Directory of Open Access Journals (Sweden)
Nora Helena Londoño A.
2010-07-01
Full Text Available Se construyó un cuestionario para evaluar creencias centrales asociadas con los trastornos de la personalidad, fundamentadas en el Modelo de la Terapia Cognitiva. Se realizó el análisis estructural y la validez de contenido de la prueba en población universitaria de la ciudad de Medellín, Colombia. La muestra fue representativa y elegida al azar a través de un procedimiento polietápico. Un número de 809 estudiantes universitarios contestaron el cuestionario de creencias centrales de los trastornos de la personalidad (CCE-TP. Se realizó un análisis factorial exploratorio de la prueba, reagrupándose los ítems en 14 factores (F que representan el 61,3% de la varianza. F1: CCE-TP antisocial (8 ítems, a 0,839; F2: CCE-TP esquizotípico/límite (8 ítems, a 0,846; F3: CCE-TP histriónico/patrón seductor (6 ítems, a 0,833; F4: CCE-TP paranoide (6 ítems, a 0,836; F5: CCE-TP por evitación / autopercepción negativa (5 ítems, a 0,755; F6: CCE-TP por dependencia (5 ítems, a 0,797; F7: CCE-TP histriónico/ dependencia emocional (4 ítems, a 0,755; F8: CCETP obsesivo-compulsivo/perfeccionista (4 ítems, a 0,808; F9: CCE-TP por evitación/hipersensible (4 ítems, a 0,766; F10: CCE-TP obsesivo-compulsivo/ crítico frente a los demás (3 ítems, a 0,851; F11: CCE-TP narcisista (4 ítems, a 0,717; F12: CCE-TP pasivo-agresivo / temor a ser dominado (3 ítems, a 0,719; F13: CCE-TP pasivo-agresivo/crítico frente a la autoridad (3 ítems, a 0,685, y F14: CCE-TP esquizoide (2 ítems, a 0,774. El alfa de Cronbach de la prueba fue de 0,931.
Directory of Open Access Journals (Sweden)
Diego Castrillón M.
2007-06-01
Full Text Available Se construyó un cuestionario para evaluar creencias centrales asociadas con los trastornos de la personalidad, fundamentadas en el Modelo de la Terapia Cognitiva. Se realizó el análisis estructural y la validez de contenido de la prueba en población universitaria de la ciudad de Medellín, Colombia. La muestra fue representativa y elegida al azar a través de un procedimiento polietápico. Un número de 809 estudiantes universitarios contestaron el cuestionario de creencias centrales de los trastornos de la personalidad (CCE-TP. Se realizó un análisis factorial exploratorio de la prueba, reagrupándose los ítems en 14 factores (F que representan el 61,3% de la varianza. F1: CCE-TP antisocial (8 ítems, a 0,839; F2: CCE-TP esquizotípico/límite (8 ítems, a 0,846; F3: CCE-TP histriónico/patrón seductor (6 ítems, a 0,833; F4: CCE-TP paranoide (6 ítems, a 0,836; F5: CCE-TP por evitación / autopercepción negativa (5 ítems, a 0,755; F6: CCE-TP por dependencia (5 ítems, a 0,797; F7: CCE-TP histriónico/dependencia emocional (4 ítems, a 0,755; F8: CCETP obsesivo-compulsivo/perfeccionista (4 ítems, a 0,808; F9: CCE-TP por evitación/hipersensible (4 ítems, a 0,766; F10: CCE-TP obsesivo-compulsivo/ crítico frente a los demás (3 ítems, a 0,851; F11: CCE-TP narcisista (4 ítems, a 0,717; F12: CCE-TP pasivo-agresivo / temor a ser dominado (3 ítems, a 0,719; F13: CCE-TP pasivo-agresivo/crítico frente a la autoridad (3 ítems, a 0,685, y F14: CCE-TP esquizoide (2 ítems, a 0,774. El alfa de Cronbach de la prueba fue de 0,931.
Consequence-driven cyber-informed engineering (CCE)
Energy Technology Data Exchange (ETDEWEB)
Freeman, Sarah G. [Idaho National Lab. (INL), Idaho Falls, ID (United States); St Michel, Curtis [Idaho National Lab. (INL), Idaho Falls, ID (United States); Smith, Robert [Idaho National Lab. (INL), Idaho Falls, ID (United States); Assante, Michael [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-10-18
The Idaho National Lab (INL) is leading a high-impact, national security-level initiative to reprioritize the way the nation looks at high-consequence risk within the industrial control systems (ICS) environment of the country’s most critical infrastructure and other national assets. The Consequence-driven Cyber-informed Engineering (CCE) effort provides both private and public organizations with the steps required to examine their own environments for high-impact events/risks; identify implementation of key devices and components that facilitate that risk; illuminate specific, plausible cyber attack paths to manipulate these devices; and develop concrete mitigations, protections, and tripwires to address the high-consequence risk. The ultimate goal of the CCE effort is to help organizations take the steps necessary to thwart cyber attacks from even top-tier, highly resourced adversaries that would result in a catastrophic physical effect. CCE participants are encouraged to work collaboratively with each other and with key U.S. Government (USG) contributors to establish a coalition, maximizing the positive effect of lessons-learned and further contributing to the protection of critical infrastructure and other national assets.
European critical loads: database, biodiversity and ecosystems at risk : CCE Final Report 2017
Hettelingh JP; Posch M; Slootweg J; M&E; DMG
2017-01-01
With this Final Report 2017 the Coordination Centre for Effects (CCE) located at the National Institute for Public Health and the Environment (RIVM, Bilthoven, the Netherlands) is concluding its work. In 1990, tasks of the CCE were offered by the Netherlands to the Convention on Long-range
CCE measurements and annealing studies on proton-irradiated p-type MCz silicon diodes
Hoedlmoser, H; Köhler, M; Nordlund, H
2007-01-01
Magnetic Czochralski (MCz) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of p-type MCz Silicon diodes irradiated with protons up to a fluence of has been performed by means of Charge Collection Efficiency (CCE) measurements as well as standard CV/IV characterizations. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. A subsequent annealing study of the irradiated detectors shows an increase in effective doping concentration and a decrease in the leakage current, whereas the CCE remains basically unchanged. Two different series of detectors have been compared differing in the implantation dose of p-spray isolation as well as effective doping concentration (Neff) of the p-type bulk presumably due to a difference in thermal donor (TD) activation during processing. The series with the higher concentration of TDs shows a delayed reverse annealing of Neff after irradia...
International Nuclear Information System (INIS)
Shelley, E.G.; Klumpar, D.M.; Peterson, W.K.; Ghielmetti, A.; Balsiger, H.; Geiss, J.; Rosenbauer, H.; Bern Universitaet, Switzerland; Max-Planck-Institut fuer Aeronomie, Katlenburg, West Germany)
1985-01-01
Observations from the Hot Plasma Composition Experiment on the AMPTE/CCE spacecraft during the magnetic storm of 4-5 September 1984 reveal that significant injection of ions of terrestrial origin accompanied the storm development. The compression of the magnetosphere at storm sudden commencement carried the magnetopause inside the CCE orbit clearly revealing the shocked solar wind plasma. A build up of suprathermal ions is observed near the plasmapause during the storm main phase and recovery phase. Pitch angle distributions in the ring current during the main phase show differences between H(+) and O(+) that suggest mass dependent injection, transport and/or loss processes. 9 references
An eastward propagating compressional Pc 5 wave observed by AMPTE/CCE in the postmidnight sector
International Nuclear Information System (INIS)
Takahashi, K.; McEntire, R.W.; Zanetti, L.J.; Lopez, R.E.; Kistler, L.M.; Ipavich, R.M.
1987-01-01
Data from three instruments, the magnetometer, the charge-energy-mass spectrometer, and the medium-energy particle analyzer onboard the Active Magnetospheric Particle Tracer Explorers/Charge Composition Explorer (CCE) spacecraft have been used to study a compressional Pc 5 wave observed at 1925-2200 UT on day 202 (July 21) of 1986 at a radial distance of ≅ 8 R E in the postmidnight sector near the beginning of minor geomagnetic activity. The wave exhibited harmonically related transverse and compressional magnetic oscillations, modulation of the flux of medium energy protons (E approx-gt 10 keV), and a large azimuthal wave number (m ∼ 65). These properties are similar to those of compressional Pc 5 waves observed previously at geostationary orbit. The unique observations associated with the CCE event are the occurrence in the postmidnight sector, the eastward (or sunward) propagation with respect to the spacecraft, and the left-handed polarization of the perturbed magnetic field. These are opposite to previous geostationary observations. The authors propose that the unique propagation and polarization are propagating westward in the plasma rest frame, appears to propagate eastward to the observer because the electric field drift velocity is larger than the wave phase velocity
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144245 includes chemical, meteorological, physical and time series data collected from MOORING CCE1_122W_33N and MOORING_CCE1_122W_33N in the North...
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0084099 includes chemical, meteorological, physical and time series data collected from MOORING CCE2_121W_34N and MOORING_CCE2_121W_34N in the North...
Energy Technology Data Exchange (ETDEWEB)
Taguchi, J.; Kuriyama, K. (Kyoto Prefectural Univ. of Medicine (Japan))
1990-05-01
Effect of ethyl beta-carboline-3-carboxylate (beta-CCE) on the function of gamma-aminobutyric acid (GABA)A receptor/benzodiazepine receptor/chloride ion channel complex was studied. Beta-CCE noncompetitively and competitively inhibited (3H)flunitrazepam binding to benzodiazepine receptor, but not (3H)muscimol binding to GABAA receptor as well as t-(3H)butylbicycloorthobenzoate (( 3H) TBOB) binding to chloride ion channel, in particulate fraction of the mouse brain. Ro15-1788 also inhibited competitively (3H) flunitrazepam binding. On the other hand, the binding of beta-(3H)CCE was inhibited noncompetitively and competitively by clonazepam and competitively by Ro15-1788. In agreement with these results, benzodiazepines-stimulated (3H)muscimol binding was antagonized by beta-CCE and Ro15-1788. Gel column chromatography for the solubilized fraction from cerebral particulate fraction by 0.2% sodium deoxycholate (DOC-Na) in the presence of 1 M KCl indicated that beta-(3H)CCE binding site was eluted in the same fraction (molecular weight, 250,000) as the binding sites for (3H)flunitrazepam, (3H)muscimol and (3H)TBOB. GABA-stimulated 36Cl- influx into membrane vesicles prepared from the bovine cerebral cortex was stimulated and attenuated by flunitrazepam and beta-CCE, respectively. These effects of flunitrazepam and beta-CCE on the GABA-stimulated 36Cl- influx were antagonized by Ro15-1788. The present results suggest that the binding site for beta-CCE, which resides on GABAA receptor/benzodiazepine receptor/chloride ion channel complex, may be different from that for benzodiazepine. Possible roles of beta-CCE binding site in the allosteric inhibitions on benzodiazepine binding site as well as on the functional coupling between chloride ion channel and GABAA receptor are also suggested.
Directory of Open Access Journals (Sweden)
Remes-Troche JM
2013-09-01
Full Text Available José María Remes-Troche,1 Victoria Alejandra Jiménez-García,2 Josefa María García-Montes,2 Pedro Hergueta-Delgado,2 Federico Roesch-Dietlen,1 Juan Manuel Herrerías-Gutiérrez2 1Digestive Physiology and Motility Lab, Medical Biological Research Institute, Universidad Veracruzana, Veracruz, México; 2Gastroenterology Service, Virgen Macarena University Hospital, Seville, Spain Background and study aims: Colon capsule endoscopy (CCE was developed for the evaluation of colorectal pathology. In this study, our aim was to assess if a dual-camera analysis using CCE allows better evaluation of the whole gastrointestinal (GI tract compared to a single-camera analysis. Patients and methods: We included 21 patients (12 males, mean age 56.20 years submitted for a CCE examination. After standard colon preparation, the colon capsule endoscope (PillCam Colon™ was swallowed after reinitiation from its “sleep” mode. Four physicians performed the analysis: two reviewed both video streams at the same time (dual-camera analysis; one analyzed images from one side of the device (“camera 1”; and the other reviewed the opposite side (“camera 2”. We compared numbers of findings from different parts of the entire GI tract and level of agreement among reviewers. Results: A complete evaluation of the GI tract was possible in all patients. Dual-camera analysis provided 16% and 5% more findings compared to camera 1 and camera 2 analysis, respectively. Overall agreement was 62.7% (kappa = 0.44, 95% CI: 0.373–0.510. Esophageal (kappa = 0.611 and colorectal (kappa = 0.595 findings had a good level of agreement, while small bowel (kappa = 0.405 showed moderate agreement. Conclusion: The use of dual-camera analysis with CCE for the evaluation of the GI tract is feasible and detects more abnormalities when compared with single-camera analysis. Keywords: capsule endoscopy, colon, gastrointestinal tract, small bowel
Fairfield, D. H.; Acuna, M. H.; Zanetti, L. J.; Potemra, T. A.
1987-01-01
The MPTE/CCE magnetic field experiment has been used to obtain a quantitative evaluation of the frequency and extent of magnetic field distortion in the near-tail region at less than 8.8 earth radii. The variation of this distortion with Kp, radial distance, longitude, and near-equatorial latitude is reported. It has been found that taillike distortions from the dipole field direction may reach 80 deg near the MPTE/CE apogee of 8.8 earth radii. The Bz field component in dipole coordinates was always positive within 0.5 earth radii of the equatorial current sheet, indicating the neutral lines were never seen inside of 8.8 earth radii. Fields were most taillike near midnight and during times of high Kp. At 8.5 earth radii the equatorial field magnitude depressions were roughly half the dipole field strength of 51 nT. These depressions are larger at lesser distances, reaching -40 nT at 3.4 earth radii for Kp of 2- or less and -80 nT and Kp of 3+ and greater.
Diagnostic Role of Colon Capsule Endoscopy in Patients with Optimal Colon Cleaning
Directory of Open Access Journals (Sweden)
Ümit Akyüz
2016-01-01
Full Text Available Background. Colon capsule endoscopy (CCE is a diagnostic test with relatively rare usage. In this study, we aimed to evaluate both the optimal cleaning regimen for CCE and the diagnostic value of test in the study group. Methods. A total of 62 patients were enrolled in this study. In the first step, 3 different colon preparing regimens were given to 30 patients [Group A: 3 days of liquid diet, sodium phosphate (NaP (90 mL, and NaP enema; Group B: 3 days of liquid diet, 4 L of polyethylene glycol (PEG, and metoclopramide; Group C: 3 days of liquid diet, 4 L of PEG, NaP (45 mL, and bisacodyl after capsule ingestion] (10 patients in each group. The other consecutive 32 patients were cleaned with the best regimen which was NaP + PEG and CCE was performed. The results of CCE were controlled with colonoscopy in 28 patients. Results. Group C had the highest cleaning score, compared with the other groups (2.2±0.4 versus 2.7±0.4 versus 3.7±0.4, p value =0.000. The CCE findings were as follows in 28 patients who were also examined with colonoscopy: polyp (range: 5–10 mm in 6 patients, internal hemorrhoids in 3 patients, angiodysplasia in 1 patient, diverticula in 1 patient, and ulcerative colitis in 1 patient. The sensitivity, specificity, PPV, and NPV of CCE were 100%, 92%, 93%, and 100%, respectively. Conclusions. Low dosage NaP combined with PEG provides optimal bowel preparation for CCE. CCE appears to be a highly sensitive diagnostic modality for detecting colonic pathologies.
Testing and Development of a Shrouded Gas Turbine Engine in a Freejet Facility
National Research Council Canada - National Science Library
Garcia, Hector
2000-01-01
.... The combined cycle engine (CCE) could be incorporated into a variety of applications. The building of a new freejet facility and engine test rig at the Naval Postgraduate School enabled dynamic testing of the ongoing development of a turboramjet...
2011-01-01
NASA is interested in developing technology that leads to more routine, safe, and affordable access to space. Access to space using airbreathing propulsion systems has potential to meet these objectives based on Airbreathing Access to Space (AAS) system studies. To this end, the NASA Fundamental Aeronautics Program (FAP) Hypersonic Project is conducting fundamental research on a Turbine Based Combined Cycle (TBCC) propulsion system. The TBCC being studied considers a dual flow-path inlet system. One flow-path includes variable geometry to regulate airflow to a turbine engine cycle. The turbine cycle provides propulsion from take-off to supersonic flight. The second flow-path supports a dual-mode scramjet (DMSJ) cycle which would be initiated at supersonic speed to further accelerate the vehicle to hypersonic speed. For a TBCC propulsion system to accelerate a vehicle from supersonic to hypersonic speed, a critical enabling technology is the ability to safely and effectively transition from the turbine to the DMSJ-referred to as mode transition. To experimentally test methods of mode transition, a Combined Cycle Engine (CCE) Large-scale Inlet testbed was designed with two flow paths-a low speed flow-path sized for a turbine cycle and a high speed flow-path designed for a DMSJ. This testbed system is identified as the CCE Large-Scale Inlet for Mode Transition studies (CCE-LIMX). The test plan for the CCE-LIMX in the NASA Glenn Research Center (GRC) 10- by 10-ft Supersonic Wind Tunnel (10x10 SWT) is segmented into multiple phases. The first phase is a matrix of inlet characterization (IC) tests to evaluate the inlet performance and establish the mode transition schedule. The second phase is a matrix of dynamic system identification (SysID) experiments designed to support closed-loop control development at mode transition schedule operating points for the CCE-LIMX. The third phase includes a direct demonstration of controlled mode transition using a closed loop control
3D-black-blood 3T-MRI for the diagnosis of thoracic large vessel vasculitis: A feasibility study
Energy Technology Data Exchange (ETDEWEB)
Treitl, Karla Maria; Saam, Tobias [Institute for Clinical Radiology, LMU Munich, Munich (Germany); German Center for Cardiovascular Disease Research (DZHK e.V.), Munich (Germany); Maurus, Stefan; Sommer, Nora Narvina; Coppenrath, Eva; Treitl, Marcus [Institute for Clinical Radiology, LMU Munich, Munich (Germany); Kooijman-Kurfuerst, Hendrik [Philips Healthcare, Hamburg (Germany); Czihal, Michael; Hoffmann, Ulrich [LMU Munich, Division of Vascular Medicine, Medical Clinic and Policlinic IV, Munich (Germany); Dechant, Claudia; Schulze-Koops, Hendrik [LMU Munich, Division of Rheumatology and Clinical Immunology, Medical Clinic and Policlinic IV, Munich (Germany)
2017-05-15
To evaluate the feasibility of T1w-3D black-blood turbo spin echo (TSE) sequence with variable flip angles for the diagnosis of thoracic large vessel vasculitis (LVV). Thirty-five patients with LVV, diagnosed according to the current standard of reference, and 35 controls were imaged at 3.0T using 1.2 x 1.3 x 2.0 mm{sup 3} fat-suppressed, T1w-3D, modified Volumetric Isotropic TSE Acquisition (mVISTA) pre- and post-contrast. Applying a navigator and peripheral pulse unit triggering (PPU), the total scan time was 10-12 min. Thoracic aorta and subclavian and pulmonary arteries were evaluated for image quality (IQ), flow artefact intensity, diagnostic confidence, concentric wall thickening and contrast enhancement (CWT, CCE) using a 4-point scale. IQ was good in all examinations (3.25 ± 0.72) and good to excellent in 342 of 408 evaluated segments (83.8 %), while 84.1 % showed no or minor flow artefacts. The interobserver reproducibility for the identification of CCE and CWT was 0.969 and 0.971 (p < 0.001) with an average diagnostic confidence of 3.47 ± 0.64. CCE and CWT were strongly correlated (Cohen's k = 0.87; P < 0.001) and significantly more frequent in the LVV-group (52.8 % vs. 1.0 %; 59.8 % vs. 2.4 %; P < 0.001). Navigated fat-suppressed T1w-3D black-blood MRI with PPU-triggering allows diagnosis of thoracic LVV. (orig.)
