GHG) forcing. The effect of North Atlantic cooling is studied using a coupled regional model with comparatively high resolution that successfully simulates Central American gap winds and other important aspects of the region. Cooler North Atlantic sea surface temperature (SST) in this model leads to a regional decrease of atmospheric moisture but also to an increase in wind speed across Central America via an anomalous pressure gradient. The latter effect dominates, resulting in a 0.13 Sv (1 Sv = 10{sup 6} m{sup 3} s{sup -1}) increase in overall moisture transport to the Pacific basin. In fresh water forcing simulations with four different general circulation models, the wind speed effect is also present but not strong enough to completely offset the effect of moisture decrease except in one model. The influence of GHG forcing is studied using simulations from the Intergovernmental Panel on Climate Change archive. In these simulations atmospheric moisture increases globally, resulting in an increase of moisture transport by 0.25 Sv from the Atlantic to Pacific. Thus, in both scenarios, moisture transport changes act to stabilize the thermohaline circulation. The notion that the Andes effectively block moisture transport from the Atlantic to the Pacific basin is not supported by the simulations and atmospheric reanalyses examined here. This indicates that such a blocking effect does not exist or else that higher resolution is needed to adequately represent the steep orography of the Andes. (orig.)
Fiedler, B.; Grundle, D.; Löscher, C. R.; Schütte, F.; Hauss, H.; Karstensen, J.; Silva, P.; Koertzinger, A.
2016-02-01
Severely oxygen-depleted mesoscale features in the open eastern tropical North Atlantic, which are formed in the Mauritanian upwelling region, were discovered only recently. So far, few remote surveys conducted with autonomous platforms such as moorings, underwater gliders and profiling floats have provided a very first insight into these mesoscale eddies. Due to their hydrographic properties such water bodies are well isolated from ambient waters and therefore can develop severe near-surface oxygen deficits. In this presentation we show results from the first-ever biogeochemical survey of one of these anticyclonic mode-water eddies conducted in spring 2014 at the Cape Verde Ocean Observatory (CVOO) off West Africa. Very low oxygen concentrations of 4.5 µmol kg-1 associated with a CO2 partial pressure of 1164 µatm were found close to the core of the eddy (at 100 m depth). Measurements for nitrate and phosphate also show exceptional high values. Findings point to rapid oxygen consumption through remineralization of organic matter along with depressed lateral mixing of this water body. Indeed, rates for oxygen utilization (OUR) were found to be enhanced when compared to known values in the Atlantic. A closer look into the carbonate system inside the eddýs core revealed disadvantageous conditions for calcifying organisms with the pH dropping down to 7.6 and the Aragonite saturation level reaching 1 at the lower boundary of the euphotic zone. Finally, strong indications for a shift in nitrogen cycling in the core of the eddy from nitrification towards denitrification were found based on gene abundance and N2O-isotope analyses. To our knowledge such severe hypoxic and even suboxic near-surface conditions along with active denitrification have never been reported before in the open Atlantic Ocean.
Redemann, J.; Wood, R.; Zuidema, P.; Haywood, J. M.; Piketh, S.; Formenti, P.; Abel, S.
2016-12-01
Southern Africa produces almost a third of the Earth's biomass burning (BB) aerosol particles. Particles lofted into the mid-troposphere are transported westward over the South-East (SE) Atlantic, home to one of the three permanent subtropical stratocumulus (Sc) cloud decks in the world. The SE Atlantic stratocumulus deck interacts with the dense layers of BB aerosols that initially overlay the cloud deck, but later subside and may mix into the clouds. These interactions include adjustments to aerosol-induced solar heating and microphysical effects, and their global representation in climate models remains one of the largest uncertainties in estimates of future climate. Hence, new observations over the SE Atlantic have significant implications for regional and global climate change predictions. Our understanding of aerosol-cloud interactions in the SE Atlantic is severely limited. Most notably, we are missing knowledge on the absorptive and cloud nucleating properties of aerosols, including their vertical distribution relative to clouds, on the locations and degree of aerosol mixing into clouds, on the processes that govern cloud property adjustments, and on the importance of aerosol effects on clouds relative to co-varying synoptic scale meteorology. We describe first results from various synergistic, international research activities aimed at studying aerosol-cloud interactions in the region: NASA's airborne ORACLES (ObseRvations of Aerosols Above Clouds and Their IntEractionS) deployment in August/September of 2016, the DoE's LASIC (Layered Atlantic Smoke Interactions with Clouds) deployment of the ARM Mobile Facility to Ascension Island (June 2016 - October 2017), the ground-based components of CNRS' AEROCLO-sA (Aerosols Clouds and Fog over the west coast of southern Africa), and ongoing regional-scale integrative, process-oriented science efforts as part of SEALS-sA (Sea Earth Atmosphere Linkages Study in southern Africa). We expect to describe experimental
Directory of Open Access Journals (Sweden)
R. Steinfeldt
2010-01-01
Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.
Directory of Open Access Journals (Sweden)
Alexander Rappaport
2017-12-01
Full Text Available The topic “West-East” has a clear cultural and historical meaning. Orthodox temples face East. The way from West to East and from East to West is tens of thousands of kilometers long and has a special meaning. It differs from the way from North to South: the horizontal axes connect regions, while the vertical axis (Earth-Sky connects the worlds. The expansion of Eurasian tribes occurred along the East-West axis – the world horizontal way. Today the cultural memory of people in the East and West finds itself in the theatre of new dramas of existence and new forces. With the advances in electronic technologies, the world movements seem to have sunk in the depth of the chthonian past to come up anew to the surface of fantastic speeds and momentary connections. A new type of planetary landscape-space relation appears, giving no place for West and East.
A contribution to the biology of the ommastrephid squid Martialia ...
African Journals Online (AJOL)
Updated knowledge on the distribution and biology of the ommastrephid squid Martialia hyadesi in the South-West Atlantic Ocean is presented. Although the species has an Antarctic circumpolar distribution, its most frequent area of appearance is in the South-West Atlantic, where commercial catches have been made.
A White Atlantic? The Idea of American Art in Nineteenth-Century Britain
Directory of Open Access Journals (Sweden)
Tim Barringer
2009-11-01
Full Text Available This article begins with the contention that 'American art' is a powerful retrospective construction, rooted in the institutional practices of art history and museology. Through a focus on the experiences of expatriate American artists (John Singleton Copley and Benjamin West in London at the start of the nineteenth century, and the genre or landscape painting in transatlantic art (including the work of the British artist Thomas Cole, this essay exposes the complex and dynamic cultural interrelationship that existed between the United States and Europe in the period. It extends Paul Gilroy's and Joseph Roach's recent concept of the 'Black Atlantic', in which they argue that a single cultural zone brought together London and New Orleans, Kingston, Jamaica and the ports of the Ivory coast, to analyse the cultural and performative exchanges that were also taking place between America and Europe (particularly Great Britain, and that have hitherto been neglected in dominant art history narratives.
Modeling the impact of iron and phosphorus limitations on nitrogen fixation in the Atlantic Ocean
Directory of Open Access Journals (Sweden)
R. R. Hood
2007-07-01
Full Text Available The overarching goal of this study is to simulate subsurface N* (sensu, Gruber and Sarmiento, 1997; GS97 anomaly patterns in the North Atlantic Ocean and determine the basin wide rates of N2-fixation that are required to do so. We present results from a new Atlantic implementation of a coupled physical-biogeochemical model that includes an explicit, dynamic representation of N2-fixation with light, nitrogen, phosphorus and iron limitations, and variable stoichiometric ratios. The model is able to reproduce nitrogen, phosphorus and iron concentration variability to first order. The latter is achieved by incorporating iron deposition directly into the model's detrital iron compartment which allows the model to reproduce sharp near surface gradients in dissolved iron concentration off the west coast of Africa and deep dissolved iron concentrations that have been observed in recent observational studies. The model can reproduce the large scale N* anomaly patterns but requires relatively high rates of surface nitrogen fixation to do so (1.8×1012 moles N yr−1 from 10° N–30° N, 3.4×1012 moles N yr−1 from 25° S–65° N. In the model the surface nitrogen fixation rate patterns are not co-located with subsurface gradients in N*. Rather, the fixed nitrogen is advected away from its source prior to generating a subsurface N* anomaly. Changes in the phosphorus remineralization rate (relative to nitrogen linearly determine the surface nitrogen fixation rate because they change the degree of phosphorus limitation, which is the dominant limitation in the Atlantic in the model. Phosphorus remineralization rate must be increased by about a factor of 2 (relative to nitrogen in order to generate subsurface N* anomalies that are comparable to the observations. We conclude that N2-fixation rate estimates for the Atlantic (and globally may need to be revised upward, which
Implications of climate change on flow regime affecting Atlantic salmon
Directory of Open Access Journals (Sweden)
2007-01-01
Full Text Available The UKCIP02 climate change scenarios (2070–2100 suggest that the UK climate will become warmer (an overall increase of 2.5–3°C, with temperature increases being greater in the summer and autumn than in the spring and winter seasons. In terms of precipitation, winters are expected to become wetter and summers drier throughout the UK. The effect of changes in the future climate on flow regimes are investigated for the Atlantic salmon, Salmo salar, in a case study in an upland UK river. Using a hydraulic modelling approach, flows simulated across the catchment are assessed in terms of hydraulic characteristics (discharge per metre width, flow depths, flow velocities and Froude number. These, compared with suitable characteristics published in the literature for various life stages of Atlantic salmon, enable assessment of habitat suitability. Climate change factors have been applied to meteorological observations in the Eden catchment (north-west England and effects on the flow regime have been investigated using the SHETRAN hydrological modelling system. High flows are predicted to increase by up to 1.5%; yet, a greater impact is predicted from decreasing low flows (e.g. a Q95 at the outlet of the study catchment may decrease to a Q85 flow. Reliability, Resilience and Vulnerability (RRV analysis provides a statistical indication of the extent and effect of such changes on flows. Results show that future climate will decrease the percentage time the ideal minimum physical habitat requirements will be met. In the case of suitable flow depth for spawning activity at the outlet of the catchment, the percentage time may decrease from 100% under current conditions to 94% in the future. Such changes will have implications for the species under the Habitats Directive and for catchment ecological flow management strategies.
Madrigal-González, Jaime; Ballesteros-Cánovas, Juan A; Herrero, Asier; Ruiz-Benito, Paloma; Stoffel, Markus; Lucas-Borja, Manuel E; Andivia, Enrique; Sancho-García, Cesar; Zavala, Miguel A
2017-12-20
The North Atlantic Oscillation (NAO) depicts annual and decadal oscillatory modes of variability responsible for dry spells over the European continent. The NAO therefore holds a great potential to evaluate the role, as carbon sinks, of water-limited forests under climate change. However, uncertainties related to inconsistent responses of long-term forest productivity to NAO have so far hampered firm conclusions on its impacts. We hypothesize that, in part, such inconsistencies might have their origin in periodical sea surface temperature anomalies in the Atlantic Ocean (i.e., Atlantic Multidecadal Oscillation, AMO). Here we show strong empirical evidence in support of this hypothesis using 120 years of periodical inventory data from Iberian pine forests. Our results point to AMO + NAO + and AMO - NAO - phases as being critical for forest productivity, likely due to decreased winter water balance and abnormally low winter temperatures, respectively. Our findings could be essential for the evaluation of ecosystem functioning vulnerabilities associated with increased climatic anomalies under unprecedented warming conditions in the Mediterranean.
Beszczynska-Möller, Agnieszka; Skagseth, Øystein; von Appen, Wilken-Jon; Walczowski, Waldemar; Lien, Vidar
2016-04-01
The heat content in the Arctic Ocean is to a large extent determined by oceanic advection from the south. During the last two decades the extraordinary warm Atlantic water (AW) inflow has been reported to progress through the Nordic Seas into the Arctic Ocean. Warm anomalies can result from higher air temperatures (smaller heat loss) in the Nordic Seas, and/or from an increased oceanic advection. But the ultimate fate of warm anomalies of Atlantic origin depends strongly on their two possible pathways towards the Arctic Ocean. The AW temperature changes from 7-10°C at the entrance to the Nordic Seas, to 6-6.5°C in the Barents Sea opening and 3-3.5°C as the AW leaving Fram Strait enters the Arctic Ocean. When AW passes through the shallow Barents Sea, nearly all its heat is lost due to atmospheric cooling and AW looses its signature. In the deep Fram Strait the upper part of Atlantic water becomes transformed into a less saline and colder surface layer and thus AW preserves its warm core. A significant warming and high variability of AW volume transport was observed in two recent decades in the West Spitsbergen Current, representing the Fram Strait Branch of Atlantic inflow. The AW inflow through Fram Strait carries between 26 and 50 TW of heat into the Arctic Ocean. While the oceanic heat influx to the Barents Sea is of a similar order, the heat leaving it through the northern exit into the Arctic Ocean is negligible. The relative strength of two Atlantic water branches through Fram Strait and the Barents Sea governs the oceanic heat transport into the Arctic Ocean. According to recently proposed mechanism, the Atlantic water flow in the Barents Sea Branch is controlled by the strength of atmospheric low over the northern Barents Sea, acting through a wind-induced Ekman divergence, which intensifies eastward AW flow. The Atlantic water transport in the Fram Strait Branch is mainly forced by the large-scale low-pressure system over the eastern Norwegian and
Seasonal influence of ENSO on the Atlantic ITCZ and equatorial South America
Münnich, M.; Neelin, J. D.
2005-11-01
In late boreal spring, especially May, a strong relationship exists in observations among precipitation anomalies over equatorial South America and the Atlantic intertropical convergence zone (ITCZ), and eastern equatorial Pacific and central equatorial Atlantic sea surface temperature anomalies (SSTA). A chain of correlations of equatorial Pacific SSTA, western equatorial Atlantic wind stress (WEA), equatorial Atlantic SSTA, sea surface height, and precipitation supports a causal chain in which El Niño/Southern Oscillation (ENSO) induces WEA stress anomalies, which in turn affect Atlantic equatorial ocean dynamics. These correlations show strong seasonality, apparently arising within the atmospheric links of the chain. This pathway and the influence of equatorial Atlantic SSTA on South American rainfall in May appear independent of that of the northern tropical Atlantic. Brazil's Nordeste is affected by the northern tropical Atlantic. The equatorial influence lies further to the north over the eastern Amazon and the Guiana Highlands.
Basement control in the development of the early cretaceous West and Central African rift system
Maurin, Jean-Christophe; Guiraud, René
1993-12-01
The structural framework of the Precambrian basement of the West and Central African Rift System (WCARS) is described in order to examine the role of ancient structures in the development of this Early Cretaceous rift system. Basement structures are represented in the region by large Pan-African mobile belts (built at ca. 600 Ma) surrounding the > 2 Ga West African, Congo and Sao Francisco cratons. Except for the small Gao trough (eastern Mali) located near the contact nappe of the Pan-African Iforas suture zone along the edge of the West African craton, the entire WCARS is located within the internal domains of the Pan-African mobile belts. Within these domains, two main structural features occur as the main basement control of the WCARS: (1) an extensive network of near vertical shear zones which trend north-south through the Congo, Brazil, Nigeria, Niger and Algeria, and roughly east-west through northeastern Brazil and Central Africa. The shear zones correspond to intra-continental strike-slip faults which accompanied the oblique collision between the West African, Congo, and Sao Francisco cratons during the Late Proterozoic; (2) a steep metamorphic NW-SE-trending belt which corresponds to a pre-Pan-African (ca. 730 Ma) ophiolitic suture zone along the eastern edge of the Trans-Saharian mobile belt. The post-Pan-African magmatic and tectonic evolution of the basement is also described in order to examine the state of the lithosphere prior to the break-up which occurred in the earliest Cretaceous. After the Pan-African thermo-tectonic event, the basement of the WCARS experienced a long period of intra-plate magmatic activity. This widespread magmatism in part relates to the activity of intra-plate hotspots which have controlled relative uplift, subsidence and occasionally block faulting. During the Paleozoic and the early Mesozoic, this tectonic activity was restricted to west of the Hoggar, west of Aïr and northern Cameroon. During the Late Jurassic
2 SDI, alliance coherence, and East-West nuclear stability
International Nuclear Information System (INIS)
Kolodzie, E.A.
1988-01-01
The nuclear modernization programme, offensive and defensive, now being implemented or seriously proposed by the Western nuclear states and the Soviet Union pose critical problems for the stability of the European and global nuclear balance. The Reagan administration's Strategic Defence Initiative (SDI) and the dramatic growth of British and French nuclear capabilities add new strains on the arms race now underway between the superpowers. Current and emerging instabilities must be addressed promptly along a broad political front, within and outside the framework of the Atlantic Alliance, before they further split the alliance and damage efforts---principally those being pursued at Geneva in the superpower arms control talks---to manage the nuclear balance and the conflicts that divide the two blocs in Europe and elsewhere. The first part of this paper diagnoses the disturbing elements of the evolving nuclear environment which promotes instability. The second suggests an approach -- complex bilateralism -- that might be employed to bring these destabilizing trends under control to promote the development of more coherent, cohesive, and mutually confident alliance strategic policies than exist today and to enhance East-West stability
Shackleton, N.J.; Backman, J.; Zimmerman, H.; Kent, D.V.; Hall, M.A.; Roberts, David G.; Schnitker, D.; Baldauf, J.G.; Desprairies, A.; Homrighausen, R.; Huddlestun, P.; Keene, J.B.; Kaltenback, A.J.; Krumsiek, K.A.O.; Morton, A.C.; Murray, J.W.; Westberg-Smith, J.
1984-01-01
We report here that DSDP Site 552A, cored with the hydraulic piston corer on the west flank of Rockall Bank, recovered an undisturbed sequence of alternating white deep-sea carbonate oozes and dark-coloured layers that are rich in glacial debris. Oxygen isotope analysis of the sequence together with detailed nannofossil and palaeomagnetic stratigraphy shows that the first major horizon of ice-rafting occurred at about 2.4 Myr, and was preceded by a minor pulse of ice-rafting at about 2.5 Myr. The carbon isotope record shows that the site has been bathed by a water mass of similar characteristics to present-day North Atlantic deep water at least since 3.5 Myr. ?? 1984 Nature Publishing Group.
Sarnthein, Michael; Jansen, Eystein; Weinelt, Mara; Arnold, Maurice; Duplessy, Jean Claude; Erlenkeuser, Helmut; FlatøY, Astrid; Johannessen, Gro; Johannessen, Truls; Jung, Simon; Koc, Nalan; Labeyrie, Laurent; Maslin, Mark; Pflaumann, Uwe; Schulz, Hartmut
1995-12-01
Eight time slices of surface-water paleoceanography were reconstructed from stable isotope and paleotemperature data to evaluate late Quaternary changes in density, current directions, and sea-ice cover in the Nordic Seas and NE Atlantic. We used isotopic records from 110 deep-sea cores, 20 of which are accelerator mass spectrometry (AMS)-14C dated and 30 of which have high (>8 cm /kyr) sedimentation rates, enabling a resolution of about 120 years. Paleotemperature estimates are based on species counts of planktonic foraminifera in 18 cores. The δ18O and δ13C distributions depict three main modes of surface circulation: (1) The Holocene-style interglacial mode which largely persisted over the last 12.8 14C ka, and probably during large parts of stage 3. (2) The peak glacial mode showing a cyclonic gyre in the, at least, seasonally ice-free Nordic Seas and a meltwater lens west of Ireland. Based on geostrophic forcing, it possibly turned clockwise, blocked the S-N flow across the eastern Iceland-Shetland ridge, and enhanced the Irminger current around west Iceland. It remains unclear whether surface-water density was sufficient for deepwater formation west of Norway. (3) A meltwater regime culminating during early glacial Termination I, when a great meltwater lens off northern Norway probably induced a clockwise circulation reaching south up to Faeroe, the northward inflow of Irminger Current water dominated the Icelandic Sea, and deepwater convection was stopped. In contrast to circulation modes two and three, the Holocene-style circulation mode appears most stable, even unaffected by major meltwater pools originating from the Scandinavian ice sheet, such as during δ18O event 3.1 and the Bölling. Meltwater phases markedly influenced the European continental climate by suppressing the "heat pump" of the Atlantic salinity conveyor belt. During the peak glacial, melting icebergs blocked the eastward advection of warm surface water toward Great Britain, thus
Marine ecosystem response to the Atlantic Multidecadal Oscillation.
Directory of Open Access Journals (Sweden)
Martin Edwards
Full Text Available Against the backdrop of warming of the Northern Hemisphere it has recently been acknowledged that North Atlantic temperature changes undergo considerable variability over multidecadal periods. The leading component of natural low-frequency temperature variability has been termed the Atlantic Multidecadal Oscillation (AMO. Presently, correlative studies on the biological impact of the AMO on marine ecosystems over the duration of a whole AMO cycle (∼60 years is largely unknown due to the rarity of continuously sustained biological observations at the same time period. To test whether there is multidecadal cyclic behaviour in biological time-series in the North Atlantic we used one of the world's longest continuously sustained marine biological time-series in oceanic waters, long-term fisheries data and historical records over the last century and beyond. Our findings suggest that the AMO is far from a trivial presence against the backdrop of continued temperature warming in the North Atlantic and accounts for the second most important macro-trend in North Atlantic plankton records; responsible for habitat switching (abrupt ecosystem/regime shifts over multidecadal scales and influences the fortunes of various fisheries over many centuries.
77 FR 10772 - Fresh and Chilled Atlantic Salmon From Norway
2012-02-23
... and Chilled Atlantic Salmon From Norway Determination On the basis of the record \\1\\ developed in the... countervailing duty order and antidumping duty order on fresh and chilled Atlantic salmon from Norway would not... and Chilled Atlantic Salmon from Norway: Investigation Nos. 701-TA-302 and 731-TA-454 (Third Review...
Atlantic Warm Pool Trigger for the Younger Dryas Climate Event
Abdul, N. A.; Mortlock, R. A.; Wright, J. D.; Fairbanks, R. G.; Teneva, L. T.
2011-12-01
There is growing evidence that variability in the size and heat content of the tropical Atlantic Warm Pool impacts circum-North Atlantic climate via the Atlantic Multi-decadal Oscillation mode (Wang et al., 2008). The Atlantic Warm Pool spans the Gulf of Mexico, Caribbean Sea and the western tropical North Atlantic. Barbados is located near the center of the tropical Atlantic Warm Pool and coupled ocean models suggest that Barbados remains near the center of the tropical Atlantic Warm Pool under varying wind stress simulations. Measurements of the oxygen isotope paleothermometer in Acropora palmata coral species recovered from cores offshore Barbados, show a 3oC monotonic decrease in sea surface temperature from 13106 ± 83 to 12744 ± 61 years before present (errors given as 2 sigma). This interval corresponds to a sea level rise from 71.4 meters to 67.1 meters below present levels at Barbados. The 3oC temperature decrease is captured in eight A. palmata specimens that are in stratigraphic sequence, 230Th/234U dated, and analyzed for oxygen isotopes. All measurements are replicated. We are confident that this is the warm pool equivalent of the Younger Dryas climate event. The initiation of this temperature drop in the Atlantic Warm Pool predates the Younger Dryas start in Greenland ice cores, reported to start at 12896 ± 138 years (relative to AD 2000) (Rasmussen et al., 2006), while few other Younger Dryas climate records are dated with similar accuracy to make the comparison. Rasmussen, S.O., Andersen, K.K., Svensson, A.M., Steffensen, J.P., Vinther, B.M., Clausen, H.B., Siggaard-Andersen, M.L., Johnsen, S.J., Larsen, L.B., Dahl-Jensen, D., Bigler, M., Röthlisberger, R., Fischer, H., Goto-Azuma, K., Hansson, M.E., and Ruth, U., 2006, A new Greenland ice core chronology for the last glacial termination: J. Geophys. Res., v. 111, p. D06102. Wang, C., Lee, S.-K., and Enfield, D.B., 2008, Atlantic Warm Pool acting as a link between Atlantic Multidecadal
76 FR 65673 - Atlantic Highly Migratory Species; Atlantic Shark Management Measures; Correction
2011-10-24
... these shark stocks and end overfishing, as necessary. The notice provided an incorrect date for a...' intent to undertake rulemaking to rebuild and/or end overfishing of these Atlantic shark stocks and to...
... for Educators Search English Español What's West Nile Virus? KidsHealth / For Kids / What's West Nile Virus? Print en español ¿Qué es el Virus del Nilo Occidental? What exactly is the West ...
75 FR 17463 - Key West Bank, Key West, Florida; Notice of Appointment of Receiver
2010-04-06
... DEPARTMENT OF THE TREASURY Office of Thrift Supervision Key West Bank, Key West, Florida; Notice... section 5(d)(2) of the Home Owners' Loan Act, the Office of Thrift Supervision has duly appointed the Federal Deposit Insurance Corporation as sole Receiver for Key West Bank, Key West, Florida, (OTS No...
Directory of Open Access Journals (Sweden)
Bruce E Kurtz
Full Text Available The Atlantic meridional overturning circulation (AMOC is the northward flow of surface water to subpolar latitudes where deepwater is formed, balanced by southward abyssal flow and upwelling in the vicinity of the Southern Ocean. It is generally accepted that AMOC flow oscillates with a period of 60-80 years, creating a regular variation in North Atlantic sea surface temperature known as the Atlantic multidecadal oscillation (AMO. This article attempts to answer two questions: how is the AMOC driven and why does it oscillate? Using methods commonly employed by chemical engineers for analyzing processes involving flowing liquids, apparently not previously applied to trying to understand the AMOC, an equation is developed for AMOC flow as a function of the meridional density gradient or the corresponding temperature gradient. The equation is based on the similarity between the AMOC and an industrial thermosyphon loop cooler, which circulates a heat transfer liquid without using a mechanical pump. Extending this equation with an analogy between the flow of heat and electricity explains why the AMOC flow oscillates and what determines its period. Calculated values for AMOC flow and AMO oscillation period are in good agreement with measured values.
Molfetti, Érica; Torres Vilaça, Sibelle; Georges, Jean-Yves; Plot, Virginie; Delcroix, Eric; Le Scao, Rozen; Lavergne, Anne; Barrioz, Sébastien; dos Santos, Fabrício Rodrigues; de Thoisy, Benoît
2013-01-01
The leatherback turtle Dermochelys coriacea is the most widely distributed sea turtle species in the world. It exhibits complex life traits: female homing and migration, migrations of juveniles and males that remain poorly known, and a strong climatic influence on resources, breeding success and sex-ratio. It is consequently challenging to understand population dynamics. Leatherbacks are critically endangered, yet the group from the Northwest Atlantic is currently considered to be under lower risk than other populations while hosting some of the largest rookeries. Here, we investigated the genetic diversity and the demographic history of contrasted rookeries from this group, namely two large nesting populations in French Guiana, and a smaller one in the French West Indies. We used 10 microsatellite loci, of which four are newly isolated, and mitochondrial DNA sequences of the control region and cytochrome b. Both mitochondrial and nuclear markers revealed that the Northwest Atlantic stock of leatherbacks derives from a single ancestral origin, but show current genetic structuration at the scale of nesting sites, with the maintenance of migrants amongst rookeries. Low nuclear genetic diversities are related to founder effects that followed consequent bottlenecks during the late Pleistocene/Holocene. Most probably in response to climatic oscillations, with a possible influence of early human hunting, female effective population sizes collapsed from 2 million to 200. Evidence of founder effects and high numbers of migrants make it possible to reconsider the population dynamics of the species, formerly considered as a metapopulation model: we propose a more relaxed island model, which we expect to be a key element in the currently observed recovering of populations. Although these Northwest Atlantic rookeries should be considered as a single evolutionary unit, we stress that local conservation efforts remain necessary since each nesting site hosts part of the genetic
Arkhipov, A G; Mamedov, A A; Simonova, T A; Tenitskaia, I A
2011-01-01
Changes in the quantitative composition of mass fish species at early stages of ontogenesis in different areas of the Central-Eastern Atlantic (CEA) in warm and cold seasons in 1994-2008 were analyzed in the paper. The most widespread representatives of ichthyocenosis of CEA were: European pilchard (Sardina pilchardus), common scad (Trachurus trachurus), round sardinella (Sardinella aurita), and West-African scad (Trachrus trecae). The data obtained indicate that, within the economic zone of Morocco, fluctuations of numbers at early stages of development in European pilchard and common scad are close over the entire water area under consideration (36 degrees-21 degrees N). The regularities of fluctuations of the numbers of ichthyoplankton are similar to the interannual changes in the biomass of fish in the area of Morocco. In the area of Mauritania (21 degrees-16 degrees N), fluctuations of numbers of the early stages of development of commercial fish cannot be unambiguously correlated with changes in the biomass of adult fish. It is known that, in the economic zone of Mauritania, there are Senegal-Mauritanian populations of round sardinella and West-African scad that inhabit waters of different states and are not completely assessed by our surveys. Therefore, no obvious relation was observed between the considered data.
Are North Atlantic Multidecadal SST Anomalies Westward Propagating?
Feng, Qingyi; Dijkstra, Hendrik
2014-01-01
The westward propagation of sea surface temperature (SST) anomalies is one of the main characteristics of one of the theories of the Atlantic Multidecadal Oscillation. Here we use techniques from complex network modeling to investigate the existence of the westward propagation in the North Atlantic
Compilation of woody species occurring in the Brazilian Atlantic Forest complex
Bergamin, Rodrigo Scarton; Da Silva Duarte, Leandro; Marcilio-Silva, Vinicius; Dos Santos Seger, Guilherme Dubal; Liebsch, Dieter; Marques, Márcia C. M.
2015-01-01
The Atlantic Forest is a hotspot for biodiversity conservation because of its high levels of endemism and threatened areas. Three main forest types, differentiated by their floras, compose the Atlantic Forest: ‘Atlantic Forest’ sensu strictu, ‘Araucaria Mixed Forest’ and ‘Seasonal Forest’. The flora comprises taxa from the Amazon forest, Cerrado gallery forests and the Andean region, which makes the Atlantic Forest a relevant study system for ecologists and biogeographers. Here, we present da...
Costa, G; Melo-Moreira, E; Pinheiro de Carvalho, M A A
2012-09-01
The helminth parasite fauna of the oceanic horse mackerel Trachurus picturatus Bowdich 1825, caught off the Madeira Islands was composed of six different taxa. Prevalence and abundance of larval Anisakis sp. (Nematoda: Anisakidae) and Nybelinia lingualis (Trypanorhyncha: Tentaculariidae), the most common parasite taxa, were 24.3%, 0.9 and 37.9%, 0.7, respectively. Bolbosoma vasculosum (Acanthocephala: Polymorphidae) and the monogeneans Heteraxinoides atlanticus (Monogenea: Heteraxinidae) and Pseudaxine trachuri (Monogenea: Gastrocotylidae) were comparatively rare. The depauperate helminth fauna of the oceanic horse mackerel at Madeira compared to other geographical regions of the north-eastern Atlantic, namely the Azores banks and the West African coast, may be attributed to the paucity of nutrients off oceanic islands and to a low density of the fish population.
Atlantic Salmon Telemetry Monitoring
National Oceanic and Atmospheric Administration, Department of Commerce — Annual telemetry data are collected as part of specific projects (assessments within watersheds) or as opportunistic efforts to characterize Atlantic salmon smolt...
Kim, J.; Seguí, M. J.; Knudson, K. P.; Yehudai, M.; Goldstein, S. L.; Pena, L. D.; Basak, C.; Ferretti, P.
2017-12-01
North Atlantic Deep Water (NADW) represents the major water mass that drives the Atlantic Meridional Ocean Circulation (AMOC), which undergoes substantial reorganization with changing climate. In order to understand its impact on ocean circulation and climate through time, it is necessary to constrain its composition. We report Nd isotope ratios of Fe-Mn oxide encrusted foraminifera and fish debris from DSDP Site 607 (41.00N 32.96W, 3427m), in the present-day core of NADW, and ODP 1063 (33.68N 57.62W, 4585m), on the deep abyssal plain at the interface between NADW and Antarctic Bottom Water. We provide a new North Atlantic paleocirculation record covering 2 Ma. At Site 607 interglacial ɛNd-values are consistently similar to present-day NADW (ɛNd -13.5), with median ɛNd-values of -14.3 in the Early Pleistocene and -13.8 in the Late Pleistocene. Glacial ɛNd-values are higher by 1 ɛNd-unit in the Early Pleistocene, and 1.5-2 ɛNd-units in the Late Pleistocene. Site 1063 shows much greater variability, with ɛNd ranging from -10 to -26. We interpret the North Atlantic AMOC source as represented by the Site 607 interglacial ɛNd-values, which has remained nearly stable throughout the entire period. The higher glacial ɛNd-values reflect incursions of some southern-sourced waters to Site 607, which is supported by coeval shifts to lower benthic foraminiferal d13C. In contrast, the Site 1063 ɛNd-values do not appear to reflect the AMOC end-member, and likely reflects local effects from a bottom source. A period of greatly disrupted ocean circulation marks 950-850 Ma, which may have been triggered by enhanced ice growth in the Northern Hemisphere that began around 1.2 Ma, as suggested by possible input events of Nd from the surrounding cratons into the North Atlantic observed in Site 607. Interglacial AMOC only recovers to the previously observed vigor over 200 ka following the disruption, whereas further intensified SSW incursion into the deep North Atlantic come to
Riehl, Torben; Kaiser, Stefanie; Brandt, Angelika
2018-02-01
The seafloor below 3500 m remains largely unexplored. The paucity of knowledge of abyssal and hadal environments encompasses a wide spectrum of geological and biological patterns and processes as well as their interactions. Historically most marine research has been conducted in the North Atlantic. However, the high proportion of undescribed taxa frequently discovered at greater depth there underline the need to fill in these knowledge gaps. The Vema-TRANSIT campaign in northern winter 2014-2015 surveyed and sampled along almost the entire extent of one of the major offsets of the Mid-Atlantic Ridge (MAR), the Vema Fracture Zone (VFZ), as well as the deepest trench in the Atlantic, the Puerto Rico Trench (PRT). The discoveries that were made include new data on deep-sea habitats showing geologically complex features across all crust ages from 110 Ma until present. Moreover, some new species and genera of the abyssal and hadal benthos were described herein. Not only the taxa themselves, but also their distributions and genetic structure were elucidated. In this context, significant differences in abundances, community composition, and species distribution were detected that were affected by the MAR as well as by the depth transition between hadal PRT and the adjacent abyss. Despite significant differences between eastern and western communities, the MAR does not represent an absolute barrier. Instead, the VFZ, and especially the VTF may serve as a connecting feature between east and west and this may be exemplary for fracture zones across the whole Atlantic. Nevertheless, the MAR as well as the 3000-m-depth gradient between abyss and hadal appear to restrict gene flow for poor dispersers and thus contribute to speciation processes in the deep sea.
77 FR 44463 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-07-30
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety zone is... Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North Carolina. The safety...
GARP Atlantic Tropical Experiment
National Oceanic and Atmospheric Administration, Department of Commerce — The GARP Atlantic Tropical Experiment (GATE) was the first major international experiment of the Global Atmospheric Research Program (GARP). It was conducted over...
Atlantic Basin refining profitability
International Nuclear Information System (INIS)
Jones, R.J.
1998-01-01
A review of the profitability margins of oil refining in the Atlantic Basin was presented. Petroleum refiners face the continuous challenge of balancing supply with demand. It would appear that the profitability margins in the Atlantic Basin will increase significantly in the near future because of shrinking supply surpluses. Refinery capacity utilization has reached higher levels than ever before. The American Petroleum Institute reported that in August 1997, U.S. refineries used 99 per cent of their capacity for several weeks in a row. U.S. gasoline inventories have also declined as the industry has focused on reducing capital costs. This is further evidence that supply and demand are tightly balanced. Some of the reasons for tightening supplies were reviewed. It was predicted that U.S. gasoline demand will continue to grow in the near future. Gasoline demand has not declined as expected because new vehicles are not any more fuel efficient today than they were a decade ago. Although federally-mandated fuel efficiency standards were designed to lower gasoline consumption, they may actually have prevented consumption from falling. Atlantic margins were predicted to continue moving up because of the supply and demand evidence: high capacity utilization rates, low operating inventories, limited capacity addition resulting from lower capital spending, continued U.S. gasoline demand growth, and steady total oil demand growth. 11 figs
Kerans, C.; Zahm, C.; Bachtel, S.; Hearty, P.; Cheng, H.
2017-12-01
The progressive refinement of the Last Interglacial (LIG) tropical carbonate record has focused attention on the dramatically abrupt and episodic nature of this critical approximate 12 ka time window. From initial carbonate platform flooding at 133 ka to rapid sea level fall and exposure at 118 ka, the majority of present-day Bahamian and Caribbean strata were produced in a remarkably similar pattern extending from Bermuda and the Bahamas through the Cayman Islands, Yucatan, and south to the Dominican Republic. The position of coral reefs and oolitic sands of the LIG to a first order fit the global insolation-driven climate warming signal. Less well accepted/resolved is the existence of two distinct SL peaks with an intervening sea level fall implying a non-orbitally forced climate shift during this broader highstand. West Caicos, a 10 x 5 km leeward island on the Caicos Platform is an excellent example of LIG carbonate stratigraphic complexity. We collected sub-meter-resolution whole-island airborn LIDAR and decimeter-resolution UAV-constructed DEM's of the western and southern coastal outcrops to serve as a base for decimeter-scale mapping of the MIS 11, 7?, 5e, and Holocene units of the island, with particular focus on the continuous 8.4 km west coast outcrop of the MIS 5e. Seventy-five AAR relative age assignments from ooid separates, pinned by 16 U/Th dates from corals coming from MIS stage 11, lower MIS 5e, and upper MIS 5e reefs helped establish the age model for the Pleistocene-Holocene stratigraphy. The lower MIS 5e reef system averages 128 ka with an onset age of 133 ka. Upper MIS 5e corals ranges from 123 ka to 116 ka, bracketing the intra-MIS 5e sea-level fall between to approximately 125 ka. The intra-MIS 5e fall is a distinct erosional unconformity across 5 km of continuous outcrop, truncating the upper 2.5 m of lower 5e reef. The complexity of MIS 5e record on West Caicos and in the Northern Atlantic and Caribbean platforms regionally provides
Lavebratt, C; Olsson, S; Backlund, L; Frisén, L; Sellgren, C; Priebe, L; Nikamo, P; Träskman-Bendz, L; Cichon, S; Vawter, M P; Osby, U; Engberg, G; Landén, M; Erhardt, S; Schalling, M
2014-03-01
The kynurenine pathway metabolite kynurenic acid (KYNA), modulating glutamatergic and cholinergic neurotransmission, is increased in cerebrospinal fluid (CSF) of patients with schizophrenia or bipolar disorder type 1 with psychotic features. KYNA production is critically dependent on kynurenine 3-monooxygenase (KMO). KMO mRNA levels and activity in prefrontal cortex (PFC) are reduced in schizophrenia. We hypothesized that KMO expression in PFC would be reduced in bipolar disorder with psychotic features and that a functional genetic variant of KMO would associate with this disease, CSF KYNA level and KMO expression. KMO mRNA levels were reduced in PFC of bipolar disorder patients with lifetime psychotic features (P=0.005, n=19) or schizophrenia (P=0.02, n=36) compared with nonpsychotic patients and controls. KMO genetic association to psychotic features in bipolar disorder type 1 was studied in 493 patients and 1044 controls from Sweden. The KMO Arg(452) allele was associated with psychotic features during manic episodes (P=0.003). KMO Arg(452) was studied for association to CSF KYNA levels in an independent sample of 55 Swedish patients, and to KMO expression in 717 lymphoblastoid cell lines and 138 hippocampal biopsies. KMO Arg(452) associated with increased levels of CSF KYNA (P=0.03) and reduced lymphoblastoid and hippocampal KMO expression (P≤0.05). Thus, findings from five independent cohorts suggest that genetic variation in KMO influences the risk for psychotic features in mania of bipolar disorder patients. This provides a possible mechanism for the previous findings of elevated CSF KYNA levels in those bipolar patients with lifetime psychotic features and positive association between KYNA levels and number of manic episodes.
77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-09-17
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-10-24
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...
Enhanced biennial variability in the Pacific due to Atlantic capacitor effect.
Wang, Lei; Yu, Jin-Yi; Paek, Houk
2017-03-20
The El Niño-Southern Oscillation (ENSO) and the variability in the Pacific subtropical highs (PSHs) have major impacts on social and ecological systems. Here we present an Atlantic capacitor effect mechanism to suggest that the Atlantic is a key pacemaker of the biennial variability in the Pacific including that in ENSO and the PSHs during recent decades. The 'charging' (that is, ENSO imprinting the North Tropical Atlantic (NTA) sea surface temperature (SST) via an atmospheric bridge mechanism) and 'discharging' (that is, the NTA SST triggering the following ENSO via a subtropical teleconnection mechanism) processes alternate, generating the biennial rhythmic changes in the Pacific. Since the early 1990s, a warmer Atlantic due to the positive phase of Atlantic multidecadal oscillation and global warming trend has provided more favourable background state for the Atlantic capacitor effect, giving rise to enhanced biennial variability in the Pacific that may increase the occurrence frequency of severe natural hazard events.
Behrens, Melanie K.; Pahnke, Katharina; Schnetger, Bernhard; Brumsack, Hans-Jürgen
2018-02-01
In the Atlantic, where deep circulation is vigorous, the dissolved neodymium (Nd) isotopic composition (expressed as ɛNd) is largely controlled by water mass mixing. In contrast, the factors influencing the ɛNd distribution in the Pacific, marked by sluggish circulation, is not clear yet. Indication for regional overprints in the Pacific is given based on its bordering volcanic islands. Our study aims to clarify the impact and relative importance of different Nd sources (rivers, volcanic islands), vertical (bio)geochemical processes and lateral water mass transport in controlling dissolved ɛNd and Nd concentration ([Nd]) distributions in the West Pacific between South Korea and Fiji. We find indication for unradiogenic continental input from South Korean and Chinese rivers to the East China Sea. In the tropical West Pacific, volcanic islands supply Nd to surface and subsurface waters and modify their ɛNd to radiogenic values of up to +0.7. These radiogenic signatures allow detailed tracing of currents flowing to the east and differentiation from westward currents with open ocean Pacific ɛNd composition in the complex tropical Pacific zonal current system. Modified radiogenic ɛNd of West Pacific intermediate to bottom waters upstream or within our section also indicates non-conservative behavior of ɛNd due to boundary exchange at volcanic island margins, submarine ridges, and with hydrothermal particles. Only subsurface to deep waters (3000 m) in the open Northwest Pacific show conservative behavior of ɛNd. In contrast, we find a striking correlation of extremely low (down to 2.77 pmol/kg Nd) and laterally constant [Nd] with the high-salinity North and South Pacific Tropical Water, indicating lateral transport of preformed [Nd] from the North and South Pacific subtropical gyres into the study area. This observation also explains the previously observed low subsurface [Nd] in the tropical West Pacific. Similarly, Western South Pacific Central Water, Antarctic
Spatiotemporal Analysis of the Ebola Hemorrhagic Fever in West Africa in 2014
Xu, M.; Cao, C. X.; Guo, H. F.
2017-09-01
Ebola hemorrhagic fever (EHF) is an acute hemorrhagic diseases caused by the Ebola virus, which is highly contagious. This paper aimed to explore the possible gathering area of EHF cases in West Africa in 2014, and identify endemic areas and their tendency by means of time-space analysis. We mapped distribution of EHF incidences and explored statistically significant space, time and space-time disease clusters. We utilized hotspot analysis to find the spatial clustering pattern on the basis of the actual outbreak cases. spatial-temporal cluster analysis is used to analyze the spatial or temporal distribution of agglomeration disease, examine whether its distribution is statistically significant. Local clusters were investigated using Kulldorff's scan statistic approach. The result reveals that the epidemic mainly gathered in the western part of Africa near north Atlantic with obvious regional distribution. For the current epidemic, we have found areas in high incidence of EVD by means of spatial cluster analysis.
Hydroclimatology of Extreme Precipitation and Floods Originating from the North Atlantic Ocean
Nakamura, Jennifer
from the tropical Atlantic Ocean and the Gulf of Mexico. The typical flow conditions are governed by an anomalous semi-stationary ridge situated east of the US East Coast, which steers the moisture and converges it into the Ohio Valley. Significantly, the moisture path common to all the 20 cases studied here as well as the case of April 2011 is distinctly different from the normal path of Atlantic moisture during spring, which occurs further west. It is shown further that the Ohio basin moisture convergence responsible for the floods is caused primarily by the atmospheric circulation anomaly advecting the climatological mean moisture field. Transport and related convergence due to the covariance between moisture anomalies and circulation anomalies are of secondary but non-negligible importance. The importance of atmospheric circulation anomalies to floods is confirmed by conducting a similar analysis for a series of winter floods on the River Eden in northwest England.
NEFSC 2006 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0615, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2008 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0809, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2003 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0308, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2004 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0413, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 1999 Atlantic Herring Acoustic/Midwater Trawl Survey (DE9909, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 1998 Atlantic Herring Acoustic/Midwater Trawl Survey (DE9810, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2011 Atlantic Herring Acoustic/Midwater Trawl Survey (DE1108, EK60)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2002 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0208, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2010 Atlantic Herring Acoustic/Midwater Trawl Survey (DE1010, EK60)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2000 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0008, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2001 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0109, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2005 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0512, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2007 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0710, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2012 Atlantic Herring Acoustic/Midwater Trawl Survey (PC1206, EK60)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 1998 Atlantic Herring Acoustic/Midwater Trawl Survey (DE9809, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
NEFSC 2009 Atlantic Herring Acoustic/Midwater Trawl Survey (DE0910, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The NEFSC Atlantic herring acoustic survey is a fisheries independent survey that provides scientific data for Atlantic herring assessments in the U.S. mid-Atlantic...
Directory of Open Access Journals (Sweden)
J Boone Kauffman
Full Text Available Globally, it is recognized that blue carbon ecosystems, especially mangroves, often sequester large quantities of carbon and are of interest for inclusion in climate change mitigation strategies. While 19% of the world's mangroves are in Africa, they are among the least investigated of all blue carbon ecosystems. We quantified total ecosystem carbon stocks in 33 different mangrove stands along the Atlantic coast of West-Central Africa from Senegal to Southern Gabon spanning large gradients of latitude, soil properties, porewater salinity, and precipitation. Mangrove structure ranged from low and dense stands that were 35,000 trees ha-1 to tall and open stands >40m in height and 1,000 Mg C ha-1. The lowest carbon stocks were found in the low mangroves of the semiarid region of Senegal (463 Mg C ha-1 and in mangroves on coarse-textured soils in Gabon South (541 Mg C ha-1. At the scale of the entirety of West-Central Africa, total ecosystem carbon stocks were poorly correlated to aboveground ecosystem carbon pools, precipitation, latitude and soil salinity (r2 = ≤0.07 for all parameters. Based upon a sample of 158 sites from Africa, Asia and Latin America that were sampled in a similar manner to this study, the global mean of carbon stocks for mangroves is 885 Mg C ha-1. The ecosystem carbon stocks of mangroves for West-Central Africa are slightly lower than those of Latin America (940 Mg C ha-1 and Asia (1049 Mg C ha-1 but substantially higher than the default Intergovernmental Panel on Climate Change (IPCC values for mangroves (511 Mg C ha-1. This study provides an improved estimation of default estimates (Tier 1 values of mangroves for Asia, Latin America, and West Central Africa.
Behrens, Melanie K.; Pahnke, Katharina; Paffrath, Ronja; Schnetger, Bernhard; Brumsack, Hans-Jürgen
2018-03-01
Recent studies suggest that transport and water mass mixing may play a dominant role in controlling the distribution of dissolved rare earth element concentrations ([REE]) at least in parts of the North and South Atlantic and the Pacific Southern Ocean. Here we report vertically and spatially high-resolution profiles of dissolved REE concentrations ([REE]) along a NW-SE transect in the West Pacific and examine the processes affecting the [REE] distributions in this area. Surface water REE patterns reveal sources of trace element (TE) input near South Korea and in the tropical equatorial West Pacific. Positive europium anomalies and middle REE enrichments in surface and subsurface waters are indicative of TE input from volcanic islands and fingerprint in detail small-scale equatorial zonal eastward transport of TEs to the iron-limited tropical East Pacific. The low [REE] of North and South Pacific Tropical Waters and Antarctic Intermediate Water are a long-range (i.e., preformed) laterally advected signal, whereas increasing [REE] with depth within North Pacific Intermediate Water result from release from particles. Optimum multiparameter analysis of deep to bottom waters indicates a dominant control of lateral transport and mixing on [REE] at the depth of Lower Circumpolar Deep Water (≥3000 m water depth; ∼75-100% explained by water mass mixing), allowing the northward tracing of LCDW to ∼28°N in the Northwest Pacific. In contrast, scavenging in the hydrothermal plumes of the Lau Basin and Tonga-Fiji area at 1500-2000 m water depth leads to [REE] deficits (∼40-60% removal) and marked REE fractionation in the tropical West Pacific. Overall, our data provide evidence for active trace element input both near South Korea and Papua New Guinea, and for a strong lateral transport component in the distribution of dissolved REEs in large parts of the West Pacific.
A Low-Li Geochemical Province in the NE Atlantic
DEFF Research Database (Denmark)
Bailey, J. C.; Gwozdz, R.
1978-01-01
Lithium was analysed in 392 basalts and related igneous rocks from the North Atlantic Tertiary-Recent province using activation analysis and Čerenkov counting. Monotonous Li values of 5.5±2 ppm in NE Atlantic basalts define a low-Li geochemical province which has persisted for 60 million years...... basalt series. No whole-rock coherence is observed between Li and Mg, K, Rb or Ca. Mantle phlogopite is considered to play an insignificant rôle in controlling the Li levels of NE Atlantic basalts....
DEFF Research Database (Denmark)
Trondhjem, Naja Blytmann; Fortescue, Michael David
West Greenlandic Eskimo. The current situation of the West Greenlandic language as principal means of communication among the majority Greenlandic population will be presented with special emphasis on the northwest hunting district of Upernavik, where traditional marine mammal hunting is still...... the principal economic activity. Research projects and language initiatives currently in progress within Greenland will be touched upon, as will the possibilities of communication with North American Inuit. West Greenlandic is unique among the native languages of the North American Arctic and Sub...
Fast northward energy transfer in the Atlantic due to Agulhas Rings
van Sebille, Erik; van Leeuwen, P.J.
2007-01-01
The adiabatic transit time of wave energy radiated by an Agulhas ring released in the South Atlantic Ocean to the North Atlantic Ocean is investigated in a two-layer ocean model. Of particular interest is the arrival time of baroclinic energy in the northern part of the Atlantic, because it is
Brands, S.; Gutiérrez, J. M.; San-Martín, D.
2017-05-01
A new atmospheric-river detection and tracking scheme based on the magnitude and direction of integrated water vapour transport is presented and applied separately over 13 regions located along the west coasts of Europe (including North Africa) and North America. Four distinct reanalyses are considered, two of which cover the entire twentieth-century: NOAA-CIRES Twentieth Century Reanalysis v2 (NOAA-20C) and ECMWF ERA-20C. Calculations are done separately for the OND and JFM-season and, for comparison with previous studies, for the ONDJFM-season as a whole. Comparing the AR-counts from NOAA-20C and ERA-20C with a running 31-year window looping through 1900-2010 reveals differences in the climatological mean and inter-annual variability which, at the start of the twentieth-century, are much more pronounced in western North America than in Europe. Correlating European AR-counts with the North Atlantic Oscillation (NAO) reveals a pattern reminiscent of the well-know precipitation dipole which is stable throughout the entire century. A similar analysis linking western North American AR-counts to the North Pacific index (NPI) is hampered by the aforementioned poor reanalysis agreement at the start of the century. During the second half of the twentieth-century, the strength of the NPI-link considerably varies with time in British Columbia and the Gulf of Alaska. Considering the period 1950-2010, AR-counts are then associated with other relevant large-scale circulation indices such as the East Atlantic, Scandinavian, Pacific-North American and West Pacific patterns (EA, SCAND, PNA and WP). Along the Atlantic coastline of the Iberian Peninsula and France, the EA-link is stronger than the NAO-link if the OND season is considered and the SCAND-link found in northern Europe is significant during both seasons. Along the west coast of North America, teleconnections are generally stronger during JFM in which case the NPI-link is significant in any of the five considered
Directory of Open Access Journals (Sweden)
André Marafon-Almeida
Full Text Available Abstract The distribution of the species of Lucifer Thompson, 1829 (Decapoda: Luciferidae in the South Atlantic Subtropical Gyre was assessed by the Brazil Transatlantic Commission in November and December 2009. The samples were collected at 83 stations on two profiles between Brazil and Africa (20 º and 30 ºS. Oblique hauls were performed with a WP-2 net up to 150 meters deep. A distinct sexual relationship was noted between the two species found and L. faxoni presented a significantly higher number of females relative to males 1:0.5 (X2 = 21.77, p = 0.0001. The L. typus sex ratio had significantly more males than females 1.86:1 (X2=50.84, p = 0.0001. The distribution of L. typus occurred in both the western and the eastern portions of the Mid-Oceanic Ridge. This distribution was significantly related to salinity (R2 = 0:13; F = 3.79, p = 0.009, which was higher in the western portion of the study area. In addition, the recordings of the two species were extended to the Atlantic Subtropical Gyre. Overall, Luciferidae shrimp were more common and abundant at the stations west of the Mid-Oceanic Ridge and L. typus was the most frequent and abundant species.
76 FR 56120 - Atlantic Highly Migratory Species; North and South Atlantic Swordfish Quotas
2011-09-12
... recreational fishing for swordfish in the Atlantic Ocean, including the Caribbean Sea and Gulf of Mexico, by... http://www.iccat.int/en/ . One swordfish measure adopted at the 2010 meeting, and one swordfish measure...
Chen, Yushun; Viadero, Roger C; Wei, Xinchao; Fortney, Ronald; Hedrick, Lara B; Welsh, Stuart A; Anderson, James T; Lin, Lian-Shin
2009-01-01
Refining best management practices (BMPs) for future highway construction depends on a comprehensive understanding of environmental impacts from current construction methods. Based on a before-after-control impact (BACI) experimental design, long-term stream monitoring (1997-2006) was conducted at upstream (as control, n = 3) and downstream (as impact, n = 6) sites in the Lost River watershed of the Mid-Atlantic Highlands region, West Virginia. Monitoring data were analyzed to assess impacts of during and after highway construction on 15 water quality parameters and macroinvertebrate condition using the West Virginia stream condition index (WVSCI). Principal components analysis (PCA) identified regional primary water quality variances, and paired t tests and time series analysis detected seven highway construction-impacted water quality parameters which were mainly associated with the second principal component. In particular, impacts on turbidity, total suspended solids, and total iron during construction, impacts on chloride and sulfate during and after construction, and impacts on acidity and nitrate after construction were observed at the downstream sites. The construction had statistically significant impacts on macroinvertebrate index scores (i.e., WVSCI) after construction, but did not change the overall good biological condition. Implementing BMPs that address those construction-impacted water quality parameters can be an effective mitigation strategy for future highway construction in this highlands region.
50 CFR 229.32 - Atlantic large whale take reduction plan regulations.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Atlantic large whale take reduction plan... Regulations § 229.32 Atlantic large whale take reduction plan regulations. (a)(1) Purpose and scope. The purpose of this section is to implement the Atlantic Large Whale Take Reduction Plan to reduce incidental...
Darroch, Louise; Buck, Justin
2017-04-01
Atlantic Ocean observation is currently undertaken through loosely-coordinated, in-situ observing networks, satellite observations and data management arrangements at regional, national and international scales. The EU Horizon 2020 AtlantOS project aims to deliver an advanced framework for the development of an Integrated Atlantic Ocean Observing System that strengthens the Global Ocean Observing System (GOOS) and contributes to the aims of the Galway Statement on Atlantic Ocean Cooperation. One goal is to ensure that data from different and diverse in-situ observing networks are readily accessible and useable to a wider community, including the international ocean science community and other stakeholders in this field. To help achieve this goal, the British Oceanographic Data Centre (BODC) produced a parameter matrix to harmonise data exchange, data flow and data integration for the key variables acquired by multiple in-situ AtlantOS observing networks such as ARGO, Seafloor Mapping and OceanSITES. Our solution used semantic linking of controlled vocabularies and metadata for parameters that were "mappable" to existing EU and international standard vocabularies. An AtlantOS Essential Variables list of terms (aggregated level) based on Global Climate Observing System (GCOS) Essential Climate Variables (ECV), GOOS Essential Ocean Variables (EOV) and other key network variables was defined and published on the Natural Environment Research Council (NERC) Vocabulary Server (version 2.0) as collection A05 (http://vocab.nerc.ac.uk/collection/A05/current/). This new vocabulary was semantically linked to standardised metadata for observed properties and units that had been validated by the AtlantOS community: SeaDataNet parameters (P01), Climate and Forecast (CF) Standard Names (P07) and SeaDataNet units (P06). Observed properties were mapped to biological entities from the internationally assured AphiaID from the WOrld Register of Marine Species (WoRMS), http
Variations in Mediterranean-Atlantic exchange across the late Pliocene climate transition
García-Gallardo, Ángela; Grunert, Patrick; Piller, Werner E.