Saladin, Michael E; Gray, Kevin M; McRae-Clark, Aimee L; Larowe, Steven D; Yeatts, Sharon D; Baker, Nathaniel L; Hartwell, Karen J; Brady, Kathleen T
2013-04-01
This study examined the effects of propranolol vs. placebo, administered immediately after a "retrieval" session of cocaine cue exposure (CCE), on craving and physiological responses occurring 24 h later during a subsequent "test" session of CCE. It was hypothesized that compared to placebo-treated cocaine-dependent (CD) individuals, propranolol-treated CD individuals would evidence attenuated craving and physiological reactivity during the test session. Secondarily, it was expected that group differences identified in the test session would be evident at a 1-week follow-up CCE session. Exploratory analyses of treatment effects on cocaine use were also performed at follow-up. CD participants received either 40 mg propranolol or placebo immediately following a "retrieval" CCE session. The next day, participants received a "test" session of CCE that was identical to the "retrieval" session except no medication was administered. Participants underwent a "follow-up" CCE session 1 week later. Craving and other reactivity measures were obtained at multiple time points during the CCE sessions. Propranolol- vs. placebo-treated participants evidenced significantly greater attenuation of craving and cardiovascular reactivity during the test session. Analysis of the follow-up CCE session data did not reveal any group differences. Although there was no evidence of treatment effects on cocaine use during follow-up, this study was insufficiently powered to rigorously evaluate differential cocaine use. This double-blind, placebo-controlled laboratory study provides the first evidence that propranolol administration following CCE may modulate memories for learning processes that subserve cocaine craving/cue reactivity in CD humans. Alternative interpretations of the findings were considered, and implications of the results for treatment were noted.
Particle signatures of magnetic topology at the magnetopause: AMPTE/CCE observations
Fuselier, S. A.; Anderson, B. J.; Onsager, T. G.
1995-01-01
Electron distributions at energies above 50 eV have been found to be a sensitive indicator of magnetic topology for magnetopause crossings of the AMPTE/CCE spacecraft. Progressing from the magnetosheath to the magnetosphere two abrupt transitions occur. First, the magnetosheath electron population directed either parallel or antiparallel to the magnetic field is replaced by a streaming, heated magnetosheath electron population. The other half of the distribution is unchanged. The region with unidirectional, heated magnetosheath electrons is identified as the magnetosheath boundary layer (MSBL). Second, the unheated magnetosheath electron population is replaced by a heated population nearly identical to the population encountered in the MSBL, resulting in a symmetric counterstreaming distribution. The region populated by the bidirectional heated magnetosheath electrons is identified as the low-latitude boundary layer (LLBL). The MSBL and LLBL identified by the electron transitions are the same as the regions identified using ion composition measurements. The magnetosheath-MSBL transition reflects a change in magnetic topology from a solar wind field line to one that threads the magnetopause, and the existence of a magnetosheath-MSBL transition implies that the magnetopause is open. When the current layer is easily identified, the MSBL-LLBL transition coincides with the magnetopause current layer, indicating that the magnetosheath electrons are heated in the current layer. Both magnetosheath-MSBL and MSBL-LLBL transitions are observed for low as well as high magnetic shears. Moreover, the transitions are particularly clear for low shear implying that magnetic topology boundaries are sharp even when abrupt changes in the field and other plasma parameters are absent. Furthermore, for low magnetic shear, solar wind ions with low parallel drift speeds make up the majority of the LLBL population indicating that the magnetosheath plasma has convected directly across the
Directory of Open Access Journals (Sweden)
Xiao-dong Shang
2015-01-01
Full Text Available The effects of 8 typhoons which passed by coldcore eddy (CCE areas in the South China Sea (SCS from 1997 to 2009 were observed and evaluated. The changes in the preexisting CCE acted upon by typhoons were described by eddy kinetic energy (EKE and eddy available gravitational potential energy (EAGPE. The mechanical energy of CCE was estimated from a two-layer reduced gravity model. Comparing with the scenario that typhoon passes by the region without CCEs, the preexisting CCE area plays an important role in the increase of chlorophyll-a (chl-a concentration in the CCEs impacted by the typhoons. The preexisting chl-a in CCE is about 25%~45% (8%~25% of postexisting chl-a in CCE for higher (slower transit speed typhoons. If the EAGPE of CCE increases greatly after typhoon passing by with slow transit speed, so does the chl-a in the CCE area. The EKE (EAGPE changes of the preexisting CCE are in the order of O(1014~1015 J. EKE and EAGPE of CCE are dominantly enhanced by typhoon with slow transit speed (<3 m/s and the posttyphoon EAGPE is always larger than posttyphoon EKE for 8 cases. The maximum EAGPE change of the preexisting CCE reaches 5.11×1015 J, which was induced by typhoon Hagibis.
Enhanced barrier functions and anti-inflammatory effect of cultured coconut extract on human skin.
Kim, Soomin; Jang, Ji Eun; Kim, Jihee; Lee, Young In; Lee, Dong Won; Song, Seung Yong; Lee, Ju Hee
2017-08-01
Natural plant oils have been used as a translational alternative to modern medicine. Particularly, virgin coconut oil (VCO) has gained popularity because of its potential benefits in pharmaceutical, nutritional, and cosmetic applications. Cultured coconut extract (CCE) is an alternative end product of VCO, which undergoes a further bacterial fermentation process. This study aimed to investigate the effects of CCE on human skin. We analyzed the expression of skin barrier molecules and collagens after applying CCE on human explanted skin. To evaluate the anti-inflammatory properties of CCE, the expression of inflammatory markers was analyzed after ultraviolet B (UVB) irradiation. The CCE-treated group showed increased expression of cornified cell envelope components, which contribute to protective barrier functions of the stratum corneum. Further, the expression of inflammatory markers was lower in the CCE-treated group after exposure to UVB radiation. These results suggest an anti-inflammatory effect of CCE against UVB irradiation-induced inflammation. Additionally, the CCE-treated group showed increased collagen and hyaluronan synthase-3 expression. In our study, CCE showed a barrier-enhancing effect and anti-inflammatory properties against ex vivo UVB irradiation-induced inflammation. The promising effect of CCE may be attributed to its high levels of polyphenols and fatty acid components. Copyright © 2017 Elsevier Ltd. All rights reserved.
Use of computer-based clinical examination to assess medical students in surgery.
El Shallaly, Gamal E H A; Mekki, Abdelrahman M
2012-01-01
To improve the viewing of the video-projected structured clinical examination (ViPSCE), we developed a computerized version; the computer-based clinical examination (CCE). This was used to assess medical students' higher knowledge and problem solving skills in surgery. We present how we did this, test score descriptive statistics, and the students' evaluation of the CCE. A CCE in surgery was administered to assess a class of 43 final year medical students at the end of their surgical clerkship. Like the ViPSCE, the exam was delivered as a slide show, using a PowerPoint computer program. However, instead of projecting it onto a screen, each student used a computer. There were 20 slides containing either still photos or short video clips of clinical situations in surgery. The students answered by hand writing on the exam papers. At the end, they completed evaluation forms. The exam papers were corrected manually. Test score descriptive statistics were calculated and correlated with the students' scores in other exams in surgery. Administration of the CCE was straightforward. The test scores were normally distributed (mean = median = 4.9). They correlated significantly with the total scores obtained by the students in surgery (r = 0.68), and with each of the other exam modalities in surgery, such as the multiple choice and structured essay questions. Acceptability of the CCE to the students was high and they recommended the use of the CCE in other departments. CCE is feasible and popular with students. It inherits the validity and reliability of the ViPSCE with the added advantage of improving the viewing of the slides.
Ben Saad, Anouar; Dalel, Brahmi; Rjeibi, Ilhem; Smida, Amani; Ncib, Sana; Zouari, Nacim; Zourgui, Lazhar
2017-12-01
Opuntia ficus-indica (L.) Mill. (Castaceae) (cactus) is used in Tunisian medicine for the treatment of various diseases. This study determines phytochemical composition of cactus cladode extract (CCE). It also investigates antioxidant activity and hepatoprotective potential of CCE against lithium carbonate (Li 2 CO 3 )-induced liver injury in rats. Twenty-four Wistar male rats were divided into four groups of six each: a control group given distilled water (0.5 mL/100 g b.w.; i.p.), a group injected with Li 2 CO 3 (25 mg/kg b.w.; i.p.; corresponding to 30% of the LD 50 ) twice daily for 30 days, a group receiving only CCE at 100 mg/kg of b.w. for 60 days and then injected with distilled water during the last 30 days of CCE treatment, and a group receiving CCE and then injected with Li 2 CO 3 during the last 30 days of CCE treatment. The bioactive components containing the CCE were identified using chemical assays. Treatment with Li 2 CO 3 caused a significant change of some haematological parameters including red blood cells (RBC), white blood cells (WBC), haemoglobin content (Hb), haematocrit (Ht) and mean corpuscular volume (VCM) compared to the control group. Moreover, significant increases in the levels of glucose, cholesterol, triglycerides and of aspartate aminotransferase (AST), alanine aminotransferase (ALT), alkaline phosphatase (ALP) and lactate dehydrogenase (LDH) activities were observed in the blood of Li 2 CO 3 -treated rats. Furthermore, exposure to Li 2 CO 3 significantly increased the LPO level and decreased superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx) activities in the hepatic tissues. CCE possesses a significant hepatoprotective effect.
Yeung, Michelle; Lu, Lily; Hughes, Adam M; Treit, Dallas; Dickson, Clayton T
2013-12-01
The neurobiological underpinnings of anxiety are of paramount importance to selective and efficacious pharmaceutical intervention. Hippocampal theta frequency in urethane anaesthetized rats is suppressed by all known (and some previously unknown) anti-anxiety (anxiolytic) drugs. Although these findings support the predictive validity of this assay, its construct validity (i.e., whether theta frequency actually indexes anxiety per se) has not been a subject of systematic investigation. We reasoned that if anxiolytic drugs suppress hippocampal theta frequency, then drugs that increase anxiety (i.e., anxiogenic agents) should increase theta frequency, thus providing evidence of construct validity. We used three proven anxiogenic drugs--two benzodiazepine receptor inverse agonists, N-methyl-β-carboline-3-carboxamide (FG7142) and β-carboline-3-carboxylate ethyl ester (βCCE), and one α2 noradrenergic receptor antagonist, 17α-hydroxy-yohimban-16α-carboxylic acid methyl ester (yohimbine) as pharmacological probes to assess the construct validity of the theta model. Although all three anxiogenic drugs significantly increased behavioural measures of anxiety in the elevated plus-maze, none of the three increased the frequency of hippocampal theta oscillations in the neurophysiological model. As a positive control, we demonstrated that diazepam, a proven anxiolytic drug, decreased the frequency of hippocampal theta, as in all other studies using this model. Given this discrepancy between the significant effects of anxiogenic drugs in the behavioural model and the null effects of these drugs in the neurophysiological model, we conclude that the construct validity of the hippocampal theta model of anxiety is questionable. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Ben Mansour Hédi
2011-10-01
Full Text Available Abstract Background Aflatoxin B1 (AFB1 is potent hepatotoxic and hepatocarcinogenic agent. In aflatoxicosis, oxidative stress is a common mechanism contributing to initiation and progression of hepatic damage. The aim of this work was to evaluate the hepatoprotective effect of cactus cladode extract (CCE on aflatoxin B1-induced liver damage in mice by measuring malondialdehyde (MDA level, the protein carbonyls generation and the heat shock proteins Hsp 70 and Hsp 27 expressions in liver. We also looked for an eventual protective effect against AFB1-induced genotoxicity as determined by chromosome aberrations test, SOS Chromotest and DNA fragmentation assay. We further evaluated the modulation of p53, bax and bcl2 protein expressions in liver. Methods Adult, healthy balbC (20-25 g male mice were pre-treated by intraperitonial administration of CCE (50 mg/Kg.b.w for 2 weeks. Control animals were treated 3 days a week for 4 weeks by intraperitonial administration of 250 μg/Kg.b.w AFB1. Animals treated by AFB1 and CCE were divided into two groups: the first group was administrated CCE 2 hours before each treatment with AFB1 3 days a week for 4 weeks. The second group was administrated without pre-treatment with CCE but this extract was administrated 24 hours after each treatment with AFB1 3 days a week for 4 weeks. Results Our results clearly showed that AFB1 induced significant alterations in oxidative stress markers. In addition, it has a genotoxic potential and it increased the expression of pro apoptotic proteins p53 and bax and decreased the expression of bcl2. The treatment of CCE before or after treatment with AFB1, showed (i a total reduction of AFB1 induced oxidative damage markers, (ii an anti-genotoxic effect resulting in an efficient prevention of chromosomal aberrations and DNA fragmentation compared to the group treated with AFB1 alone (iii restriction of the effect of AFB1 by differential modulation of the expression of p53 which
Evaluating and quantifying the liming potential of phosphate rocks
International Nuclear Information System (INIS)
Sikora, F.J.
2002-01-01
The liming potential of phosphate rock was evaluated with theoretical calculations and quantified by laboratory titration and soil incubation. Three anions present in the carbonate apatite structure of phosphate rock that can consume protons and cause an increase in pH when dissolved from apatite are PO 4 3- , CO 3 2- , and F - . The pKa for HF is so low that F - has very little effect on increasing pH. The pKa for 2 protons on H 2 PO 4 - and H 2 CO 3 are sufficiently high enough to cause an increase in pH with PO 4 3- and CO 3 2- released into solution if the pH range is between 4 and 6. Because of the greater molar quantity of PO 4 3- compared toCO 3 2- , PO 4 3- exerts a greater affect on the liming potential of P rock. For a variety of phosphate rocks with a axes ranging from 9.322 to 9.374 A in the carbonate apatite structure, the theoretical % calcium carbonate equivalence (CCE) ranges from 59.5 to 62%. With the presence of gangue carbonate minerals from 2.5 to 10% on a weight basis in the phosphate rocks, the theoretical %CCE ranges from 59.5 to 63.1%. Use of AOAC method 955.01 for quantifying the %CCE of North Carolina phosphate rock (NCPR) and Idaho phosphate rock (IDPR) resulted in %CCE ranging from 39.9 to 53.7% which were less than the theoretical values. The lower values measured in the AOAC method was presumed to be due to formation of CaHPO 4 or CaHPO 4 ·2H 2 O precipitates which would result in less than 2 protons neutralized per mole of PO 4 3- released from carbonate apatite. The highly concentrated solution formed in the method was considered not indicative of a soil solution and thus determined %CCE values would be suspect. A soil incubation study was conducted to determine a more appropriate %CCE value in a soil environment using Copper Basin, Tennessee soil with a soil pH of 4.2. Agricultural limestone, NCPR, IDPR, and a granulated IDPR were added to 100 g of soil at rates of 0.1, 0.3, 1, 3, and 10 g/kg soil, incubated for 105 days at field
Assessment of an electronic learning system for colon capsule endoscopy: a pilot study.
Watabe, Hirotsugu; Nakamura, Tetsuya; Yamada, Atsuo; Kakugawa, Yasuo; Nouda, Sadaharu; Terano, Akira
2016-06-01
Training for colon capsule endoscopy (CCE) procedures is currently performed as a lecture and hands-on seminar. The aims of this pilot study were to assess the utility of an electronic learning system for CCE (ELCCE) designed for the Japanese Association for Capsule Endoscopy using an objective scoring engine, and to evaluate the efficacy of ELCCE on the acquisition of CCE reading competence. ELCCE is an Internet-based learning system with the following steps: step 1, introduction; step 2, CCE reading competence assessment test (CCAT), which evaluates the competence of CCE reading prior to training; step 3, learning reading theory; step 4, training with guidance; step 5, training without guidance; step 6, final assessment; and step 7, the same as step 2. The CCAT, step 5 and step 6 were scored automatically according to: lesion detection, diagnosis (location, size, shape of lesion), management recommendations, and quality of view. Ten trainee endoscopists were initially recruited (cohort 1), followed by a validating cohort of 11 trainee endoscopists (cohort 2). All but one participant finished ELCCE training within 7 weeks. In step 6, accuracy ranged from 53 to 98 % and was not impacted by step 2 pretest scores. The average CCAT scores significantly increased between step 2 pretest and step 7 in both cohorts, from 42 ± 18 % to 79 ± 15 % in cohort 1 (p = 0.0004), and from 52 ± 15 % to 79 ± 14 % in cohort 2 (p = 0.0003). ELCCE is useful and effective for improving CCE reading competence.
Concurrent approach for evolving compact decision rule sets
Marmelstein, Robert E.; Hammack, Lonnie P.; Lamont, Gary B.
1999-02-01
The induction of decision rules from data is important to many disciplines, including artificial intelligence and pattern recognition. To improve the state of the art in this area, we introduced the genetic rule and classifier construction environment (GRaCCE). It was previously shown that GRaCCE consistently evolved decision rule sets from data, which were significantly more compact than those produced by other methods (such as decision tree algorithms). The primary disadvantage of GRaCCe, however, is its relatively poor run-time execution performance. In this paper, a concurrent version of the GRaCCE architecture is introduced, which improves the efficiency of the original algorithm. A prototype of the algorithm is tested on an in- house parallel processor configuration and the results are discussed.