2018-03-01
Mediterranean-Atlantic exchange through the Strait of Gibraltar plays a significant role in the global ocean-climate dynamics in two ways. On one side, the injection of the saline and warm Mediterranean Outflow Water (MOW) contributes to North Atlantic deep-water formation. In return, the Atlantic inflow is considered a sink of less saline water for the North Atlantic Ocean. However, while the history of MOW is the focus of numerous studies, the Pliocene Atlantic inflow has received little attention so far. The present study provides an assessment of the Mediterranean-Atlantic exchange with a focus on the Atlantic inflow strength and its response to regional and global climate from 3.33 to 2.60 Ma. This time interval comprises the mid-Pliocene warm period (MPWP; 3.29-2.97 Ma) and the onset of the Northern Hemisphere glaciation (NHG). For this purpose, gradients in surface δ18O records of the planktonic foraminifer Globigerinoides ruber between the Integrated Ocean Drilling Program (IODP) Hole U1389E (Gulf of Cádiz) and Ocean Drilling Program (ODP) Hole 978A (Alboran Sea) have been evaluated. Interglacial stages and warm glacials of the MPWP revealed steep and reversed (relative to the present) W-E δ18O gradients suggesting a weakening of Mediterranean-Atlantic exchange likely caused by high levels of relative humidity in the Mediterranean region. In contrast, periods of stronger inflow are indicated by flat δ18O gradients due to more intense arid conditions during the severe glacial Marine Isotope Stage (MIS) M2 and the initiation of NHG (MIS G22, G14, G6-104). Intensified Mediterranean-Atlantic exchange in cold periods is linked to the occurrence of ice-rafted debris (IRD) at low latitudes and a weakening of the Atlantic Meridional Overturning Circulation (AMOC). Our results thus suggest the development of a negative feedback between AMOC and exchange rates at the Strait of Gibraltar in the latest Pliocene as it has been proposed for the late Quaternary.
The distribution of 226Ra in the Atlantic Ocean
International Nuclear Information System (INIS)
Broecker, W.S.; Goddard, J.; Sarmiento, J.L.
1976-01-01
Based on results obtained during the GEOSECS program the primary features of the distribution of 226 Ra in the Atlantic Ocean can be defined. Outside the Antarctic no significant variation has been found in the 226 Ra content of surface waters. Eighty samples yield an average of 7.4 dpm/100 kg (normalized to a salinity of 35.00%). Deep waters in the central Atlantic have 226 Ra contents several dpm/100 kg higher than expected from the mixing of Antarctic Bottom Water (21.3 dpm/100 kg) and basal North Atlantic Deep Water (10.3 dpm/100 kg). These excesses correlate well with deficiencies in O 2 and excesses in SiO 2 . The intermediate water 226 Ra maximum in the South Atlantic is associated with the inflow of low-oxygen Circumpolar Intermediate Water beneath the Antarctic Intermediate Water. (Auth.)
Atlantic Oceanographic and Meteorological Laboratory
Federal Laboratory Consortium — The Atlantic Oceanographic and Meteorological Laboratory conducts research to understand the physical, chemical, and biological characteristics and processes of the...
Pietrak, Michael R.; Bricknell, Ian
2013-01-01
Integrated multitrophic aquaculture (IMTA) reduces the environmental impacts of commercial aquaculture systems by combining the cultivation of fed species with extractive species. Shellfish play a critical role in IMTA systems by filter-feeding particulate-bound organic nutrients. As bioaccumulating organisms, shellfish may also increase disease risk on farms by serving as reservoirs for important finfish pathogens such as infectious pancreatic necrosis virus (IPNV). The ability of the blue mussel (Mytilus edulis) to bioaccumulate and transmit IPNV to naive Atlantic salmon (Salmo salar) smolts was investigated. To determine the ability of mussels to filter and accumulate viable IPNV, mussels were held in water containing log 4.6 50% tissue culture infective dose(s) (TCID50) of the West Buxton strain of IPNV ml−1. Viable IPNV was detected in the digestive glands (DGs) of IPNV-exposed mussels as early as 2 h postexposure. The viral load in mussel DG tissue significantly increased with time and reached log 5.35 ± 0.25 TCID50 g of DG tissue−1 after 120 h of exposure. IPNV titers never reached levels that were significantly greater than that in the water. Viable IPNV was detected in mussel feces out to 7 days postdepuration, and the virus persisted in DG tissues for at least 18 days of depuration. To determine whether IPNV can be transmitted from mussels to Atlantic salmon, IPNV-exposed mussels were cohabitated with naive Atlantic salmon smolts. Transmission of IPNV did occur from mussels to smolts at a low frequency. The results demonstrate that a nonenveloped virus, such as IPNV, can accumulate in mussels and be transferred to naive fish. PMID:23872575
CARINA TCO2 data in the Atlantic Ocean
Directory of Open Access Journals (Sweden)
R. Wanninkhof
2010-07-01
Full Text Available Water column data of carbon and carbon-relevant hydrographic and hydrochemical parameters from 188 cruises in the Arctic Mediterranean Seas, Atlantic and Southern Ocean have been retrieved and merged in a new data base: the CARINA (CARbon IN the Atlantic Project. These data have gone through rigorous quality control (QC procedures so as to improve the quality and consistency of the data as much as possible. Secondary quality control, which involved objective study of data in order to quantify systematic differences in the reported values, was performed for the pertinent parameters in the CARINA data base. Systematic biases in the data have been tentatively corrected in the data products. The products are three merged data files with measured, adjusted and interpolated data of all cruises for each of the three CARINA regions (Arctic Mediterranean Seas, Atlantic and Southern Ocean. Ninety-eight cruises were conducted in the "Atlantic" defined as the region south of the Greenland-Iceland-Scotland Ridge and north of about 30° S. Here we report the details of the secondary QC which was done on the total dissolved inorganic carbon (TCO2 data and the adjustments that were applied to yield the final data product in the Atlantic. Procedures of quality control – including crossover analysis between stations and inversion analysis of all crossover data – are briefly described. Adjustments were applied to TCO2 measurements for 17 of the cruises in the Atlantic Ocean region. With these adjustments, the CARINA data base is consistent both internally as well as with GLODAP data, an oceanographic data set based on the WOCE Hydrographic Program in the 1990s, and is now suitable for accurate assessments of, for example, regional oceanic carbon inventories, uptake rates and model validation.
Kitzberger, Thomas; Brown, Peter M; Heyerdahl, Emily K; Swetnam, Thomas W; Veblen, Thomas T
2007-01-09
Widespread synchronous wildfires driven by climatic variation, such as those that swept western North America during 1996, 2000, and 2002, can result in major environmental and societal impacts. Understanding relationships between continental-scale patterns of drought and modes of sea surface temperatures (SSTs) such as El Niño-Southern Oscillation (ENSO), Pacific Decadal Oscillation (PDO), and Atlantic Multidecadal Oscillation (AMO) may explain how interannual to multidecadal variability in SSTs drives fire at continental scales. We used local wildfire chronologies reconstructed from fire scars on tree rings across western North America and independent reconstructions of SST developed from tree-ring widths at other sites to examine the relationships of multicentury patterns of climate and fire synchrony. From 33,039 annually resolved fire-scar dates at 238 sites (the largest paleofire record yet assembled), we examined forest fires at regional and subcontinental scales. Since 1550 CE, drought and forest fires covaried across the West, but in a manner contingent on SST modes. During certain phases of ENSO and PDO, fire was synchronous within broad subregions and sometimes asynchronous among those regions. In contrast, fires were most commonly synchronous across the West during warm phases of the AMO. ENSO and PDO were the main drivers of high-frequency variation in fire (interannual to decadal), whereas the AMO conditionally changed the strength and spatial influence of ENSO and PDO on wildfire occurrence at multidecadal scales. A current warming trend in AMO suggests that we may expect an increase in widespread, synchronous fires across the western U.S. in coming decades.
Nakamura, Shigehisa
2010-05-01
This work is an introduction of a meridional ocean circulation. As for the zonal motions,there have been many contributions. Recent oceanographic works noticed an overturn of the ocean current in the North Atlantic. The author notices this overturn is a trigger to generate a meridional ocean circulation to have a track through the deep Atlantic, the deep circum-polar current, the deep branch flow to the Pacific between the Australian and the South America. The east part of the branch flow relates to the upwelling off Peru, and the west part relates to form a deep water in the Northwest Pacific. THe overturn of the North Atlantic suggests an outflow of the deep water and a storage of the old aged deep water in the Northwest Pacific. The storage water increase in the Northwest Pacific shoould be a trigger of the swelling up of the sea level mid Pacific to affect to the ocean front variations between the coastal waters and the ocean water. In order to keep a hydrodynamic balance on the earth, an increase of the deep water in the Pacific should flow through the Bering Sea and the Arctic Sea to get to the North Atlantic. It should be noted that a budget of the ocean water flow must be hold the condition of the water masses concservation on the earth surface. This inertia motion is maintained once induced after any natural effect or some man-made influences. At this stage, the author has to notice that there has been developed a meridional inertia path of the air particle as well as the ocean water parcel, nevertheless nobody has had pointed out this inertiamotion with a meridional path in the ocean. Air-sea interaction must be one of the main factors for driving the ocean water though the inertia motion in the global scale is more energetic. To the details, the scientists should pursue what geophysical dynamics must be developed in the future.
Thirumalai, Kaustubh; Quinn, Terrence M.; Okumura, Yuko; Richey, Julie; Partin, Judson W.; Poore, Richard Z.; Moreno-Chamarro, Eduardo
2018-01-01
Surface-ocean circulation in the northern Atlantic Ocean influences Northern Hemisphere climate. Century-scale circulation variability in the Atlantic Ocean, however, is poorly constrained due to insufficiently-resolved paleoceanographic records. Here we present a replicated reconstruction of sea-surface temperature and salinity from a site sensitive to North Atlantic circulation in the Gulf of Mexico which reveals pronounced centennial-scale variability over the late Holocene. We find significant correlations on these timescales between salinity changes in the Atlantic, a diagnostic parameter of circulation, and widespread precipitation anomalies using three approaches: multiproxy synthesis, observational datasets, and a transient simulation. Our results demonstrate links between centennial changes in northern Atlantic surface-circulation and hydroclimate changes in the adjacent continents over the late Holocene. Notably, our findings reveal that weakened surface-circulation in the Atlantic Ocean was concomitant with well-documented rainfall anomalies in the Western Hemisphere during the Little Ice Age.
Thirumalai, Kaustubh; Quinn, Terrence M; Okumura, Yuko; Richey, Julie N; Partin, Judson W; Poore, Richard Z; Moreno-Chamarro, Eduardo
2018-01-26
Surface-ocean circulation in the northern Atlantic Ocean influences Northern Hemisphere climate. Century-scale circulation variability in the Atlantic Ocean, however, is poorly constrained due to insufficiently-resolved paleoceanographic records. Here we present a replicated reconstruction of sea-surface temperature and salinity from a site sensitive to North Atlantic circulation in the Gulf of Mexico which reveals pronounced centennial-scale variability over the late Holocene. We find significant correlations on these timescales between salinity changes in the Atlantic, a diagnostic parameter of circulation, and widespread precipitation anomalies using three approaches: multiproxy synthesis, observational datasets, and a transient simulation. Our results demonstrate links between centennial changes in northern Atlantic surface-circulation and hydroclimate changes in the adjacent continents over the late Holocene. Notably, our findings reveal that weakened surface-circulation in the Atlantic Ocean was concomitant with well-documented rainfall anomalies in the Western Hemisphere during the Little Ice Age.
On the Influence of Global Warming on Atlantic Hurricane Frequency
Hosseini, S. R.; Scaioni, M.; Marani, M.
2018-04-01
In this paper, the possible connection between the frequency of Atlantic hurricanes to the climate change, mainly the variation in the Atlantic Ocean surface temperature has been investigated. The correlation between the observed hurricane frequency for different categories of hurricane's intensity and Sea Surface Temperature (SST) has been examined over the Atlantic Tropical Cyclogenesis Regions (ACR). The results suggest that in general, the frequency of hurricanes have a high correlation with SST. In particular, the frequency of extreme hurricanes with Category 5 intensity has the highest correlation coefficient (R = 0.82). In overall, the analyses in this work demonstrates the influence of the climate change condition on the Atlantic hurricanes and suggest a strong correlation between the frequency of extreme hurricanes and SST in the ACR.
An evaluation of management strategies for Atlantic tuna stocks
Directory of Open Access Journals (Sweden)
L. T. Kell
2003-04-01
Full Text Available International agreements for the International Commission for the Conservation of Atlantic Tunas (ICCAT convention area imply that Atlantic tuna stocks should be managed by strategies based on maximum sustainable yield (MSY; however, there is concern whether this will actually ensure sustainability with sufficiently high probability consistent with the principals of the precautionary approach. Therefore, the performance of MSY management strategies based on current assessment procedures was evaluated using a computer simulation framework. The framework includes the data collection, assessment, prediction, and management processes, as well as the implementation of management regulations. It therefore provides an integrated way to evaluate the relative importance of and the interactions between each component of the system with regard to the overall success of the management strategy. The study elucidates guidelines about assessment and management that are general enough to be applied to all tunas in the Atlantic Ocean. It does so by comparing different hypotheses about management and assessment for three stocks (North Atlantic albacore, Atlantic bigeye and East Atlantic skipjack, which are representative of the variety encountered (i.e. from data rich to poor and tropical to temperate waters in ICCAT stocks. Management performance was especially sensitive to the carrying capacity of the stock. The type of proxy used for MSY was more important to the success of the procedure than the frequency of assessment or the number of indices used in the assessment. Whilst the procedure was successful at achieving the management objectives for albacore, it was only partially successful for bigeye and was too conservative for skipjack.
Constraining formation of the Eggvin Bank (West of Jan Mayen, N. Atlantic) from OBS data
Tan, P.; Breivik, A. J.; Mjelde, R.; Azuma, R.
2015-12-01
The anomalously high magma flux in the Eggvin Bank area has triggered new research efforts to better understand the crustal development in this area. The Eggvin Bank is located between the Jan Mayen Island and the west coast of Greenland. Some proposed origins of the Eggvin Bank are: a distinct plume located beneath Jan Mayen; an extension of the Iceland plume; minor spreading or leakage along West Jan Mayen Fracture Zone (WJMFZ); intruded continental crust extending from Jan Mayen Microcontinent (JMMC); and rifted Greenland sub-continental lithospheric mantle. In this first modern refraction seismic study of the Eggvin Bank, we present a 2D velocity model based on OBS data. The OBSs were deployed approx. N-S over the Eggvin Bank with good data quality constrained by 4 OBSs. The air-gun array used during OBS shooting produced good quality reflection data. Three distinct seamounts are observed along the profile: the northern seamount (water depth 730m), has a flat top with a thin sedimentary veneer on top, which indicates it has been eroded at sea surface; while the southern two seamounts, one (water depth 550m) is less flat with around 100m thick sedimentary units on top, another one is rounded with tiny sedimentary veneer on top having the shallowest water depth (460m). This could suggest that the southern seamounts are younger, since they are shallower but without obvious signs that they were subaerially exposed. However, increased cooling of the lithosphere across the WJMFZ in the north may also contribute to depth differences. A normal fault offsetting sedimentary strata (~300 m) in the Greenland Basin indicates recent tectonic activity north of the Eggvin Bank. The velocity modeling shows crustal thickness with large variations, ranging from 8 km to 14 km, where crustal thickness changes of 4-5 km are associated with 20-30 km wide segments with thick crust under the seamounts. The crust consists of three oceanic crustal layers: upper crust (2.8km/s-4.8km
Murphy, Fionn; Russell, Marie; Ewins, Ciaran; Quinn, Brian
2017-09-15
This study reports plastic ingestion in various fish found from coastal and offshore sites in Scottish marine waters. Coastal samples consisted of three demersal flatfish species (n=128) collected from the East and West coasts of Scotland. Offshore samples consisted of 5 pelagic species and 4 demersal species (n=84) collected from the Northeast Atlantic. From the coastal fish sampled, 47.7% of the gastrointestinal tracts contained macroplastic and microplastic. Of the 84 pelagic and demersal offshore fish, only 2 (2.4%) individuals from different species had ingested plastic identified as a clear polystyrene fibre and a black polyamide fibre. The average number of plastic items found per fish from all locations that had ingested plastic was 1.8 (±1.7) with polyamide (65.3%), polyethylene terephthalate (14.4%) and acrylic (14.4%) being the three most commonly found plastics. This study adds to the existing data on macroplastic and microplastic ingestion in fish species. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Donders, Timme H. [Utrecht University, Laboratory of Palaeobotany and Palynology, Institute of Environmental Biology, Utrecht (Netherlands); TNO Geological Survey of the Netherlands, Utrecht (Netherlands); Boer, Hugo Jan de; Dekker, Stefan C. [Utrecht University, Department of Environmental Sciences, Faculty of Geosciences, P.O. Box 80115, Utrecht (Netherlands); Finsinger, Walter; Wagner-Cremer, Friederike [Utrecht University, Laboratory of Palaeobotany and Palynology, Institute of Environmental Biology, Utrecht (Netherlands); Grimm, Eric C. [Research and Collections Center, Illinois State Museum, Springfield, IL (United States); Reichart, Gert Jan [Utrecht University, Geochemistry, Department of Earth Sciences, Faculty of Geosciences, P.O. Box 80021, Utrecht (Netherlands)
2011-01-15
Recurrent phases of increased pine at Lake Tulane, Florida have previously been related to strong stadials terminated by so-called Heinrich events. The climatic significance of these pine phases has been interpreted in different ways. Using a pollen-climate inference model, we quantified the climate changes and consistently found that mean summer precipitation (P{sub JJA}) increased (0.5-0.9 mm/day) and mean November temperature increased (2.0-3.0 C) during pine phases coeval with Heinrich events and the Younger Dryas. Marine sea surface temperature records indicate that potential sources for these moisture and heat anomalies are in the Gulf of Mexico and the western tropical Atlantic. We explain this low latitude warming by an increased Loop Current facilitated by persistence of the Atlantic Warm Pool during summer. This hypothesis is supported by a climate model sensitivity analysis. A positive heat anomaly in the Gulf of Mexico and equatorial Atlantic best approximates the pollen-inferred climate reconstructions from Lake Tulane during the (stadials around) Heinrich events and the Younger Dryas. (orig.)
Population structure of Atlantic Mackerel (Scomber scombrus)
DEFF Research Database (Denmark)
Jansen, Teunis; Gislason, Henrik
2013-01-01
Atlantic mackerel (Scomber scombrus) occurs on both sides of the north Atlantic and has traditionally been grouped into 5 spawning components, some of which were thought to be isolated natal homing stocks. Previous studies have provided no evidence for cross Atlantic migration and no or weak...... between the North Sea and Celtic Sea, which indicates that the two spawning components may be connected by straying individuals. This finding is based on unique larvae samples collected before the collapse of North Sea component, thus showing that the exchange is not a recent phenomenon due...... to the collapse. The analyses of old as well as more recent age distributions show that strong year classes spread into other areas where they spawn as adults (“twinning”). Our findings are in accordance with the lack of solid evidence for stock separation from previous analyses of tagging data, genetics...
Geophysical and geodynamic studies of the North Atlantic Realm
DEFF Research Database (Denmark)
Schiffer, Christian
2015-01-01
The geology of the North Atlantic Realm (NAR), including the North Atlantic, Greenland, the Arctic, Iceland, Scandinavia, Northern Europe and Northeast America has been studied for more than a century and inspired some of the most fundamental theories in geoscience, such as plate tectonics, the s...
Atlantic Meridional Overturning Circulation During the Last Glacial Maximum.
Lynch-Stieglitz, J.; Adkins, J.F.; Curry, W.B.; Dokken, T.; Hall, I.R.; Herguera, J.C.; Hirschi, J.J.-M.; Ivanova, E.V.; Kissel, C.; Marchal, O.; Marchitto, T.M.; McCave, I.N.; McManus, J.F.; Mulitza, S.; Ninnemann, U.; Peeters, F.J.C.; Yu, E.-F.; Zahn, R.
2007-01-01
The circulation of the deep Atlantic Ocean during the height of the last ice age appears to have been quite different from today. We review observations implying that Atlantic meridional overturning circulation during the Last Glacial Maximum was neither extremely sluggish nor an enhanced version of
Phylogeography of Rattus norvegicus in the South Atlantic Ocean
Directory of Open Access Journals (Sweden)
Melanie Hingston
2016-12-01
Full Text Available Norway rats are a globally distributed invasive species, which have colonized many islands around the world, including in the South Atlantic Ocean. We investigated the phylogeography of Norway rats across the South Atlantic Ocean and bordering continental countries. We identified haplotypes from 517 bp of the hypervariable region I of the mitochondrial D-loop and constructed a Bayesian consensus tree and median-joining network incorporating all other publicly available haplotypes via an alignment of 364 bp. Three Norway rat haplotypes are present across the islands of the South Atlantic Ocean, including multiple haplotypes separated by geographic barriers within island groups. All three haplotypes have been previously recorded from European countries. Our results support the hypothesis of rapid Norway rat colonization of South Atlantic Ocean islands by sea-faring European nations from multiple European ports of origin. This seems to have been the predominant pathway for repeated Norway rat invasions of islands, even within the same archipelago, rather than within-island dispersal across geographic barriers.
ON THE INFLUENCE OF GLOBAL WARMING ON ATLANTIC HURRICANE FREQUENCY
Directory of Open Access Journals (Sweden)
S. R. Hosseini
2018-04-01
Full Text Available In this paper, the possible connection between the frequency of Atlantic hurricanes to the climate change, mainly the variation in the Atlantic Ocean surface temperature has been investigated. The correlation between the observed hurricane frequency for different categories of hurricane’s intensity and Sea Surface Temperature (SST has been examined over the Atlantic Tropical Cyclogenesis Regions (ACR. The results suggest that in general, the frequency of hurricanes have a high correlation with SST. In particular, the frequency of extreme hurricanes with Category 5 intensity has the highest correlation coefficient (R = 0.82. In overall, the analyses in this work demonstrates the influence of the climate change condition on the Atlantic hurricanes and suggest a strong correlation between the frequency of extreme hurricanes and SST in the ACR.
Directory of Open Access Journals (Sweden)
Guido Abbattista
2008-01-01
Full Text Available This essay is devoted to a relatively minor episode in Edmund Burke’s parliamentary career and political speculation involving the rights of war and international law in the final years of the American War of Independence. The starting point for Burke’s consideration of these questions was the affair of St. Eustatius, that is to say Britain’s conquest in 1781 of the Dutch West-Indian island early in the “fourth Anglo-Dutch War” of 1780-1784. The harsh treatment of the Dutch colony’s cosmopolitan community by the commanding officers of the British Navy and Army provoked a series of reactions in Britain and the colonies. The essay starts by outlining the identity of St. Eustatius with its economic, demographic and social features, its peculiar role in the eighteenth-century West Indies and its emblematic meaning in the historical literature of the Enlightenment as a symbol of the virtues of commerce and of economic liberty. It goes on to analyse the facts of the military conquest in 1781 and the ensuing occupation realized by Admiral George Rodney and Major-General John Vaughan, particularly as this affected the “poor Jews at St. Eustatius” (as Burke himself qualified them in his second speech on 4 December 1781, with the subsequent reactions of the Dutch and especially the British Atlantic world. We then examine Edmund Burke’s reasons for taking up this affair, including the political and ideological motives and the sources of arguments he used in the two parliamentary speeches he made on the topic during 1781, relating this to Burke’s ideas on international relations and imperial government during the 1770s and 1780s. We end by pointing to cultural links between Burke’s positions and a wider political, commercial and civic culture emerging in the British Atlantic world which reflected some of the most typical European Enlightenment values and ideological commitments.
Mehta, Vikram M.
1998-09-01
Gridded time series from the Global Ocean Surface Temperature Atlas were analyzed with a variety of techniques to identify spatial structures and oscillation periods of the tropical Atlantic sea surface temperature (SST) variations at decadal timescales, and to develop physical interpretations of statistical patterns of decadal SST variations. Each time series was 110 yr (1882-1991) long. The tropical Atlantic SST variations were compared with decadal variations in a 74-yr-long (1912-85) north Nordeste Brazil rainfall time series and a 106-yr-long (1886-1991) tropical Atlantic cyclone activity index time series. The tropical Atlantic SST variations were also compared with decadal variations in the extratropical Atlantic SST.Multiyear to multidecadal variations in the cross-equatorial dipole pattern identified as a dominant empirical pattern of the tropical Atlantic SST variations in earlier and present studies are shown to be variations in the approximately north-south gradient of SST anomalies. It is also shown that there was no dynamical-thermodynamical, dipole mode of SST variations during the analysis period. There was a distinct decadal timescale (12-13 yr) of SST variations in the tropical South Atlantic, whereas no distinct decadal timescale was found in the tropical North Atlantic SST variations. Approximately 80% of the coherent decadal variance in the cross-equatorial SST gradient was `explained' by coherent decadal oscillations in the tropical South Atlantic SSTs. There were three, possibly physical, modes of decadal variations in the tropical Atlantic SSTs during the analysis period. In the more energetic mode of the North Atlantic decadal SST variations, anomalies traveled into the tropical North Atlantic from the extratropical North Atlantic along the eastern boundary of the basin. The anomalies strengthened and resided in the tropical North Atlantic for several years, then frequently traveled northward into the mid-high-latitude North Atlantic along
Walsh, J. J.; Weisberg, R. H.; Lenes, J. M.; Chen, F. R.; Dieterle, D. A.; Zheng, L.; Carder, K. L.; Vargo, G. A.; Havens, J. A.; Peebles, E.; Hollander, D. J.; He, R.; Heil, C. A.; Mahmoudi, B.; Landsberg, J. H.
2009-01-01
Toxic Florida red tides of the dinoflagellate Kareniabrevis have downstream consequences of 500-1000 km spatial extent. Fish stocks, shellfish beds, and harmful algal blooms of similar species occupy the same continental shelf waters of the southeastern United States, amounting to economic losses of more than 25 million dollars in some years. Under the aegis of the Center for Prediction of Red tides, we are now developing coupled biophysical models of the conditions that lead to red tides and impacted coastal fisheries, from the Florida Panhandle to Cape Hatteras. Here, a nitrogen isotope budget of the coastal food web of the West Florida shelf (WFS) and the downstream South Atlantic Bight (SAB) reaffirms that diazotrophs are the initial nutrient source for onset of red tides and now identifies clupeid fish as the major recycled nutrient source for their maintenance. The recent isotope budget of WFS and SAB coastal waters during 1998-2001 indicates that since prehistoric times of Timacua Indian settlements along the Georgia coast during 1075, ∼50% of the nutrients required for large red tides of >1 μg chl l -1 of K.brevis have been derived from nitrogen-fixers, with the other half from decomposing dead sardines and herrings. During 2001, >90% of the harvest of WFS clupeids was by large ichthyotoxic red tides of >10 μg chl l -1 of K.brevis, rather than by fishermen. After onset of the usual red tides in summer of 2006 and 2007, the simulated subsequent fall exports of Florida red tides in September 2007 to North Carolina shelf waters replicate observations of just ∼1 μg chl l -1 on the WFS that year. In contrast, the earlier red tides of >10 μg chl l -1 left behind off West Florida during 2006, with less physical export, are instead 10-fold larger than those of 2007. Earlier, 55 fish kills were associated with these coastal red tides during September 2006, between Tampa and Naples. Yet, only six fish kills were reported there in September 2007. With little
A nested Atlantic-Mediterranean Sea general circulation model for operational forecasting
Directory of Open Access Journals (Sweden)
P. Oddo
2009-10-01
Full Text Available A new numerical general circulation ocean model for the Mediterranean Sea has been implemented nested within an Atlantic general circulation model within the framework of the Marine Environment and Security for the European Area project (MERSEA, Desaubies, 2006. A 4-year twin experiment was carried out from January 2004 to December 2007 with two different models to evaluate the impact on the Mediterranean Sea circulation of open lateral boundary conditions in the Atlantic Ocean. One model considers a closed lateral boundary in a large Atlantic box and the other is nested in the same box in a global ocean circulation model. Impact was observed comparing the two simulations with independent observations: ARGO for temperature and salinity profiles and tide gauges and along-track satellite observations for the sea surface height. The improvement in the nested Atlantic-Mediterranean model with respect to the closed one is particularly evident in the salinity characteristics of the Modified Atlantic Water and in the Mediterranean sea level seasonal variability.
The North Atlantic Ocean Is in a State of Reduced Overturning
Smeed, D. A.; Josey, S. A.; Beaulieu, C.; Johns, W. E.; Moat, B. I.; Frajka-Williams, E.; Rayner, D.; Meinen, C. S.; Baringer, M. O.; Bryden, H. L.; McCarthy, G. D.
2018-02-01
The Atlantic Meridional Overturning Circulation (AMOC) is responsible for a variable and climatically important northward transport of heat. Using data from an array of instruments that span the Atlantic at 26°N, we show that the AMOC has been in a state of reduced overturning since 2008 as compared to 2004-2008. This change of AMOC state is concurrent with other changes in the North Atlantic such as a northward shift and broadening of the Gulf Stream and altered patterns of heat content and sea surface temperature. These changes resemble the response to a declining AMOC predicted by coupled climate models. Concurrent changes in air-sea fluxes close to the western boundary reveal that the changes in ocean heat transport and sea surface temperature have altered the pattern of ocean-atmosphere heat exchange over the North Atlantic. These results provide strong observational evidence that the AMOC is a major factor in decadal-scale variability of North Atlantic climate.
76 FR 30921 - South Atlantic Fishery Management Council; Public Meetings
2011-05-27
.... SUMMARY: The South Atlantic Fishery Management Council will hold a joint meeting of its Executive/Finance... Atlantic Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries Service (NMFS..., Assessment and Review (SEDAR) Committee; Law Enforcement [[Page 30922
Disease resistance is related to inherent swimming performance in Atlantic salmon
Castro, Vicente; Grisdale-Helland, Barbara; Jørgensen, Sven Martin; Helgerud, Jan; Claireaux, Guy; Farrell, Anthony P.; Krasnov, Aleksei; Helland, Ståle; Takle, Harald Rune
2013-01-01
Background Like humans, fish can be classified according to their athletic performance. Sustained exercise training of fish can improve growth and physical capacity, and recent results have documented improved disease resistance in exercised Atlantic salmon. In this study we investigated the effects of inherent swimming performance and exercise training on disease resistance in Atlantic salmon. Atlantic salmon were first classified as either poor or good according to their swimming per...
Atlantic Ocean CARINA data: overview and salinity adjustments
Directory of Open Access Journals (Sweden)
T. Tanhua
2010-02-01
Full Text Available Water column data of carbon and carbon-relevant hydrographic and hydrochemical parameters from 188 previously non-publicly available cruise data sets in the Arctic Mediterranean Seas, Atlantic and Southern Ocean have been retrieved and merged into a new database: CARINA (CARbon dioxide IN the Atlantic Ocean. The data have gone through rigorous quality control procedures to assure the highest possible quality and consistency. The data for the pertinent parameters in the CARINA database were objectively examined in order to quantify systematic differences in the reported values, i.e. secondary quality control. Systematic biases found in the data have been corrected in the three data products: merged data files with measured, calculated and interpolated data for each of the three CARINA regions, i.e. the Arctic Mediterranean Seas, the Atlantic and the Southern Ocean. These products have been corrected to be internally consistent. Ninety-eight of the cruises in the CARINA database were conducted in the Atlantic Ocean, defined here as the region south of the Greenland-Iceland-Scotland Ridge and north of about 30° S. Here we present an overview of the Atlantic Ocean synthesis of the CARINA data and the adjustments that were applied to the data product. We also report the details of the secondary QC (Quality Control for salinity for this data set. Procedures of quality control – including crossover analysis between stations and inversion analysis of all crossover data – are briefly described. Adjustments to salinity measurements were applied to the data from 10 cruises in the Atlantic Ocean region. Based on our analysis we estimate the internal consistency of the CARINA-ATL salinity data to be 4.1 ppm. With these adjustments the CARINA data products are consistent both internally as well as with GLODAP data, an oceanographic data set based on the World Hydrographic Program in the 1990s, and is now suitable for accurate assessments of, for example
Kim, J.
2001-12-01
Meteorological and oceanographic studies show that interannual and decadal variability in tropical Atlantic sea-surface temperature (SST) strongly influences the climates over northeast Brazil, sub-Saharan Africa, as well as the Central American and Caribbean regions. In this context, it is worthwhile to reconstruct spatial temperature patterns for the longer-term tropical Atlantic SST history. In this study, a high-resolution alkenone-derived SST record from the subtropical eastern South Atlantic (core GeoB 1023-5) is compared with one from the tropical western North Atlantic (core M35003-4). This comparison reveals synchronous SST variations between both near equatorial Atlantic regions during the Heinrich Event 1 (H1) (18-15.5 cal kyr B.P.), but dipole-like SST variations during the Younger Dryas (YD) (13-11.5 cal kyr B.P.). To assess the relationship of SST variations between both regions, we calculated SST differences between cores GeoB 1023-5 and M35003-4, and compared it with the coccolithophorid Florisphaera profunda abundance record from the equatorial eastern Atlantic (core RC24-08) as an indicator of variations in intensity of south-easterly trade winds [McIntyre and Molfino, 1996]. This comparison suggests that synchronous warming in both regions during the H1 can be attributed to a reduced northward heat transport from the warm equatorial Atlantic to the cold high-latitude North Atlantic linked to the slowdown of thermohaline circulation overturning during cold events under full glacial conditions. However, dipole-like SST variations during the YD is probably more associated with strengthened south-easterly trade winds, which led to a strong upwelling-related cooling in the eastern South Atlantic region and concurrently enhanced advection of warm subtropical South Atlantic waters to the tropical western Atlantic during that time. Accordingly, a coupled oceanic-atmospheric process created a warm pool in the tropical western Atlantic and thus a dipole
Virginia Atlantic Coast Recreational Use
Virginia Department of Environmental Quality — As a member of the Mid-Atlantic Regional Council on the Ocean (MARCO), Virginia, through its Coastal Zone Management (CZM) Program, collected information on how the...
VA Atlantic Coast Recreational Use
Virginia Department of Environmental Quality — As a member of the Mid-Atlantic Regional Council on the Ocean (MARCO), Virginia, through its Coastal Zone Management (CZM) Program, collected information on how the...
Comparative visual ecophysiology of mid-Atlantic temperate reef fishes
Directory of Open Access Journals (Sweden)
Andrij Z. Horodysky
2013-11-01
The absolute light sensitivities, temporal properties, and spectral sensitivities of the visual systems of three mid-Atlantic temperate reef fishes (Atlantic spadefish [Ephippidae: Chaetodipterus faber], tautog [Labridae: Tautoga onitis], and black sea bass [Serranidae: Centropristis striata] were studied via electroretinography (ERG. Pelagic Atlantic spadefish exhibited higher temporal resolution but a narrower dynamic range than the two more demersal foragers. The higher luminous sensitivities of tautog and black sea bass were similar to other benthic and demersal coastal mid-Atlantic fishes. Flicker fusion frequency experiments revealed significant interspecific differences at maximum intensities that correlated with lifestyle and habitat. Spectral responses of the three species spanned 400–610 nm, with high likelihood of cone dichromacy providing the basis for color and contrast discrimination. Significant day-night differences in spectral responses were evident in spadefish and black sea bass but not tautog, a labrid with characteristic structure-associated nocturnal torpor. Atlantic spadefish responded to a wider range of wavelengths than did deeper-dwelling tautog or black sea bass. Collectively, these results suggest that temperate reef-associated fishes are well-adapted to their gradient of brighter to dimmer photoclimates, representative of their unique ecologies and life histories. Continuing anthropogenic degradation of water quality in coastal environments, at a pace faster than the evolution of visual systems, may however impede visual foraging and reproductive signaling in temperate reef fishes.
76 FR 68719 - Mid-Atlantic Fishery Management Council; Public Meeting
2011-11-07
... Mid-Atlantic Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National....org . Council address: Mid-Atlantic Fishery Management Council, 800 North State Street, Suite 201...
78 FR 57534 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic
2013-09-19
... requirements, South Atlantic, Virgin Islands. Dated: September 12, 2013. Samuel D. Rauch III, Deputy Assistant... Mexico, and South Atlantic AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and... Mexico, and South Atlantic: Caribbean coral, Caribbean reef fish, Caribbean spiny lobster, Caribbean...
2013-05-20
... Coastal Fisheries Cooperative Management Act Provisions; Horseshoe Crabs; Application for Exempted Fishing... Atlantic Coastal Fisheries Cooperative Management Act (Atlantic Coastal Act). The EFP would allow for an exemption from the Reserve. Regulations under the Atlantic Coastal Act require publication of this...
Trape, Sébastien; Harrison, Ian J; Diouf, Papa Samba; Durand, Jean-Dominique
2012-02-01
Liza bandialensis Diouf 1991 is redescribed because previous descriptions have not been in well-distributed publications and have lacked sufficient detail or reference to voucher specimens. The description provided here is based on specimens from the Sine Saloum estuary, Senegal (West Africa), from where the species was originally described. The distinctness of the species is confirmed both by meristic and molecular criteria. L. bandialensis presents a unique combination of characters with a low number of scales in the longitudinal series (32-33), 10.5-12 transverse scale rows, and distinctly yellowish dorsal, anal, and caudal fins. The currently known distribution of L. bandialensis includes coastal waters of Senegal, Gambia and Guinea Bissau. Finally, we provide a morphological identification key for the sixteen species of Mugilidae species occurring along the eastern central Atlantic coast of Africa. Copyright © 2011 Académie des sciences. All rights reserved.
77 FR 51968 - Mid-Atlantic Fishery Management Council; Public Meeting
2012-08-28
... Mid-Atlantic Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National....mafmc.org . Council address: Mid-Atlantic Fishery Management Council, 800 North State Street, Suite 201...
75 FR 8673 - Mid-Atlantic Fishery Management Council; Public Meeting
2010-02-25
... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National... Mid-Atlantic Fishery Management Council (Council) will conduct an educational workshop on catch shares in cooperation with the Fisheries Leadership and Sustainability Forum (FLSF), the Atlantic States...
Energy Technology Data Exchange (ETDEWEB)
Huhn, Oliver; Roether, Wolfgang [Institut fuer Umweltphysik, Universitaet Bremen (Germany)
2007-07-01
North Atlantic Deep Water (NADW) represents the Atlantic part of the deep, southward return arm of the oceanic 'conveyor belt', which moderates Europe's climate and effects most of the water transfer from the ocean surface into the deep waters globally. The transfer starts from the NADW formation regions, which in the case of upper NADW (approx. 1500-2000 m depth) is the Labrador Sea (far NW Atlantic). NADW is found concentrated toward the continental slope of the Americas, but subject to meandering, and to recirculation into, and mixing with, the waters of the interior Atlantic. Individual water parcels thus follow a complex ensemble of trajectories. We have obtained characteristics of that ensemble by fitting the free parameters of a suitable function using extensive observations of the transient tracers CFC-11, CFC-12, CCl{sub 4}, and tritium. A tracer transfer function of ocean-surface concentrations to those in newly formed NADW was derived as a precursory step. In the upper NADW we obtain RMS transfer-time dispersions on the way from the Labrador Sea of 31 years at 6 N rising to 53 years at 20 S, compared to mean transfer times ranging 46 to 79 years ({+-}20 %); furthermore, approximately 10 % to 40 % of the water is old, tracer-free water admixed on the way. Similar results have been obtained for lower NADW (approx. 2500-4000 m). The combination of tritium and CFC observations is particularly suited to constrain the dispersion, since it acts on the concentrations of these tracers in an opposite way. The tracer-adjusted transfer functions allow quantification of the NADW transport of pollutants and other compounds delivered to the NADW formation region. The results can furthermore check mean transfer times and large-scale dispersion of the NADW part of dynamic ocean circulation models.
Bird Habitat Conservation at Various Scales in the Atlantic Coast Joint Venture
Andrew Milliken; Craig Watson; Chuck Hayes
2005-01-01
The Atlantic Coast Joint Venture is a partnership focused on the conservation of habitats for migratory birds within the Atlantic Flyway/Atlantic Coast Region from Maine south to Puerto Rico. In order to be effective in planning and implementing conservation in this large and diverse area, the joint venture must work at multiple spatial scales, from the largest ?...
South Atlantic Humanities Center Seminars -- Spring 2004
Elliott, Jean
2004-01-01
The South Atlantic Humanities Center (SAHC) at Virginia Tech is sponsoring several seminars this spring.•À_•À_ SAHC is a partnership of the Virginia Foundation for the Humanities, Virginia Tech, and the University of Virginia.•À_•À_ SAHC focuses on the U.S. South Atlantic from a regional and transatlantic perspective. It explores and preserves the rich heritage of a region stretching from Virginia to the Virgin Islands.•À_•À_ It engages artists and performers, writers and filmmakers, teachers...
75 FR 2488 - Mid-Atlantic Fishery Management Council; Public Meeting
2010-01-15
... Mid-Atlantic Fishery Management Council's (MAFMC) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National... 21240; telephone: (410) 859-3300. Council address: Mid-Atlantic Fishery Management Council, 300 S. New...
75 FR 55743 - Mid-Atlantic Fishery Management Council; Public Meeting
2010-09-14
... Mid-Atlantic Fishery Management Council's (MAFMC) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National... address: Mid-Atlantic Fishery Management Council, 800 N. State Street, Suite 201, Dover, DE 19901...
76 FR 9553 - Mid-Atlantic Fishery Management Council; Public Meeting
2011-02-18
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA226 Mid-Atlantic... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of public meeting. SUMMARY: The Social and Economic Sub-Committee of the Mid-Atlantic Fishery Management Council's (Council) Scientific...
76 FR 16620 - Mid-Atlantic Fishery Management Council (MAFMC); Meeting
2011-03-24
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA316 Mid-Atlantic... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of public meeting. SUMMARY: The Social and Economic Sub-Committee of the Mid-Atlantic Fishery Management Council's (Council) Scientific...
Elemental composition of air masses under different altitudes in Azores, central north Atlantic
International Nuclear Information System (INIS)
Vieira, B.J.; Wolterbeek, H.Th.
2012-01-01
Between 8th July 2002 and 18th June 2004, aerosol samples were collected in Azores. Their inorganic composition was obtained by neutron activation analysis in order to study the differences of aerosols in two atmospheric altitudes of the central north Atlantic: (1) PICO-NARE observatory (Lower Free Troposphere-LFT) at Pico mountain summit (38,470 deg N, 28,404 deg W, 2,225 m a.s.l.) in Pico Island, Azores, where air masses from the surrounding continents (Africa, Europe, Central and North America) pass through, carrying aerosols with anthropogenic (Sb, Br, Mo, U, Se and Tb) and/or natural emissions (Fe, Co, La, Na, Sm, Cr, Zn, Hf, K and Th); (2) TERCEIRA-NARE station (Marine Boundary Layer) at Serreta (38,69 deg N, 27,36 deg W, 50 m a.s.l.), in Terceira Island, Azores, where natural aerosols (I, Cl, Na, Br and other soil related elements) are predominant. However, a combined interpretation of the data points out to a co-existence of the anthropogenic elements Sb and Mo, eventually with similar origins as the ones passing Pico Mountain summit. Very high concentrations and enrichment factors for Sb, Mo and Br in LFT, higher than the ones found in other areas, confirm atmospheric long-range transport mainly from the west boundary of north Atlantic; this may indicate eventual accumulation and persistence of those elements in the area due to the presence of Azores high pressures or the Hadley cells effect. A significant correlation between Fe and Yb and the enrichment of rare earth elements (La, Sm, Tb and Yb) and Th in LFT aerosols, both reflect a mineral dust intrusions from north Africa (Sahara and Sahel region). (author)
Tiger sharks can connect equatorial habitats and fisheries across the Atlantic Ocean basin.
Afonso, André S; Garla, Ricardo; Hazin, Fábio H V
2017-01-01
Increasing our knowledge about the spatial ecology of apex predators and their interactions with diverse habitats and fisheries is necessary for understanding the trophic mechanisms that underlie several aspects of marine ecosystem dynamics and for guiding informed management policies. A preliminary assessment of tiger shark (Galeocerdo cuvier) population structure off the oceanic insular system of Fernando de Noronha (FEN) and the large-scale movements performed by this species in the equatorial Atlantic Ocean was conducted using longline and handline fishing gear and satellite telemetry. A total of 25 sharks measuring 175-372 cm in total length (TL) were sampled. Most sharks were likely immature females ranging between 200 and 260 cm TL, with few individuals shark size-distribution previously reported for coastal waters off the Brazilian mainland, where most individuals measured shark-1; SD = 65.6). These sharks exhibited a considerable variability in their horizontal movements, with three sharks showing a mostly resident behavior around FEN during the extent of the respective tracks, two sharks traveling west to the South American continent, and two sharks moving mostly along the middle of the oceanic basin, one of which ending up in the northern hemisphere. Moreover, one shark traveled east to the African continent, where it was eventually caught by fishers from Ivory Coast in less than 474 days at liberty. The present results suggest that young tiger sharks measuring sharks are able to connect marine trophic webs from the neritic provinces of the eastern and western margins of the Atlantic Ocean across the equatorial basin and that they may experience mortality induced by remote fisheries. All this information is extremely relevant for understanding the energetic balance of marine ecosystems as much as the exposure of this species to fishing pressure in this yet poorly-known region.
Recent variations in geopotential height associated with West African monsoon variability
Okoro, Ugochukwu K.; Chen, Wen; Nath, Debashis
2018-02-01
In the present study, the atmospheric circulation patterns associated with the seasonal West Africa (WA) monsoon (WAM) rainfall variability has been investigated. The observational rainfall data from the Climatic Research Unit (CRU) and atmospheric fields from the National Center for Environmental Prediction (NCEP) reanalysis 2, from 1979 to 2014, have been used. The rainfall variability extremes, classified as wet or dry years, are the outcomes of simultaneous 6-month SPI at the three rainfall zones, which shows increasing trends [Guinea Coast (GC = 0.012 year-1), Eastern Sudano Sahel (ESS = 0.045 year-1) and Western Sudano Sahel (WSS = 0.056 year-1) from Sen's slope]; however, it is significant only in the Sahel region (α = 0.05 and α = 0.001 at ESS and WSS, respectively, from Mann-Kendall test). The vertical profile of the geopotential height (GpH) during the wet and dry years reveals that the 700 hPa anomalies show remarkable pattern at about 8°N to 13°N. This shows varying correlation with the zonal averaged vertically integrated moisture flux convergence and rainfall anomalies, respectively, as well as the oceanic pulsations indexes [Ocean Nino Index (ONI) and South Atlantic Ocean dipole index (SAODI), significant from t test], identified as precursors to the Sahel and GC rainfall variability respectively. The role of GpH anomalies at 700 hPa has been identified as the facilitator to the West African Westerly Jet's input to the moisture flux transported over the WA. This is a new perspective of the circulation processes associated with WAM and serves as a basis for modeling investigations.
Atlantic update, July 1986--June 1990: Outer Continental Shelf oil and gas activities
Energy Technology Data Exchange (ETDEWEB)
Karpas, R.M.; Gould, G.J.
1990-10-01
This report describes outer continental shelf oil and gas activities in the Atlantic Region. This edition of the Atlantic Update includes an overview of the Mid-Atlantic Planning Area and a summary of the Manteo Prospect off-shore North Carolina. 6 figs., 8 tabs.
77 FR 19175 - Atlantic Highly Migratory Species; 2012 Atlantic Bluefin Tuna Quota Specifications
2012-03-30
...). Attachments to electronic comments will be accepted in Microsoft Word or Excel, WordPerfect, or Adobe PDF file... active member of the International Commission for the Conservation of Atlantic Tunas (ICCAT), the United States implements binding ICCAT recommendations to comply with this international treaty. ATCA authorizes...
Turtle riders: remoras on marine turtles in Southwest Atlantic
Directory of Open Access Journals (Sweden)
Ivan Sazima
Full Text Available An overview is presented for a poorly documented relationship between reef vertebrates in Southwest Atlantic: remoras (Echeneidae associated with marine turtles. Two remora species (Echeneis naucrates and Remora remora and four turtle species (Caretta caretta, Chelonia mydas, Eretmochelys imbricata, and Dermochelys coriacea are here recorded in symbiotic associations in the SW Atlantic. Echeneis naucrates was recorded both on the coast and on oceanic islands, whereas R. remora was recorded only at oceanic islands and in the open sea. The remora-turtle association is usually regarded as an instance of phoresis (hitchhiking, albeit feeding by the fish is also involved in this symbiosis type. This association seems to be rare in SW Atlantic.
76 FR 3878 - Mid-Atlantic Fishery Management Council; Public Meeting
2011-01-21
... Mid-Atlantic Fishery Management Council's (MAFMC) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National.... ADDRESSES: The webinar will be held at Mid-Atlantic Fishery Management Council, 800 N. State Street, Suite...
75 FR 56994 - Mid-Atlantic Fishery Management Council; Public Meeting
2010-09-17
... Mid-Atlantic Fishery Management Council's (MAFMC) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National.... ADDRESSES: The webinar will be held at Mid-Atlantic Fishery Management Council, 800 N. State Street, Suite...
77 FR 23662 - Mid-Atlantic Fishery Management Council; Public Meeting
2012-04-20
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XB170 Mid-Atlantic... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of a public meeting. SUMMARY: The Social and Economic Sub-Committee of the Mid-Atlantic Fishery Management Council's (Council) Scientific...
Global Warming Attenuates the Tropical Atlantic-Pacific Teleconnection
Jia, Fan; Wu, Lixin; Gan, Bolan; Cai, Wenju
2016-01-01
Changes in global sea surface temperature (SST) since the end of last century display a pattern of widespread warming intercepted by cooling in the eastern equatorial Pacific and western coasts of the American continent. Studies have suggested that the cooling in the eastern equatorial Pacific may be partly induced by warming in the North Atlantic. However, it remains unknown how stable this inter-tropical teleconnection will be under global warming. Here we show that the inter-tropical teleconnection from the tropical Atlantic to Pacific weakens substantially as the CO2 concentration increases. This reduced impact is related to the El Niño-like warming of the tropical Pacific mean state, which leads to limited seasonal migration of the Pacific inter-tropical convergence zone (ITCZ) and weakened ocean heat transport. A fast decay of the tropical Atlantic SST anomalies in a warmer climate also contributes to the weakened teleconnection. Our study suggests that as greenhouse warming continues, the trend in the tropical Pacific as well as the development of ENSO will be less frequently interrupted by the Atlantic because of this attenuation. The weakened teleconnection is also supported by CMIP5 models, although only a few of these models can capture this inter-tropical teleconnection. PMID:26838053
Global Warming Attenuates the Tropical Atlantic-Pacific Teleconnection.
Jia, Fan; Wu, Lixin; Gan, Bolan; Cai, Wenju
2016-02-03
Changes in global sea surface temperature (SST) since the end of last century display a pattern of widespread warming intercepted by cooling in the eastern equatorial Pacific and western coasts of the American continent. Studies have suggested that the cooling in the eastern equatorial Pacific may be partly induced by warming in the North Atlantic. However, it remains unknown how stable this inter-tropical teleconnection will be under global warming. Here we show that the inter-tropical teleconnection from the tropical Atlantic to Pacific weakens substantially as the CO2 concentration increases. This reduced impact is related to the El Niño-like warming of the tropical Pacific mean state, which leads to limited seasonal migration of the Pacific inter-tropical convergence zone (ITCZ) and weakened ocean heat transport. A fast decay of the tropical Atlantic SST anomalies in a warmer climate also contributes to the weakened teleconnection. Our study suggests that as greenhouse warming continues, the trend in the tropical Pacific as well as the development of ENSO will be less frequently interrupted by the Atlantic because of this attenuation. The weakened teleconnection is also supported by CMIP5 models, although only a few of these models can capture this inter-tropical teleconnection.
Genome-wide physical activity interactions in adiposity - A meta-analysis of 200,452 adults.
Directory of Open Access Journals (Sweden)
Mariaelisa Graff
2017-04-01
Full Text Available Physical activity (PA may modify the genetic effects that give rise to increased risk of obesity. To identify adiposity loci whose effects are modified by PA, we performed genome-wide interaction meta-analyses of BMI and BMI-adjusted waist circumference and waist-hip ratio from up to 200,452 adults of European (n = 180,423 or other ancestry (n = 20,029. We standardized PA by categorizing it into a dichotomous variable where, on average, 23% of participants were categorized as inactive and 77% as physically active. While we replicate the interaction with PA for the strongest known obesity-risk locus in the FTO gene, of which the effect is attenuated by ~30% in physically active individuals compared to inactive individuals, we do not identify additional loci that are sensitive to PA. In additional genome-wide meta-analyses adjusting for PA and interaction with PA, we identify 11 novel adiposity loci, suggesting that accounting for PA or other environmental factors that contribute to variation in adiposity may facilitate gene discovery.
Efficacy and toxicity of iodine disinfection of Atlantic salmon eggs
Chalupnicki, M.A.; Ketola, H.G.; Starliper, C.E.; Gallagher, D.
2011-01-01
Recent interest in the restoration of Atlantic salmon Salmo salar in the Great Lakes has given rise to new culture techniques and management programs designed to reduce pathogen transmission while stabilizing and enhancing wild populations. We examined the toxicity of iodine to Atlantic salmon eggs and its effectiveness as a disinfectant against bacteria on egg surfaces. We spawned and fertilized eight gravid Atlantic salmon from Cayuga Lake, New York, and exposed their eggs to 10 concentrations of iodine (5, 10, 50, 75, 100, 500, 750, 1,000, 5,000, and 7,500 mg/L) for 30 min during water hardening. An additional subsample of unfertilized eggs was also exposed to some of the same concentrations of iodine (5, 10, 50, 75, and 100 mg/L) to determine the efficiency of disinfection. Viable eggs were only obtained from four females. Survival of eggs to the eyed stage and hatch tended to be reduced at iodine concentrations of 50 and 75 mg/L and was significantly reduced at concentrations of 100 mg/L iodine or more. We calculated the concentrations of iodine that killed 50% of the Atlantic salmon eggs at eye-up and hatch to be 175 and 85 mg/L, respectively. Aeromonas veronii, A. schubertii, A. hydrophila, A. caviae, Plesiomonas shiggeloides, and Citrobacter spp. were the predominant bacteria present on the surface of green eggs and were significantly reduced by an iodine immersion. The use of iodine as a disinfectant on Atlantic salmon eggs was effective at low concentrations (50–75 mg/L), for which toxicity to Atlantic salmon was minimal.
Strong Flows of Bottom Water in Abyssal Channels of the Atlantic
Morozov, E. G.
Analysis of bottom water transport through the abyssal channels of the Atlantic Ocean is presented. The study is based on recent observations in the Russian expeditions and historical data. A strong flow of Antarctic Bottom Water from the Argentine Basin to the Brazil Basin through the Vema Channel is observed on the basis of lowered profilers and anchored buoys with current meters. The further flow of bottom water in the Brazil Basin splits in the northern part of the basin. Part of the bottom water flows to the East Atlantic through the Romanche and Chain fracture zones. The other part follows the bottom topography and flows to the northwester into the North American Basin. Part of the northwesterly flow propagates through the Vema Fracture Zone into the Northeastern Atlantic. This flow generally fills the bottom layer in the Northeastern Atlantic basins. The flows of bottom waters through the Romanche and Chain fracture zones do not spread to the Northeast Atlantic due to strong mixing in the equatorial zone and enhanced transformation of bottom water properties.
75 FR 71187 - Atlantic Coast Financial Corporation, Waycross, GA; Approval of Conversion Application
2010-11-22
... DEPARTMENT OF THE TREASURY Office of Thrift Supervision [AC-56 OTS No. H-4438] Atlantic Coast... November 12, 2010, the Office of Thrift Supervision approved the application of Atlantic Coast Federal, MHC and Atlantic Coast Bank, Waycross, Georgia, to convert to the stock form of organization. Copies of...
Geothermal investigations in West Virginia
Energy Technology Data Exchange (ETDEWEB)
Hendry, R.; Hilfiker, K.; Hodge, D.; Morgan, P.; Swanberg, C.; Shannon, S.S. Jr.