Critical Science Education in a Suburban High School Chemistry Class
Ashby, Patrick
To improve students' scientific literacy and their general perceptions of chemistry, I enacted critical chemistry education (CCE) in two "regular level" chemistry classes with a group of 25 students in a suburban, private high school as part of this study. CCE combined the efforts of critical science educators (Fusco & Calabrese Barton, 2001; Gilbert 2013) with the performance expectations of the Next Generation Science Standards (NGSS) (NGSS Lead States, 2013a) to critically transform the traditional chemistry curriculum at this setting. Essentially, CCE engages students in the critical exploration of socially situated chemistry content knowledge and requires them to demonstrate this knowledge through the practices of science. The purpose of this study was to gauge these students development of chemistry content knowledge, chemistry interest, and critical scientific literacy (CSL) as they engaged in CCE. CSL was a construct developed for this study that necessarily combined the National Research Center's (2012) definition of scientific literacy with a critical component. As such, CSL entailed demonstrating content knowledge through the practices of science as well as the ability to critically analyze the intersections between science content and socially relevant issues. A mixed methods, critical ethnographic approach framed the collection of data from open-ended questionnaires, focus group interviews, Likert surveys, pre- and post unit tests, and student artifacts. These data revealed three main findings: (1) students began to develop CSL in specific, significant ways working through the activities of CCE, (2) student participants of CCE developed a comparable level of chemistry content understanding to students who participated in a traditional chemistry curriculum, and (3) CCE developed a group of students' perceptions of interest in chemistry. In addition to being able to teach students discipline specific content knowledge, the implications of this study are
Müller, Philip C; Senft, Jonas D; Gath, Philip; Steinemann, Daniel C; Nickel, Felix; Billeter, Adrian T; Müller-Stich, Beat P; Linke, Georg R
2018-01-01
The risk of infectious complications due to peritoneal contamination is a major concern and inhibits the widespread use of transrectal NOTES. A standardized rectal washout with a reversible colon occlusion device in situ has previously shown potential in reducing peritoneal contamination. The aim of this study was to compare the peritoneal contamination rate and inflammatory reaction for transrectal cholecystectomy after ideal rectal preparation (trCCE) and standard laparoscopic cholecystectomy (lapCCE) in a porcine survival experiment. Twenty pigs were randomized to trCCE (n = 10) or lapCCE (n = 10). Before trCCE, rectal washout was performed with saline solution. A colon occlusion device was then inserted and a second washout with povidone-iodine was performed. The perioperative course and the inflammatory reaction (leukocytes, C-reactive protein) were compared. At necropsy, 14 days after surgery the abdominal cavity was screened for infectious complications and peritoneal swabs were obtained for comparison of peritoneal contamination. Peritoneal contamination was lower after trCCE than after lapCCE (0/10 vs. 6/10; p = 0.003). No infectious complications were found at necropsy in either group and postoperative complications did not differ (p = 1.0). Immediately after the procedure, leukocytes were higher after lapCCE (17.0 ± 2.7 vs. 14.6 ± 2.3; p = 0.047). Leukocytes and C-reactive protein showed no difference in the further postoperative course. Intraoperative complications and total operation time (trCCE 114 ± 32 vs. 111 ± 27 min; p = 0.921) did not differ, but wound closure took longer for trCCE (31.5 ± 19 vs. 13 ± 5 min; p = 0.002). After standardized rectal washout with a colon occlusion device in situ, trCCE was associated without peritoneal contamination and without access-related infectious complications. Based on the findings of this study, a randomized controlled clinical study comparing clinical outcomes of trCCE with
Yoshimura, Masafumi; Aoba, Yukihiro; Watari, Taiji; Momomura, Rei; Watanabe, Keita; Tomonaga, Akihito; Matsunaga, Michitaka; Suda, Yoshimasa; Lee, Woo Young; Asai, Katsuhito; Yoshimura, Kaori; Nakagawa, Takashi; Yamamoto, Tetsuro; Yamaguchi, Hideyo; Nagaoka, Isao
2012-10-01
In a previous study, we revealed that a commercially available product of dietary supplement containing a chicken comb extract (CCE), which is rich in hyaluronan, not only relieves joint pain and other symptoms, but also potentially improves the balance of type II collagen degradation/synthesis in patients with knee osteoarthritis. Since soccer is one of the sports most likely to cause knee osteoarthritis (OA), we evaluated the effect of a CCE-containing supplement on cartilage and bone metabolism in athletes. Fourteen and 15 subjects (all midfielders) were randomly assigned to receive the test product (test group) and the dummy placebo containing only vehicle (placebo group), respectively, for 12 weeks. The daily oral intake of the CCE-containing test product clearly decreased the urinary levels of both C-terminal crosslinked telopeptides of cartilage-specific type II collagen (CTX-II) as a type II collagen degradation marker and the N-terminal telopeptides of bone-specific type I collagen (NTx) as a marker of bone resorption at 12 weeks after the initiation of the intervention. By contrast, no significant reduction was detected in the placebo group at any timepoint during the intervention. These observations indicate that the test product is effective in inhibiting, not only cartilage degradation, but also bone remodeling. Thus, the CCE-containing supplement may be useful for the management of joint health in athletes.
submitter Test strategies for industrial testers for converter controls equipment
Oleniuk, P; Kasampalis, V; Nisbet, D; Todd, B; Uznański, S
2017-01-01
Power converters and their controls electronics are key elements for the operation of the CERN accelerator complex, having a direct impact on its availability. To prevent early-life failures and provide means to verify electronics, a set of industrial testers is used throughout the converters controls electronics' life cycle. The roles of the testers are to validate mass production during the manufacturing phase and to provide means to diagnose and repair failed modules that are brought back from operation. In the converter controls electronics section of the power converters group in the technology department of CERN (TE/EPC/CCE), two main test platforms have been adopted: a PXI platform for mixed analogue-digital functional tests and a JTAG Boundary-Scan platform for digital interconnection and functional tests. Depending on the functionality of the device under test, the appropriate test platforms are chosen. This paper is a follow-up to results presented at the TWEPP 2015 conference, adding the boundary s...
Secure Testing for Genetic Diseases on Encrypted Genomes with Homomorphic Encryption Scheme
Directory of Open Access Journals (Sweden)
Tan Ping Zhou
2018-01-01
Full Text Available The decline in genome sequencing costs has widened the population that can afford its cost and has also raised concerns about genetic privacy. Kim et al. present a practical solution to the scenario of secure searching of gene data on a semitrusted business cloud. However, there are three errors in their scheme. We have made three improvements to solve these three errors. (1 They truncate the variation encodings of gene to 21 bits, which causes LPCE error and more than 5% of the entries in the database cannot be queried integrally. We decompose these large encodings by 44 bits and deal with the components, respectively, to avoid LPCE error. (2 We abandon the hash function used in Kim’s scheme, which may cause HCE error with a probability of 2-22 and decompose the position encoding of gene into three parts with the basis 211 to avoid HCE error. (3 We analyze the relationship between the parameters and the CCE error and specify the condition that parameters need to satisfy to avoid the CCE error. Experiments show that our scheme can search all entries, and the probability of searching error is reduced to less than 2-37.4.
Presenilin-mediated modulation of capacitative calcium entry.
Yoo, A S; Cheng, I; Chung, S; Grenfell, T Z; Lee, H; Pack-Chung, E; Handler, M; Shen, J; Xia, W; Tesco, G; Saunders, A J; Ding, K; Frosch, M P; Tanzi, R E; Kim, T W
2000-09-01
We studied a novel function of the presenilins (PS1 and PS2) in governing capacitative calcium entry (CCE), a refilling mechanism for depleted intracellular calcium stores. Abrogation of functional PS1, by either knocking out PS1 or expressing inactive PS1, markedly potentiated CCE, suggesting a role for PS1 in the modulation of CCE. In contrast, familial Alzheimer's disease (FAD)-linked mutant PS1 or PS2 significantly attenuated CCE and store depletion-activated currents. While inhibition of CCE selectively increased the amyloidogenic amyloid beta peptide (Abeta42), increased accumulation of the peptide had no effect on CCE. Thus, reduced CCE is most likely an early cellular event leading to increased Abeta42 generation associated with FAD mutant presenilins. Our data indicate that the CCE pathway is a novel therapeutic target for Alzheimer's disease.
Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle
International Nuclear Information System (INIS)
Ranganathan, S.; Easton, E.B.
2009-01-01
Sol-gel chemistry is becoming more popular for the synthesis of electrode materials. For example, the sol-gel reaction can be performed in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together via the ceramic binder, which can also promote ion transport. Furthermore, the CCE structure has a high active surface area and is chemical and thermally robust. We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments (cyclic voltammetry, electrochemical impedance spectroscopy) were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. Our initial results have shown that CCE-based electrodes vastly outperform a bare carbon electrode, and thus are highly promising and cost-effective electrode material. Subsequent experiments involved the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements will be presented. (author)
Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle
Energy Technology Data Exchange (ETDEWEB)
Ranganathan, S.; Easton, E.B. [Faculty of Science, Univ. of Ontario Inst. of Technology, Oshawa, Ontario (Canada)], E-mail: ranga@uoit.ca, Brad.Easton@uoit.ca
2009-07-01
Sol-gel chemistry is becoming more popular for the synthesis of electrode materials. For example, the sol-gel reaction can be performed in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together via the ceramic binder, which can also promote ion transport. Furthermore, the CCE structure has a high active surface area and is chemical and thermally robust. We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments (cyclic voltammetry, electrochemical impedance spectroscopy) were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. Our initial results have shown that CCE-based electrodes vastly outperform a bare carbon electrode, and thus are highly promising and cost-effective electrode material. Subsequent experiments involved the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements will be presented. (author)
Mitra, Achintya; Sur, Tapas Kumar; Upadhyay, Sachhidananda; Bhattacharyya, Dipankar; Hazra, Jayram
2017-11-01
Swarna Jibanti scientifically known as Coelogyne cristata Lindley (Orchidaceae), an orchid mentioned in Ayurvedic medicine is used to promote healthy life span. The present work was planned to study the efficacy of hydro-alcoholic extract of pseudobulbs of C.cristata (CCE) to assess its role on chronic fatigue syndrome (CFS) induced behavioural and biochemical changes in aged Wistar rats compared to Panax ginseng (PG), a prototype anti-stress agent. CFS was induced by forced swimming for consecutive 21 days for fixed duration (15 min sessions). The criteria of CFS due to fatigue were counted using locomotor activity, depression and anxiety through automated photactometer, immobility time and plus maze activity respectively. Acute toxicity study of CCE (upto 2 g/kg, Limit test) was also performed. For CFS, animals were divided into five groups, naive control, control, CCE treated (25 mg/kg b.w., 250 mg/kg b.w.) and standard PG treated (100 mg/kg b.w.) groups. All drugs were given orally for consecutive 21 days along with CFS. After assessing behavioural parameters, all animals were sacrificed at day 21 and in vivo antioxidant potential of CCE was determined by lipid peroxides, nitrite, catalase (CAT) and superoxide dismutase (SOD) in brain tissue. CCE was found to be non-toxic. CCE treated aged rats significantly improved (p < 0.001) the spontaneous locomotor movement with respect to control rats, while, decreased the mobility period or depression score. In CFS, CCE also enhanced the time spent (p < 0.001) in open arms while reducing the time spent in closed arm as compared to CFS control, indicating lowering anxiety score. Moreover, marked diminution in lipid peroxidation, nitrite and SOD level was exhibited after CCE treatment and significantly enhanced catalase level significantly (p < 0.01) with respect to CFS control. PG also showed similar actions. The results confirmed the potential therapeutic actions of CCE against experimentally induced CFS in
International Nuclear Information System (INIS)
Auden, E.C.; Vizkelethy, G.; Serkland, D.K.; Bossert, D.J.; Doyle, B.L.
2017-01-01
The Hecht equation can be used to model the nonlinear degradation of charge collection efficiency (CCE) in response to radiation-induced displacement damage in both fully and partially depleted GaAs photodiodes. CCE degradation is measured for laser-generated photocurrent as a function of fluence and bias in Al_0_._3Ga_0_._7As/GaAs/Al_0_._2_5Ga_0_._7_5As p-i-n photodiodes which have been irradiated with 12 MeV C and 7.5 MeV Si ions. CCE is observed to degrade more rapidly with fluence in partially depleted photodiodes than in fully depleted photodiodes. When the intrinsic GaAs layer is fully depleted, the 2-carrier Hecht equation describes CCE degradation as photogenerated electrons and holes recombine at defect sites created by radiation damage in the depletion region. If the GaAs layer is partially depleted, CCE degradation is more appropriately modeled as the sum of the 2-carrier Hecht equation applied to electrons and holes generated within the depletion region and the 1-carrier Hecht equation applied to minority carriers that diffuse from the field-free (non-depleted) region into the depletion region. Enhanced CCE degradation is attributed to holes that recombine within the field-free region of the partially depleted intrinsic GaAs layer before they can diffuse into the depletion region.
Energy Technology Data Exchange (ETDEWEB)
Auden, E.C., E-mail: eauden@sandia.gov; Vizkelethy, G.; Serkland, D.K.; Bossert, D.J.; Doyle, B.L.
2017-05-15
The Hecht equation can be used to model the nonlinear degradation of charge collection efficiency (CCE) in response to radiation-induced displacement damage in both fully and partially depleted GaAs photodiodes. CCE degradation is measured for laser-generated photocurrent as a function of fluence and bias in Al{sub 0.3}Ga{sub 0.7}As/GaAs/Al{sub 0.25}Ga{sub 0.75}As p-i-n photodiodes which have been irradiated with 12 MeV C and 7.5 MeV Si ions. CCE is observed to degrade more rapidly with fluence in partially depleted photodiodes than in fully depleted photodiodes. When the intrinsic GaAs layer is fully depleted, the 2-carrier Hecht equation describes CCE degradation as photogenerated electrons and holes recombine at defect sites created by radiation damage in the depletion region. If the GaAs layer is partially depleted, CCE degradation is more appropriately modeled as the sum of the 2-carrier Hecht equation applied to electrons and holes generated within the depletion region and the 1-carrier Hecht equation applied to minority carriers that diffuse from the field-free (non-depleted) region into the depletion region. Enhanced CCE degradation is attributed to holes that recombine within the field-free region of the partially depleted intrinsic GaAs layer before they can diffuse into the depletion region.
Deliverable 3.3.2 Specification of tests and test groups
DEFF Research Database (Denmark)
Peterson, Carrie Beth; Mitseva, Anelia; Harpur, Jill
2009-01-01
Deliverable 3.3.2: Specification of tests and test groups One of the main goals of the ISISEMD project is to offer innovative ICT services to improve the quality of life of elderly persons with cognitive problems or mild dementia and their informal and formal caregivers who provide every day care...... for them. This will be done via integrating intelligent scalable ICT services which will be tested for a period of 12 months under realistic conditions. Offering the services could not be complete without evaluating quality of life improvement, user acceptance and user satisfaction with a representative...... group of the target user groups. This document is devoted to describing important aspects of services evaluation such as: who the test participants will be, inclusion and exclusion criterion, selection standards, how the test participants will be recruited, ethical considerations, etc. Test methodology...
Test strategies for industrial testers for converter controls equipment
International Nuclear Information System (INIS)
Oleniuk, P.; Kasampalis, V.; Cosmo, M. Di; Nisbet, D.; Todd, B.; Uznański, S.
2017-01-01
Power converters and their controls electronics are key elements for the operation of the CERN accelerator complex, having a direct impact on its availability. To prevent early-life failures and provide means to verify electronics, a set of industrial testers is used throughout the converters controls electronics' life cycle. The roles of the testers are to validate mass production during the manufacturing phase and to provide means to diagnose and repair failed modules that are brought back from operation. In the converter controls electronics section of the power converters group in the technology department of CERN (TE/EPC/CCE), two main test platforms have been adopted: a PXI platform for mixed analogue-digital functional tests and a JTAG Boundary-Scan platform for digital interconnection and functional tests. Depending on the functionality of the device under test, the appropriate test platforms are chosen. This paper is a follow-up to results presented at the TWEPP 2015 conference, adding the boundary scan test platform and the first results from exploitation of the test system. This paper reports on the test software, hardware design and test strategy applied for a number of devices that has resulted in maximizing test coverage and minimizing test design effort.
International Nuclear Information System (INIS)
Lehr, Elizabeth; Brown, Darron R.
2003-01-01
Infection of the genital tract with human papillomaviruses (HPVs) leads to proliferative and dysplastic epithelial lesions. The mechanisms used by the virus to escape the infected keratinocyte are not well understood. Infection of keratinocytes with HPV does not cause lysis, the mechanism used by many viruses to release newly formed virions. For HPV 11, a type associated with a low risk of neoplastic disease, the cornified cell envelope (CCE) of infected keratinocytes is thin and fragile, and transcription of loricrin, the major CCE protein, is reduced. The effects of high-risk HPV infection on components of the CCE have not been previously reported. HPV 59, an oncogenic genital type related to HPV types 18 and 45 was identified in a condylomata acuminata lesion. An extract of this lesion was used to infect human foreskin fragments, which were grown in athymic mice as xenografts. Continued propagation using extracts of xenografts permitted growth of additional HPV 59-infected xenografts. CCEs purified from HPV 59-infected xenografts displayed subtle morphologic abnormalities compared to those derived from uninfected xenografts. HPV 59-infected xenografts revealed dysplastic-appearing cells with mitotic figures. Detection of loricrin, involucrin, and cytokeratin 10 was reduced in HPV 59-infected epithelium, while small proline-rich protein 3 (SPR3) was increased. Reduction in loricrin was most apparent in regions of epithelium containing abundant HPV 59 DNA. Compared to uninfected epithelium, loricrin transcription was decreased in HPV 59-infected epithelium. We conclude that HPV 59 shares with HPV 11 the ability to alter CCE components and to specifically reduce transcription of the loricrin gene. Because loricrin is the major CCE protein, a reduction in this component could alter the physical properties of the CCE, thus facilitating virion release
Kim, Jin Seoub; Koppula, Sushruta; Yum, Mun Jeong; Shin, Gwang Mo; Chae, Yun Jin; Hong, Seok Min; Lee, Jae Dong; Song, MinDong
2017-12-01
Cuscuta chinensis Lam. (Convolvulaceae) has been used as a traditional herbal remedy for treating liver and kidney disorders. Anti-fibrotic effects of C. chinensis extract (CCE) in cellular and experimental animal models were investigated. HSC-T6 cell viability, cell cycle and apoptosis were analysed using MTT assay, flow cytometry and Annexin V-FITC/PI staining techniques. Thioacetamide (TAA)-induced fibrosis model was established using Sprague Dawley rats (n = 10). Control, TAA, CCE 10 (TAA with CCE 10 mg/kg), CCE 100 (TAA with CCE 100 mg/kg) and silymarin (TAA with silymarin 50 mg/kg). Fibrosis was induced by TAA (200 mg/kg, i.p.) twice per week for 13 weeks. CCE and silymarin were administered orally two times per week from the 7th to 13th week. Fibrotic related gene expression (α-SMA, Col1α1 and TGF-β1) was measured by RT-PCR. Serum biomarkers, glutathione (GSH) and hydroxyproline were estimated by spectrophotometer using commercial kits. CCE (0.05 and 0.1 mg/mL) and silymarin (0.05 mg/mL) treatment significantly (p < 0.01 and p < 0.001) induced apoptosis (11.56%, 17.52% for CCE; 16.50% for silymarin, respectively) in activated HSC-T6 cells, compared with control group (7.26%). Further, rat primary HSCs showed changes in morphology with CCE 0.1 mg/mL treatment. In in vivo studies, CCE (10 and 100 mg/kg) treatment ameliorated the TAA-induced altered levels of serum biomarkers, fibrotic related gene expression, GSH, hydroxyproline significantly (p < 0.05-0.001) and rescued the histopathological changes. CCE can be developed as a potential agent in the treatment of hepatofibrosis.
JENDL-3.3 thermal reactor benchmark test
International Nuclear Information System (INIS)
Akie, Hiroshi
2001-01-01
Integral tests of JENDL-3.2 nuclear data library have been carried out by Reactor Integral Test WG of Japanese Nuclear Data Committee. The most important problem in the thermal reactor benchmark testing was the overestimation of the multiplication factor of the U fueled cores. With several revisions of the data of 235 U and the other nuclides, JENDL-3.3 data library gives a good estimation of multiplication factors both for U and Pu fueled thermal reactors. (author)
Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle
Energy Technology Data Exchange (ETDEWEB)
Ranganathan, S.; Easton, E.B. [Univ. of Ontario Inst. of Technology, Oshawa, ON (Canada). Faculty of Science
2009-07-01
A thermochemical cycle is a process by which water is decomposed into hydrogen and oxygen through a series of chemical reactions. The chemicals that are used in these reactions are regenerated and recycled during the process. Sol-gel chemistry is becoming more common for the synthesis of electrode materials. The sol-gel reaction can be conducted in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together through the ceramic binder, which can also promote ion transport. The CCE structure also has a high active surface area and is chemically and thermally robust. This paper presented an investigation of CCE materials prepared using 3-aminopropyl trimethoxysilane. Several electrochemical experiments including cyclic voltammetry and electrochemical impedance spectroscopy were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the copper-chlorine thermochemical cycle. Subsequent experiments included the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements were also presented. Specifically, the paper presented the experiment with particular reference to the CCE preparation; electrochemical experiments; thermal analysis; and scanning electron microscopy. Results were also provided. These included TGA analysis; scanning electron microscopy analysis; electrochemical characterization; and anodic polarization. Characterization of these CCE material demonstrated that they had good thermal stability, could be used at high temperatures, and were therefore, very promising anode materials. 15 refs., 7 figs.