1982-11-01
Deep sedimentary basins and warm-spring systems in West Virginia are potential geothermal resources. A temperature gradient map based on 800 bottom-hole temperatures for West Virginia shows that variations of temperature gradient trend northeasterly, parallel to regional structure. Highest temperature gradient values of about 28/sup 0/C/km occur in east-central West Virginia, and the lowest gradients (18/sup 0/C/km) are found over the Rome Trough. Results from ground-water geochemistry indicate that the warm waters circulate in very shallow aquifers and are subject to seasonal temperature fluctuations. Silica heat-flow data in West Virginia vary from about 0.89 to 1.4 HFU and generally increase towards the west. Bouguer, magnetic, and temperature gradient profiles suggest that an ancient rift transects the state and is the site of several deep sedimentary basins.
Tropical Dominance of N2 Fixation in the North Atlantic Ocean
Marconi, Dario; Sigman, Daniel M.; Casciotti, Karen L.; Campbell, Ethan C.; Alexandra Weigand, M.; Fawcett, Sarah E.; Knapp, Angela N.; Rafter, Patrick A.; Ward, Bess B.; Haug, Gerald H.
2017-10-01
To investigate the controls on N2 fixation and the role of the Atlantic in the global ocean's fixed nitrogen (N) budget, Atlantic N2 fixation is calculated by combining meridional nitrate fluxes across World Ocean Circulation Experiment sections with observed nitrate 15N/14N differences between northward and southward transported nitrate. N2 fixation inputs of 27.1 ± 4.3 Tg N/yr and 3.0 ± 0.5 Tg N/yr are estimated north of 11°S and 24°N, respectively. That is, 90% of the N2 fixation in the Atlantic north of 11°S occurs south of 24°N in a region with upwelling that imports phosphorus (P) in excess of N relative to phytoplankton requirements. This suggests that, under the modern iron-rich conditions of the equatorial and North Atlantic, N2 fixation occurs predominantly in response to P-bearing, N-poor conditions. We estimate a N2 fixation rate of 30.5 ± 4.9 Tg N/yr north of 30°S, implying only 3 Tg N/yr between 30° and 11°S, despite evidence of P-bearing, N-poor surface waters in this region as well; this is consistent with iron limitation of N2 fixation in the South Atlantic. Since the ocean flows through the Atlantic surface in Pacific basins.
BrO measurements over the Eastern North-Atlantic
Directory of Open Access Journals (Sweden)
U. Platt
2009-12-01
Full Text Available The aim of the work presented here was to detect BrO in the marine boundary layer over the Eastern North-Atlantic by Multi AXis-Differential Optical Absorption Spectroscopy (MAX-DOAS of scattered sunlight. With this technique, information about the concentration and the vertical profile of trace gases in the atmosphere can be gained. BrO can be formed in the marine atmosphere by degradation of biogenic organohalogens or by oxidation of bromide in sea salt aerosol. BrO influences the chemistry in marine air in many ways, e.g. since it catalytically destroys ozone, changes the NO2/NO-ratio as well as the OH/HO2-ratio and oxidises DMS. However, the abundance and the significance of BrO in the marine atmosphere is not yet fully understood.
We report on data collected during a ship cruise, which took place along the West African Coast in February 2007, within the framework of the Surface Ocean PRocesses in the ANthropocene project (SOPRAN. Tropospheric BrO could be detected during this cruise at peak mixing ratios of (10.2±3.7 ppt at an assumed layer height of 1 km on 18 February 2007. Furthermore, it was found that the mean BrO concentrations increased when cruising close to the African Coast suggesting that at least part of the BrO might have originated from there.
Abstracts of the Atlantic Geoscience Society's 2007 colloquium and annual general meeting
International Nuclear Information System (INIS)
Johnson, S.; Parkhill, M.; Wilson, R.; Desrosiers, M.; Lentz, D.; Pitre, C.; Pronk, T.; Spooner, I.; Toole, R.; Wallace, P.
2007-01-01
The Atlantic Geoscience Society (AGS) hosts annual meetings, workshops and field trips to promote a better understanding of the geology of Atlantic Canada. This colloquium highlighted current research in the Atlantic provinces with special sessions devoted to patterns and geohazards in the North Atlantic; late and post-glacial climate change events in eastern Canada; salt matters; tectonic, thermal and resource aspects of Paleozoic to Mesozoic evaporite basins; mineral resources research by students of the Society of Economic Geologists; dendrochronology; a physical volcanology workshop; and, a North American soil geochemical landscape project orientation session. One of the 74 papers presented at this colloquium has been catalogued separately for inclusion in this database
Energy Technology Data Exchange (ETDEWEB)
Rubio, C.J.; MacIas, D.; Camiñas, J.A.; Fernandez, I.L.; Baez, J.C.
2016-07-01
Tuna are highly migratory pelagic species (HMPS) with great importance in commercial fishing. Several authors have highlighted the effect of climatic oscillations such as the NAO (North Atlantic Oscillation) on HMPS. This paper analyzes the effects of the NAO on two HMPS: albacore, Thunnus alalunga, and yellowfin tuna, Thunnus albacares. Fishing data from the Spanish fleet operating in the North Atlantic area were obtained from the International Commission for the Conservation of Atlantic Tunas (ICCAT) database. The results show a positive correlation between the NAO index and the Catch per Unit Effort (CPUE) for both albacore and yellowfin tuna, depicting a potential effect on their capturability. (Author)
Holocene mangrove swamps of West Africa sedimentology and soils
Marius, C.; Lucas, J.
The mangrove swamps of West African Coast belong to the Atlantic type which is characterized by a small number of species. They colonize tidal environments which are dissected by numerous meandering tidal channels and are presently subject to a low rate of sediment accumulation. The mangrove vegetation exhibits a characteristic zonation pattern that basically reflects the adaptation of the various species to saline conditions. The typical zonation sequence is: Rhizophora racemosa (or Rh. mangle), Rh. mangle + Avicennia africana, Avicennia, flooded tanne, barren tanne, herbaceous tanne. The tannes are generated by aridic climatic conditions, heavy soil and water salt content, and are, in a way a peculiar feature of mangrove swamps in West Africa. The sediment colonized by the mangroves is relatively homogenous. Mineralogically, they are dominated by quartz and clay to which are associated halite, pyrite and jarosite. The clay suite is mainly composed of smectite and kaolinite. Smectite is predominant in the inlet areas and is replaced inland by kaolinite. Chemically, the sediments contain very low amounts of Ca, bases and trace elements. The mangrove swamp floodwaters have a chemical composition similar to that of seawater. It is dominated by sodium and chloride. Morphologically, the ripening of the soils appears with a chestnut mash colour horizon and buttery consistency in relation with the decomposition of fibrous roots of Rhizophora and also with pale yellow jarosite mottles in the top horizons of the tanne profiles due to the oxidation of pyrine. The two main properties of the mangrove soils of West Africa are acidity and salinity; the first is related to the high content of sulphur and the second to the sea influence. The acidity has to be connected mainly to the Rhizophora vegetation whose the root system is a real trap for catching the pyrites resulting from the reduction of the sulphates of sea water by the sulphate reducing bacteria, in a reduced
Tiger sharks can connect equatorial habitats and fisheries across the Atlantic Ocean basin.
Directory of Open Access Journals (Sweden)
André S Afonso
Full Text Available Increasing our knowledge about the spatial ecology of apex predators and their interactions with diverse habitats and fisheries is necessary for understanding the trophic mechanisms that underlie several aspects of marine ecosystem dynamics and for guiding informed management policies. A preliminary assessment of tiger shark (Galeocerdo cuvier population structure off the oceanic insular system of Fernando de Noronha (FEN and the large-scale movements performed by this species in the equatorial Atlantic Ocean was conducted using longline and handline fishing gear and satellite telemetry. A total of 25 sharks measuring 175-372 cm in total length (TL were sampled. Most sharks were likely immature females ranging between 200 and 260 cm TL, with few individuals < 200 cm TL being caught. This contrasts greatly with the tiger shark size-distribution previously reported for coastal waters off the Brazilian mainland, where most individuals measured < 200 cm TL. Also, the movements of 8 individuals measuring 202-310 cm TL were assessed with satellite transmitters for a combined total of 757 days (mean = 94.6 days∙shark-1; SD = 65.6. These sharks exhibited a considerable variability in their horizontal movements, with three sharks showing a mostly resident behavior around FEN during the extent of the respective tracks, two sharks traveling west to the South American continent, and two sharks moving mostly along the middle of the oceanic basin, one of which ending up in the northern hemisphere. Moreover, one shark traveled east to the African continent, where it was eventually caught by fishers from Ivory Coast in less than 474 days at liberty. The present results suggest that young tiger sharks measuring < 200 cm TL make little use of insular oceanic habitats from the western South Atlantic Ocean, which agrees with a previously-hypothesized ontogenetic habitat shift from coastal to oceanic habitats experienced by juveniles of this species in this region
Trade in the Atlantic Basin, 2000-2012: a panoramic view
Directory of Open Access Journals (Sweden)
Lorena Ruano
2013-09-01
Full Text Available This article offers a descriptive analysis of the goods trade in the Atlantic, and provides the following data: the largest trade volume can be found in the North Atlantic and the Americas, albeit with slower growth; Africa and South America trade mainly with the North, but with a tendency towards diversification; Europe depends less on Atlantic trade than other regions, South America being the most dependent of these; Africa mainly trades with extra-regional partners; the Atlantic’s role in world trade is diminishing owing to the rise of Asia (China; exports can be divided into those from the North (products with greater added value and the South (raw materials; imports are dominated by automobiles and oil; the main challenge is the economic crisis in Europe; with the Doha round havingstalled, the Atlantic free trade agreements under negotiation (Canada-EU; TTIP are gaining importance, with the aim of boosting the flow of goods, which represents one of the largest in the world.
Influence of North Atlantic modes on European climate extremes
Proemmel, K.; Cubasch, U.
2017-12-01
It is well known that the North Atlantic strongly influences European climate. Only few studies exist that focus on its impact on climate extremes. We are interested in these extremes and the processes and mechanisms behind it. For the analysis of the North Atlantic Oscillation (NAO) we use simulations performed with the Max Planck Institute for Meteorology Earth System Model (MPI-ESM). The NAO has a strong impact especially on European winter and the changes in minimum temperature are even larger than in maximum temperature. The impact of the Atlantic Multi-decadal Variability (AMV) on climate extremes is analyzed in ECHAM6 simulations forced with AMV warm and AMV cold sea surface temperature patterns. We analyze different extreme indices and try to understand the processes.
Eurotiumins A–E, Five New Alkaloids from the Marine-Derived Fungus Eurotium sp. SCSIO F452
Directory of Open Access Journals (Sweden)
Wei-Mao Zhong
2018-04-01
Full Text Available Three new prenylated indole 2,5-diketopiperazine alkaloids (1–3 with nine known ones (5–13, one new indole alkaloid (4, and one new bis-benzyl pyrimidine derivative (14 were isolated and characterized from the marine-derived fungus Eurotium sp. SCSIO F452. 1 and 2, occurring as a pair of diastereomers, both presented a hexahydropyrrolo[2,3-b]indole skeleton. Their chemical structures, including absolute configurations, were elucidated by 1D and 2D NMR, HRESIMS, quantum chemical calculations of electronic circular dichroism, and single crystal X-ray diffraction experiments. Most isolated compounds were screened for antioxidative potency. Compounds 3, 5, 6, 7, 9, 10, and 12 showed significant radical scavenging activities against DPPH with IC50 values of 13, 19, 4, 3, 24, 13, and 18 µM, respectively. Five new compounds were evaluated for cytotoxic activities.
77 FR 75896 - Atlantic Highly Migratory Species; 2013 Atlantic Shark Commercial Fishing Season
2012-12-26
... the non-sandbar large coastal shark quotas and retention limits in 2013 and asked for the reasoning... geographical distribution of non-sandbar large coastal shark landings in the Atlantic throughout the season... the 2006 Consolidated HMS FMP on EFH, we reviewed the geographical range of all HMS and analyzed the...
Atlantic and indian oceans pollution in africa
Abubakar, Babagana
Africa is the second largest and most populated continent after Asia. Geographically it is located between the Atlantic and Indian Oceans. Most of the Africa's most populated and industrialized cities are located along the coast of the continent facing the Atlantic and Indian Oceans, example of such cities include Casablanca, Dakar, Accra, Lagos, Luanda and Cape town all facing the Atlantic Ocean and cities like East London, Durban, Maputo, Dar-es-salaam and Mogadishu are all facing the Indian Ocean. As a result of the geographical locations of African Coastal Cities plus increase in their population, industries, sea port operations, petroleum exploration activities, trafficking of toxic wastes and improper waste management culture lead to the incessant increase in the pollution of the two oceans. NATURE OF POLLUTION OF THE ATLANTIC OCEAN i. The petroleum exploration activities going on along the coast of "Gulf of Guinea" region and Angola continuously causes oil spillages in the process of drilling, bunkering and discharging of petroleum products in the Atlantic Ocean. ii. The incessant degreasing of the Sea Ports "Quay Aprons" along the Coastal cities of Lagos, Luanda, Cape Town etc are continuously polluting the Atlantic Ocean with chemicals. iii. Local wastes generated from the houses located in the coastal cities are always finding their ways into the Atlantic Ocean. NATURE OF POLLUTION OF THE INDIAN OCEAN i. Unlike the Atlantic ocean where petroleum is the major pollutant, the Indian Ocean is polluted by Toxic / Radioactive waste suspected to have been coming from the developed nations as reported by the United Nations Environmental Programme after the Tsunami disaster in December 2004 especially along the coast of Somalia. ii. The degreasing of the Quay Aprons at Port Elizabeth, Maputo, Dar-es-Salaam and Mongolism Sea Ports are also another major source polluting the Indian Ocean. PROBLEMS GENERATED AS A RESULT OF THE OCEANS POLLUTION i. Recent report
Mid-Atlantic elasmobranchs: Suitable metal scouts?
International Nuclear Information System (INIS)
Torres, Paulo; Tristão da Cunha, Regina; Rodrigues, Armindo dos Santos
2017-01-01
Heavy metals are a hazard to marine fauna and human health. In this study we assess stable isotopes and metal content in Prionace glauca and Isurus oxyrinchus and analyse these results within and among other species and across regions and geographical areas. Also, we evaluate their suitability, together with Raja clavata and Galeorhinus galeus, as Mid-Atlantic bioindicators. Prionace glauca and I. oxyrinchus shared the same trophic level in a pelagic food web and did not present significant differences between genders or metals, except for As. Arsenic and Hg accumulated while Cd and Pb were not detected. One I. oxyrinchus presented Hg values above regulatory limits. A high Hg exposure was associated with I. oxyrinchus since its maximum weekly intake was exceeded. Elasmobranchs can be used as metal sentinels, each presenting different key features which defines a good marine bioindicator, allowing long-term monitoring at different temporal and spatial scales. - Highlights: • We analysed P. glauca and I. oxyrinchus muscle from Mid-Atlantic. • We determined stable isotopes, trophic ecology and heavy metal content. • Results reflect bioaccumulation for As and Hg. • Oxyrinchus already presented Hg values above regulatory limits. • Mid-Atlantic elasmobranchs appear to be effective metal bioindicators.
Grizzly West: A Failed Attempt to Reintroduce Grizzly Bears in the Mountain West
Directory of Open Access Journals (Sweden)
Douglas M. Richardson
2016-05-01
Full Text Available Reviewed: Grizzly West: A Failed Attempt to Reintroduce Grizzly Bears in the Mountain West. By Michael M. Dax. Lincoln, NE: University of Nebraska Press, 2015. x + 289 pp. US$ 37.50. ISBN 978-0-8032-6673-5.
North Atlantic observations sharpen meridional overturning projections
Olson, R.; An, S.-I.; Fan, Y.; Evans, J. P.; Caesar, L.
2018-06-01
Atlantic Meridional Overturning Circulation (AMOC) projections are uncertain due to both model errors, as well as internal climate variability. An AMOC slowdown projected by many climate models is likely to have considerable effects on many aspects of global and North Atlantic climate. Previous studies to make probabilistic AMOC projections have broken new ground. However, they do not drift-correct or cross-validate the projections, and do not fully account for internal variability. Furthermore, they consider a limited subset of models, and ignore the skill of models at representing the temporal North Atlantic dynamics. We improve on previous work by applying Bayesian Model Averaging to weight 13 Coupled Model Intercomparison Project phase 5 models by their skill at modeling the AMOC strength, and its temporal dynamics, as approximated by the northern North-Atlantic temperature-based AMOC Index. We make drift-corrected projections accounting for structural model errors, and for the internal variability. Cross-validation experiments give approximately correct empirical coverage probabilities, which validates our method. Our results present more evidence that AMOC likely already started slowing down. While weighting considerably moderates and sharpens our projections, our results are at low end of previously published estimates. We project mean AMOC changes between periods 1960-1999 and 2060-2099 of -4.0 Sv and -6.8 Sv for RCP4.5 and RCP8.5 emissions scenarios respectively. The corresponding average 90% credible intervals for our weighted experiments are [-7.2, -1.2] and [-10.5, -3.7] Sv respectively for the two scenarios.
2010-04-27
... species of sharks, including basking, great hammerhead, scalloped hammerhead, white, dusky, tiger, sand... Plan for Atlantic Coastal Sharks (Plan) and that the measures New Jersey has failed to implement and enforce are necessary for the conservation of the shark resource. This determination is consistent with...
DEFF Research Database (Denmark)
Köster, Fritz; Trippel, E.A.; Tomkiewicz, Jonna
2013-01-01
Sexual maturation patterns of 22 North Atlantic stocks of cod (Gadus morhua) were examined and related to geographical distribution area, ambient water temperature, growth and surplus production. Four patterns were identified, i.e. sexual maturation early in life at small size, early in life...... Atlantic stocks. This comparative analysis suggests that maturation patterns relate to growth potential and surplus production whereas annual production of recruits per unit biomass appears unrelated to average size at sexual maturation...
Gregory, Gerald L.; Scott, A. Donald, Jr.
1995-01-01
This compendium describes aircraft data that are available from NASA's Pacific Exploratory Mission West-B (PEM West-B). PEM West is a component of the International Global Atmospheric Chemistry's (IGAC) East Asia/North Pacific Regional Study (APARE) project. Objectives of PEM West are to investigate the atmospheric chemistry of ozone over the northwest Pacific -- natural budgets and the impact of anthropogenic/continental sources; and to investigate sulfur chemistry -- continental and marine sulfur sources. The PEM West program encompassed two expeditions. PEM West-A was conducted in September 1991 during which the predominance of tropospheric air was from mid-Pacific (marine) regions, but (at times) was modified by Asian outflow. PEM West-B was conducted during February 1994, a period characterized by maximum Asian outflow. Results from PEM West-A and B are public domain. PEM West-A data are summarized in NASA TM 109177 (published February 1995). Flight experiments were based at Guam, Hong Kong, and Japan. This document provides a representation of NASA DC-8 aircraft data that are available from NASA Langley's Distributed Active Archive Center (DAAC). The DAAC includes numerous other data such as meteorological and modeling products, results from surface studies, satellite observations, and sonde releases.
Flecker, Rachel
2017-04-01
Today Mediterranean seawater flows out through the Gibraltar Straits, forming a saline plume at intermediate depths in the Atlantic. The plume's sedimentary record of distinctive, contouritic deposits has recently been recovered during IODP Leg 339 in the Gulf of Cadiz documenting a Mediterranean contribution to Atlantic thermohaline circulation since the Pliocene. However, before the Pliocene, the conduit for Mediterranean-Atlantic exchange is unclear. Gibraltar may have already been open, but two additional marine corridors also existed through northern Morocco and southern Spain. The restriction and closure of these Miocene connections resulted in extreme salinity fluctuations in the Mediterranean, leading to the precipitation of thick evaporites. This event is known as the Messinian Salinity Crisis (MSC) and recovering a complete record of the MSC is the target of current IODP drilling proposals (e.g. DREAM). Understanding both the causes of high-amplitude salinity change in the Mediterranean and its global consequences for thermohaline circulation in the Atlantic is dependent on recovering a complete record of Mediterranean-Atlantic exchange before, during and after the MSC. This key objective of the IMMAGE drilling proposal requires core recovery on-shore at the mouths of the Betic and Rifian corridors which are now exposed on land, as well as offshore, in the Alborán Sea and on the Atlantic continental margin. Consequently to meet this objective, an amphibious drilling strategy is necessary, involving both IODP and ICDP targets. In addition to allowing us to reconstruct Mediterranean-Atlantic exchange during high amplitude salinity fluctuations and identify the conduit through which exchange occurred, the sediments recovered from IMMAGE drilling will also provide us with a unique and explicit test for ocean physics hypotheses describing the location, size and velocity of overflow plumes under conditions where the density contrast between the two water
The wood industry in Atlantic Canada: A focus on value-added
International Nuclear Information System (INIS)
1998-11-01
This report prepared by the Atlantic Canada Opportunities Agency in consultation with the four Atlantic provinces focuses on the value-added aspects of the wood products industry in Atlantic Canada. It also examines the state of the resource, the state of the industry, productivity and economic benefits, products and markets, trade and regulations, and needs, challenges and targets. The analysis was undertaken to determine the possibility of further utilization of forest resources in the region for value-added products, and to assess the possibilities for the wood products industry of Atlantic Canada exploring world markets for its products. The inventory of resources found 1.4 billion cubic meter of wood-growing productive forest land in the region, with softwoods accounting for 76 per cent of the forests. Concern was expressed about forest stands at regeneration levels. Total Annual Allowable Cut (AAC) for the Atlantic Provinces in 1995 was almost 20 million cubic meter, approximately 10 per cent of the national total. Although total harvests are below the AAC for the region, softwood harvesting in 1994 and in 1995 was well above the AAC. The analysis concluded that given the current level of harvesting, sustained growth in Atlantic Canada's wood industries will have to rely on access to external fibre sources and better use of the existing fibre source. At the same time, since many value-added manufacturers in the region rely on imported wood resources, the health of the value-added wood industry does not appear to be completely dependent on the sustainability of forest resources in the Atlantic region. Part Two of the report provides an economic profile of the industry, including brief reviews on employment, wages and salaries, exports and imports, transportation, education and training, research and technology and marketing. refs., tabs
Does the Fukushima NPP disaster affect the caesium activity of North Atlantic Ocean fish?
International Nuclear Information System (INIS)
Kanisch, G.; Aust, M.O.
2013-01-01
Fillet samples of marine fish collected from the East/West Greenland currents (GC) and from the Baltic Sea (BS) have been investigated by gamma-ray spectrometry within the regular German monitoring programme. In samples of the second half of 2011, "1"3"4Cs traces have been detected that are suggested to originate from the Fukushima fallout that was deposited in March/April 2011 over the northern North Atlantic and accumulated by fish. The radionuclide "1"3"4Cs (half-life 2 yr) was indeed detected with quite small activities at about 0.0036 Bq kg"-"1 w.w. Existing box models describing the transport of Cs within seawater boxes of the northeast Atlantic allowed for estimation of "1"3"4Cs contributions from other sources, i.e. from the Chernobyl fallout and from discharges by the two major European nuclear reprocessing plants; both were negligible around Greenland, while for the Chernobyl fallout a small "1"3"4Cs background contribution to BS fish was estimated. Model results confirmed the level of "1"3"4C measured in BS fish and showed its maximum to have occurred in winter 2011/2012 followed by a continuous decrease. It was also determined that "1"3"4Cs activity, but not that of "1"3"7Cs, showed a significant negative correlation with sampling depth (150-400 m) of GC fish; this strengthens our Fukushima fallout assumption. As a result, the Fukushima fallout in these sea areas only marginally enhanced (GC: 4%; BS: 0.1%) pre-Fukushima levels of individual dose rates received by human fish consumers; the addition was around 0.001 μSv following the consumption of 10 kg of fish per year, which is not expected to cause concern according to present guidelines for radiation protection.
Does the Fukushima NPP disaster affect the caesium activity of North Atlantic Ocean fish?
Energy Technology Data Exchange (ETDEWEB)
Kanisch, G.; Aust, M.O. [Thuenen Institute of Fisheries Ecology, Hamburg (Germany)
2013-07-01
Fillet samples of marine fish collected from the East/West Greenland currents (GC) and from the Baltic Sea (BS) have been investigated by gamma-ray spectrometry within the regular German monitoring programme. In samples of the second half of 2011, {sup 134}Cs traces have been detected that are suggested to originate from the Fukushima fallout that was deposited in March/April 2011 over the northern North Atlantic and accumulated by fish. The radionuclide {sup 134}Cs (half-life 2 yr) was indeed detected with quite small activities at about 0.0036 Bq kg{sup -1} w.w. Existing box models describing the transport of Cs within seawater boxes of the northeast Atlantic allowed for estimation of {sup 134}Cs contributions from other sources, i.e. from the Chernobyl fallout and from discharges by the two major European nuclear reprocessing plants; both were negligible around Greenland, while for the Chernobyl fallout a small {sup 134}Cs background contribution to BS fish was estimated. Model results confirmed the level of {sup 134}C measured in BS fish and showed its maximum to have occurred in winter 2011/2012 followed by a continuous decrease. It was also determined that {sup 134}Cs activity, but not that of {sup 137}Cs, showed a significant negative correlation with sampling depth (150-400 m) of GC fish; this strengthens our Fukushima fallout assumption. As a result, the Fukushima fallout in these sea areas only marginally enhanced (GC: 4%; BS: 0.1%) pre-Fukushima levels of individual dose rates received by human fish consumers; the addition was around 0.001 μSv following the consumption of 10 kg of fish per year, which is not expected to cause concern according to present guidelines for radiation protection.
Does the Fukushima NPP disaster affect the caesium activity of North Atlantic Ocean fish?
Kanisch, G.; Aust, M.-O.
2013-08-01
Fillet samples of marine fish collected from the East/West Greenland currents (GC) and from the Baltic Sea (BS) have been investigated by gamma-ray spectrometry within the regular German monitoring programme. In samples of the second half of 2011, 134Cs traces have been detected that are suggested to originate from the Fukushima fallout that was deposited in March/April 2011 over the northern North Atlantic and accumulated by fish. The radionuclide 134Cs (half-life 2 yr) was indeed detected with quite small activities at about 0.0036 Bq kg-1 w.w. Existing box models describing the transport of Cs within seawater boxes of the northeast Atlantic allowed for estimation of 134Cs contributions from other sources, i.e. from the Chernobyl fallout and from discharges by the two major European nuclear reprocessing plants; both were negligible around Greenland, while for the Chernobyl fallout a small 134Cs background contribution to BS fish was estimated. Model results confirmed the level of 134C measured in BS fish and showed its maximum to have occurred in winter 2011/2012 followed by a continuous decrease. It was also determined that 134Cs activity, but not that of 134Cs, showed a significant negative correlation with sampling depth (150-400 m) of GC fish; this strengthens our Fukushima fallout assumption. As a result, the Fukushima fallout in these sea areas only marginally enhanced (GC: 4%; BS: 0.1%) pre-Fukushima levels of individual dose rates received by human fish consumers; the addition was around 0.001 μSv following the consumption of 10 kg of fish per year, which is not expected to cause concern according to present guidelines for radiation protection.
Does the Fukushima NPP disaster affect the caesium activity of North Atlantic Ocean fish?
Directory of Open Access Journals (Sweden)
G. Kanisch
2013-08-01
Full Text Available Fillet samples of marine fish collected from the East/West Greenland currents (GC and from the Baltic Sea (BS have been investigated by gamma-ray spectrometry within the regular German monitoring programme. In samples of the second half of 2011, 134Cs traces have been detected that are suggested to originate from the Fukushima fallout that was deposited in March/April 2011 over the northern North Atlantic and accumulated by fish. The radionuclide 134Cs (half-life 2 yr was indeed detected with quite small activities at about 0.0036 Bq kg−1 w.w. Existing box models describing the transport of Cs within seawater boxes of the northeast Atlantic allowed for estimation of 134Cs contributions from other sources, i.e. from the Chernobyl fallout and from discharges by the two major European nuclear reprocessing plants; both were negligible around Greenland, while for the Chernobyl fallout a small 134Cs background contribution to BS fish was estimated. Model results confirmed the level of 134C measured in BS fish and showed its maximum to have occurred in winter 2011/2012 followed by a continuous decrease. It was also determined that 134Cs activity, but not that of 134Cs, showed a significant negative correlation with sampling depth (150–400 m of GC fish; this strengthens our Fukushima fallout assumption. As a result, the Fukushima fallout in these sea areas only marginally enhanced (GC: 4%; BS: 0.1% pre-Fukushima levels of individual dose rates received by human fish consumers; the addition was around 0.001 μSv following the consumption of 10 kg of fish per year, which is not expected to cause concern according to present guidelines for radiation protection.
Directory of Open Access Journals (Sweden)
Richard J. Lilley
2014-12-01
Full Text Available The Atlantic cod (Gadus morhua is a species of significant economic and historic importance but infamous for its decline. Apart from overfishing, the causes of this decline and its subsequent lack of recovery remain largely unresolved. Indeed, the degree to which specific habitats are important for this species remains unquantified at the scale of North Atlantic. Here, the literature on the role of eelgrass meadows (Zostera marina as valuable nursery habitat for the Atlantic cod is reviewed and synthesized. Evidence is presented on relative densities of Atlantic cod in shallow water environments and in eelgrass meadows in comparison to alternative habitats. In addition, evidence pertaining to the ’viability gains’ attributed to the use of eelgrass meadows as nursery habitat (growth and survival by juvenile Atlantic cod is analyzed. Although juvenile Atlantic cod use of Z. marina is found to be facultative, when possible, available literatures indicates that they may select Z. marina as a nursery habitat where they are found in high density (average of at least 246 ha−1. From their use of Z. marina habitat the juvenile Atlantic cod receives viability benefits from it, improving their chances of reaching maturation. This paper provides strong evidence that eelgrass meadows are of significant importance to contributing to Atlantic cod stocks. Keywords: Zostera marina, Eelgrass, Gadus morhua, Fisheries, Juveniles, Nursery habitat
Directory of Open Access Journals (Sweden)
Talero, R.
2009-03-01
Full Text Available The same cementitious materials (OPCs, SRPCs and matekaolin, MK, the same blended cements and the same ASTM C 452-68 test than in Part I, were used. Other complementary determinations were: chemical analysis of cementing materials, SEM and XRD analysis of ettringites and specific properties of some cement tested and of their pastes.The experimental results have also demonstrated that when 7.0% SO3, equivalent to 15.05% of gypsum, was added to the M pozzolan-containing Portland cement and tested with the ASTM C 452-68 method, it was not found to behave aggressively but rather as “setting regulator ”, because the increase in mechanical strengths over time and setting times in these mixes were, therefore, similar to the pattern observed in any PC. However, when the gypsum content was raised to triple than that amount (21.0% SO3, it behaved aggressively. In both cases, logically, ettringite from both origins were involved in the resulting beneficial or adverse behavior.En esta Parte II se utilizaron los mismos materiales cementíceos (CPO, CPRS, y metakaolín, MK, los mismos cementos de mezcla y el mismo método de ensayo ASTM C 452-68 que en la Parte I. Otras determinaciones complementarias fueron: análisis químico de los materiales cementíceos, análisis por DRX y SEM de ettringitas y propiedades específicas de algunos cementos ensayados y de sus pastas.Los resultados experimentales obtenidos han demostrado también que, el 7.0% de SO3 presente en los 30 cementos de mezcla con MK, ensayados conforme el método ASTM C 452-68, no se comporta como agresivo sino como ”regulador de fraguado”, porque los tiempos de fraguado y el aumento de resistencias mecánicas fueron como los de cualquier CP. De aquí que algunos de esos cementos de mezcla puedan ser considerados “cementos hidráulicos expansivos”, el resto, no. Sin embargo, cuando la cantidad de yeso aportada fue el triple (21,0% SO3, se comportó como agresivo, motivo por el cual
North Atlantic explosive cyclones and large scale atmospheric variability modes
Liberato, Margarida L. R.
2015-04-01
Extreme windstorms are one of the major natural catastrophes in the extratropics, one of the most costly natural hazards in Europe and are responsible for substantial economic damages and even fatalities. During the last decades Europe witnessed major damage from winter storms such as Lothar (December 1999), Kyrill (January 2007), Klaus (January 2009), Xynthia (February 2010), Gong (January 2013) and Stephanie (February 2014) which exhibited uncommon characteristics. In fact, most of these storms crossed the Atlantic in direction of Europe experiencing an explosive development at unusual lower latitudes along the edge of the dominant North Atlantic storm track and reaching Iberia with an uncommon intensity (Liberato et al., 2011; 2013; Liberato 2014). Results show that the explosive cyclogenesis process of most of these storms at such low latitudes is driven by: (i) the southerly displacement of a very strong polar jet stream; and (ii) the presence of an atmospheric river (AR), that is, by a (sub)tropical moisture export over the western and central (sub)tropical Atlantic which converges into the cyclogenesis region and then moves along with the storm towards Iberia. Previous studies have pointed to a link between the North Atlantic Oscillation (NAO) and intense European windstorms. On the other hand, the NAO exerts a decisive control on the average latitudinal location of the jet stream over the North Atlantic basin (Woollings et al. 2010). In this work the link between North Atlantic explosive cyclogenesis, atmospheric rivers and large scale atmospheric variability modes is reviewed and discussed. Liberato MLR (2014) The 19 January 2013 windstorm over the north Atlantic: Large-scale dynamics and impacts on Iberia. Weather and Climate Extremes, 5-6, 16-28. doi: 10.1016/j.wace.2014.06.002 Liberato MRL, Pinto JG, Trigo IF, Trigo RM. (2011) Klaus - an exceptional winter storm over Northern Iberia and Southern France. Weather 66:330-334. doi:10.1002/wea.755 Liberato
2011-01-14
... Assistant Administrator has determined that this proposed rule is consistent with the Atlantic Bluefish FMP... D. Rauch III, Deputy Assistant Administrator for Regulatory Programs, National Marine Fisheries... mortality; stock status; recent estimates of recruitment; virtual population analysis results; levels of...
National Oceanic and Atmospheric Administration, Department of Commerce — Ocean station data were collected using seechi disk, meteorological sensors, and bottle casts in the Northwest Atlantic Ocean (limit-40 W) and Southwest Atlantic...
78 FR 23223 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2013-04-18
.... SUMMARY: The Scientific and Statistical Committee (SSC) of the Mid- Atlantic Fishery Management Council... Fishery Management Council (MAFMC); Public Meeting AGENCY: National Marine Fisheries Service (NMFS...: (410) 522-7377. Council address: Mid-Atlantic Fishery Management Council, 800 N. State Street, Suite...
78 FR 13867 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2013-03-01
...: The Mid-Atlantic Fishery Management Council's Scientific and Statistical Committee (SSC) will hold a... Fishery Management Council (MAFMC); Public Meeting AGENCY: National Marine Fisheries Service (NMFS... address: Mid-Atlantic Fishery Management Council, 800 North State Street, Suite 201, Dover, DE 19901...
78 FR 21915 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2013-04-12
.... SUMMARY: The Scientific and Statistical Committee (SSC) of the Mid- Atlantic Fishery Management Council... Fishery Management Council (MAFMC); Public Meeting AGENCY: National Marine Fisheries Service (NMFS...://www.mafmc.org . Council address: Mid-Atlantic Fishery Management Council, 800 North State Street...
78 FR 53731 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2013-08-30
...: The Scientific and Statistical Committee (SSC) of the Mid- Atlantic Fishery Management Council... Fishery Management Council (MAFMC); Public Meeting AGENCY: National Marine Fisheries Service (NMFS..., MD 21231, telephone: (410) 522-7380. Council address: Mid-Atlantic Fishery Management Council, 800 N...
An overview of chemosynthetic symbioses in bivalves from the North Atlantic and Mediterranean Sea
Duperron, S.; Gaudron, S. M.; Rodrigues, C. F.; Cunha, M. R.; Decker, C.; Olu, K.
2013-05-01
Deep-sea bivalves found at hydrothermal vents, cold seeps and organic falls are sustained by chemosynthetic bacteria that ensure part or all of their carbon nutrition. These symbioses are of prime importance for the functioning of the ecosystems. Similar symbioses occur in other bivalve species living in shallow and coastal reduced habitats worldwide. In recent years, several deep-sea species have been investigated from continental margins around Europe, West Africa, eastern Americas, the Gulf of Mexico, and from hydrothermal vents on the Mid-Atlantic Ridge. In parallel, numerous, more easily accessible shallow marine species have been studied. Herein we provide a summary of the current knowledge available on chemosymbiotic bivalves in the area ranging west-to-east from the Gulf of Mexico to the Sea of Marmara, and north-to-south from the Arctic to the Gulf of Guinea. Characteristics of symbioses in 53 species from the area are summarized for each of the five bivalve families documented to harbor chemosynthetic symbionts (Mytilidae, Vesicomyidae, Solemyidae, Thyasiridae and Lucinidae). Comparisons are made between the families, with special emphasis on ecology, life cycle, and connectivity. Chemosynthetic symbioses are a major adaptation to ecosystems and habitats exposed to reducing conditions. However, relatively little is known regarding their diversity and functioning, apart from a few "model species" on which effort has focused over the last 30 yr. In the context of increasing concern about biodiversity and ecosystems, and increasing anthropogenic pressure on oceans, we advocate a better assessment of the diversity of bivalve symbioses in order to evaluate the capacities of these remarkable ecological and evolutionary units to withstand environmental change.
An overview of chemosynthetic symbioses in bivalves from the North Atlantic and Mediterranean Sea
Directory of Open Access Journals (Sweden)
S. Duperron
2013-05-01
Full Text Available Deep-sea bivalves found at hydrothermal vents, cold seeps and organic falls are sustained by chemosynthetic bacteria that ensure part or all of their carbon nutrition. These symbioses are of prime importance for the functioning of the ecosystems. Similar symbioses occur in other bivalve species living in shallow and coastal reduced habitats worldwide. In recent years, several deep-sea species have been investigated from continental margins around Europe, West Africa, eastern Americas, the Gulf of Mexico, and from hydrothermal vents on the Mid-Atlantic Ridge. In parallel, numerous, more easily accessible shallow marine species have been studied. Herein we provide a summary of the current knowledge available on chemosymbiotic bivalves in the area ranging west-to-east from the Gulf of Mexico to the Sea of Marmara, and north-to-south from the Arctic to the Gulf of Guinea. Characteristics of symbioses in 53 species from the area are summarized for each of the five bivalve families documented to harbor chemosynthetic symbionts (Mytilidae, Vesicomyidae, Solemyidae, Thyasiridae and Lucinidae. Comparisons are made between the families, with special emphasis on ecology, life cycle, and connectivity. Chemosynthetic symbioses are a major adaptation to ecosystems and habitats exposed to reducing conditions. However, relatively little is known regarding their diversity and functioning, apart from a few "model species" on which effort has focused over the last 30 yr. In the context of increasing concern about biodiversity and ecosystems, and increasing anthropogenic pressure on oceans, we advocate a better assessment of the diversity of bivalve symbioses in order to evaluate the capacities of these remarkable ecological and evolutionary units to withstand environmental change.
Protein (Cyanobacteria): 470019 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available hypothetical protein Pro1185 Prochlorococcus marinus subsp. marinus str. CCMP1375 MLNGLNLCTLLEKYCYSKKISDKEVEFLERCWLDSLNSLHYNRYPGIAPAIVCDEAGVARGSYWISCNAAILDKLKPLGTTRSRSARIFDVLFQSGLIAA ...
Mechanisms of the atmospheric response to North Atlantic multidecadal variability: a model study
Energy Technology Data Exchange (ETDEWEB)
Msadek, Rym [Universite Pierre et Marie Curie-Paris 6, LOCEAN/IPSL, Paris Cedex 05 (France); Princeton University, GFDL/NOAA, AOS Program, Princeton, NJ (United States); Frankignoul, Claude [Universite Pierre et Marie Curie-Paris 6, LOCEAN/IPSL, Paris Cedex 05 (France); Li, Laurent Z.X. [Universite Pierre et Marie Curie-Paris 6, LMD/IPSL, Paris Cedex 05 (France)
2011-04-15
The atmospheric circulation response to decadal fluctuations of the Atlantic meridional overturning circulation (MOC) in the IPSL climate model is investigated using the associated sea surface temperature signature. A SST anomaly is prescribed in sensitivity experiments with the atmospheric component of the IPSL model coupled to a slab ocean. The prescribed SST anomaly in the North Atlantic is the surface signature of the MOC influence on the atmosphere detected in the coupled simulation. It follows a maximum of the MOC by a few years and resembles the model Atlantic multidecadal oscillation. It is mainly characterized by a warming of the North Atlantic south of Iceland, and a cooling of the Nordic Seas. There are substantial seasonal variations in the geopotential height response to the prescribed SST anomaly, with an East Atlantic Pattern-like response in summer and a North Atlantic oscillation-like signal in winter. In summer, the response of the atmosphere is global in scale, resembling the climatic impact detected in the coupled simulation, albeit with a weaker amplitude. The zonally asymmetric or eddy part of the response is characterized by a trough over warm SST associated with changes in the stationary waves. A diagnostic analysis with daily data emphasizes the role of transient-eddy forcing in shaping and maintaining the equilibrium response. We show that in response to an intensified MOC, the North Atlantic storm tracks are enhanced and shifted northward during summer, consistent with a strengthening of the westerlies. However the anomalous response is weak, which suggests a statistically significant but rather modest influence of the extratropical SST on the atmosphere. The winter response to the MOC-induced North Atlantic warming is an intensification of the subtropical jet and a southward shift of the Atlantic storm track activity, resulting in an equatorward shift of the polar jet. Although the SST anomaly is only prescribed in the Atlantic ocean
Directory of Open Access Journals (Sweden)
Paul G Matson
Full Text Available The species concept in marine phytoplankton is defined based on genomic, morphological, and functional properties. Reports of intraspecific diversity are widespread across major phytoplankton groups but the impacts of this variation on ecological and biogeochemical processes are often overlooked. Intraspecific diversity is well known within coccolithophores, which play an important role in the marine carbon cycle via production of particulate inorganic carbon. In this study, we investigated strain-specific responses to temperature in terms of morphology, carbon production, and carbonate mineralogy using a combination of microscopy, elemental analysis, flow cytometry, and nuclear magnetic resonance. Two strains of the cosmopolitan coccolithophore E. huxleyi isolated from different regions (subtropical, CCMP371; temperate, CCMP3266 were cultured under a range of temperature conditions (10°C, 15°C, and 20°C using batch cultures and sampled during both exponential and stationary growth. Results for both strains showed that growth rates decreased at lower temperatures while coccosphere size increased. Between 15°C and 20°C, both strains produced similar amounts of total carbon, but differed in allocation of that carbon between particulate inorganic carbon (PIC and particulate organic carbon (POC, though temperature effects were not detected. Between 10°C and 20°C, temperature effects on daily production of PIC and POC, as well as the cellular quota of POC were detected in CCMP3266. Strain-specific differences in coccolith shedding rates were found during exponential growth. In addition, daily shedding rates were negatively related to temperature in CCMP371 but not in CCMP3266. Despite differences in rates of particulate inorganic carbon production, both strains were found to produce coccoliths composed entirely of pure calcite, as established by solid-state 13C and 43Ca NMR and X-ray diffraction measurements. These results highlight the
Directory of Open Access Journals (Sweden)
Talero, R.
2008-12-01
Full Text Available In this first part of the study, the results obtained in prior research with XRD and SEM, as well as the Le Chatelier-Ansttet test were confirmed with the ASTM C 452-68 test. To this end, 20%, 30% and 40% metakaolin (MK was added to ten Portland cements, six OPCs and four SRPCs. Both the ten plain PCs and the 30 metakaolin (MK blends were tested for two years under ASTM C 452-68 specifications, determining not only the percentage increase in length, ΔL(%, of the specimens, but also the sulphate content in the curing water. Other parameters studied included: chemical analysis of the cementitious materials used and specific properties of some of the cements tested.The experimental results, ΔL(% versus time, re-confirmed that the formation rate of ettringite from the reactive alumina, Al2O3r-, present in the pozzolan must be substantially higher than the formation rate of ettringite from the C3A present in the PC. This was verified by the variation of the sulphate content in the specimen curing water throughout the test. In light of those findings, in this article these two types of ettringite are denominated rapid forming ettringite or ett-rf, and slow forming ettringite or ett-lf.En esta Parte I de la investigación, se han logrado verificar mediante el ensayo ASTM C 452-68, los resultados obtenidos en anteriores investigaciones realizadas con DRX y SEM y el ensayo Le Chatelier-Ansttet. Para ello, a 10 cementos Portland –6 CPO y 4 CPRS– se les añadió 20%, 30% y 40% de metakaolín (MK. Tanto los 10 CP como los 30 de sus mezclas con metakaolín (MK, se ensayaron durante 2 años, mediante dicho método ASTM C 452-68, y a sus probetas no sólo se les determinó su incremento porcentual de longitud, ΔL(%, sino además, el contenido de sulfatos de sus aguas de conservación. Otras determinaciones complementarias fueron: análisis químico de los materiales cementiceos utilizados y propiedades específicas de algunos cementos ensayados
Alien smuggling: East to West.
Walsh, J H
1987-01-01
This year untold millions of illegal aliens will enter Western Europe, Canada, and the US; in 1986, the US alone made 1.7 million apprehensions. Because of the numbers involved and the hard currency exchanged, alien smuggling has become big business--a lucrative track in desparate human beings. West Germany's open door asylum policy has been a boon to the smugglers, and West Berlin is currently a favored port of entry. The government provides social benefits--apartments, food, a stipend, and clothing--for asylum seekers. Smuggling operations appear to fit 3 categories: 1) state-sponsored alien smugglers, with a sub-category of terrorists; 2) ethnic smugglers with a history of terrorist spinoffs; and 3) independent smugglers, who are profit oriented, and willing to handle ethnic aliens and terrorists. In West Germany, immigration investigations begin at the border. West German officials often know that as they cause the Eastern border to be tightened, the flow will gravitate south toward Austria. Redirecting the trasit of Third Worlders from East Berlin away from West Germany, Sweden, and Denmark will be a stop-gap measure at best. Part of West Germany's immigration problem can be traced to the Basic Law that provides asylum for those who claim persecution (political, racial, ethnic, or religious). Yet, any attempt to change asylum would result in an admission of defeat in the quest for a unified Germany. Should Austria move to tighten its immigration laws, agreements similar to those between East and West Germany will likely follow.
Atlantic Sharpnose Shark Reproductive Biology Data
National Oceanic and Atmospheric Administration, Department of Commerce — Reproductive data from Atlantic sharpnose sharks were collected from specimens captured throughout the northern Gulf of Mexico on various research vessels. Data...
Diel and seasonal variation in food habits of Atlantic salmon parr in a small stream
Grader, M.; Letcher, B.H.
2006-01-01
The diel and seasonal food habits of young-of-year (YOY) and post-young-of-year (PYOY) Atlantic salmon (Salmo salar) parr were assayed over the course of 11 months in the West Brook, Massachusetts USA. Gut fullness of YOY salmon did not vary significantly among months. PYOY salmon exhibited significant seasonal differences in gut fullness, with peak fullness occurring in the spring and late fall. Significant diel differences in PYOY gut fullness occurred in June and April, with peak fullness always occurring at dawn. Prey composition varied substantially among months. Dominant prey items of PYOY salmon were baetid mayflies in June, July, and August, limnephilid caddisflies in October and November, and ephemerellid mayflies in February and April. Few differences in prey composition between PYOY and YOY salmon were observed. Fish growth was unrelated to prey availability, but gut fullness explained up to 97% of growth variation across seasons. Results suggest that spring and fall are critical periods of feeding for PYOY salmon and that diel feeding intensity shifts seasonally.
Hyodo, Masayuki; Bradák, Balázs; Okada, Makoto; Katoh, Shigehiro; Kitaba, Ikuko; Dettman, David L; Hayashi, Hiroki; Kumazawa, Koyo; Hirose, Kotaro; Kazaoka, Osamu; Shikoku, Kizuku; Kitamura, Akihisa
2017-08-30
Suborbital-scale climate variations, possibly caused by solar activity, are observed in the Holocene and last-glacial climates. Recently published bicentennial-resolution paleoceanic environmental records reveal millennial-scale high-amplitude oscillations postdating the last geomagnetic reversal in the Marine Isotope Stage (MIS) 19 interglacial. These oscillations, together with decoupling of post-reversal warming from maximum sea-level highstand in mid-latitudes, are key features for understanding the climate system of MIS 19 and the following Middle Pleistocene. It is unclear whether the oscillations are synchronous, or have the same driver as Holocene cycles. Here we present a high resolution record of western North Pacific submarine anoxia and sea surface bioproductivity from the Chiba Section, central Japan. The record reveals many oxic events in MIS 19, coincident with cold intervals, or with combined cold and sea-level fall events. This allows detailed correlations with paleoceanic records from the mid-latitude North Atlantic and Osaka Bay, southwest Japan. We find that the millennial-scale oscillations are synchronous between East and West hemispheres. In addition, during the two warmest intervals, bioproductivity follows the same pattern of change modulated by bicentennial cycles that are possibly related to solar activity.
77 FR 55192 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2012-09-07
.... SUMMARY: The Scientific and Statistical Committee (SSC) of the Mid- Atlantic Fishery Management Council... Fishery Management Council (MAFMC); Public Meeting AGENCY: National Marine Fisheries Service (NMFS.... Council address: Mid-Atlantic Fishery Management Council, 800 N. State Street, Suite 201, Dover, DE 19901...
77 FR 35903 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC
2012-06-15
... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... Intracoastal Waterway, mile 226, at Emerald Isle, North Carolina. [[Page 35904
2012-10-01
... vessels permitted in the Atlantic tunas General category in Puerto Rico and 10 in the U.S. Virgin Islands... [Docket No. 080603729-2454-02] RIN 0648-AW83 Atlantic Highly Migratory Species; 2006 Consolidated Highly... management plan (FMP) amendment addresses Atlantic highly migratory species (HMS) fishery management measures...
Bertacchi Uvo, Cintia; Repelli, Carlos A.; Zebiak, Stephen E.; Kushnir, Yochanan
1998-04-01
The monthly patterns of northeast Brazil (NEB) precipitation are analyzed in relation to sea surface temperature (SST) in the tropical Pacific and Atlantic Oceans, using singular value decomposition. It is found that the relationships between precipitation and SST in both basins vary considerably throughout the rainy season (February-May). In January, equatorial Pacific SST is weakly correlated with precipitation in small areas of southern NEB, but Atlantic SST shows no significant correlation with regional precipitation. In February, Pacific SST is not well related to precipitation, but south equatorial Atlantic SST is positively correlated with precipitation over the northern Nordeste, the latter most likely reflecting an anomalously early (or late) southward migration of the ITCZ precipitation zone. During March, equatorial Pacific SST is negatively correlated with Nordeste precipitation, but no consistent relationship between precipitation and Atlantic SST is found. Atlantic SST-precipitation correlations for April and May are the strongest found among all months or either ocean. Precipitation in the Nordeste is positively correlated with SST in the south tropical Atlantic and negatively correlated with SST in the north tropical Atlantic. These relationships are strong enough to determine the structure of the seasonal mean SST-precipitation correlations, even though the corresponding patterns for the earlier months of the season are quite different. Pacific SST-precipitation correlations for April and May are similar to those for March. Extreme wet (dry) years for the Nordeste occur when both Pacific and Atlantic SST patterns for April and May occur simultaneously. A separate analysis reinforces previous findings in showing that SST in the tropical Pacific and the northern tropical Atlantic are positively correlated and that tropical Pacific-south Atlantic correlations are negligible.Time-lagged analyses show the potential for forecasting either seasonal mean
Brown, Douglas M
2010-09-01
This historical treatise documents the unbroken legacy of the West family of chiropractors which has flourished in Canada for over 100 years. Part I, unearths the origins, development and careers of Archibald West, the founder of this dynasty, his son Samuel and grandson Stephen. Part II, not yet ready for publication, will delve into the lives of Archibald's brother Samson and his chiropractic progeny, as well as a nephew of Stephen and another relative of Frederick West.
Environmental studies results: 1973-1992. Atlantic Outer Continental Shelf. Final report
International Nuclear Information System (INIS)
Wilson, J.M.
1992-01-01
The Outer Continental Shelf (OCS) Environmental Studies Program was initiated in 1973 under the Bureau of Land Management by the Secretary of the Interior. The Purpose of the program was to conduct studies needed to predict, assess and manage impacts on the human, marine and coastal environments of the OCS and nearshore areas that may be affected by oil and gas activities. The narrative summary updates the version printed in 1986, which covered studies managed by the MMS in the Atlantic OCS region between 1973 and 1985. Descriptions of the study results are divided into the following categories: baseline studies and environmental inventories, biology/ecology, drill site monitoring, endangered species, geology/chemistry, oil spill studies, physical oceanography/meteorology, and social and economic studies. Results of each major type of study are subdivided into North Atlantic, Mid-Atlantic, South Atlantic, and multiregional studies in chronological sequence
Food habits of Atlantic sturgeon off the central New Jersey coast
Johnson, J. H.; Dropkin, D.S.; Warkentine, B.E.; Rachlin, J.W.; Andrews, W.D.
1997-01-01
Limited information exists on the marine diet of the Atlantic sturgeon Acipenser oxyrinchus oxyrinchus. We examined the food habits of 275 Atlantic sturgeon (total length, 106-203 cm) caught in the commercial fishery off the coast of New Jersey. Stomachs were provided by fishermen. Significantly more stomachs were empty in the spring than in the fall. Sand and organic debris were a major component in the stomachs (26.3-75.4% by weight). Polycheates were the primary pre group consumed, although the isopod Politolana conchorum was the most important individual prey eaten. Mollusks and fish contributed little to the diet. Some prey taxa (i.e., polychaetes, isopods, amphipods) exhibited seasonal variation in importance in the diet of Atlantic sturgeon. Identification of the offshore diet of Atlantic sturgeon is an important step in developing a better understanding of the life history requirements and marine ecology of this species.
Burial, Uplift and Exhumation History of the Atlantic Margin of NE Brazil
Japsen, Peter; Bonow, Johan M.; Green, Paul F.; Cobbold, Peter R.; Chiossi, Dario; Lilletveit, Ragnhild
2010-05-01
We have undertaken a regional study of landscape development and thermo-tectonic evo-lution of NE Brazil. Our results reveal a long history of post-Devonian burial and exhuma-tion across NE Brazil. Uplift movements just prior to and during Early Cretaceous rifting led to further regional denudation, to filling of rift basins and finally to formation of the Atlantic margin. The rifted margin was buried by a km-thick post-rift section, but exhumation began in the Late Cretaceous as a result of plate-scale forces. The Cretaceous cover probably extended over much of NE Brazil where it is still preserved over extensive areas. The Late Cretaceous exhumation event was followed by events in the Paleogene and Neogene. The results of these events of uplift and exhumation are two regional peneplains that form steps in the landscape. The plateaux in the interior highlands are defined by the Higher Surface at c. 1 km above sea level. This surface formed by fluvial erosion after the Late Cretaceous event - and most likely after the Paleogene event - and thus formed as a Paleogene pene-plain near sea level. This surface was reburied prior to the Neogene event, in the interior by continental deposits and along the Atlantic margin by marine and coastal deposits. Neo-gene uplift led to reexposure of the Palaeogene peneplain and to formation of the Lower Surface by incision along rivers below the uplifted Higher Surface that characterise the pre-sent landscape. Our results show that the elevated landscapes along the Brazilian margin formed during the Neogene, c. 100 Myr after break-up. Studies in West Greenland have demonstrated that similar landscapes formed during the late Neogene, c. 50 Myr after break-up. Many passive continental margins around the world are characterised by such elevated plateaus and it thus seems possible, even likely, that they may also post-date rifting and continental separation by many Myr.
Copepod distribution and production in a Mid-Atlantic Ridge archipelago
Directory of Open Access Journals (Sweden)
PEDRO A.M.C. MELO
2014-12-01
Full Text Available The Saint Peter and Saint Paul Archipelago (SPSPA are located close to the Equator in the Atlantic Ocean. The aim of this study was to assess the spatial variations in the copepod community abundance, and the biomass and production patterns of the three most abundant calanoid species in the SPSPA. Plankton samples were collected with a 300 µm mesh size net along four transects (north, east, south and west of the SPSPA, with four stations plotted in each transect. All transects exhibited a tendency toward a decrease in copepod density with increasing distance from the SPSPA, statistically proved in the North. Density varied from 3.33 to 182.18 ind.m−3, and differences were also found between the first perimeter (first circular distance band and the others. The total biomass varied from 15.25 to 524.50 10−3 mg C m−3 and production from 1.19 to 22.04 10−3 mg C m−3d−1. The biomass and production of Undinula vulgaris (Dana, 1849, Acrocalanus longicornis Giesbrecht, 1888 and Calocalanus pavo (Dana, 1849 showed differences between some transects. A trend of declining biodiversity and production with increasing distance from archipelago was observed, suggesting that even small features like the SPSPA can affect the copepod community in tropical oligotrophic oceanic areas.