Polycrystalline diamond detectors with three-dimensional electrodes
Energy Technology Data Exchange (ETDEWEB)
Lagomarsino, S., E-mail: lagomarsino@fi.infn.it [University of Florence, Department of Physics, Via Sansone 1, 50019 Sesto Fiorentino (Italy); INFN Firenze, Via B. Rossi 1, 50019 Sesto Fiorentino (Italy); Bellini, M. [INO-CNR Firenze, Largo E. Fermi 6, 50125 Firenze (Italy); Brianzi, M. [INFN Firenze, Via B. Rossi 1, 50019 Sesto Fiorentino (Italy); Carzino, R. [Smart Materials-Nanophysics, Istituto Italiano di Tecnologia, Genova, Via Morego 30, 16163 Genova (Italy); Cindro, V. [Joseph Stefan Institute, Jamova Cesta 39, 1000 Ljubljana (Slovenia); Corsi, C. [University of Florence, Department of Physics, Via Sansone 1, 50019 Sesto Fiorentino (Italy); LENS Firenze, Via N. Carrara 1, 50019 Sesto Fiorentino (Italy); Morozzi, A.; Passeri, D. [INFN Perugia, Perugia (Italy); Università degli Studi di Perugia, Dipartimento di Ingegneria, via G. Duranti 93, 06125 Perugia (Italy); Sciortino, S. [University of Florence, Department of Physics, Via Sansone 1, 50019 Sesto Fiorentino (Italy); INFN Firenze, Via B. Rossi 1, 50019 Sesto Fiorentino (Italy); Servoli, L. [INFN Perugia, Perugia (Italy)
2015-10-01
The three-dimensional concept in diamond detectors has been applied, so far, to high quality single-crystal material, in order to test this technology in the best available conditions. However, its application to polycrystalline chemical vapor deposited diamond could be desirable for two reasons: first, the short inter-electrode distance of three-dimensional detectors should improve the intrinsically lower collection efficiency of polycrystalline diamond, and second, at high levels of radiation damage the performances of the poly-crystal material are not expected to be much lower than those of the single crystal one. We report on the fabrication and test of three-dimensional polycrystalline diamond detectors with several inter-electrode distances, and we demonstrate that their collection efficiency is equal or higher than that obtained with conventional planar detectors fabricated with the same material. - Highlights: • Pulsed laser fabrication of polycristalline diamond detectors with 3D electrodes. • Measurement of the charge collection efficiency (CCE) under beta irradiation. • Comparation between the CCE of 3D and conventional planar diamond sensors. • A rationale for the behavior of three-dimensional and planar sensors is given.
Directory of Open Access Journals (Sweden)
Jatinder Singh Sangha
2015-10-01
Full Text Available We report here the protective effects of a methanol extract from a cultivated strain of the red seaweed, Chondrus crispus, against β-amyloid-induced toxicity, in a transgenic Caenorhabditis elegans, expressing human Aβ1-42 gene. The methanol extract of C. crispus (CCE, delayed β-amyloid-induced paralysis, whereas the water extract (CCW was not effective. The CCE treatment did not affect the transcript abundance of amy1; however, Western blot analysis revealed a significant decrease of Aβ species, as compared to untreated worms. The transcript abundance of stress response genes; sod3, hsp16.2 and skn1 increased in CCE-treated worms. Bioassay guided fractionation of the CCE yielded a fraction enriched in monogalactosyl diacylglycerols (MGDG that significantly delayed the onset of β-amyloid-induced paralysis. Taken together, these results suggested that the cultivated strain of C. crispus, whilst providing dietary nutritional value, may also have significant protective effects against β-amyloid-induced toxicity in C. elegans, partly through reduced β-amyloid species, up-regulation of stress induced genes and reduced accumulation of reactive oxygen species (ROS.
Measurement and assessment of carrying capacity of the environment in Ningbo, China.
Liu, R Z; Borthwick, Alistair G L
2011-08-01
Carrying Capacity of the Environment (CCE) provides a useful measure of the sustainable development of a region. Approaches that use integrated assessment instead of measurement can lead to misinterpretation of sustainable development because of confusion between Environmental Stress (ES) indexes and CCE indexes, and the selection of over-simple linear plus models. The present paper proposes a comprehensive measurement system for CCE which comprises models of natural resources capacity, environmental assimilative capacity, ecosystem services capacity, and society supporting capacity. The corresponding measurable indexes are designed to assess CCE using a carrying capacity surplus ratio model and a vector of surplus ratio of carrying capacity model. The former aims at direct comparison of ES and CCE based on the values of basic indexes, and the latter uses a Euclidean vector to assess CCE states. The measurement and assessment approaches are applicable to Strategic Environmental Assessment (SEA) and environmental planning and management. A case study is presented for Ningbo, China, whereby all the basic indexes of ECC are measured and the CCE states assessed for 2005 and 2010. Copyright © 2011 Elsevier Ltd. All rights reserved.
Ceramic carbon electrode-based anodes for use in the Cu-Cl thermochemical cycle
Energy Technology Data Exchange (ETDEWEB)
Ranganathan, Santhanam; Easton, E. Bradley [Faculty of Science, University of Ontario Institute of Technology, 2000 Simcoe Street North, Oshawa, Ontario (Canada)
2010-05-15
We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. CCE-based electrodes vastly outperform a bare carbon electrode. Optimization of the organosilicate loading revealed maximum electrode performance was achieved with 36 wt% and was explained in terms of the optimal balance of active area and anion transport properties. (author)
Taeroe, Anders; Mustapha, Walid Fayez; Stupak, Inge; Raulund-Rasmussen, Karsten
2017-07-15
Forests' potential to mitigate carbon emissions to the atmosphere is heavily debated and a key question is if forests left unmanaged to store carbon in biomass and soil provide larger carbon emission reductions than forests kept under forest management for production of wood that can substitute fossil fuels and fossil fuel intensive materials. We defined a modelling framework for calculation of the carbon pools and fluxes along the forest energy and wood product supply chains over 200 years for three forest management alternatives (FMA): 1) a traditionally managed European beech forest, as a business-as-usual case, 2) an energy poplar plantation, and 3) a set-aside forest left unmanaged for long-term storage of carbon. We calculated the cumulative net carbon emissions (CCE) and carbon parity times (CPT) of the managed forests relative to the unmanaged forest. Energy poplar generally had the lowest CCE when using coal as the reference fossil fuel. With natural gas as the reference fossil fuel, the CCE of the business-as-usual and the energy poplar was nearly equal, with the unmanaged forest having the highest CCE after 40 years. CPTs ranged from 0 to 156 years, depending on the applied model assumptions. CCE and CPT were especially sensitive to the reference fossil fuel, material alternatives to wood, forest growth rates for the three FMAs, and energy conversion efficiencies. Assumptions about the long-term steady-state levels of carbon stored in the unmanaged forest had a limited effect on CCE after 200 years. Analyses also showed that CPT was not a robust measure for ranking of carbon mitigation benefits. Copyright © 2017 Elsevier Ltd. All rights reserved.
Colon Capsule Endoscopy: Where Are We and Where Are We Going
Directory of Open Access Journals (Sweden)
Yoo Min Han
2016-09-01
Full Text Available Colon capsule endoscopy (CCE is a noninvasive technique for diagnostic imaging of the colon. It does not require air inflation or sedation and allows minimally invasive and painless colonic evaluation. The role of CCE is rapidly evolving; for example, for colorectal screening (colorectal cancer [CRC] in average-risk patients, in patients with an incomplete colonoscopy, in patients refusing a conventional colonoscopy, and in patients with contraindications for conventional colonoscopy. In this paper, we comprehensively review the technical characteristics and procedure of CCE and compare CCE with conventional methods such as conventional colonoscopy or computed tomographic colonography. Future expansion of CCE in the area of CRC screening for the surveillance of polyps and adenomatous lesions and for assessment of inflammatory bowel disease is also discussed.
Silicon microstrip detectors in 3D technology for the sLHC
Energy Technology Data Exchange (ETDEWEB)
Parzefall, Ulrich [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany)], E-mail: ulrich.parzefall@physik.uni-freiburg.de; Dalla Betta, Gian-Franco [INFN and Universita' di Trento, via Sommarive 14, 38050 Povo di Trento (Italy); Eckert, Simon [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Eklund, Lars; Fleta, Celeste [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Jakobs, Karl; Kuehn, Susanne; Pahn, Gregor [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Parkes, Chris; Pennicard, David [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Ronchin, Sabina [FBK-irst, Center for Materials and Microsystems, via Sommarive 18, 38050 Povo di Trento (Italy); Zoboli, Andrea [INFN and Universita' di Trento, via Sommarive 14, 38050 Povo di Trento (Italy); Zorzi, Nicola [FBK-irst, Center for Materials and Microsystems, via Sommarive 18, 38050 Povo di Trento (Italy)
2009-08-01
The projected luminosity upgrade of the large hadron collider (LHC), the sLHC, will constitute a challenging radiation environment for tracking detectors. Massive improvements in radiation hardness are required with respect to the LHC. In the layout for the new ATLAS tracker, silicon strip detectors (SSDs) with short strips cover the region from 28 to 60 cm distance to the beam. These SSDs will be exposed to fluences up to 10{sup 15}N{sub eq}/cm{sup 2}, hence radiation resistance is the major concern. It is advantageous to fuse the superior radiation hardness of the 3D design originally conceived for pixel-style applications with the benefits of the well-known planar technology for strip detectors. This is achieved by ganging rows of 3D columns together to form strips. Several prototype sLHC detector modules using 3D SSD with short strips, processed on p-type silicon, and LHC-speed front-end electronics from the present ATLAS semi-conductor tracker (SCT) were built. The modules were tested before and after irradiation to fluences of 10{sup 15}N{sub eq}/cm{sup 2}. The tests were performed with three systems: a highly focused IR-laser with 5{mu}m spot size to make position-resolved scans of the charge collection efficiency (CCE), a Sr{sup 90}{beta}-source set-up to measure the signal levels for a minimum ionizing particles (MIPs), and a beam test with 180 GeV pions at CERN. This article gives a brief overview of the performance of these 3D modules, and draws conclusions about options for using 3D strip sensors as tracking detectors at the sLHC.
Silicon microstrip detectors in 3D technology for the sLHC
International Nuclear Information System (INIS)
Parzefall, Ulrich; Dalla Betta, Gian-Franco; Eckert, Simon; Eklund, Lars; Fleta, Celeste; Jakobs, Karl; Kuehn, Susanne; Pahn, Gregor; Parkes, Chris; Pennicard, David; Ronchin, Sabina; Zoboli, Andrea; Zorzi, Nicola
2009-01-01
The projected luminosity upgrade of the large hadron collider (LHC), the sLHC, will constitute a challenging radiation environment for tracking detectors. Massive improvements in radiation hardness are required with respect to the LHC. In the layout for the new ATLAS tracker, silicon strip detectors (SSDs) with short strips cover the region from 28 to 60 cm distance to the beam. These SSDs will be exposed to fluences up to 10 15 N eq /cm 2 , hence radiation resistance is the major concern. It is advantageous to fuse the superior radiation hardness of the 3D design originally conceived for pixel-style applications with the benefits of the well-known planar technology for strip detectors. This is achieved by ganging rows of 3D columns together to form strips. Several prototype sLHC detector modules using 3D SSD with short strips, processed on p-type silicon, and LHC-speed front-end electronics from the present ATLAS semi-conductor tracker (SCT) were built. The modules were tested before and after irradiation to fluences of 10 15 N eq /cm 2 . The tests were performed with three systems: a highly focused IR-laser with 5μm spot size to make position-resolved scans of the charge collection efficiency (CCE), a Sr 90 β-source set-up to measure the signal levels for a minimum ionizing particles (MIPs), and a beam test with 180 GeV pions at CERN. This article gives a brief overview of the performance of these 3D modules, and draws conclusions about options for using 3D strip sensors as tracking detectors at the sLHC.
Directory of Open Access Journals (Sweden)
Mana eKatano
2016-02-01
Full Text Available Efficient use of seed nutrient reserves is crucial for germination and establishment of plant seedlings. Mobilizing seed oil reserves in Arabidopsis involves β-oxidation, the glyoxylate cycle, and gluconeogenesis, which provide essential energy and the carbon skeletons needed to sustain seedling growth until photoautotrophy is acquired. We demonstrated that H+-PPase activity is required for gluconeogenesis. Lack of H+-PPase in fugu5 mutants increases cytosolic pyrophosphate (PPi levels, which partially reduces sucrose synthesis de novo and inhibits cell division. In contrast, post-mitotic cell expansion in cotyledons was unusually enhanced, a phenotype called compensation. Therefore, it appears that PPi inhibits several cellular functions, including cell cycling, to trigger compensated cell enlargement (CCE. Here, we mutagenized fugu5-1 seeds with 12C6+ heavy-ion irradiation and screened mutations that restrain CCE to gain insight into the genetic pathway(s involved in CCE. We isolated A#3-1, in which cell size was severely reduced, but cell number remained similar to that of original fugu5-1. Moreover, cell number decreased in A#3-1 single mutant (A#3-1sm, similar to that of fugu5-1, but cell size was almost equal to that of the wild type. Surprisingly, A#3-1 mutation did not affect CCE in other compensation exhibiting mutant backgrounds, such as an3-4 and fugu2-1/fas1-6. Subsequent map-based cloning combined with genome sequencing and HRM curve analysis identified enoyl-CoA hydratase 2 (ECH2 as the causal gene of A#3-1. The above phenotypes were consistently observed in the ech2-1 allele and supplying sucrose restored the morphological and cellular phenotypes in fugu5-1, ech2-1, A#3-1sm, fugu5-1 ech2-1 and A#3-1;fugu5-1. Taken together, these results suggest that defects in either H+-PPase or ECH2 compromise cell proliferation due to defects in mobilizing stored lipids. In contrast, ECH2 alone likely promotes CCE during the post-mitotic cell
Seizing market shaping opportunities for vaccine cold chain equipment.
Azimi, Tara; Franzel, Lauren; Probst, Nina
2017-04-19
Gavi, the Vaccine Alliance, supports immunisation programmes in eligible countries to reach children with lifesaving vaccines. Dramatic improvement in the scale and performance of current cold chain systems is required to extend the reach of immunisation services - especially for children living in remote locations - to advance progress towards full vaccine coverage. Achieving these improvements will require a healthier market for cold chain equipment where the products meet user needs, are sustainably priced, and are available in sufficient quantities to meet demand. Yet evidence suggests that the cold chain market has suffered from several failures including limited demand visibility, fragmented procurement, and insufficient information exchange between manufacturers and buyers on needs and equipment performance. One of Gavi's strategic goals is to shape markets for vaccines and other immunisation products, including cold chain equipment and in 2015, Gavi created a new mechanism - the Cold Chain Equipment (CCE) Optimisation Platform - to strengthen country cold chain systems by offering financial support and incentives for higher performing CCE. The main objective of the CCE Platform is to get more equipment that is efficient, sustainable, and better performing deployed to every health facility where it is required at an affordable price. To achieve these objectives, Gavi is putting in place tested market shaping approaches and tools adapted for the CCE market: the development of market strategies or 'roadmaps'; improvement of product performance through the development of target product profiles (TPPs); strategic engagement with CCE manufacturers and countries to enhance information sharing; and tailoring procurement tactics to the CCE market. These approaches and tools will allow for increased demand and supply of higher-performing, cost-effective and quality products. By strengthening immunisation systems with improved cold chain equipment, Gavi countries can
The formation of a cold-core eddy in the East Australian Current
Macdonald, H. S.; Roughan, M.; Baird, M. E.; Wilkin, J.
2016-02-01
Cold-core eddies (CCEs) frequently form in western boundary currents and can affect continental shelf processes. It is not always clear, however, if baroclinic or barotropic instabilities contribute more to their formation. The Regional Ocean Modelling System (ROMS) is used to investigate the ocean state during the formation of a CCE in the East Australian Current (EAC) during October 2009. The observed eddy initially appeared as a small billow (approx. 50 km in length) that perturbed the landward edge of the EAC. The billow grew into a mesoscale CCE (approx. 100 km in diameter), diverting the EAC around it. A ROMS simulation with a realistic wind field reproduced a similar eddy. This eddy formed from negative vorticity waters found on the continental shelf south of the EAC separation point. A sensitivity analysis is performed whereby the impact of 3 different wind forcing scenarios, upwelling, downwelling, and no winds, are investigated. A CCE formed in all wind scenarios despite the wind induced changes in hydrographic conditions in the continental shelf and slope waters. As such, the source of energy for eddy formation did not come from the interactions of wind with the continental shelf waters. Analysis of strain and energy transformation confirms this by showing that the prevailing source of CCE energy was kinetic energy of the offshore EAC. These results clearly link the formation of the CCE to the swift flowing EAC and barotropic instabilities.
Regulation of capacitative and non-capacitative Ca2+ entry in A7r5 vascular smooth muscle cells
Directory of Open Access Journals (Sweden)
COLIN W TAYLOR
2004-01-01
Full Text Available A capacitative Ca2+ entry (CCE pathway, activated by depletion of intracellular Ca2+ stores, is thought to mediate much of the Ca2+ entry evoked by receptors that stimulate phospholipase C (PLC. However, in A7r5 vascular smooth muscle cells, vasopressin, which stimulates PLC, empties intracellular Ca2+ stores but simultaneously inhibits their ability to activate CCE. The diacylglycerol produced with the IP3 that empties the stores is metabolized to arachidonic and this leads to activation of nitric oxide (NO synthase, production of NO and cyclic GMP, and consequent activation of protein kinase G. The latter inhibits CCE. In parallel, NO directly activates a non-capacitative Ca2+ entry (NCCE pathway, which is entirely responsible for the Ca2+ entry that occurs in the presence of vasopressin. This reciprocal regulation of two Ca2+ entry pathways ensures that there is sequential activation of first NCCE in the presence of vasopressin, and then a transient activation of CCE when vasopressin is removed. We suggest that the two routes for Ca2+ entry may selectively direct Ca2+ to processes that mediate activation and then recovery of the cell.
Directory of Open Access Journals (Sweden)
Mikaela Hermans
2014-10-01
Full Text Available It has been increasingly recognised that education plays a key role in addressing human-induced climate change. The ultimate goal of climate change education (CCE is positive impacts on the climate through both individual and collective actions. The aim of this study is to investigate geography teachers’ and their ninth-graders’ views about CCE. Data was collected using semi-structured interviews with geography teachers (N = 13 and questionnaires for ninth-graders (N = 549 at eleven secondary schools from all parts of Swedish-speaking Finland. The results show that although the students’ attitudes to CCE is positive, it does not supply them with action competence. The geography teachers in this study largely miss the ultimate goal of CCE, pointing at the need for more effort to be made in the process of developing CCE at secondary school.
Technology developments for a compound cycle engine
Bobula, George A.; Wintucky, William T.; Castor, J. G.
1988-01-01
The Compound Cycle Engine (CCE) is a highly turbocharged, power compounded power plant which combines the light weight pressure rise capability of a gas turbine with the high efficiency of a diesel. When optimized for a rotorcraft, the CCE will reduce fuel burned for a typical 2 hour (plus 30 min reserve) mission by 30 to 40 percent when compared to a conventional advanced technology gas turbine. The CCE can provide a 50 percent increase in range-payload product on this mission. Results of recent activities in a program to establish the technology base for a CCE are presented. The objective of this program is to research and develop those critical technologies which are necessary for the demonstration of a multicylinder diesel core in the early 1990s. A major accomplishment was the initial screening and identification of a lubricant which has potential for meeting the material wear rate limits of the application. An in-situ wear measurement system also was developed to provide accurate, readily obtainable, real time measurements of ring and liner wear. Wear data, from early single cylinder engine tests, are presented to show correlation of the in-situ measurements and the system's utility in determining parametric wear trends. A plan to demonstrate a compound cycle engine by the mid 1990s is included.
Irradiation Effects Test Series: Test IE-3. Test results report
International Nuclear Information System (INIS)
Farrar, L.C.; Allison, C.M.; Croucher, D.W.; Ploger, S.A.
1977-10-01
The objectives of the test reported were to: (a) determine the behavior of irradiated fuel rods subjected to a rapid power increase during which the possibility of a pellet-cladding mechanical interaction failure is enhanced and (b) determine the behavior of these fuel rods during film boiling following this rapid power increase. Test IE-3 used four 0.97-m long pressurized water reactor type fuel rods fabricated from previously irradiated fuel. The fuel rods were subjected to a preconditioning period, followed by a power ramp to 69 kW/m at a coolant mass flux of 4920 kg/s-m 2 . After a flow reduction to 2120 kg/s-m 2 , film boiling occurred on the fuel rods. One rod failed approximately 45 seconds after the reactor was shut down as a result of cladding embrittlement due to extensive cladding oxidation. Data are presented on the behavior of these irradiated fuel rods during steady-state operation, the power ramp, and film boiling operation. The effects of a power ramp and power ramp rates on pellet-cladding interaction are discussed. Test data are compared with FRAP-T3 computer model calculations and data from a previous Irradiation Effects test in which four irradiated fuel rods of a similar design were tested. Test IE-3 results indicate that the irradiated state of the fuel rods did not significantly affect fuel rod behavior during normal, abnormal (power ramp of 20 kW/m per minute), and accident (film boiling) conditions
Ten good reasons why everybody can and should perform cardiac ultrasound in the ICU.
Charron, Cyril; Repessé, Xavier; Bodson, Laurent; Au, Siu-Ming; Vieillard-Baron, Antoine
2014-01-01
Critical care ultrasonography (CCUS) has been defined as an ultrasound evaluation of the heart, abdomen, pleura and lungs at the bedside by the intensivist, 24/7. Within CCUS, critical care echocardiography (CCE) is used to assess cardiac function and more generally haemodynamics. Experts in haemodynamics have published a 'consensus of 16' regarding an update on haemodynamic monitoring. They reported the ten key properties of an 'ideal' haemodynamic monitoring system, which perfectly match the ten good reasons we describe here for performing CCE in critically ill patients. Even though unfortunately no evidence-based medicine study is available to support this review, especially regarding CCE-related improvement of outcome, many clinical studies have demonstrated that CCE provides measurements of relevant, accurate, reproducible and interpretable variables, is easy to use, readily available, has a rapid response time, causes no harm, and is cost-effective. Whether it is operator-independent is obviously more debatable and is discussed in this review. All these characteristics are arguments for the extensive use of CCE by intensivists. This is why experts in the field have recommended that a basic level of CCE should be included in the training of all intensivists.
DEFF Research Database (Denmark)
Taeroe, Anders; Fayez Mustapha, Walid; Stupak, Inge
2017-01-01
fossil fuels and fossil fuel intensive materials. We defined a modelling framework for calculation of the carbon pools and fluxes along the forest energy and wood product supply chains over 200 years for three forest management alternatives (FMA): 1) a traditionally managed European beech forest...... the lowest CCE when using coal as the reference fossil fuel. With natural gas as the reference fossil fuel, the CCE of the business-as-usual and the energy poplar was nearly equal, with the unmanaged forest having the highest CCE after 40 years. CPTs ranged from 0 to 156 years, depending on the applied model...... assumptions. CCE and CPT were especially sensitive to the reference fossil fuel, material alternatives to wood, forest growth rates for the three FMAs, and energy conversion efficiencies. Assumptions about the long-term steady-state levels of carbon stored in the unmanaged forest had a limited effect on CCE...
Test Re-Test Reliability of Four Versions of the 3-Cone Test in Non-Athletic Men
Directory of Open Access Journals (Sweden)
Jason G. Langley, Robert D. Chetlin
2017-03-01
Full Text Available Until recently, measurement and evaluation in sport science, especially agility testing, has not always included key elements of proper test construction. Often tests are published without reporting reliability and validity analysis for a specific population. The purpose of the present study was to examine the test re-test reliability of four versions of the 3-Cone Test (3CT, and provide guidance on proper test construction for testing agility in athletic populations. Forty male students enrolled in classes in the Department of Physical Education at a mid-Atlantic university participated. On each of test day participants performed 10 trials. In random order, they performed three trials to the right (3CTR, standard test, three to the left (3CTL, and two modified trials (3CTAR and 3CTAL, which included a reactive component in which a visual cue was given to indicate direction. Intra-class correlation coefficients (ICC indicated a moderate to high reliability for the four tests, 3CTR 0.79 (0.64-0.88, 95%CI, 3CTL 0.73 (0.55-0.85, 3CTAR 0.85(0.74-0.92, and 3CTAL 0.79 (0.64-0.88. Small standard error of the measurement (SEM was found; range 0.09 to 0.10. Pearson correlations between tests were high (0.82-0.92 on day one as well as day two (0.72-0.85. These results indicate each version of the 3-Cone Test is reliable; however, further tests are needed with specific athletic populations. Only the 3CTAR and 3CTAL are tests of agility due to the inclusion of a reactive component. Future studies examining agility testing and training should incorporate technological elements, including automated timing systems and motion capture analysis. Such instrumentation will allow for optimal design of tests that simulate sport-specific game conditions.
Fluidized-Bed Gasification of Plastic Waste, Wood, and Their Blends with Coal
Directory of Open Access Journals (Sweden)
Lucio Zaccariello
2015-08-01
Full Text Available The effect of fuel composition on gasification process performance was investigated by performing mass and energy balances on a pre-pilot scale bubbling fluidized bed reactor fed with mixtures of plastic waste, wood, and coal. The fuels containing plastic waste produced less H2, CO, and CO2 and more light hydrocarbons than the fuels including biomass. The lower heating value (LHV progressively increased from 5.1 to 7.9 MJ/Nm3 when the plastic waste fraction was moved from 0% to 100%. Higher carbonaceous fines production was associated with the fuel containing a large fraction of coal (60%, producing 87.5 g/kgFuel compared to only 1.0 g/kgFuel obtained during the gasification test with just plastic waste. Conversely, plastic waste gasification produced the highest tar yield, 161.9 g/kgFuel, while woody biomass generated only 13.4 g/kgFuel. Wood gasification showed a carbon conversion efficiency (CCE of 0.93, while the tests with two fuels containing coal showed lowest CCE values (0.78 and 0.70, respectively. Plastic waste and wood gasification presented similar cold gas efficiency (CGE values (0.75 and 0.76, respectively, while that obtained during the co-gasification tests varied from 0.53 to 0.73.
Energy Technology Data Exchange (ETDEWEB)
Ranganathan, Santhanam; Easton, E. Bradley [Faculty of Science, University of Ontario Institute of Technology, 2000 Simcoe Street North, Oshawa, Ontario L1H 7K4 (Canada)
2010-02-15
A high performance ceramic carbon electrode (CCE) was fabricated by the sol-gel method to study the CuCl electrolysis in Cu-Cl thermochemical cycle. The electrochemical behavior and stability of the CCE was investigated by polarization experiments at different concentrations of CuCl/HCl system. The CCE displayed excellent anodic performance and vastly outperformed the bare carbon fiber paper (CFP) even at high concentrations of CuCl (0.5 M) and HCl (6 M), which is explained in terms of increased active area and enhanced anion transport properties. Further enhancement of activity was achieved by coating the CCE layer onto both sides of the CFP substrate. (author)
Everett, J. D.; Baird, M. E.; Suthers, I. M.
2011-12-01
Swarms of the salp Thalia democratica periodically occur off southeast Australia following the austral spring bloom of phytoplankton. In October 2008 a filament of upwelled water was advected south by the adjacent East Australian Current and formed a 30 km diameter cold-core eddy (CCE). The three-dimensional structure of a subsurface swarm of T. democratica within the eddy was examined using both oblique and vertical hauls and an optical plankton counter (OPC) deployed on a towed body. The CCE displayed distinct uplift of the nutricline and elevated fluorescence. Net samples show the zooplankton community was dominated by T. democratica, comprising 73%-88% of zooplankton abundance. The size distribution of T. democratica measured from net samples was 0.5-5 mm and was used to interpret the OPC transects, which showed the swarm formed a 15 km diameter disc located 20-40 m deep in the center of the eddy. The maximum salp abundance was in the pycnocline and coincided with the subsurface fluorescence maximum. The mean abundance of T. democratica size particles within the disc was 5003 individuals m-3 (ind. m-3), contrasted with only 604 ind. m-3 at the outer edge of the eddy. The vertically concentrated and horizontally constrained disc-shaped salp swarm occurred at the interface of salp-bearing inner shelf water and nutrient-rich upwelled water in a CCE. The physical processes that formed the CCE on the inshore edge of the western boundary current led to the largest density of salps recorded.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Test methods. 80.3 Section 80.3... FUELS AND FUEL ADDITIVES General Provisions § 80.3 Test methods. The lead and phosphorus content of gasoline shall be determined in accordance with test methods set forth in the appendices to this part. [47...
Directory of Open Access Journals (Sweden)
Takeshi Yokoo
2015-01-01
Full Text Available Purpose. To noninvasively assess liver fibrosis using combined-contrast-enhanced (CCE magnetic resonance imaging (MRI and texture analysis. Materials and Methods. In this IRB-approved, HIPAA-compliant prospective study, 46 adults with newly diagnosed HCV infection and recent liver biopsy underwent CCE liver MRI following intravenous administration of superparamagnetic iron oxides (ferumoxides and gadolinium DTPA (gadopentetate dimeglumine. The image texture of the liver was quantified in regions-of-interest by calculating 165 texture features. Liver biopsy specimens were stained with Masson trichrome and assessed qualitatively (METAVIR fibrosis score and quantitatively (% collagen stained area. Using L1 regularization path algorithm, two texture-based multivariate linear models were constructed, one for quantitative and the other for quantitative histology prediction. The prediction performance of each model was assessed using receiver operating characteristics (ROC and correlation analyses. Results. The texture-based predicted fibrosis score significantly correlated with qualitative (r=0.698, P<0.001 and quantitative (r=0.757, P<0.001 histology. The prediction model for qualitative histology had 0.814–0.976 areas under the curve (AUC, 0.659–1.000 sensitivity, 0.778–0.930 specificity, and 0.674–0.935 accuracy, depending on the binary classification threshold. The prediction model for quantitative histology had 0.742–0.950 AUC, 0.688–1.000 sensitivity, 0.679–0.857 specificity, and 0.696–0.848 accuracy, depending on the binary classification threshold. Conclusion. CCE MRI and texture analysis may permit noninvasive assessment of liver fibrosis.
Directory of Open Access Journals (Sweden)
Kundziņa Ieva
2014-09-01
Full Text Available Introduction. This sports-science-related article heavily relies on studies that have reported an increase in beta-endorphin (â-EP concentration in plasma in response to physical activity. It examines the psychological and physiological effects of physical activity and exercise and reports on a research-experiment-based, endorphin-hypotheses-related pilot study aimed at exploring mood-related â-EP effects occurring in physically active male and female individuals aged 45-55 in response to physical load. Material and methods. Six 45 to 55-year-old individuals (3 males and 3 females rated as exhibiting moderate and high levels of physical activity in sport's laboratory. International Physical Activity Questionnaire (IPAQ was used to establish physical activity level. For facial expression analysis a short interview was applied, using software “FaceReader 3.0” (FR. As a load test a veloergometer exercise test was used, and Beta-endorphin (â-EP levels were measured from venous blood. Results. The findings demonstrated an increase in â-EP levels in 50% of the subjects. No positive relation between â-EP increase and happiness has been observed. In four subjects an increase in disgust was observed due to the laboratory conditions. Five minutes after the load test FR data recorded the reduction or disappearance of negative emotions for all research subjects. Conclusions. Further investigation into the relationship of plasma levels of â-EP and the emotional state of the individual involved in physical activities is needed. This necessitates a further insight into how exercise-elevated endorphins (â-EP affect mood state outside laboratory conditions. Therefore, a further investigation of people involved in physical recreation activities outdoors is envisaged.
Irradiation Effects Test Series: Test IE-3. Test results report. [PWR
Energy Technology Data Exchange (ETDEWEB)
Farrar, L. C.; Allison, C. M.; Croucher, D. W.; Ploger, S. A.
1977-10-01
The objectives of the test reported were to: (a) determine the behavior of irradiated fuel rods subjected to a rapid power increase during which the possibility of a pellet-cladding mechanical interaction failure is enhanced and (b) determine the behavior of these fuel rods during film boiling following this rapid power increase. Test IE-3 used four 0.97-m long pressurized water reactor type fuel rods fabricated from previously irradiated fuel. The fuel rods were subjected to a preconditioning period, followed by a power ramp to 69 kW/m at a coolant mass flux of 4920 kg/s-m/sup 2/. After a flow reduction to 2120 kg/s-m/sup 2/, film boiling occurred on the fuel rods. One rod failed approximately 45 seconds after the reactor was shut down as a result of cladding embrittlement due to extensive cladding oxidation. Data are presented on the behavior of these irradiated fuel rods during steady-state operation, the power ramp, and film boiling operation. The effects of a power ramp and power ramp rates on pellet-cladding interaction are discussed. Test data are compared with FRAP-T3 computer model calculations and data from a previous Irradiation Effects test in which four irradiated fuel rods of a similar design were tested. Test IE-3 results indicate that the irradiated state of the fuel rods did not significantly affect fuel rod behavior during normal, abnormal (power ramp of 20 kW/m per minute), and accident (film boiling) conditions.
A novel cascade organic Rankine cycle (ORC) system for waste heat recovery of truck diesel engines
International Nuclear Information System (INIS)
Chen, Tao; Zhuge, Weilin; Zhang, Yangjun; Zhang, Lei
2017-01-01
Highlights: • A confluent cascade expansion ORC (CCE-ORC) system is proposed. • Cyclopentane is considered as the most suitable fluid for this system. • The CCE-ORC system performance under full operating conditions is analyzed. • The BSFC of diesel engine can be reduced by 9.2% with the CCE-ORC system. • Performance comparison of CCE-ORC and dual-loop ORC is conducted. - Abstract: Waste heat recovery (WHR) of engines has attracted increasingly more concerns recently, as it can improve engine thermal efficiency and help truck manufacturers meet the restrictions of CO_2 emission. The organic Rankine cycle (ORC) has been considered as the most potential technology of WHR. To take full advantage of waste heat energy, the waste heat in both exhaust gases and the coolant need to be recovered; however, conventional multi-source ORC systems are too complex for vehicle applications. This paper proposed a confluent cascade expansion ORC (CCE-ORC) system for engine waste heat recovery, which has simpler architecture, a smaller volume and higher efficiency compared with conventional dual-loop ORC systems. Cyclopentane is analyzed to be regarded as the most suitable working fluid for this novel system. A thermodynamic simulation method is established for this system, and off-design performance of main components and the working fluid side pressure drop in the condenser have been taken into consideration. System performance simulations under full engine operating conditions are conducted for the application of this system on a heavy-duty truck diesel engine. Results show that the engine peak thermal efficiency can be improved from 45.3% to 49.5% where the brake specific fuel consumption (BSFC) decreases from 185.6 g/(kW h) to 169.9 g/(kW h). The average BSFC in the frequently operating region can decrease by 9.2% from 187.9 g/(kW h) to 172.2 g/(kW h). Compared with the conventional dual-loop ORC system, the CCE-ORC system can generate 8% more net power, while the
Integral test of JENDL-3.3 on fast reactors
International Nuclear Information System (INIS)
Chiba, Gou; Hazama, Taira
2003-05-01
An integral test has been carried out to evaluate a performance of evaluated nuclear data library JENDL-3.3, which was newly released, in a view of applying neutronics analyses of fast reactors. Japan Nuclear Cycle Development Institute has a large amount of data of critical assembly experiments (ZPPR, BFS, MOZART and FCA) and power reactor tests (JOYO). The database was utilized in this test. In plutonium loaded cores, an improvement was observed about 0.3% ε k in criticality and 5% in the non-leakage term of sodium void reactivity by a revision form JENDL-3.2 to -3.3. These results shoed that the revision is valid in plutonium loaded cores. In uranium loaded cores, dependence of C/E values on control rod position became smaller in control rod worth in ZPPR cores. On the other hand, C/E values became worse both in criticality (0.6%εk) and in sodium void reactivity (30%) in BFS cores. The main cause was a revision of uranium-235 capture cross section, and it could not be concluded whether the revision is valid or not in uranium loaded cores. It is necessary to carry out a validation test at other independent critical experiments in which uranium fuel is used. (author)
Hoedlmoser, H; Haerkoenen, J; Kronberger, M; Trummer, J; Rodeghiero, P
2007-01-01
Epitaxial (EPI) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of 150 mm thick EPI silicon diodes irradiated with 24GeV=c protons up to a fluence of 3 1015 p=cm2 has been performed by means of Charge Collection Efficiency (CCE) measurements, investigations with the Transient Current Technique (TCT) and standard CV=IV characterizations. The aim of the work was to investigate the impact of radiation damage as well as the influence of the wafer processing on the material performance by comparing diodes from different manufacturers. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. While the generation of leakage current due to irradiation is similar in all investigated series of detectors, a difference in the effective doping concentration can be observed after irradiation. In the CCE measurements an anomalous drop in performance was found even for diodes exposed to ...
ORF Alignment: NC_001143 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yces cerevisiae] emb|CAA81846.1| CCE1 ... [Saccharomyces cerevisiae] sp|Q03702|CCE1_YEAST ... Cruciform cutting... ... [Saccharomyces cerevisiae] gb|AAB02883.1| cruciform ... cutting endon
Crippling load test of Budd Pioneer Car 244, test 3.
2013-04-01
This report summarizes Test 3, a crippling load test on Budd Pioneer Car 244, conducted on June 28, 2011. Before the crippling load test, Transportation Technology Center, Inc., conducted two 800,000-pound (lb) quasi-static tests on Car 244 in accord...
Energy Technology Data Exchange (ETDEWEB)
Kassel, Florian; Boer, Wim de [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany); Guthoff, Moritz; Dabrowski, Anne [CERN, Meyrin (Switzerland)
2016-10-15
The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. After an integrated luminosity of a few fb{sup -1} corresponding to a few weeks of LHC operation, the CCE of the sCVD diamonds dropped by a factor of five or more and quickly approached the poor CCE of pCVD diamonds. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and recombination and hence reduces the CCE in a strongly non-linear way. A diamond irradiation campaign was started to investigate the rate-dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the transient current technique (TCT), the CCE was measured. The experimental results were used to create an effective deep trap model that takes the radiation damage into account. Using this trap model, the rate-dependent electrical field deformation and the CCE were simulated with the software SILVACO TCAD. The simulation, tuned to rate-dependent measurements from a strong radioactive source, was able to predict the non-linear decrease of the
International Nuclear Information System (INIS)
Kassel, Florian; Boer, Wim de; Guthoff, Moritz; Dabrowski, Anne
2016-01-01
The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. After an integrated luminosity of a few fb -1 corresponding to a few weeks of LHC operation, the CCE of the sCVD diamonds dropped by a factor of five or more and quickly approached the poor CCE of pCVD diamonds. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and recombination and hence reduces the CCE in a strongly non-linear way. A diamond irradiation campaign was started to investigate the rate-dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the transient current technique (TCT), the CCE was measured. The experimental results were used to create an effective deep trap model that takes the radiation damage into account. Using this trap model, the rate-dependent electrical field deformation and the CCE were simulated with the software SILVACO TCAD. The simulation, tuned to rate-dependent measurements from a strong radioactive source, was able to predict the non-linear decrease of the CCE in
CRRES observations of stormtime ring current ion composition
International Nuclear Information System (INIS)
Roeder, J.L.; Fennell, J.F.; Chen, M.W.; Grande, M.; Livi, S.; Schulz, M.