Li, Xinnian; Duke, Norman C; Yang, Yuchen; Huang, Lishi; Zhu, Yuxiang; Zhang, Zhang; Zhou, Renchao; Zhong, Cairong; Huang, Yelin; Shi, Suhua
2016-01-01
Avicennia L. (Avicenniaceae), one of the most diverse mangrove genera, is distributed widely in tropical and subtropical intertidal zones worldwide. Five species of Avicennia in the Indo-West Pacific region have been previously described. However, their phylogenetic relationships were determined based on morphological and allozyme data. To enhance our understanding of evolutionary patterns in the clade, we carried out a molecular phylogenetic study using wide sampling and multiple loci. Our results support two monophyletic clades across all species worldwide in Avicennia: an Atlantic-East Pacific (AEP) lineage and an Indo-West Pacific (IWP) lineage. This split is in line with biogeographic distribution of the clade. Focusing on the IWP branch, we reconstructed a detailed phylogenetic tree based on sequences from 25 nuclear genes. The results identified three distinct subclades, (1) A. rumphiana and A. alba, (2) A. officinalis and A. integra, and (3) the A. marina complex, with high bootstrap support. The results strongly corresponded to two morphological traits in floral structure: stigma position in relation to the anthers and style length. Using Bayesian dating methods we estimated diversification of the IWP lineage was dated to late Miocene (c. 6.0 million years ago) and may have been driven largely by the fluctuating sea levels since that time.
Directory of Open Access Journals (Sweden)
Xinnian Li
Full Text Available Avicennia L. (Avicenniaceae, one of the most diverse mangrove genera, is distributed widely in tropical and subtropical intertidal zones worldwide. Five species of Avicennia in the Indo-West Pacific region have been previously described. However, their phylogenetic relationships were determined based on morphological and allozyme data. To enhance our understanding of evolutionary patterns in the clade, we carried out a molecular phylogenetic study using wide sampling and multiple loci. Our results support two monophyletic clades across all species worldwide in Avicennia: an Atlantic-East Pacific (AEP lineage and an Indo-West Pacific (IWP lineage. This split is in line with biogeographic distribution of the clade. Focusing on the IWP branch, we reconstructed a detailed phylogenetic tree based on sequences from 25 nuclear genes. The results identified three distinct subclades, (1 A. rumphiana and A. alba, (2 A. officinalis and A. integra, and (3 the A. marina complex, with high bootstrap support. The results strongly corresponded to two morphological traits in floral structure: stigma position in relation to the anthers and style length. Using Bayesian dating methods we estimated diversification of the IWP lineage was dated to late Miocene (c. 6.0 million years ago and may have been driven largely by the fluctuating sea levels since that time.
Simulated variability of the Atlantic meridional overturning circulation
Bentsen, M.; Drange, H.; Furevik, T.; Zhou, T.
To examine the multi-annual to decadal scale variability of the Atlantic Meridional Overturning Circulation (AMOC) we conducted a four-member ensemble with a daily reanalysis forced, medium-resolution global version of the isopycnic coordinate ocean model MICOM, and a 300-years integration with the fully coupled Bergen Climate Model (BCM). The simulations of the AMOC with both model systems yield a long-term mean value of 18 Sv and decadal variability with an amplitude of 1-3 Sv. The power spectrum of the inter-annual to decadal scale variability of the AMOC in BCM generally follows the theoretical red noise spectrum, with indications of increased power near the 20-years period. Comparison with observational proxy indices for the AMOC, e.g. the thickness of the Labrador Sea Water, the strength of the baroclinic gyre circulation in the North Atlantic Ocean, and the surface temperature anomalies along the mean path of the Gulf Stream, shows similar trends and phasing of the variability, indicating that the simulated AMOC variability is robust and real. Mixing indices have been constructed for the Labrador, the Irminger and the Greenland-Iceland-Norwegian (GIN) seas. While convective mixing in the Labrador and the GIN seas are in opposite phase, and linked to the NAO as observations suggest, the convective mixing in the Irminger Sea is in phase with or leads the Labrador Sea. Newly formed deep water is seen as a slow, anomalous cold and fresh, plume flowing southward along the western continental slope of the Atlantic Ocean, with a return flow of warm and saline water on the surface. In addition, fast-travelling topographically trapped waves propagate southward along the continental slope towards equator, where they go east and continue along the eastern rim of the Atlantic. For both types of experiments, the Northern Hemisphere sea level pressure and 2 m temperature anomaly patterns computed based on the difference between climate states with strong and weak AMOC
78 FR 48419 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting
2013-08-08
...: The Mid-Atlantic Fishery Management Council's (Council) Bluefish Advisory Panel (AP) will meet to develop a Fishery Performance Report for the Bluefish fishery in preparation for the Council and the... Council address below. Webinar link: http://mafmc.adobeconnect.com/bluefish/ Council address: Mid-Atlantic...
Management of Atlantic walrus (Odobenus rosmarus rosmarus in the arctic Atlantic
Directory of Open Access Journals (Sweden)
Øystein Wiig
2014-12-01
Full Text Available We review the management of Atlantic walruses (Odobenus rosmarus rosmarus past and present in the four range states—Canada, Greenland, Norway and Russia—which have permanent populations of Atlantic walruses. Populations in all four countries have been depleted, although the extent of depletion is not well known. Inuit in Arctic Canada and Greenland hunt Atlantic walruses for subsistence while they have been protected at Svalbard (Norway since 1952 and in the western Russian Arctic since 1956. Since the second half of the 20th Century Canada and Greenland have increased protection of their walrus. Generally the number of walruses landed in Canada is governed by the number of hunters and/or people in the settlement and not by stock-specific quotas. Although quotas have been set in few communities, it is not known if they are adequate to prevent overhunting. A quota system for walrus hunting in Greenland began in 2006. The current control system is largely effective in ensuring the quotas are applied and that reporting is correct. Greenland currently sets quotas based on recommendations from scientific assessments using recent population estimates to allow population growth from a depleted population. A challenge with respect to managing walrus hunting remains the variable and sometimes high rates of lost animals. Since the 1960s changes in socio-economics in hunting areas of Arctic Canada and Greenland (and the use of snowmobiles instead of dog sleds in Canada have led to a general decrease in interest in hunting of walruses and reduced harvest on walrus stocks in these countries. Although there is an active ongoing cooperation between Canada and Greenland scientists regarding assessments of shared populations of walruses currently there is no formal agreement between the two range states on co-management of shared stocks. Protection of walrus from other anthropogenic impacts generally focusses on large-scale industrial activity. The level
Tropical Atlantic-Korea teleconnection pattern during boreal summer season
Ham, Yoo-Geun; Chikamoto, Yoshimitsu; Kug, Jong-Seong; Kimoto, Masahide; Mochizuki, Takashi
2017-10-01
The remote impact of tropical Atlantic sea surface temperature (SST) variability on Korean summer precipitation is examined based on observational data analysis along with the idealized and hindcast model experiments. Observations show a significant correlation (i.e. 0.64) between Korean precipitation anomalies (averaged over 120-130°E, 35-40°N) and the tropical Atlantic SST index (averaged over 60°W-20°E, 30°S-30°N) during the June-July-August (JJA) season for the 1979-2010 period. Our observational analysis and partial-data assimilation experiments using the coupled general circulation model demonstrate that tropical Atlantic SST warming induces the equatorial low-level easterly over the western Pacific through a reorganization of the global Walker Circulation, causing a decreased precipitation over the off-equatorial western Pacific. As a Gill-type response to this diabatic forcing, an anomalous low-level anticyclonic circulation appears over the Philippine Sea, which transports wet air from the tropics to East Asia through low-level southerly, resulting an enhanced precipitation in the Korean peninsula. Multi-model hindcast experiments also show that predictive skills of Korean summer precipitation are improved by utilizing predictions of tropical Atlantic SST anomalies as a predictor for Korean precipitation anomalies.
Roque, Cristina; Hernández-Molina, F. Javier; Madureira, Pedro; Quartau, Rui; Magalhães, Vitor; Carrara, Gabriela; Santos de Campos, Aldino; Brandão, Filipe; Tomás Vázquez, Juan; Somoza, Luis
2017-04-01
During the last decades several works have been carried out on the morphosedimentary processes driven by bottom-currents in several continental margins and abyssal plains worldwide. However these processes still remain poorly understood on deep-water settings and particularly around oceanic islands. This study is focused on the offshore of Madeira Island (Portugal), which is located in the Northeast Atlantic at about 700 km west of NW Africa. The interpretation of a newly acquired dataset, composed of multibeam bathymetry, Parasound echosounder profiles and multichannel seismic reflection profiles, allowed to identify a giant (about 385 km long and over than 175 km wide) plastered contourite drift, called the "Madeira Drift", developing along the lower slope of the Madeira plateau. It formed on top of a major erosional unconformity that truncates the underlying pelagic deposits, which drape over faulted blocks of Cretaceous oceanic crust. The Madeira Drift is composed of three main regional seismic units showing a predominant aggradational stacking pattern, without evidence of major lateral migration thought time. Its internal configuration indicates that it was build-up by a northwards flowing deep bottom current. These characteristics suggests that an almost persistent and stable water mass has been responsible for its edification trough time. While the precise age of this contourite drift is undetermined, some chronostratigraphic constraints can be determined based upon published works regarding seafloor magnetic anomalies (e.g. Bird et al., 2007), DSDP Site 136drilling data (Hayes et al., 1978). Attending to this, we propose that the possible onset of Madeira Drift must have occurred after Late Cretaceous, within the tertiary period, and quite probably in the Late Eocene / Eocene-Oligocene transition. Based on them is commonly accepted that an enhanced proto-Antarctic Bottom Water (AABW) started to circulate at that time we considered this water mass as the
Atlantic Bluefin Tuna (Thunnus thynnus) Biometrics and Condition.
Rodriguez-Marin, Enrique; Ortiz, Mauricio; Ortiz de Urbina, José María; Quelle, Pablo; Walter, John; Abid, Noureddine; Addis, Piero; Alot, Enrique; Andrushchenko, Irene; Deguara, Simeon; Di Natale, Antonio; Gatt, Mark; Golet, Walter; Karakulak, Saadet; Kimoto, Ai; Macias, David; Saber, Samar; Santos, Miguel Neves; Zarrad, Rafik
2015-01-01
The compiled data for this study represents the first Atlantic and Mediterranean-wide effort to pool all available biometric data for Atlantic bluefin tuna (Thunnus thynnus) with the collaboration of many countries and scientific groups. Biometric relationships were based on an extensive sampling (over 140,000 fish sampled), covering most of the fishing areas for this species in the North Atlantic Ocean and Mediterranean Sea. Sensitivity analyses were carried out to evaluate the representativeness of sampling and explore the most adequate procedure to fit the weight-length relationship (WLR). The selected model for the WLRs by stock included standardized data series (common measurement types) weighted by the inverse variability. There was little difference between annual stock-specific round weight-straight fork length relationships, with an overall difference of 6% in weight. The predicted weight by month was estimated as an additional component in the exponent of the weight-length function. The analyses of monthly variations of fish condition by stock, maturity state and geographic area reflect annual cycles of spawning and feeding behavior. We update and improve upon the biometric relationships for bluefin currently used by the International Commission for the Conservation of Atlantic Tunas, by incorporating substantially larger datasets than ever previously compiled, providing complete documentation of sources and employing robust statistical fitting. WLRs and other conversion factors estimated in this study differ from the ones used in previous bluefin stock assessments.
Linking the South Atlantic Meridional Overturning Circulation and the Global Monsoons
Lopez, H.; Dong, S.; Goni, G. J.; Lee, S. K.
2016-02-01
This study tested the hypothesis whether low frequency decadal variability of the South Atlantic meridional heat transport (SAMHT) influences decadal variability of the global monsoons. A multi-century run from a state-of-the-art coupled general circulation model is used as basis for the analysis. Our findings indicate that multi-decadal variability of the South Atlantic Ocean plays a key role in modulating atmospheric circulation via interhemispheric changes in Atlantic Ocean heat content. Weaker SAMHT produces anomalous ocean heat divergence over the South Atlantic resulting in negative ocean heat content anomaly about 15 years later. This, in turn, forces a thermally direct anomalous interhemispheric Hadley circulation in the atmosphere, transporting heat from the northern hemisphere (NH) to the southern hemisphere (SH) and moisture from the SH to the NH, thereby intensify (weaken) summer (winter) monsoon in the NH and winter (summer) monsoon in the SH. Results also show that anomalous atmospheric eddies, both transient and stationary, transport heat northward in both hemispheres producing eddy heat flux convergence (divergence) in the NH (SH) around 15-30°, reinforcing the anomalous Hadley circulation. Overall, SAMHT decadal variability leads its atmospheric response by about 15 years, suggesting that the South Atlantic is a potential predictor of global climate variability.
Genome-wide physical activity interactions in adiposity ― A meta-analysis of 200,452 adults
Feitosa, Mary F.; Barata, Llilda; Chu, Audrey Y.; Mahajan, Anubha; Hadley, David; Xue, Luting; Workalemahu, Tsegaselassie; den Hoed, Marcel; Ahluwalia, Tarunveer S.; Qi, Qibin; Ngwa, Julius S.; Quaye, Lydia; Eicher, John D.; Hayes, James E.; Cornelis, Marilyn; Kutalik, Zoltan; Lim, Elise; Luan, Jian’an; Huffman, Jennifer E.; Zhang, Weihua; Zhao, Wei; Griffin, Paula J.; Haller, Toomas; Ahmad, Shafqat; Marques-Vidal, Pedro M.; Bien, Stephanie; Yengo, Loic; Teumer, Alexander; Smith, Albert Vernon; Kumari, Meena; Harder, Marie Neergaard; Justesen, Johanne Marie; Kleber, Marcus E.; Hollensted, Mette; Lohman, Kurt; Rivera, Natalia V.; Whitfield, John B.; Zhao, Jing Hua; Stringham, Heather M.; Lyytikäinen, Leo-Pekka; Huppertz, Charlotte; Willemsen, Gonneke; Peyrot, Wouter J.; Wu, Ying; Kristiansson, Kati; Demirkan, Ayse; Fornage, Myriam; Hassinen, Maija; Bielak, Lawrence F.; Cadby, Gemma; Tanaka, Toshiko; Mägi, Reedik; van der Most, Peter J.; Jackson, Anne U.; Bragg-Gresham, Jennifer L.; Vitart, Veronique; Marten, Jonathan; Navarro, Pau; Bellis, Claire; Pasko, Dorota; Johansson, Åsa; Snitker, Søren; Cheng, Yu-Ching; Eriksson, Joel; Lim, Unhee; Aadahl, Mette; Adair, Linda S.; Amin, Najaf; Balkau, Beverley; Auvinen, Juha; Beilby, John; Bergman, Richard N.; Bergmann, Sven; Bertoni, Alain G.; Blangero, John; Bonnefond, Amélie; Bonnycastle, Lori L.; Borja, Judith B.; Brage, Søren; Busonero, Fabio; Buyske, Steve; Campbell, Harry; Chines, Peter S.; Collins, Francis S.; Corre, Tanguy; Smith, George Davey; Delgado, Graciela E.; Dueker, Nicole; Dörr, Marcus; Ebeling, Tapani; Eiriksdottir, Gudny; Esko, Tõnu; Faul, Jessica D.; Fu, Mao; Færch, Kristine; Gieger, Christian; Gläser, Sven; Gong, Jian; Gordon-Larsen, Penny; Grallert, Harald; Grammer, Tanja B.; Grarup, Niels; van Grootheest, Gerard; Harald, Kennet; Hastie, Nicholas D.; Havulinna, Aki S.; Hernandez, Dena; Hindorff, Lucia; Hocking, Lynne J.; Holmens, Oddgeir L.; Holzapfel, Christina; Hottenga, Jouke Jan; Huang, Jie; Huang, Tao; Hui, Jennie; Huth, Cornelia; Hutri-Kähönen, Nina; James, Alan L.; Jansson, John-Olov; Jhun, Min A.; Juonala, Markus; Kinnunen, Leena; Koistinen, Heikki A.; Kolcic, Ivana; Komulainen, Pirjo; Kuusisto, Johanna; Kvaløy, Kirsti; Kähönen, Mika; Lakka, Timo A.; Launer, Lenore J.; Lehne, Benjamin; Lindgren, Cecilia M.; Lorentzon, Mattias; Luben, Robert; Marre, Michel; Milaneschi, Yuri; Monda, Keri L.; Montgomery, Grant W.; De Moor, Marleen H. M.; Mulas, Antonella; Müller-Nurasyid, Martina; Musk, A. W.; Männikkö, Reija; Männistö, Satu; Narisu, Narisu; Nauck, Matthias; Nettleton, Jennifer A.; Nolte, Ilja M.; Oldehinkel, Albertine J.; Olden, Matthias; Ong, Ken K.; Padmanabhan, Sandosh; Paternoster, Lavinia; Perez, Jeremiah; Perola, Markus; Peters, Annette; Peters, Ulrike; Peyser, Patricia A.; Prokopenko, Inga; Puolijoki, Hannu; Raitakari, Olli T.; Rankinen, Tuomo; Rasmussen-Torvik, Laura J.; Rawal, Rajesh; Ridker, Paul M.; Rose, Lynda M.; Rudan, Igor; Sarti, Cinzia; Sarzynski, Mark A.; Savonen, Kai; Scott, William R.; Sanna, Serena; Shuldiner, Alan R.; Sidney, Steve; Silbernagel, Günther; Smith, Blair H.; Smith, Jennifer A.; Snieder, Harold; Stančáková, Alena; Sternfeld, Barbara; Swift, Amy J.; Tammelin, Tuija; Tan, Sian-Tsung; Thorand, Barbara; Thuillier, Dorothée; Vandenput, Liesbeth; Vestergaard, Henrik; van Vliet-Ostaptchouk, Jana V.; Vohl, Marie-Claude; Völker, Uwe; Waeber, Gérard; Walker, Mark; Wild, Sarah; Wong, Andrew; Wright, Alan F.; Zillikens, M. Carola; Zubair, Niha; Haiman, Christopher A.; Lemarchand, Loic; Gyllensten, Ulf; Ohlsson, Claes; Hofman, Albert; Rivadeneira, Fernando; Uitterlinden, André G.; Pérusse, Louis; Wilson, James F.; Hayward, Caroline; Polasek, Ozren; Cucca, Francesco; Hveem, Kristian; Hartman, Catharina A.; Tönjes, Anke; Bandinelli, Stefania; Palmer, Lyle J.; Kardia, Sharon L. R.; Rauramaa, Rainer; Sørensen, Thorkild I. A.; Tuomilehto, Jaakko; Salomaa, Veikko; Penninx, Brenda W. J. H.; de Geus, Eco J. C.; Boomsma, Dorret I.; Lehtimäki, Terho; Mangino, Massimo; Laakso, Markku; Bouchard, Claude; Martin, Nicholas G.; Kuh, Diana; Liu, Yongmei; Linneberg, Allan; März, Winfried; Strauch, Konstantin; Kivimäki, Mika; Harris, Tamara B.; Gudnason, Vilmundur; Völzke, Henry; Qi, Lu; Järvelin, Marjo-Riitta; Chambers, John C.; Kooner, Jaspal S.; Froguel, Philippe; Kooperberg, Charles; Vollenweider, Peter; Hallmans, Göran; Hansen, Torben; Pedersen, Oluf; Metspalu, Andres; Wareham, Nicholas J.; Langenberg, Claudia; Weir, David R.; Porteous, David J.; Boerwinkle, Eric; Chasman, Daniel I.; Abecasis, Gonçalo R.; McCarthy, Mark I.; Frayling, Timothy M.; O’Connell, Jeffrey R.; van Duijn, Cornelia M.; Boehnke, Michael; Heid, Iris M.; Mohlke, Karen L.; Fox, Caroline S.; Hirschhorn, Joel N.; Johnson, Andrew D.; Borecki, Ingrid B.; Franks, Paul W.; North, Kari E.; Cupples, L. Adrienne; Loos, Ruth J. F.; Kilpeläinen, Tuomas O.
2017-01-01
Physical activity (PA) may modify the genetic effects that give rise to increased risk of obesity. To identify adiposity loci whose effects are modified by PA, we performed genome-wide interaction meta-analyses of BMI and BMI-adjusted waist circumference and waist-hip ratio from up to 200,452 adults of European (n = 180,423) or other ancestry (n = 20,029). We standardized PA by categorizing it into a dichotomous variable where, on average, 23% of participants were categorized as inactive and 77% as physically active. While we replicate the interaction with PA for the strongest known obesity-risk locus in the FTO gene, of which the effect is attenuated by ~30% in physically active individuals compared to inactive individuals, we do not identify additional loci that are sensitive to PA. In additional genome-wide meta-analyses adjusting for PA and interaction with PA, we identify 11 novel adiposity loci, suggesting that accounting for PA or other environmental factors that contribute to variation in adiposity may facilitate gene discovery. PMID:28448500
Environmental Factors and Natural Resource Stock: Atlantic Herring case
Energy Technology Data Exchange (ETDEWEB)
Cho, J.H. [Korea Maritime Institute, Seoul (Korea); John, M. Gate [University of Rhode Island, Kingston (United States)
2001-12-01
Atlantic herrings have held the important position as fish-baits in the marine ecosystem such as major baits in fishing lobsters. The Atlantic herring is sensitively influenced by the environmental factors of the marine ecosystem, such as the temperature of seawater, the amount of planktons, and the submarine deposit of the habitat. In the immature phase of herrings, especially, they are very sensitive of the low temperature of seawater. This study analyzes the correlation between two-year-old imported herring resources and the temperature of seawater, measured by a satellite. The area of measuring temperature is limited to the spawning ground of Atlantic herrings. As results of the analysis, the coefficient is 0.69, which means that the environmental factors should be very seriously considered in explaining the change of fishing resources. 12 refs., 4 figs., 1 tab.
Genetic diversity of Bromeliaceae species from the Atlantic Forest.
Sheu, Y; Cunha-Machado, A S; Gontijo, A B P L; Favoreto, F C; Soares, T B C; Miranda, F D
2017-04-20
The Bromeliaceae family includes a range of species used for many purposes, including ornamental use and use as food, medicine, feed, and fiber. The state of Espírito Santo, Brazil is a center of diversity for this family in the Atlantic Forest. We evaluated the genetic diversity of five populations of the Bromeliaceae family, including specimens of the genera Aechmea, Billbergia (subfamily Bromelioideae), and Pitcairnia (subfamily Pitcairnioidea), all found in the Atlantic Forest and distributed in the state of Espírito Santo. The number of alleles per locus in populations ranged from two to six and the fixation index (F), estimated for some simple sequence repeats in bromeliad populations, was less than zero in all populations. All markers in the Pitcairnia flammea population were in Hardy-Weinberg equilibrium (P Atlantic Forest remnants in the south of Espírito Santo state.
Late Quaternary Palaeoceanographic Changes in Sea Surface Conditions in the Tropical Atlantic
Fischel, Andrea; Seidenkrantz, Marit-Solveig; Kuijpers, Antoon; Nürnberg, Dirk
2013-04-01
Palaeoceanographic changes and the variability in surface water mass hydrography are reconstructed in order to track tropical ocean and climate variability and inter-hemispheric heat exchange through the last 42,000 year BP. Our studies are based on the relative abundance of planktonic foraminifera combined with sea surface temperature approximation based Mg/Ca measurements, XRF scanning and stable oxygen isotope analyses in a 5 m long gravity core Ga307-Win-12GC (17°50.80N, 64°48.7290W), retrieved in the Virgin Island Basin in approx. 3,960 m water depth. The Virgin Island Basin is the deepest part of the Anegada-Jungfern Passage in the northeast Caribbean, one of the most important pathways for water mass exchange between the Central Atlantic and the Caribbean Sea. Due to its bathymetry surface waters as well as deep water mass strata from the northern and southern hemisphere enter the basin, comprising Caribbean Surface Water (CSW), Antarctic Intermediate Water (AAIW), Atlantic Intermediate Water (AIW) and North Atlantic Deep Water (NADW). The planktonic foraminiferal assemblage suggests rather stable sea-surface conditions during the Holocene in the NE Caribbean. However, major changes in the hydrographic setting could be identified within the glacial period. During the glacial period, clear millennial-scale variability in sea-surface temperature and productivity are present. Fluctuations in the relative abundance of Globigerinoides ruber in the sediment core may be correlated to Dansgaard-Oeschger events in the northern North Atlantic. Furthermore an increase in relative abundance of Globorotalia rubescens occurs synchronous with ice rafted debris layers described from the North Atlantic. The faunal changes in the tropical Atlantic may thus be correlated to major climate changes in the North Atlantic, mainly D-O cyclicity as well as Heinrich events. Thus, the synchronous change in water mass distribution and hydrographic cyclicity suggests a possible linkage
Interdecadal North-Atlantic meridional overturning circulation variability in EC-EARTH
Energy Technology Data Exchange (ETDEWEB)
Wouters, Bert; Drijfhout, Sybren; Hazeleger, Wilco
2012-12-15
The Atlantic meridional overturning circulation (AMOC) in a 600 years pre-industrial run of the newly developed EC-EARTH model features marked interdecadal variability with a dominant time-scale of 50-60 years. An oscillation of approximately 2 Sverdrup (1 Sv = 10{sup 6} m{sup 3} s{sup -1}) is identified, which manifests itself as a monopole causing the overturning to simultaneously strengthen (/weaken) and deepen (/shallow) as a whole. Eight years before the AMOC peaks, density in the Labrador-Irminger Sea region reaches a maximum, triggering deep water formation. This density change is caused by a counterclockwise advection of temperature and salinity anomalies at lower latitudes, which we relate to the north-south excursions of the subpolar-subtropical gyre boundary and variations in strength and position of the subpolar gyre and the North Atlantic Current. The AMOC fluctuations are not directly forced by the atmosphere, but occur in a delayed response of the ocean to forcing by the North Atlantic Oscillation, which initiates ''intergyre''-gyre fluctuations. Associated with the AMOC is a 60-year sea surface temperature variability in the Atlantic, with a pattern and timescale showing similarities with the real-world Atlantic Multidecadal Variability. This good agreement with observations lends a certain degree of credibility that the mechanism that is described in this article could be seen as representative of the real climate system. (orig.)
Gregory, G. L.; Scott, A. D., Jr.
1995-01-01
This compendium describes aircraft data that are available from NASA's Pacific Exploratory Mission West-A (PEM West-A). PEM West is a component of the International Global Atmospheric Chemistry's (IGAC) East Asia/North Pacific Regional Study (APARE) project. The PEM- West program encompassed two expeditions to study contrasting meteorological regimes in the Pacific. Objectives of PEM West are to investigate the atmospheric chemistry of ozone over the northwest Pacific -- natural budgets and the impact of anthropogenic sources; and to investigate sulfur chemistry -- continental versus marine sulfur sources. PEM West-A was conducted in September 1991 during which the predominance of tropospheric air is from the mid-Pacific (marine) regions, but (at times) is modified/mixed with Asian continental outflow. PEM West-B was conducted during February 1994, a period characterized by maximum continental outflow. PEM-B data (not included) will become public domain during the Summer of 1995. PEM West-A flight experiments were based at Japan, Hong Kong, and Guam. This document provides a representation of NASA DC-8 aircraft data that are available from NASA Langley's Distributed Active Archive Center (DAAC), which include numerous data such as meteorological observations, modeling products, results from surface studies, satellite observations, and sonde releases.
Sarnthein, Michael; Grunert, Patrick; Khélifi, Nabil; Frank, Martin; Nürnberg, Dirk
2018-03-01
The ultimate, possibly geodynamic control and potential impact of changes in circulation activity and salt discharge of Mediterranean outflow waters (MOW) on Atlantic meridional overturning circulation have formed long-standing objectives in paleoceanography. Late Pliocene changes in the distal advection of MOW were reconstructed on orbital timescales for northeast Atlantic DSDP/ODP sites 548 and 982 off Brittany and on Rockall Plateau, supplemented by a proximal record from Site U1389 west off Gibraltar, and compared to Western Mediterranean surface and deep-water records of Alboran Sea Site 978. From 3.43 to 3.3 Ma, MOW temperatures and salinities form a prominent rise by 2-4 °C and 3 psu, induced by a preceding and coeval rise in sea surface and deep-water salinity and increased summer aridity in the Mediterranean Sea. We speculate that these changes triggered an increased MOW flow and were ultimately induced by a persistent 2.5 °C cooling of Indonesian Through-Flow waters. The temperature drop resulted from the northward drift of Australia that crossed a threshold value near 3.6-3.3 Ma and led to a large-scale cooling of the eastern subtropical Indian Ocean and in turn, to a reduction of African monsoon rains. Vice versa, we show that the distinct rise in Mediterranean salt export after 3.4 Ma induced a unique long-term rise in the formation of Upper North Atlantic Deep Water, that followed with a phase lag of 100 ky. In summary, we present evidence for an interhemispheric teleconnection of processes in the Indonesian Gateways, the Mediterranean and Labrador Seas, jointly affecting Pliocene climate.