1996-01-01
The Magnetospheric Ion Composition Spectrometer onboard the CRRES spacecraft provided mass and charge state composition data for positive ions in the energy-per-charge range 1 endash 426 keV/e. The CRRES data is compared to the AMPTE/CCE observations during a moderately large geomagnetic storm on 4 June 1991. The results are compared to observations of large storms by CRRES and by the AMPTE/CCE spacecraft. The CRRES data show that oxygen ions formed 29% of the total measured ion energy density at L=3 endash 5 during the storm recovery phase. This result implies that domination of the plasma by oxygen ions may not be necessary to produce the observed rapid initial recovery of the Dst magnetic index. A preliminary test of the Dessler-Parker-Sckopke relation between the ion energy and the global magnetic perturbation shows that the observed particle fluxes during the 4 June 1991 storm could account for only 40 endash 70% of the variation of Dst. copyright 1996 American Institute of Physics
Interagency Collaboration in Support of Climate Change Education
Schoedinger, S. E.; Chambers, L. H.; Karsten, J. L.; McDougall, C.; Campbell, D.
2011-12-01
NASA, NOAA and NSF support climate change education (CCE) through their grant programs. As the agencies' investment in CCE has grown, coordination among the agencies has become increasingly important. Although the political landscape and budgets continue to change, the agencies are committed to continued coordination and collaboration. To date, this has taken the form of jointly hosted principal investigator (PI) meetings, the largest of which was held last February (see Eos Vol. 92, No. 24, 14 June 2011). The joint goals are: (1) increased collaboration among grantees and across programs; (2) building capacity among grantees in areas of mutual interest; (3) identification of gaps in investments to date; and (4) identification of opportunities for coordination of evaluation efforts. NOAA's primary funding opportunity for CCE projects is its Environmental Literacy Grant (ELG) Program. Although not exclusively focused on climate, there has been increased emphasis on this area since 2009. Through ELG, NOAA encourages the use of NOAA assets (data, facilities, educational resources, and people) in grantees' work. Thirty awards with a primary focus on CCE have been awarded to institutions of higher education, informal science education, and non-profit organizations involved in K-12 and informal/non-formal education. We anticipate this funding opportunity will continue to support the improvement of climate literacy among various audiences of learners in the future. NASA supported efforts in CCE in an ad hoc way for years. It became a focus area in 2008 with the launch of the NASA Global Climate Change Education (GCCE) Project. This project funded 57 awards in 2008-2010, the vast majority of them in teacher professional development, or use of data, models, or simulations. Beginning in FY11, NASA moved the project into the Minority University Research and Education Program. Fourteen awards were made to minority higher education institutions, non-profit organizations, and
9 CFR 147.3 - The stained-antigen, rapid, whole-blood test. 3
2010-01-01
...-blood test. 3 147.3 Section 147.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Blood Testing Procedures § 147.3 The stained-antigen, rapid, whole-blood test. 3 3 The procedure described is a modification of the method reported by Schaffer, MacDonald, Hall, and Bunyea, Jour. Amer. Vet...
Compound cycle engine for helicopter application
Castor, Jere G.
1986-01-01
The Compound Cycle Engine (CCE) is a highly turbocharged, power compounded, ultra-high power density, light-weight diesel engine. The turbomachinery is similar to a moderate pressure ratio, free power turbine engine and the diesel core is high speed and a low compression ratio. This engine is considered a potential candidate for future military light helicopter applications. This executive summary presents cycle thermodynamic (SFC) and engine weight analyses performed to establish general engine operating parameters and configuration. An extensive performance and weight analysis based on a typical two hour helicopter (+30 minute reserve) mission determined final conceptual engine design. With this mission, CCE performance was compared to that of a T-800 class gas turbine engine. The CCE had a 31% lower-fuel consumption and resulted in a 16% reduction in engine plus fuel and fuel tank weight. Design SFC of the CCE is 0.33 lb-HP-HR and installed wet weight is 0.43 lbs/HP. The major technology development areas required for the CCE are identified and briefly discussed.
Cerebellar clear cell ependymoma in a 10 year old girl
Energy Technology Data Exchange (ETDEWEB)
Thinzar Aye Nyein; Moon, Ah Rim; Hwang, Sun Chul; Hong, Hyun Sook; Lee, A Leum; Chang, Kee Hyun; Kim, Hee Kyung; Chin, Su Sie [Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of); Park, Ji Sang [Soonchunhyang University Gumi Hospital, Gumi (Korea, Republic of)
2016-01-15
Clear cell ependymoma (CCE) is a histological rare variant (1–5%) of ependymoma, which is distinguished from other histological subtypes by the presence of fusiform cells arrayed radially around small blood vessels. These alleged perivascular pseudorosettes are significant characteristic features of ependymomas. About 95% of infratentorial ependymomas are found in the fourth ventricle and the remainder occurs as cerebellopontine angle lesions. In previous reports, the cerebellum is found to be a rare location for ependymoma. In this study we report one case of CCE originating from the cerebellar hemisphere, showing unusual morphology on 3T MRI.
Test plan for Series 3 NNWSI spent fuel leaching/dissolution tests
International Nuclear Information System (INIS)
Wilson, C.N.
1986-04-01
The Series 3 tests will differ from the Series 2 tests in that the Series 3 tests will be run at 85 0 C (J-13 water) in sealed 304 stainless steel (SS) test vessels. The current NNWSI reference spent fuel container material is 304L SS. The candidate NNWSI repository horizon is above the water table, and 95 0 C (boiling temperature at the repository elevation) is the maximum liquid water temperature expected to contact spent fuel in the repository
Gearbox Reliability Collaborative Phase 3 Gearbox 3 Test Plan
Energy Technology Data Exchange (ETDEWEB)
Keller, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wallen, Robb [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-10-01
This document describes the Phase 3 test plan for the Gearbox Reliability Collaborative Gearbox #3. The primary test objective is to measure the planetary load sharing characteristics in the same conditions as the original gearbox design. If the measured load-sharing characteristics are close to the design model, the projected three-times improvement in planetary section predicted fatigue life and the efficacy of preloaded tapered roller bearings in mitigating the planetary bearing fatigue failure mode will have been demonstrated.
Oyler, J.; Anderson, R.; Running, S. W.
2010-12-01
In topographically complex landscapes, there is often a mismatch in scale between global climate model projections and more local climate-forcing factors and related ecological/hydrological processes. To overcome this limitation, the objective of this study was to downscale climate projections to the rugged Crown of the Continent Ecosystem (CCE) within the U.S. Northern Rockies and assess future impacts on water balances, vegetation dynamics, and carbon fluxes. A 40-year (1970-2009) spatial historical climate dataset (800m resolution, daily timestep) was generated for the CCE and modified for terrain influences. Regional climate projections were downscaled by applying them to the fine-scale historical dataset using a modified delta downscaling method and stochastic weather generator. The downscaled projections were used to drive the Biome-BGC ecosystem model. Overall CCE impacts included decreases in April 1 snow water equivalent, less days with snow on the ground, increased vegetation water stress, and increased growing degree days. The relaxing of temperature constraints increased annual net primary productivity (NPP) throughout most of the CCE landscape. However, an increase in water stress seems to have limited the growth in NPP and, in some areas, NPP actually decreased. Thus, CCE vegetation productivity trends under increasing temperatures will likely be determined by local changes in hydrologic function. Given the greater uncertainty in precipitation projections, future work should concentrate on determining thresholds in water constraints that greatly modify the magnitude and direction of carbon accumulation within the CCE under a warming climate.
Mechanical Tensile Testing of Titanium 15-3-3-3 and Kevlar 49 at Cryogenic Temperatures
James, Bryan L.; Martinez, Raul M.; Shirron, Peter; Tuttle, Jim; Galassi, Nicholas M.; Mcguinness, Daniel S.; Puckett, David; Francis, John J.; Flom, Yury
2011-01-01
Titanium 15-3-3-3 and Kevlar 49 are highly desired materials for structural components in cryogenic applications due to their low thennal conductivity at low temperatures. Previous tests have indicated that titanium 15-3-3-3 becomes increasingly brittle as the temperature decreases. Furthermore, little is known regarding the mechanical properties of Kevlar 49 at low temperatures, most specifically its Young's modulus. This testing investigates the mechanical properties of both materials at cryogenic temperatures through cryogenic mechanical tensile testing to failure. The elongation, ultimate tensile strength, yield strength, and break strength of both materials are provided and analyzed here.
Energy Technology Data Exchange (ETDEWEB)
Härkönen, J., E-mail: jaakko.harkonen@helsinki.fi [Helsinki Institute of Physics (Finland); Tuovinen, E. [Helsinki Institute of Physics (Finland); VTT Technical Research Centre of Finland, Microsystems and Nanoelectronics (Finland); Luukka, P.; Gädda, A.; Mäenpää, T.; Tuominen, E.; Arsenovich, T. [Helsinki Institute of Physics (Finland); Junkes, A. [Institute for Experimental Physics, University of Hamburg (Germany); Wu, X. [VTT Technical Research Centre of Finland, Microsystems and Nanoelectronics (Finland); Picosun Oy, Tietotie 3, FI-02150 Espoo Finland (Finland); Li, Z. [School of Materials Science and Engineering, Xiangtan University, Xiangtan, Hunan 411105 (China)
2016-08-21
Detectors manufactured on p-type silicon material are known to have significant advantages in very harsh radiation environment over n-type detectors, traditionally used in High Energy Physics experiments for particle tracking. In p-type (n{sup +} segmentation on p substrate) position-sensitive strip detectors, however, the fixed oxide charge in the silicon dioxide is positive and, thus, causes electron accumulation at the Si/SiO{sub 2} interface. As a result, unless appropriate interstrip isolation is applied, the n-type strips are short-circuited. Widely adopted methods to terminate surface electron accumulation are segmented p-stop or p-spray field implantations. A different approach to overcome the near-surface electron accumulation at the interface of silicon dioxide and p-type silicon is to deposit a thin film field insulator with negative oxide charge. We have processed silicon strip detectors on p-type Magnetic Czochralski silicon (MCz-Si) substrates with aluminum oxide (Al{sub 2}O{sub 3}) thin film insulator, grown with Atomic Layer Deposition (ALD) method. The electrical characterization by current–voltage and capacitance−voltage measurement shows reliable performance of the aluminum oxide. The final proof of concept was obtained at the test beam with 200 GeV/c muons. For the non-irradiated detector the charge collection efficiency (CCE) was nearly 100% with a signal-to-noise ratio (S/N) of about 40, whereas for the 2×10{sup 15} n{sub eq}/cm{sup 2} proton irradiated detector the CCE was 35%, when the sensor was biased at 500 V. These results are comparable with the results from p-type detectors with the p-spray and p-stop interstrip isolation techniques. In addition, interestingly, when the aluminum oxide was irradiated with Co-60 gamma-rays, an accumulation of negative fixed oxide charge in the oxide was observed.
A3 Subscale Diffuser Test Article Design
Saunders, G. P.
2009-01-01
This paper gives a detailed description of the design of the A3 Subscale Diffuser Test (SDT) Article Design. The subscale diffuser is a geometrically accurate scale model of the A3 altitude rocket facility. It was designed and built to support the SDT risk mitigation project located at the E3 facility at Stennis Space Center, MS (SSC) supporting the design and construction of the A3 facility at SSC. The subscale test article is outfitted with a large array of instrumentation to support the design verification of the A3 facility. The mechanical design of the subscale diffuser and test instrumentation are described here
The U.S.EPA has published recommendations for calibrator cell equivalent (CCE) densities of enterococci in recreational waters determined by a qPCR method in its 2012 Recreational Water Quality Criteria (RWQC). The CCE quantification unit stems from the calibration model used to ...
Charge Collection Efficiency Simulations of Irradiated Silicon Strip Detectors
Peltola, T.
2014-01-01
During the scheduled high luminosity upgrade of LHC, the world's largest particle physics accelerator at CERN, the position sensitive silicon detectors installed in the vertex and tracking part of the CMS experiment will face more intense radiation environment than the present system was designed for. Thus, to upgrade the tracker to required performance level, comprehensive measurements and simulations studies have already been carried out. Essential information of the performance of an irradiated silicon detector is obtained by monitoring its charge collection efficiency (CCE). From the evolution of CCE with fluence, it is possible to directly observe the effect of the radiation induced defects to the ability of the detector to collect charge carriers generated by traversing minimum ionizing particles (mip). In this paper the numerically simulated CCE and CCE loss between the strips of irradiated silicon strip detectors are presented. The simulations based on Synopsys Sentaurus TCAD framework were performed ...
Evidence for free-living Bacteroides in Cladophora along the shores of the Great Lakes
Whitman, Richard L.; Byappanahalli, Muruleedhara; Spoljaric, Ashley; Przybyla-Kelly, Katarzyna; Shively, Dawn A.; Nevers, Meredith
2014-01-01
Bacteroides is assumed to be restricted to the alimentary canal of animals and humans and is considered to be non-viable in ambient environments. We hypothesized that Bacteroides could persist and replicate within beach-stranded Cladophora glomerata mats in southern Lake Michigan, USA. Mean Bacteroides concentration (per GenBac3 Taqman quantitative PCR assay) during summer 2012 at Jeorse Park Beach was 5.2 log calibrator cell equivalents (CCE) g-1 dry weight (dw), ranging from 3.7 to 6.7. We monitored a single beach-stranded mat for 3 wk; bacterial concentrations increased by 1.6 log CCE g-1 dw and correlated significantly with ambient temperature (p = 0.003). Clonal growth was evident, as observed by >99% nucleotide sequence similarity among clones. In in vitro studies, Bacteroides concentrations increased by 5.5 log CCE g-1 after 7 d (27°C) in fresh Cladophora collected from rocks. Partial sequencing of the 16S rRNA gene of 36 clones from the incubation experiment showed highly similar genotypes (≥97% sequence overlap). The closest enteric Bacteroides spp. from the National Center for Biotechnology Information database were only 87 to 91% similar. Genomic similarity, clonality, growth, and persistence collectively suggest that putative, free-living Bacteroides inhabit Cladophora mats of southern Lake Michigan. These findings may have important biological, medical, regulatory, microbial source tracking, and public health implications.
Razmi, H; Heidari, H
2009-05-01
This work describes the electrochemical and electrocatalytic properties of carbon ceramic electrode (CCE) modified with lead nitroprusside (PbNP) nanoparticles as a new electrocatalyst material. The structure of deposited film on the CCE was characterized by energy dispersive X-ray (EDX), Fourier transform infrared (FTIR), and scanning electron microscopy (SEM). The cyclic voltammogram (CV) of the PbNP modified CCE showed two well-defined redox couples due to [Fe(CN)5NO](3-)/[Fe(CN)5NO](2-) and Pb(IV)/Pb(II) redox reactions. The modified electrode showed electrocatalytic activity toward the oxidation of L-cysteine and was used as an amperometric sensor. Also, to reduce the fouling effect of L-cysteine and its oxidation products on the modified electrode, a thin film of Nafion was coated on the electrode surface. The sensor response was linearly changed with L-cysteine concentration in the range of 1 x 10(-6) to 6.72 x 10(-5)mol L(-1) with a detection limit (signal/noise ratio [S/N]=3) of 0.46 microM. The sensor sensitivity was 0.17 microA (microM)(-1), and some important advantages such as simple preparation, fast response, good stability, interference-free signals, antifouling properties, and reproducibility of the sensor for amperometric determination of L-cysteine were achieved.
Development of cryogenic tracking detectors for very high luminosity experiments
Härkönen, J; Anbinderis, T; Bates, R; de Boer, W; Borchi, E; Bruzzi, M; Buttar, C; Chen, W; Cindro, V; Czellar, S; Eremin, V; Furgeri, A; Gaubas, E; Heijne, E; Ilyashenko, I; Kalesinskas, V; Krause, M; Li, Z; Luukka, P; Mandic, I; Menichelli, D; Mikuz, M; Militaru, O; Mueller, S; Niinikoski, T O; O’Shea, V; Parkes, C; Piotrzkowski, K; Pirollo, S; Pusa, P; Räisänen, J; Rouby, X; Tuominen, E; Tuovinen, E; Vaitkus, J; Verbitskaya, E; Väyrynen, S; Zavrtanik, M
2009-01-01
Experimental results and simulations of Charge Collection Efficiency (CCE) of Current Injected Detectors (CIDs) are focused. CID is a concept where the current is limited by the space charge. The injected carriers will be trapped by the deep levels. This induces a stable electric field through the entire bulk regardless of the irradiation fluence the detector has been exposed. Our results show that the CCE of CIDs is about two times higher than of regular detectors when irradiated up to 1×1016 cm−2. The higher CCE is achieved already at −50 °C temperatures.
Cholesterol Crystal Embolism and Chronic Kidney Disease.
Li, Xuezhu; Bayliss, George; Zhuang, Shougang
2017-05-24
Renal disease caused by cholesterol crystal embolism (CCE) occurs when cholesterol crystals become lodged in small renal arteries after small pieces of atheromatous plaques break off from the aorta or renal arteries and shower the downstream vascular bed. CCE is a multisystemic disease but kidneys are particularly vulnerable to atheroembolic disease, which can cause an acute, subacute, or chronic decline in renal function. This life-threatening disease may be underdiagnosed and overlooked as a cause of chronic kidney disease (CKD) among patients with advanced atherosclerosis. CCE can result from vascular surgery, angiography, or administration of anticoagulants. Atheroembolic renal disease has various clinical features that resemble those found in other kidney disorders and systemic diseases. It is commonly misdiagnosed in clinic, but confirmed by characteristic renal biopsy findings. Therapeutic options are limited, and prognosis is considered to be poor. Expanding knowledge of atheroembolic renal disease due to CCE opens perspectives for recognition, diagnosis, and treatment of this cause of progressive renal insufficiency.
arXiv Description of radiation damage in diamond sensors using an effective defect model
Kassel, Florian; Dabrowski, Anne; De Boer, Wim
The BCML system is a beam monitoring device in the CMS experiment at the LHC. As detectors poly-crystalline diamond sensors are used. Here high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the CCE. However, the loss in CCE was much more severe than expected. The reason why in real experiments the CCE is so much worse than in laboratory experiments is related to the rate of incident particles. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and hence reduces the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge the TCAD simulation program SILVACO was used. Two effective acceptor and donor levels were needed ...
40 CFR 205.57-3 - Test vehicle preparation.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test vehicle preparation. 205.57-3... PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-3 Test vehicle preparation. (a) Prior to the official test, the test vehicle selected in accordance with § 205-57-2 shall not...
TTCN-3 for distributed testing embedded systems
Blom, S.C.C.; Deiß, T.; Ioustinova, N.; Kontio, A.; Pol, van de J.C.; Rennoch, A.; Sidorova, N.; Virbitskaite, I.; Voronkov, A.
2007-01-01
Abstract. TTCN-3 is a standardized language for specifying and executing test suites that is particularly popular for testing embedded systems. Prior to testing embedded software in a target environment, the software is usually tested in the host environment. Executing in the host environment often
Directory of Open Access Journals (Sweden)
Martina A. Doblin
2016-04-01
Full Text Available The intensification of western boundary currents in the global ocean will potentially influence meso-scale eddy generation, and redistribute microbes and their associated ecological and biogeochemical functions. To understand eddy-induced changes in microbial community composition as well as how they control growth, we targeted the East Australian Current (EAC region to sample microbes in a cyclonic (cold-core eddy (CCE and the adjacent EAC. Phototrophic and diazotrophic microbes were more diverse (2–10 times greater Shannon index in the CCE relative to the EAC, and the cell size distribution in the CCE was dominated (67% by larger micro-plankton $(\\geq 20\\lrm{\\mu }\\mathrm{m}$ ≥ 20 μ m , as opposed to pico- and nano-sized cells in the EAC. Nutrient addition experiments determined that nitrogen was the principal nutrient limiting growth in the EAC, while iron was a secondary limiting nutrient in the CCE. Among the diazotrophic community, heterotrophic NifH gene sequences dominated in the EAC and were attributable to members of the gamma-, beta-, and delta-proteobacteria, while the CCE contained both phototrophic and heterotrophic diazotrophs, including Trichodesmium, UCYN-A and gamma-proteobacteria. Daily sampling of incubation bottles following nutrient amendment captured a cascade of effects at the cellular, population and community level, indicating taxon-specific differences in the speed of response of microbes to nutrient supply. Nitrogen addition to the CCE community increased picoeukaryote chlorophyll a quotas within 24 h, suggesting that nutrient uplift by eddies causes a ‘greening’ effect as well as an increase in phytoplankton biomass. After three days in both the EAC and CCE, diatoms increased in abundance with macronutrient (N, P, Si and iron amendment, whereas haptophytes and phototrophic dinoflagellates declined. Our results indicate that cyclonic eddies increase delivery of nitrogen to the upper ocean to potentially
International Nuclear Information System (INIS)
Anon.