2011-08-05
... Management Councils, in conjunction with NOAA Fisheries and the Atlantic and Gulf States Marine Fisheries... Management Councils and NOAA Fisheries Southeast Regional Office and Southeast Fisheries Science Center..., biologists, and researchers; constituency representatives including fishermen, environmentalists, and NGO's...
David J. Nowak; Eric J. Greenfield
2009-01-01
This report details how land cover and urbanization vary within the states of Delaware, Florida, Georgia, Maryland, North Carolina, South Carolina, Virginia, and West Virginia; and the District of Columbia by community (incorporated and census designated places), county subdivision, and county. Specifically this report provides critical urban and community forestry...
Regionalizing Telecommunications Reform in West Africa
World Bank
2007-01-01
This report assesses the potential gains from regionalized telecommunications policy in West Africa. The report seeks to assist officials in the Economic Community of West African States (ECOWAS), the West African Telecommunications Regulators Assembly (WATRA) and member states in designing an effective regional regulatory process. To this end, the report: (i) discusses how regional coop...
78 FR 17358 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meetings
2013-03-21
... Organizational Reports, the New England and South Atlantic Liaison Reports, the Executive Director's Report, the... December 2012 and February 2013 minutes, receive Organizational Reports, the New England and South Atlantic... recommendation on the workshop results to include control dates, roll-over provisions, GRAs, port meetings, etc...
Directory of Open Access Journals (Sweden)
Mohd. Kamal Hassan
1997-06-01
Full Text Available The scientific and technological developments during the 18th and' the 19th centuries ensured material progress of the West, as well as emergence of the West as the dominating power which colonized the rest of the world. During the post-colonial phase, Islam emerged as a revitalized sociopolitical force. This has been mistaken as a threat by the West, and Islam has been portrayed as the "new enemy after the demise of communism. This is partly an effort to establish a Western identity, which is disintegrating due to lack of a challenge; and partly a reflection of the failure of Muslims to realize the social and ethical ideals of Islam.
Why Do Organisms in the Atlantic Ocean Produce So Much CaCO3?
Toggweiler, J. R.
2010-12-01
Sediments in the Atlantic are richer in CaCO3 than sediments in the other oceans. Sediment trap observations show that sinking particles in the Atlantic also tend to have more CaCO3 in relation to organic carbon than sinking particles elsewhere. The reason for the extra production of CaCO3 has never been very clear. The Atlantic is unusual because it receives much more than its share of the global input of river water. River water adds alkalinity to the surface ocean while the production of CaCO3 takes it away. In this presentation a new tracer, called Alk*, is derived from the surface alkalinity distribution to highlight the impact of river inputs and the production of CaCO3. If the production of CaCO3 were evenly distributed across the ocean one would expect the Atlantic to have a higher level of Alk* becaused of its river inputs. We find instead that Alk* is lower in the middle of the Atlantic than almost any place else. This, of course, is consistent with the fact that organisms in the Atlantic produce a lot of CaCO3. Comparison with other areas with especially low values of Alk* (Red Sea and northern Arabian Sea) shows that the production of CaCO3 is highly correlated across the ocean with the surface salinity. Hence, we argue that organisms in the Atlantic produce a lot of CaCO3 simply because the Atlantic is so salty. Salty waters, by definition, have more CO3= ions, which increase the supersaturation with respect to calcite and aragonite. This finding, while extremely simple, has major implifications for the impact of ocean acidification on calcifying organisms.
Protein (Viridiplantae): 203761 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 017 ... 38832:3226 ... 38833:3539 ... 564608:3539 predicted protein Micromonas pusilla CCMP1545 MHPPLTLENHPLCKDVVIALKRCHRDNPWARAWGACNEQKWALDDCLKKQKLFKFRANHAKAKAQQDRLRRRVEKYGHATTNGQFKG
Atlantic Marine Mammal Assessment Vessel Surveys
National Oceanic and Atmospheric Administration, Department of Commerce — These data sets are a compilation of large vessel surveys for marine mammal stock assessments in South Atlantic (Florida to Maryland) waters from 1994 to the...
Energy Technology Data Exchange (ETDEWEB)
Baratozzi, L.; Cagnoli, P.; Filippi, N.; Gherardi, L.; Montaletti, V.; Poli, G.; Scarelli, M. [Regione Emilia-Romagna, Assessorato Territorio, Programmazione e Ambiente, Servizio Paesaggio, Parchi e Patrimonio Naturale, Bologna (Italy); Basili, M.; Battista, A.; Colonna, N.; Del Ciello, R.; Forni, A.; Olivetti, I.; Regina, P.; Zarlenga, F. [ENEA, Divisione Caratterizzazione dell' Ambiente e del Territorio, Centro Ricerche della Casaccia, Rome (Italy)
2001-07-01
The Atlante Project applied in Emilia-Romagna region, has the objective in management of transformations in landscape, evaluating the sustainability of choice of programming. [Italian] Il progetto Atlante, si e' posto l'obiettivo di verificare la validita' delle Unita' di Paesaggio, come riferimento per una gestione delle trasformazioni del territorio, che permetta di anticipare la valutazione della sostenibilita' delle scelte della programmazione superando l'attuale prassi di verifica amministrativa a posteriori, che l'esperienza degli ultimi anni ha dimostrato non essere efficace.
The Seabed and Shallow Geology Mapping of the Porcupine Bank, West of Ireland
Thébaudeau, B.; Monteys, X.; McCarron, S. G.
2016-02-01
The "Porcupine Bank" is a bathymetric high of over 40,000 km2 linked to the western shelf of Ireland which lies between 51-54° N and 11-15° W approximately 100 km west of Ireland. Water depths are as shallow as 145 m over the "Porcupine Ridge". The Bank's location on the north eastern fringe of the Atlantic Ocean, in a critical position between the shelf edge and the main land and along the line of the Polar Front, means it may contain significant indications of glacial/interglacial changes in northern hemisphere climate and in North Atlantic Ocean circulation. But it also means that it consists of strategically important marine environments with very likely future developmental pressures. Peer-reviewed publications on the geology of the Bank are very limited and this current state of knowledge will hamper any marine ecosystem research and protection. This paper will describe the first results of a research project aiming at filling the gap of our understanding of the region's shallow geology and subseabed resources and characteristics. As a first step, seabed geomorphology mapping using high resolution MBES and sub bottom data have highlighted a wealth of glacially derived features such as iceberg scours and elongated ridges whose formation could be directly influenced by the presence of ice on or nearby the bank. Other features interpreted as sand waves could help understand relict or modern currents. In addition to these surface features, this paper introduces recent geological mapping of the shallow stratigraphy of the bank using 2D seismic and sub bottom profiler data collected at a high density correlated with recently collected vibro-cores. The seismic units and corresponding lithofacies (some with radiocarbon dates) are consistently described and a regional correlation built.
2010-01-13
... Management Councils, in conjunction with NOAA Fisheries and the Atlantic and Gulf States Marine Fisheries... researchers; constituency representatives including fishermen, environmentalists, and NGO's; international... Conservation and Management Act, provided the public has been notified of the Council's intent to take final...
The impact of the subtropical South Atlantic SST on South American precipitation
Directory of Open Access Journals (Sweden)
A. S. Taschetto
2008-11-01
Full Text Available The Community Climate Model (CCM3 from the National Center for Atmospheric Research (NCAR is used to investigate the effect of the South Atlantic sea surface temperature (SST anomalies on interannual to decadal variability of South American precipitation. Two ensembles composed of multidecadal simulations forced with monthly SST data from the Hadley Centre for the period 1949 to 2001 are analysed.
A statistical treatment based on signal-to-noise ratio and Empirical Orthogonal Functions (EOF is applied to the ensembles in order to reduce the internal variability among the integrations. The ensemble treatment shows a spatial and temporal dependence of reproducibility. High degree of reproducibility is found in the tropics while the extratropics is apparently less reproducible. Austral autumn (MAM and spring (SON precipitation appears to be more reproducible over the South America-South Atlantic region than the summer (DJF and winter (JJA rainfall. While the Inter-tropical Convergence Zone (ITCZ region is dominated by external variance, the South Atlantic Convergence Zone (SACZ over South America is predominantly determined by internal variance, which makes it a difficult phenomenon to predict. Alternatively, the SACZ over western South Atlantic appears to be more sensitive to the subtropical SST anomalies than over the continent.
An attempt is made to separate the atmospheric response forced by the South Atlantic SST anomalies from that associated with the El Niño – Southern Oscillation (ENSO. Results show that both the South Atlantic and Pacific SSTs modulate the intensity and position of the SACZ during DJF. Particularly, the subtropical South Atlantic SSTs are more important than ENSO in determining the position of the SACZ over the southeast Brazilian coast during DJF. On the other hand, the ENSO signal seems to influence the intensity of the SACZ not only in DJF but especially its oceanic branch during MAM. Both local and
Atlantic Surfclam and Ocean Quahog Survey
National Oceanic and Atmospheric Administration, Department of Commerce — The standardized NEFSC Atlantic Surfclam and Ocean Quahog Survey has covered an area from Cape Hatteras to Georges Bank. The survey was conducted every two or three...
Ols, Clémentine; Trouet, Valerie; Girardin, Martin P.; Hofgaard, Annika; Bergeron, Yves; Drobyshev, Igor
2018-06-01
The mid-20th century changes in North Atlantic Ocean dynamics, e.g. slow-down of the Atlantic meridional overturning thermohaline circulation (AMOC), have been considered as early signs of tipping points in the Earth climate system. We hypothesized that these changes have significantly altered boreal forest growth dynamics in northeastern North America (NA) and northern Europe (NE), two areas geographically adjacent to the North Atlantic Ocean. To test our hypothesis, we investigated tree growth responses to seasonal large-scale oceanic and atmospheric indices (the AMOC, North Atlantic Oscillation (NAO), and Arctic Oscillation (AO)) and climate (temperature and precipitation) from 1950 onwards, both at the regional and local levels. We developed a network of 6876 black spruce (NA) and 14437 Norway spruce (NE) tree-ring width series, extracted from forest inventory databases. Analyses revealed post-1980 shifts from insignificant to significant tree growth responses to summer oceanic and atmospheric dynamics both in NA (negative responses to NAO and AO indices) and NE (positive response to NAO and AMOC indices). The strength and sign of these responses varied, however, through space with stronger responses in western and central boreal Quebec and in central and northern boreal Sweden, and across scales with stronger responses at the regional level than at the local level. Emerging post-1980 associations with North Atlantic Ocean dynamics synchronized with stronger tree growth responses to local seasonal climate, particularly to winter temperatures. Our results suggest that ongoing and future anomalies in oceanic and atmospheric dynamics may impact forest growth and carbon sequestration to a greater extent than previously thought. Cross-scale differences in responses to North Atlantic Ocean dynamics highlight complex interplays in the effects of local climate and ocean-atmosphere dynamics on tree growth processes and advocate for the use of different spatial scales in
Directory of Open Access Journals (Sweden)
Matthew T Balazik
Full Text Available Atlantic sturgeon (Acipenser oxyrinchus oxyrinchus, Acipenseridae populations are currently at severely depleted levels due to historic overfishing, habitat loss, and pollution. The importance of biologically correct stock structure for effective conservation and management efforts is well known. Recent improvements in our understanding of Atlantic sturgeon migrations, movement, and the occurrence of putative dual spawning groups leads to questions regarding the true stock structure of this endangered species. In the James River, VA specifically, captures of spawning Atlantic sturgeon and accompanying telemetry data suggest there are two discrete spawning groups of Atlantic sturgeon. The two putative spawning groups were genetically evaluated using a powerful microsatellite marker suite to determine if they are genetically distinct. Specifically, this study evaluates the genetic structure, characterizes the genetic diversity, estimates effective population size, and measures inbreeding of Atlantic sturgeon in the James River. The results indicate that fall and spring spawning James River Atlantic sturgeon groups are genetically distinct (overall FST = 0.048, F'ST = 0.181 with little admixture between the groups. The observed levels of genetic diversity and effective population sizes along with the lack of detected inbreeding all indicated that the James River has two genetically healthy populations of Atlantic sturgeon. The study also demonstrates that samples from adult Atlantic sturgeon, with proper sample selection criteria, can be informative when creating reference population databases. The presence of two genetically-distinct spawning groups of Atlantic sturgeon within the James River raises concerns about the current genetic assignment used by managers. Other nearby rivers may also have dual spawning groups that either are not accounted for or are pooled in reference databases. Our results represent the second documentation of genetically
Towards a governance agenda for the emerging Atlantic Hemisphere
Directory of Open Access Journals (Sweden)
Daniel S. Hamilton
2013-09-01
Full Text Available The Atlantic Basin is re-emerging as an important subsystem within the global political economy: inter-linked flows of people and energy, money and weapons,goods and services, technology and terror,drugs and crime; greater access to each other’s markets, resources, and talent. Yet,growing interdependencies gene-rate new vulnerabilities and challenges: cooperation over resources and energy connections; promotion of trade and investment; migration and integration; building resilient societies; enhancement of good governance; investment in human development; and the fight against transnational criminal organisations and their growing links to terrorists and insurgents. However, while governance mechanisms and diplomatic cooperation based on a pan-Atlantic framework are in their infancy, a host of developments suggests that broadranging, interwoven hemispheric cooperation may be possible. In fact, the Atlantic Basin may emerge as a global laboratory for interregional, networked governance between developed and emerging countries.
Population Structure of West Greenland Narwhals
DEFF Research Database (Denmark)
Riget, F.; Dietz, R.; Møller, P.
The hypothesis that different populations of narwhals in the West Greenland area exist has been tested by different biomarkers (metal and organochlorine concentrations, stable isotopes and DNA). Samples of muscle, liver, kidney, blubber and skin tissues of narwhals from West Greenland have been...... isotopes could not support the population structure with two West Greenland populations suggested by the genetic study....
International Nuclear Information System (INIS)
Montie, Eric W.; Reddy, Christopher M.; Gebbink, Wouter A.; Touhey, Katie E.; Hahn, Mark E.; Letcher, Robert J.
2009-01-01
Concentrations of several congeners and classes of organohalogen contaminants (OHCs) and/or their metabolites, namely organochlorine pesticides (OCs), polychlorinated biphenyls (PCBs), hydroxylated-PCBs (OH-PCBs), methylsulfonyl-PCBs (MeSO 2 -PCBs), polybrominated diphenyl ether (PBDE) flame retardants, and OH-PBDEs, were measured in cerebrospinal fluid (CSF) of short-beaked common dolphins (n = 2), Atlantic white-sided dolphins (n = 8), and gray seal (n = 1) from the western North Atlantic. In three Atlantic white-sided dolphins, cerebellum gray matter (GM) was also analyzed. The levels of OCs, PCBs, MeSO 2 -PCBs, PBDEs, and OH-PBDEs in cerebellum GM were higher than the concentrations in CSF. 4-OH-2,3,3',4',5-pentachlorobiphenyl (4-OH-CB107) was the only detectable OH-PCB congener present in CSF. The sum (Σ) OH-PCBs/Σ PCB concentration ratio in CSF was approximately two to three orders of magnitude greater than the ratio in cerebellum GM for dolphins. - Organohalogens and/or metabolites in cerebrospinal fluid and cerebellum gray matter in short-beaked common dolphins, Atlantic white-sided dolphins, and gray seal.
75 FR 61094 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway, Beaufort, SC
2010-10-04
.... Highway 21, Sea Island Parkway Bridge at mile marker 536 over the Beaufort River (Atlantic Intracoastal... Bridge, which is across the Atlantic Intracoastal Waterway at mile 539.0 in Port Royal, South Carolina... Bridge, across the Beaufort River, Mile 536.0 at Beaufort. The draw shall operate as follows: (1) On...
Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP
Arts, G.H.P.
2002-01-01
This review presents an overview of the most important succession patterns and underlying processes associated with the deterioration of soft water macrophyte communities in atlantic and boreo-atlantic regions. As acidification, eutrophication and alkalinisation are the dominant processes, this
2010-03-08
... recreational landings for the 2010 fishing year by using simple linear regression of the recent (2001-2008... specifications document, including the Environmental Assessment and Initial Regulatory Flexibility Analysis (EA...-Atlantic RSA Program was published on January 2, 2009 (74 FR 72). For analysis of impacts for each TAL...
2013-10-22
... Essential Fish Habitat Policy Statements and receive training on the use of the Regional Habitat and... meeting of the South Atlantic Fishery Management Council's Habitat and Environmental Protection (Habitat... of its Habitat AP in St. Petersburg, FL. The meeting is open to the public. DATES: The meeting will...
2013-04-18
... Agenda, Tuesday, May 7, 2013, 8:30 a.m. until 4:30 p.m. 1. Review draft Essential Fish Habitat (EFH... of the South Atlantic Fishery Management Council's Habitat & Environmental Protection Advisory Panel (AP); Coral AP; Joint Meeting of the Habitat & Environmental Protection AP and Coral AP; and Deepwater...
2010-10-22
... five-year Essential Fish Habitat review, the Governor's South Atlantic Alliance Action Plan, a status... its Habitat and Environmental Protection (Habitat) Advisory Panel in North Charleston, SC. DATES: [email protected] . SUPPLEMENTARY INFORMATION: Members of the Habitat Advisory Panel will meet from 9 a.m.-5 p.m...
Role of tropical Indian and Atlantic Oceans variability on ENSO
Prodhomme, Chloé; Terray, Pascal; Masson, Sebastien; Boschat, Ghyslaine
2014-05-01
There are strong evidences of an interaction between tropical Indian, Atlantic and Pacific Oceans. Nevertheless, these interactions remain deeply controversial. While some authors claim the tropical Indian and Atlantic oceans only play a passive role with respect to ENSO, others suggest a driving role for these two basins on ENSO. The mecanisms underlying these relations are not fully understood and, in the Indian Ocean, the possible role of both modes of tropical variability (the Indian Ocean Dipole (IOD) and the Indian Ocean Basin mode (IOB)) remain unclear. To better quantify and understand how the variability of the tropical Indian and Atlantic Oceans impact ENSO variability, we performed two sensitivity experiments using the SINTEX-F2 coupled model. For each experiment, we suppressed the variability of SST and the air-sea coupling in either the tropical Indian Ocean or tropical Atlantic Ocean by applying a strong nudging of the SST to the observed SST climatology. In both experiments, the ENSO periodicity increases. In the Atlantic experiment, our understanding of this increased periodicity is drastically limited by the strongly biased mean state in this region. Conversely, in the Indian Ocean experiment, the increase of ENSO periodicity is related to the absence of the IOB following the El Niño peak, which leads to a decrease of westerly winds in the western Pacific during late winter and spring after the peak. These weaker westerlies hinders the transition to a La Niña phase and thus increase the duration and periodicity of the event.
Stahlman, Shauna; Grosso, Ashley; Ketende, Sosthenes; Pitche, Vincent; Kouanda, Seni; Ceesay, Nuha; Ouedraogo, Henri G; Ky-Zerbo, Odette; Lougue, Marcel; Diouf, Daouda; Anato, Simplice; Tchalla, Jules; Baral, Stefan
2016-09-01
Suicidal ideation is understudied among men who have sex with men (MSM) across Sub-Saharan Africa. This study aimed to explore social capital and sexual behavior stigma associated with suicidal ideation among MSM in the West African nations of The Gambia, Burkina Faso and Togo. Participants were recruited using respondent-driven sampling and snowball sampling across multiple cities (n = 1555) from July 2011 to August 2013. During a single study visit, participants completed a survey. Logistic regression models were used to assess bivariate and multivariable associations with suicidal ideation. The prevalence of lifetime suicidal ideation was 13% overall and ranged 6%-17% across study sites. After adjusting for potential confounders, MSM who reported stigma as a result of having sex with men were more likely to report suicidal ideation. Physical and sexual violence was strongly associated with suicidal ideation, including being physically harmed (adjusted odds ratio (aOR) = 2.94, 95% confidence interval (CI) = 1.91, 4.52), tortured (aOR = 3.86, 95% CI = 2.17, 6.86) and raped (aOR = 3.07, 95% CI = 2.05, 4.60). In contrast, increasing social participation with the broader community was associated with decreased report of suicidal ideation (aOR = 0.91, 95% CI = 0.85, 0.99). Sexual behavior stigma should be addressed to improve mental health among MSM in Western Sub-Saharan Africa. © The Author(s) 2016.
Directory of Open Access Journals (Sweden)
Brad L Smith
Full Text Available Previous genetic studies of Atlantic swordfish (Xiphias gladius L. revealed significant differentiation among Mediterranean, North Atlantic and South Atlantic populations using both mitochondrial and nuclear DNA data. However, limitations in geographic sampling coverage, and the use of single loci, precluded an accurate placement of boundaries and of estimates of admixture. In this study, we present multilocus analyses of 26 single nucleotide polymorphisms (SNPs within 10 nuclear genes to estimate population differentiation and admixture based on the characterization of 774 individuals representing North Atlantic, South Atlantic, and Mediterranean swordfish populations. Pairwise FST values, AMOVA, PCoA, and Bayesian individual assignments support the differentiation of swordfish inhabiting these three basins, but not the current placement of the boundaries that separate them. Specifically, the range of the South Atlantic population extends beyond 5°N management boundary to 20°N-25°N from 45°W. Likewise the Mediterranean population extends beyond the current management boundary at the Strait of Gibraltar to approximately 10°W. Further, admixture zones, characterized by asymmetric contributions of adjacent populations within samples, are confined to the Northeast Atlantic. While South Atlantic and Mediterranean migrants were identified within these Northeast Atlantic admixture zones no North Atlantic migrants were identified respectively in these two neighboring basins. Owing to both, the characterization of larger number of loci and a more ample spatial sampling coverage, it was possible to provide a finer resolution of the boundaries separating Atlantic swordfish populations than previous studies. Finally, the patterns of population structure and admixture are discussed in the light of the reproductive biology, the known patterns of dispersal, and oceanographic features that may act as barriers to gene flow to Atlantic swordfish.
D'Arrigo, Rosanne; Anchukaitis, Kevin J.; Buckley, Brendan; Cook, Ed; Wilson, Rob
2012-03-01
We describe a millennial length (~ 1500-yr) tree-ring chronology developed from West Virginia (WVA), USA red cedar (Juniperus virginiana) ring widths that is significantly correlated with local to regional temperature and precipitation for the region. Using ensemble methods of tree-ring standardization, above average ring widths are indicated for the period between ~ 1000 and 1300 CE, the approximate time of the Medieval Climate Anomaly (MCA), the most recent major warm episode prior to the modern era. The chronology then transitions to more negative overall growth persisting through much of the subsequent period known as the Little Ice Age (LIA). While WVA cedar growth levels during the MCA are broadly similar to the 20th century mean, the most positive values during the MCA are associated with RCS-standardized chronologies, which pseudoproxy tests reveal are likely biased artificially positive, warranting further investigation. This cedar record is significantly correlated with the NAO, due to the tendency for warmer, wetter conditions to occur in the eastern-central USA during the NAO's positive phase. These types of conditions are inferred for this cedar chronology during the MCA period, during which NAO reconstructions suggest a persistently-positive NAO state.
ATLANTIC BATS: a data set of bat communities from the Atlantic Forests of South America.
Muylaert, Renata D L; Stevens, Richard D; Esbérard, Carlos E L; Mello, Marco A R; Garbino, Guilherme S T; Varzinczak, Luiz H; Faria, Deborah; Weber, Marcelo D M; Kerches Rogeri, Patricia; Regolin, André L; Oliveira, Hernani F M D; Costa, Luciana D M; Barros, Marília A S; Sabino-Santos, Gilberto; Crepaldi de Morais, Mara Ariane; Kavagutti, Vinicius S; Passos, Fernando C; Marjakangas, Emma-Liina; Maia, Felipe G M; Ribeiro, Milton C; Galetti, Mauro
2017-12-01
Bats are the second most diverse mammal order and they provide vital ecosystem functions (e.g., pollination, seed dispersal, and nutrient flux in caves) and services (e.g., crop pest suppression). Bats are also important vectors of infectious diseases, harboring more than 100 different virus types. In the present study, we compiled information on bat communities from the Atlantic Forests of South America, a species-rich biome that is highly threatened by habitat loss and fragmentation. The ATLANTIC BATS data set comprises 135 quantitative studies carried out in 205 sites, which cover most vegetation types of the tropical and subtropical Atlantic Forest: dense ombrophilous forest, mixed ombrophilous forest, semideciduous forest, deciduous forest, savanna, steppe, and open ombrophilous forest. The data set includes information on more than 90,000 captures of 98 bat species of eight families. Species richness averaged 12.1 per site, with a median value of 10 species (ranging from 1 to 53 species). Six species occurred in more than 50% of the communities: Artibeus lituratus, Carollia perspicillata, Sturnira lilium, Artibeus fimbriatus, Glossophaga soricina, and Platyrrhinus lineatus. The number of captures divided by sampling effort, a proxy for abundance, varied from 0.000001 to 0.77 individuals·h -1 ·m -2 (0.04 ± 0.007 individuals·h -1 ·m -2 ). Our data set reveals a hyper-dominance of eight species that together that comprise 80% of all captures: Platyrrhinus lineatus (2.3%), Molossus molossus (2.8%), Artibeus obscurus (3.4%), Artibeus planirostris (5.2%), Artibeus fimbriatus (7%), Sturnira lilium (14.5%), Carollia perspicillata (15.6%), and Artibeus lituratus (29.2%). © 2017 by the Ecological Society of America.
Directory of Open Access Journals (Sweden)
Fiona Lees
Full Text Available BACKGROUND: Infestations of the parasitic copepod Lepeophtheirus salmonis, commonly referred to as sea lice, represent a major challenge to commercial salmon aquaculture. Dependence on a limited number of theraputants to control such infestations has led to concerns of reduced sensitivity in some sea lice populations. This study investigates trends in the efficacy of the in-feed treatment emamectin benzoate in Scotland, the active ingredient most widely used across all salmon producing regions. METHODOLOGY/PRINCIPAL FINDINGS: Study data were drawn from over 50 commercial Atlantic salmon farms on the west coast of Scotland between 2002 and 2006. An epi-informatics approach was adopted whereby available farm records, descriptive epidemiological summaries and statistical linear modelling methods were used to identify factors that significantly affect sea lice abundance following treatment with emamectin benzoate (SLICE(R, Schering Plough Animal Health. The results show that although sea lice infestations are reduced following the application of emamectin benzoate, not all treatments are effective. Specifically there is evidence of variation across geographical regions and a reduction in efficacy over time. CONCLUSIONS/SIGNIFICANCE: Reduced sensitivity and potential resistance to currently available medicines are constant threats to maintaining control of sea lice populations on Atlantic salmon farms. There is a need for on-going monitoring of emamectin benzoate treatment efficacy together with reasons for any apparent reduction in performance. In addition, strategic rotation of medicines should be encouraged and empirical evidence for the benefit of such strategies more fully evaluated.
Lees, Fiona; Baillie, Mark; Gettinby, George; Revie, Crawford W
2008-02-06
Infestations of the parasitic copepod Lepeophtheirus salmonis, commonly referred to as sea lice, represent a major challenge to commercial salmon aquaculture. Dependence on a limited number of theraputants to control such infestations has led to concerns of reduced sensitivity in some sea lice populations. This study investigates trends in the efficacy of the in-feed treatment emamectin benzoate in Scotland, the active ingredient most widely used across all salmon producing regions. Study data were drawn from over 50 commercial Atlantic salmon farms on the west coast of Scotland between 2002 and 2006. An epi-informatics approach was adopted whereby available farm records, descriptive epidemiological summaries and statistical linear modelling methods were used to identify factors that significantly affect sea lice abundance following treatment with emamectin benzoate (SLICE(R), Schering Plough Animal Health). The results show that although sea lice infestations are reduced following the application of emamectin benzoate, not all treatments are effective. Specifically there is evidence of variation across geographical regions and a reduction in efficacy over time. Reduced sensitivity and potential resistance to currently available medicines are constant threats to maintaining control of sea lice populations on Atlantic salmon farms. There is a need for on-going monitoring of emamectin benzoate treatment efficacy together with reasons for any apparent reduction in performance. In addition, strategic rotation of medicines should be encouraged and empirical evidence for the benefit of such strategies more fully evaluated.