1994-01-01
A bronze-process Nb 3 Sn conductor was measured as part of the second VAMAS (Versailles Project on Advanced Materials and Standards) international critical-current round robin. The conductor specifications are given in Table 15. The critical current was measured as a function of magnetic field and axial tensile strain. The measured data are presented in Table 16 and in Figs. 23 and 24. The I c and J c values are based on an electric field criterion (E c ) of 1 μV/cm. In the first VAMAS round robin tests, differences in the test specimens' axial strain, caused by variations in the thermal contraction of different test fixtures, was a major source of interlaboratory variation in the critical-current data. Consequently, electromechanical characterization of the test specimen is important for data interpretation and error analysis. In the second round robin, the test apparatus and procedure were more rigidly specified. This increased experimental control reduced the critical-current variation by a factor of 3.5. The results of our measurements will be published in the final VAMAS report
Kossyvakis, I; Faus-golfe, A
2007-01-01
The design of CLIC is based on a two-beam scheme, where short pulses of high power 30 GHz RF are extracted from a drive beam running parallel to the main beam. The 3rd generation CLIC Test Facility (CTF3) will demonstrate the generation of the drive beam with the appropriate time structure, the extraction of 30 GHz RF power from this beam, as well as acceleration of a probe beam with 30 GHz RF cavities. The project makes maximum use of existing equipment and infrastructure of the LPI complex, which became available after the closure of LEP.
Laessøe, Jeppe; Mochizuki, Yoko
2015-01-01
Climate change education (CCE) is a new phenomenon which is gaining increasing significance in the work of international organizations and international non-governmental organizations. Based primarily on a cross-national desk study of national policy documents relevant to CCE in 17 countries, which was commissioned by UNESCO to gain a robust…
Hematologia e bioquímica sérica de equinos de concurso completo de equitação em treinamento
Directory of Open Access Journals (Sweden)
J.M. Santiago
2013-04-01
Full Text Available Avaliaram-se a hematologia e a bioquímica sérica em equinos de concurso completo de equitação (CCE em treinamento durante testes de esforço incremental em esteira ergométrica de alta velocidade. Foram utilizados 16 equinos em delineamento experimental inteiramente ao acaso com quatro tratamentos e quatro repetições em esquema de parcelas subdivididas, utilizando-se como fontes de variação nos tratamentos a idade e o histórico de treinamento em CCE. As parcelas foram constituídas pelos testes incrementais realizados nas fases inicial e final do treinamento. As subparcelas foram representadas pelos tempos de avaliação e coletas. Os equinos do grupo experimental novos iniciantes apresentaram valor médio do hematócrito de 43,24%, sendo inferior ao hematócrito do grupo adultos iniciantes, 45,63%, novos experientes, 46,39%, e competidores, 47,74%. Houve diferença (P<0,05 entre os testes físicos realizados nas fases inicial e final do treinamento, com redução na concentração plasmática de glicose, de 112 para 98,88mg/dL, nas concentrações séricas de creatinina, de 1,41 para 1,29mg/dL, e de proteínas totais, de 6,52 para 6,38g/dL, na contagem de monócitos, de 0,54 para 0,48 10³/mm³, e com aumento na concentração plasmática de lactato, de 3,31 para 3,79mmol/L, na concentração sérica de ácido úrico, de 1,44 para 1,77mg/dL, no hematócrito, de 44,19 para 46,90%, na concentração de hemoglobina, de 14,33 para 15,10g/dL, e na contagem de leucócitos totais, de 9,26 para 9,61 10³/mm³. O treinamento dos equinos de CCE aumentou o condicionamento físico dos equinos, com maior capacidade de metabolização do lactato após o exercício e aumento nos valores basais do hematócrito e da concentração de hemoglobina.
Directory of Open Access Journals (Sweden)
Nina Kolleck
2017-10-01
Full Text Available While there is little doubt that social networks are essential for processes of implementing social innovations in community education such as Climate Change Education (CCE or Education for Sustainable Development (ESD, scholars have neglected to analyze these processes in the multilevel governance system using Social Network Analysis. In this article, we contribute to closing this research gap by exploring the implementation of CCE and ESD in education at the regional and global levels. We compare the way CCE is negotiated and implemented within and through the global conferences of the UN Framework Convention on Climate Change (UNFCCC with the way the UN Decade of ESD is put into practice through networks in five different German municipalities. We argue that the role of social networks is particularly strong in policy areas like CCE and ESD, which are best characterized as multi-level and multi-actor governance. Based on data derived from standardized surveys and from Twitter we analyze the complex interactions of public and private actors at different levels of governance in the two selected policy areas. We find, amongst others, that the implementation of CCE and ESD in community education depends in part on actors that had not been assumed to be influential at the outset. Furthermore, our analyses suggest the different levels of governance are not well integrated throughout the phases of the policy innovation cycle.
Phase Startup Initiative Phases 3 and 4 Test Plan and Test Specification ( OCRWM)
Energy Technology Data Exchange (ETDEWEB)
PAJUNEN, A.L.; LANGEVIN, M.J.
2000-08-07
Construction for the Spent Nuclear Fuel (SNF) Project facilities is continuing per the Level III Baseline Schedule, and installation of the Fuel Retrieval System (FRS) and Integrated Water Treatment System (IWTS) in K West Basin is now complete. In order to accelerate the project, a phased start up strategy to initiate testing of the FRS and IWTS early in the overall project schedule was proposed (Williams 1999). Wilkinson (1999) expands the definition of the original proposal into four functional testing phases of the Phased Startup Initiative (PSI). Phases 1 and 2 are based on performing functional tests using dummy fuel. This test plan provides overall guidance for Phase 3 and 4 tests, which are performed using actual irradiated N fuel assemblies. The overall objective of the Phase 3 and 4 testing is to verify how the FRS and IWTS respond while processing actual fuel. Conducting these tests early in the project schedule will allow identification and resolution of equipment and process problems before they become activities on the start-up critical path. The specific objectives of this test plan are to: Define the Phase 3 and 4 test scope for the FRS and IWTS; Provide detailed test requirements that can be used to write the specific test procedures; Define data required and measurements to be taken. Where existing methods to obtain these do not exist, enough detail will be provided to define required additional equipment; and Define specific test objectives and acceptance criteria.
Phase Startup Initiative Phases 3 and 4 Test Plan and Test Specification (OCRWM)
International Nuclear Information System (INIS)
PAJUNEN, A.L.; LANGEVIN, M.J.
2000-01-01
Construction for the Spent Nuclear Fuel (SNF) Project facilities is continuing per the Level III Baseline Schedule, and installation of the Fuel Retrieval System (FRS) and Integrated Water Treatment System (IWTS) in K West Basin is now complete. In order to accelerate the project, a phased start up strategy to initiate testing of the FRS and IWTS early in the overall project schedule was proposed (Williams 1999). Wilkinson (1999) expands the definition of the original proposal into four functional testing phases of the Phased Startup Initiative (PSI). Phases 1 and 2 are based on performing functional tests using dummy fuel. This test plan provides overall guidance for Phase 3 and 4 tests, which are performed using actual irradiated N fuel assemblies. The overall objective of the Phase 3 and 4 testing is to verify how the FRS and IWTS respond while processing actual fuel. Conducting these tests early in the project schedule will allow identification and resolution of equipment and process problems before they become activities on the start-up critical path. The specific objectives of this test plan are to: Define the Phase 3 and 4 test scope for the FRS and IWTS; Provide detailed test requirements that can be used to write the specific test procedures; Define data required and measurements to be taken. Where existing methods to obtain these do not exist, enough detail will be provided to define required additional equipment; and Define specific test objectives and acceptance criteria
2013-11-21
... airbag tests, Stapp Car Crash Journal, V44: 25-50. Since the Q3 had yet to show it was suitable for side... on May 2, 2002, 67 FR 21836. In early 2002, NHTSA tested a prototype version of the Q3s.\\6\\ NHTSA..., durability, and biofidelity. We determined that the thorax of the prototype appeared biofidelic and...
40 CFR Table 3 of Subpart Aaaaaaa... - Test Methods
2010-07-01
... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Test Methods 3 Table 3 of Subpart..., Subpt. AAAAAAA, Table 3 Table 3 of Subpart AAAAAAA of Part 63—Test Methods For * * * You must use * * * 1. Selecting the sampling locations a and the number of traverse points EPA test method 1 or 1A in...
Real Language Meets Real Business
Muirhead, Muirhead; Schechter, Sarah
2016-01-01
The Real Business Language Challenge was a collaborative pilot project between Coca-Cola Enterprises (CCE) and Routes into Languages East for Year 9 and 10 pupils. It was based on CCE's award-winning Real Business Challenge, part of its highly acclaimed education programme. The Real Business Language Challenge transformed the project into a…
Phased Startup Initiative Phases 3 and 4 Test Plan and Test Specification (OCRWM)
International Nuclear Information System (INIS)
PITNER, A.L.
2000-01-01
Construction for the Spent Nuclear Fuel (SNF) Project facilities is continuing per the Level III Baseline Schedule, and installation of the Fuel Retrieval System (FRS) and Integrated Water Treatment System (IWTS) in K West Basin is now complete. In order to accelerate the project, a phased start up strategy to initiate testing of the FRS and IWTS early in the overall project schedule was proposed (Williams 1999). Wilkinson (1999) expands the definition of the original proposal into four functional testing phases of the Phased Startup Initiative (PSI). Phases 1 and 2 are based on performing functional tests using dummy fuel. These tests are described in separate planning documents. This test plan provides overall guidance for Phase 3 and 4 tests, which are performed using actual irradiated N fuel assemblies. The overall objective of the Phase 3 and 4 testing is to verify how the FRS and IWTS respond while processing actual fuel. Conducting these tests early in the project schedule will allow identification and resolution of equipment and process problems before they become activities on the start-up critical path. The specific objectives of this test plan are to: (1) Define the test scope for the FRS and IWTS; (2) Provide detailed test requirements that can be used to write the specific test procedures; (3) Define data required and measurements to be taken. Where existing methods to obtain these do not exist, enough detail will be provided to define required additional equipment; and (4) Define specific test objectives and acceptance criteria
Background-Oriented Schlieren used in a hypersonic inlet test at NASA GRC
Clem, Michelle; Woike, Mark; Saunders, John
2016-01-01
Background Oriented Schlieren (BOS) is a derivative of the classical schlieren technology, which is used to visualize density gradients, such as shock wave structures in a wind tunnel. Changes in refractive index resulting from density gradients cause light rays to bend, resulting in apparent motion of a random background pattern. The apparent motion of the pattern is determined using cross-correlation algorithms (between no-flow and with-flow image pairs) producing a schlieren-like image. One advantage of BOS is its simplified setup which enables a larger field-of-view (FOV) than traditional schlieren systems. In the present study, BOS was implemented into the Combined Cycle Engine Large-Scale Inlet Mode Transition Experiment (CCE LIMX) in the 10x10 Supersonic Wind Tunnel at NASA Glenn Research Center. The model hardware for the CCE LIMX accommodates a fully integrated turbine based combined cycle propulsion system. To date, inlet mode transition between turbine and ramjet operation has been successfully demonstrated. High-speed BOS was used to visualize the behavior of the flow structures shock waves during unsteady inlet unstarts, a phenomenon known as buzz. Transient video images of inlet buzz were recorded for both the ramjet flow path (high speed inlet) and turbine flow path (low speed inlet). To understand the stability limits of the inlet, operation was pushed to the point of unstart and buzz. BOS was implemented in order to view both inlets simultaneously, since the required FOV was beyond the capability of the current traditional schlieren system. An example of BOS data (Images 1-6) capturing inlet buzz are presented.
40 CFR Table 3 of Subpart Bbbbbbb... - Test Methods
2010-07-01
... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Test Methods 3 Table 3 of Subpart... 3 Table 3 of Subpart BBBBBBB of Part 63—Test Methods For * * * You must use * * * 1. Selecting the sampling locations a and the number of traverse points EPA test method 1 or 1A in appendix A to part 60. 2...
Eddy Mediated Nutrient Pattern in the North Eastern Arabian Sea
Thachaparambil, M.; Moolakkal Antony, R.; B R, S.; V N, S.; N, C.; M, S.
2016-02-01
A Cold Core Eddy (CCE) mediated nutrient pattern in the North Eastern Arabian Sea (NEAS) is explained based on in situ measurments during March 2013 onboard FORV Sagar Sampada which was not reported earlier in the area. Samples for physical, chemical and biological parameters were collected in 5 stations along the diameter of the eddy and following standard protocols. The core of the CCE is identified at 21°20.38'N; 66°30.68'E with a diameter of 120Km. Earlier studies explaining the process and the forcing mechanism of the particular eddy records that, the eddy is short term (1-3 months) and is regular during the season. Surface waters were well oxygenated (>4.8 ml L-1) in the core. Surface value of nutrients viz., Nitrate, Nitrite, Silicate and phosphate in the core regions was 0.9µM, 0.01 µM, 0.5 µM and 0.7 µM respectively indicating upwelling in the core. Spring intermonsoon (SIM) is generally termed as a transition period between the active winter and summer seasons and as per earlier studies, high biological production and the regularly occurring Noctilica bloom is supported by the nutrient loading due to convective mixing during winter as well as regenerated production. However, present observations shows that, nutrient pumping due to the upwelling associated with the CCE also contributes for sustaining high biological production and are evident in the Chl a and mesozooplankton biovolume which records values of 4.35mg/m3 and 1.09ml/m3 respectively in the core. An intense Noctiluca blooms observed in the western flank of the eddy (Chl a 13.25 mg/m3; cell density 5.8×106 cells/litre), where Nitrate concentration records 1.04µM explains the role of such mesoscale processes in the sustenance of the HAB events. While eastern flank of the CCE showed typical open ocean condition of the season showing Nitrate 0.08µM; Chl a 0.23mg/m3; and phytoplankton cell density as 421 cells/litre. Keywords: Cold core eddy, nutrients, NEAS, SIM, biological production
Acceptance test report, 241-SY-101 Flexible Receiver System, Phase 3 testing
International Nuclear Information System (INIS)
Ritter, G.A.
1995-01-01
This document summarizes the results of the phase 3 acceptance test of the 241-SY-101 Flexible Receiver System (FRS). The purpose of this acceptance test is to verify the sealing integrity of the FRS to ensure that the release of waste and aerosols will be minimized during the removal of the test mixer pump from Tank 241-SY-101. The FRS is one of six major components of the Equipment Removal System, which has been designed to retrieve, transport, and store the mixer pump. This acceptance test was performed at the 306E Facility in the 300 area from January 10, 1995 to January 17, 1995. The Phase 3 test consisted of two parts. Part one was a water leak test of the seal between the blast shield and mock load distribution frame (LDF) to ensure that significant contamination of the pump pit and waste interaction with the aluminum impact-limiting material under the LDF are prevented during the pump removal operation. The second part of this acceptance test was an air leak test of the assembled flexible receiver system. The purpose of this test was to verify that the release of hazardous aerosols will be minimized if the tank dome pressure becomes slightly positive during the decontamination of the mixer pump
International Nuclear Information System (INIS)
Lopez, R.E.; Lui, A.T.Y.
1990-01-01
This study presents observations made by four spacecraft (AMPTE CCE, AMPTE IRM, GOES 5, and GOES 6) and two ground stations (San Juan and Tucson) during a substorm that occurred at ∼0830 UT on April 19, 1985. The spacecraft were arrayed in a configuration that allows for the examination of the spatial evolution of the substorm current wedge, CCE was located between the GOES spacecraft in longitude, but at a radial distance of 8.0 R E . IRM was located west of the other three spacecraft in the same sector as Tucson, but at a radial distance of 11.6 R E . The relative times at which the signature of the substorm current wedge was first observed at the GOES spacecraft and the ground stations are consistent with a simple longitudinally expanding current wedge. However, the times at which IRM and CCE observed the current wedge are not consistent with a current wedge that expanded only longitudinally, IRM first observed the signature of the current wedge at about the same time the signature was observed by GOES 6 and Tucson, and CCE observed the current wedge only after both GOES satellites and the ground stations had done so. Moreover, both GOES spacecraft observed signatures consistent with entry into the central plasma sheet before CCE and IRM did, even though we estimate that CCE was slightly closer to the neutral sheet than the geosynchronous spacecraft. The sequence of events suggests that during this substorm the disruption of the cross-tail current sheet, the formation of the substorm current wedge, and the expansion of the plasma sheet began in the near-Earth region, and subsequently spread tailward as well as longitudinally
Use of Computer-based Clinical Examination for Assessment of ...
African Journals Online (AJOL)
This was used to assess medical students' higher knowledge and problem solving skills in surgery. We present how we did it, test scores descriptive ... Conclusion: CCE is feasible. It inherits the validity and reliability of the ViPSCE with the added advantage of improving the viewing of the slides. It proved popular with the ...
International Nuclear Information System (INIS)
Mullins, C.B.; Felde, D.K.; Sutton, A.G.; Gould, S.S.; Morris, D.G.; Robinson, J.J.
1982-05-01
Reduced instrument responses are presented for Thermal-Hyraulic Test Facility (THTF) Test 3.06.6B. This test was conducted by members of the Oak Ridge National Laboratory Pressurized-Water-Reactor (PWR) Blowdown Heat Transfer (BDHT) Separate-Effects Program on August 29, 1980. The objective of the program was to investigate heat transfer phenomena believed to occur in PWR's during accidents, including small and large break loss-of-coolant accidents. Test 3.06.6B was conducted to obtain transient film boiling data in rod bundle geometry under reactor accident-type conditions. The primary purpose of this report is to make the reduced instrument responses for THTF Test 3.06.6B available. Included in the report are uncertainties in the instrument responses, calculated mass flows, and calculated rod powers
Directory of Open Access Journals (Sweden)
István Rácz
2010-02-01
Full Text Available Although capsule retention is a known complication of small bowel capsule endoscopy, initial studies with colon capsule endoscopy (CCE have not reported any capsule retention or sticking neither in the small bowel nor in the colon. We report a complication of CCE when the stuck colon capsule was passed through the malignant colon stricture and removed by the aid of a flexible colonoscope. During CCE in a 76-year-old iron deficiency anemia patient the real-time viewing system indicated the colon capsule to be stuck in a malignant ascending colon stricture for more than two hours. With the aim to avoid complete capsule retention, immediate colonoscopy was performed. The stuck capsule was caught by a polypectomy snare, passed through the tumor stricture and finally removed from the large bowel. The current case describes the usefulness of the real-time viewing system. Similar situations may occur during the forthcoming spread of CCE and the present case is an example of how to manage the potentially risky stuck colon capsule condition.
Prototype Repository. Tracer dilution tests during operation phase, test campaign 3
Energy Technology Data Exchange (ETDEWEB)
Harrstroem, Johan; Andersson, Peter (Geosigma AB (Sweden))
2010-05-15
The Prototype Repository project is focused on testing and demonstrating the function of the SKB deep repository system. The third tracer dilution campaign during the Prototype Repository operation period was performed in January 2010. The purpose was to estimate the groundwater flows and hydraulic gradients in the boreholes vicinity and will function as a reference for comparison with results from modeling and prior assumptions. The test campaign consisted of tracer dilution tests in 13 different borehole sections. Each test consisted of approximately 15-55 min tracer injection time and about 1-3 days dilution test time depending on the transmissivity of the test section. The data interpretation also included estimates of the local hydraulic gradients in the vicinity of the borehole sections
ACER Spelling Test: Years 3-6. Handbook.
Australian Council for Educational Research, Hawthorn.
The Australian Council for Educational Research (ACER) Spelling Test is designed to measure levels of achievement in spelling and comprises Test Cards, Answer Sheets, Class Analysis Charts and Handbook. The test itself is divided into four parts, one part for each of years 3 through 6 with each part consisting of 50 words. Directions for…
Evaluation report on SCTF Core-III tests S3-7 and S3-8
International Nuclear Information System (INIS)
Okubo, Tsutomu; Iguchi, Tadashi; Iwamura, Takamichi
1990-03-01
It has been said that the Emergency Core Cooling (ECC) water injected into the hot legs flows into the upper plenum and then falls back to the core (i.e. break-through) during reflood phase in a German type Pressurized Water Reactor (GPWR) with the combined-injection-type ECCS, and that the break-through occurs where the water temperature at the tie plate area is lower and subcooled. Based on this information two tests were conducted with the Slab Core Test Facility (SCTF) Core-III in order to investigate the effects of the water temperature distribution at the tie plate area on the break-through and the core cooling. In these tests, the subcooled ECC water was injected just above the Upper Core Support Plate (UCSP) in order to establish the desired water temperature distribution at the tie plate area. In one test (Test S3-7) the ECC water injection above the UCSP was performed above Bundles 3 and 4, and in the other test (Test S3-8) above Bundles 7 and 8 during initial 60 s a and then was changed to above Bundles 3 and 4. The test data were compared with those of Test S3-SH1, in which the injection was performed above Bundles 7 and 8 and the other test conditions were the same as in Tests S3-7 and S3-8. Analyzing these test data, the following has been found: The break-through occurs where the water temperature at the tie plate area is subcooled and the core cooling is enhanced significantly in the break-through region. The break-through location changes, with some time lag, following the change of the water temperature distribution at the tie plate area. Furthermore, the core cooling in the non-break-through regions is almost the same regardless of the location of the break-through. (author)
Integral test of JENDL-3.3 for fast reactors
International Nuclear Information System (INIS)
Chiba, Gou
2003-01-01
An integral test of JENDL-3.3 was performed for fast reactors. Various types of fast reactors were analyzed. Calculation values of the nuclear characteristics were greatly especially affected by the revisions of the cross sections of U-235 capture and elastic scattering reactions. The C/E values were improved for ZPPR cross where plutonium is mainly fueled, but not for BFS cores where uranium is mainly fueled. (author)
Developing a TTCN-3 Test Harness for Legacy Software
DEFF Research Database (Denmark)
Okika, Joseph C.; Ravn, Anders Peter; Siddalingaiah, Lokesh
2006-01-01
We describe a prototype test harness for an embedded system which is the control software for a modern marine diesel engine. The operations of such control software requires complete certification. We adopt Testing and Test Control Notation (TTCN-3) to define test cases for this purpose. The main...... challenge in developing the test harness is to interface a generic test driver to the legacy software and provide a suitable interface for test engineers. The main contribution of this paper is a demonstration of a suitable design for such a test harness. It includes: a TTCN-3 test driver in C++, the legacy...
Test results of Nb3Sn ribbons for the Princeton D coil test program
International Nuclear Information System (INIS)
Kaugerts, J.; File, J.; Willard, J.W.
1974-10-01
A previously described D coil test program was modified. Details of a smaller Nb 3 Sn D coil test program are described. Cusp coil tests were made with several Nb 3 Sn composite ribbons. Measurements of both the quench and recovery currents as a function of magnetic field component perpendicular to the wide edge of the ribbon are presented. (auth)
Integral test of JENDL-3.3 for thermal reactors
International Nuclear Information System (INIS)
Okumura, Keisuke; Mori, Takamasa
2003-01-01
Criticality benchmark testing was carried out for 59 experiments in various thermal reactors using a continues-energy Monte Carlo code MVP and its different libraries generated from JENDL-3.2, JENDL-3.3, JEF-2.2 and ENDF/B-VI (R8). From the benchmark results, we can say JENDL-3.3 generally gives better k eff values compared with other nuclear data libraries. However, further modification of JENDL-3.3 is expected to solve the following problems: 1) systematic underestimation of k eff depending on 235 U enrichment for the cores with low (less than 3wt.%) enriched uranium fueled cores, 2) dependence of C/E value of k eff on neutron spectrum and plutonium composition for MOX fueled cores. These are common problems for all of the nuclear data libraries used in this study. (author)
Makwana, J P; Joshi, Asim Kumar; Athawale, Gaurav; Singh, Dharminder; Mohanty, Pravakar
2015-02-01
An experimental study of air gasification of rice husk was conducted in a bench-scale fluidized bed gasifier (FBG) having 210 mm diameter and 1600 mm height. Heating of sand bed material was performed using conventional charcoal fuel. Different operating conditions like bed temperature, feeding rate and equivalence ratio (ER) varied in the range of 750-850 °C, 25-31.3 kg/h, and 0.3-0.38, respectively. Flow rate of air was kept constant (37 m(3)/h) during FBG experiments. The carbon conversion efficiencies (CCE), cold gas efficiency, and thermal efficiency were evaluated, where maximum CCE was found as 91%. By increasing ER, the carbon conversion efficiency was decreased. Drastic reduction in electric consumption for initial heating of gasifier bed with charcoal compared to ceramic heater was ∼45%. Hence rice husk is found as a potential candidate to use directly (without any processing) in FBG as an alternative renewable energy source from agricultural field. Copyright © 2014 Elsevier Ltd. All rights reserved.
Prato, Tony; Fagre, Daniel B.
2007-01-01
Prato and Fagre offer the first systematic, multi-disciplinary assessment of the challenges involved in managing the Crown of the Continent Ecosystem ( CCE), an area of the Rocky Mountains that includes northwestern Montana, southwestern Alberta, and southeastern British Columbia. The spectacular landscapes, extensive recreational options, and broad employment opportunities of the CCE have made it one of the fastest growing regions in the United States and Canada, and have lead to a shift in its economic base from extractive resource industries to service-oriented recreation and tourism industries. In the process, however, the amenities and attributes that draw people to this “New West” are under threat. Pastoral scenes are disappearing as agricultural lands and other open spaces are converted to residential uses, biodiversity is endangered by the fragmentation of fish and wildlife habitats, and many areas are experiencing a decline in air and water quality. Sustaining Rocky Mountain Landscapes provides a scientific basis for communities to develop policies for managing the growth and economic transformation of the CCE without sacrificing the quality of life and environment for which the land is renowned. This forthcoming edited volume focuses on five aspects of sustaining mountain landscapes in the CCE and similar regions in the Rocky Mountains. The five aspects are: 1) how social, economic, demo graphic and environmental forces are transforming ecosystem structure and function, 2) trends in use and conditions for human and environmental resources, 3) activating science, policy and education to enhance sustainable landscape management, 4) challenges to sustainable management of public and private lands, and 5) future prospects for achieving sustainable landscapes.
Diagnostic validation of three test methods for detection of cyprinid herpesvirus 3 (CyHV-3).
Clouthier, Sharon C; McClure, Carol; Schroeder, Tamara; Desai, Megan; Hawley, Laura; Khatkar, Sunita; Lindsay, Melissa; Lowe, Geoff; Richard, Jon; Anderson, Eric D
2017-03-06
Cyprinid herpesvirus 3 (CyHV-3) is the aetiological agent of koi herpesvirus disease in koi and common carp. The disease is notifiable to the World Organisation for Animal Health. Three tests-quantitative polymerase chain reaction (qPCR), conventional PCR (cPCR) and virus isolation by cell culture (VI)-were validated to assess their fitness as diagnostic tools for detection of CyHV-3. Test performance metrics of diagnostic accuracy were sensitivity (DSe) and specificity (DSp). Repeatability and reproducibility were measured to assess diagnostic precision. Estimates of test accuracy, in the absence of a gold standard reference test, were generated using latent class models. Test samples originated from wild common carp naturally exposed to CyHV-3 or domesticated koi either virus free or experimentally infected with the virus. Three laboratories in Canada participated in the precision study. Moderate to high repeatability (81 to 99%) and reproducibility (72 to 97%) were observed for the qPCR and cPCR tests. The lack of agreement observed between some of the PCR test pair results was attributed to cross-contamination of samples with CyHV-3 nucleic acid. Accuracy estimates for the PCR tests were 99% for DSe and 93% for DSp. Poor precision was observed for the VI test (4 to 95%). Accuracy estimates for VI/qPCR were 90% for DSe and 88% for DSp. Collectively, the results show that the CyHV-3 qPCR test is a suitable tool for surveillance, presumptive diagnosis and certification of individuals or populations as CyHV-3 free.
Energy Technology Data Exchange (ETDEWEB)
Zayas, Jose R.; Johnson, Wesley D.
2008-03-01
In support of a Work-For-Other (WFO) agreement between the Wind Energy Technology Department at Sandia National Laboratories and 3TEX, one of the three Micon 65/13M wind turbines at the USDA Agriculture Research Service (ARS) center in Bushland, Texas, has been used to test a set of 9 meter wind turbine blades, manufactured by TPI composites using the 3TEX carbon material for the spar cap. Data collected from the test has been analyzed to evaluate both the aerodynamic performance and the structural response from the blades. The blades aerodynamic and structural performance, the meteorological inflow and the wind turbine structural response has been monitored with an array of 57 instruments: 15 to characterize the blades, 13 to characterize inflow, and 15 to characterize the time-varying state of the turbine. For the test, data was sampled at a rate of 40 Hz using the ATLAS II (Accurate GPS Time-Linked Data Acquisition System) data acquisition system. The system features a time-synchronized continuous data stream and telemetered data from the turbine rotor. This paper documents the instruments and infrastructure that have been developed to monitor these blades, turbines and inflow, as well as both modeling and field testing results.
Directory of Open Access Journals (Sweden)
Ewa Bacia
2017-09-01
Findings: Findings: The results of the case studies provide numerous insights into the issue’s complexity and highlight the need to discuss the goals as well as different models of CCE more broadly. Since the understanding of goals and appropriate means of CCE differs strongly depending on cultural and school context, analyzing CCE in the context of heterogeneity in democratic societies implies multidimensional questions. Practical implications: Future research needs to include more members of the studied school communities in the process of participatory action research: Deeper insight into the field can be achieved by integrating multiple perspectives. At the same time more members of the school community can reflect on the study outcomes, which might facilitate their direct implementation into practice.
A statistical study of magnetic field magnitude changes during substorms in the near earth tail
Lopez, R. E.; Lui, A. T. Y.; Mcentire, R. W.; Potemra, T. A.; Krimigis, S. M.
1990-01-01
Using AMPTE/CCE data taken in 1985 and 1986 when the CCE apogee (8.8 earth radii) was within 4.5 hours of midnight, 167 injection events in the near-earth magnetotail have been cataloged. These events are exactly or nearly dispersionless on a 72-sec time scale from 25 keV to 285 keV. The changes in the field magnitude are found to be consistent with the expected effects of the diversion/disruption of the cross-tail current during a substorm, and the latitudinal position of the current sheet is highly variable within the orbit of CCE. The local time variation of the magnetic-field changes implies that the substorm current wedge is composed of longitudinally broad Birkeland currents.
Testing of the 3M Company Composite Conductor
Energy Technology Data Exchange (ETDEWEB)
Stovall, John P [ORNL; Rizy, D Tom [ORNL; Kisner, Roger A [ORNL
2010-10-01
The 3M Company has developed a high-temperature low-sag conductor referred to as Aluminum-Conductor Composite-Reinforced or ACCR. The conductor uses an aluminum metal matrix material to replace the steel in conventional conductors. The objective of this work is to accelerate the commercial acceptance by electric utilities of this new conductor design by testing four representative conductor classes in controlled conditions. A unique facility called the Powerline Conductor Accelerated Testing (PCAT) Facility was built at ORNL for testing overhead conductors. The PCAT has been uniquely designed for testing overhead bare transmission line conductors at high currents and temperatures after they have been installed and tensioned to the manufacturer's specifications. The ability to operate a transmission line conductor in this manner does not exist elsewhere in the United States. Four classes of ACCR cable designed by the 3M Company have been successfully test at ORNL small, medium, large and small/compact. Based on these and other manufacturer tests, the 3M Company has successfully introduced the ACCR into the commercial market and has completed over twenty installations for utility companies.
Patwardhan, Supriya; Dasari, Srikanth; Bhagavatula, Krishna; Mueller, Steffen; Deepak, Saligrama Adavigowda; Ghosh, Sudip; Basak, Sanjay
2015-01-01
An efficient PCR-based method to trace genetically modified food and feed products is in demand due to regulatory requirements and contaminant issues in India. However, post-PCR detection with conventional methods has limited sensitivity in amplicon separation that is crucial in multiplexing. The study aimed to develop a sensitive post-PCR detection method by using PCR-chip capillary electrophoresis (PCR-CCE) to detect and identify specific genetically modified organisms in their genomic DNA mixture by targeting event-specific nucleotide sequences. Using the PCR-CCE approach, novel multiplex methods were developed to detect MON531 cotton, EH 92-527-1 potato, Bt176 maize, GT73 canola, or GA21 maize simultaneously when their genomic DNAs in mixtures were amplified using their primer mixture. The repeatability RSD (RSDr) of the peak migration time was 0.06 and 3.88% for the MON531 and Bt176, respectively. The RSD (RSDR) of the Cry1Ac peak ranged from 0.12 to 0.40% in multiplex methods. The method was sensitive in resolving amplicon of size difference up to 4 bp. The PCR-CCE method is suitable to detect multiple genetically modified events in a composite DNA sample by tagging their event specific sequences.
Experiment data report for Semiscale Mod-1 Test S-05-3 (alternate ECC injection test)
International Nuclear Information System (INIS)
Feldman, E.M.; Patton, M.L. Jr.; Sackett, K.E.
1977-03-01
Recorded test data are presented for Test S-05-3 of the Semiscale Mod-1 alternate ECC injection test series. These tests are among several Semiscale Mod-1 experiments conducted to investigate the thermal and hydraulic phenomena accompanying a hypothesized loss-of-coolant accident in a pressurized water reactor (PWR) system. Test S-05-3 was conducted from initial conditions of 2263 psia and 545 0 F to investigate the response of the Semiscale Mod-1 system to a depressurization and reflood transient following a simulated double-ended offset shear of the cold leg broken loop piping. During the test, cooling water was injected into the cold leg sides of the intact and broken loops and into the vessel upper plenum to simulate emergency core coolant injection in a PWR. For Test S-05-3, specifically the effects of upper plenum coolant injection on core thermal and system response were being investigated
Cytotoxic effects of betaxolol on healthy corneal endothelial cells both in vitro and in vivo
Directory of Open Access Journals (Sweden)
Ying Miao
2014-02-01
Full Text Available AIM: To demonstrate the cytotoxic effect of betaxolol and its underlying mechanism on human corneal endothelial cells(HCE cells in vitro and cat corneal endothelial cells(CCE cells in vivo, providing experimental basis for safety anti-glaucoma drug usage in clinic of ophthalmology.METHODS: In vivo and in vitro experiments were conducted to explore whether and how betaxolol participates in corneal endothelial cell injury. The in vitro morphology, growth status, plasma membrane permeability, DNA fragmentation, and ultrastructure of HCE cells treated with 0.021875-0.28g/L betaxolol were examined by light microscope, 3-(4,5-dimethylthiahiazo (-z-y1-3,5-di-phenytetrazoliumromide (MTT assay, acridine orange (AO/ethidium bromide (EB double-fluorescent staining, DNA agarose gel electrophoresis, and transmission electron microscope (TEM. The in vivo density, morphology, and ultrastructure of CCE cells, corneal thickness, and eye pressure of cat eyes treated with 0.28g/L betaxolol were investigated by specular microscopy, applanation tonometer, alizarin red staining, scanning electron microscope (SEM, and TEM.RESULTS: Exposure to betaxolol at doses from 0.0875g/L to 2.8g/L induced morphological and ultrastructural changes of in vitro cultured HCE cells such as cytoplasmic vacuolation, cellular shrinkage, structural disorganization, chromatin condensation, and apoptotic body appearance. Simultaneously, betaxolol elevated plasma membrane permeability and induced DNA fragmentation of these cells in a dose-dependent manner in AO/EB staining. Furthermore, betaxolol at a dose of 2.8g/L also induced decrease of density of CCE cells in vivo, and non-hexagonal and shrunk apoptotic cells were also found in betaxolol-treated cat corneal endothelia.CONCLUSION: Betaxolol has significant cytotoxicity on HCE cells in vitro by inducing apoptosis of these cells, and induced apoptosis of CCE cells in vivo as well. The findings help provide new insight into the apoptosis
International Nuclear Information System (INIS)
Hoedlmoser, H.; Moll, M.; Haerkoenen, J.; Kronberger, M.; Trummer, J.; Rodeghiero, P.
2007-01-01
Epitaxial (EPI) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of 150μm thick EPI silicon diodes irradiated with 24GeV/c protons up to a fluence of 3x10 15 p/cm 2 has been performed by means of Charge Collection Efficiency (CCE) measurements, investigations with the Transient Current Technique (TCT) and standard CV/IV characterizations. The aim of the work was to investigate the impact of radiation damage as well as the influence of the wafer processing on the material performance by comparing diodes from different manufacturers. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. While the generation of leakage current due to irradiation is similar in all investigated series of detectors, a difference in the effective doping concentration can be observed after irradiation. In the CCE measurements an anomalous drop in performance was found even for diodes exposed to very low fluences (5x10 13 p/cm 2 ) in all measured series. This result was confirmed for one series of diodes in TCT measurements with an infrared laser. TCT measurements with a red laser showed no type inversion up to fluences of 3x10 15 p/cm 2 for n-type devices whereas p-type diodes undergo type inversion from p- to n-type for fluences higher than ∼2x10 14 p/cm 2
46 CFR 57.06-3 - Method of performing production testing.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Method of performing production testing. 57.06-3 Section 57.06-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING WELDING AND BRAZING Production Tests § 57.06-3 Method of performing production testing. (a) Except as...
Lennon, Pat; Atuhaire, Brian; Yavari, Shahrzad; Sampath, Vidya; Mvundura, Mercy; Ramanathan, Nithya; Robertson, Joanie
2017-04-19
Vaccine cold chain equipment (CCE) in developing countries is often exposed to harsh environmental conditions, such as extreme temperatures and humidity, and is subject to many additional challenges, including intermittent power supply, insufficient maintenance capacity, and a scarcity of replacement parts. Together, these challenges lead to high failure rates for refrigerators, potentially damaging vaccines and adversely affecting immunization coverage. Providing a sustainable solution for improving CCE performance requires an understanding of the root causes of failure. Project teams conducted small-scale studies to determine the root causes of CCE failure in selected locations in Uganda and Mozambique. The evaluations covered 59 failed refrigerators and freezers in Uganda and 27 refrigerators in Mozambique. In Uganda, the vast majority of failures were due to a cooling unit fault in one widely used refrigerator model. In Mozambique, 11 of the 27 problems were attributable to solar refrigerators with batteries that were unable to hold a charge, and another eight problems were associated with a need to adjust thermostat settings. The studies showed that tracking and evaluation of equipment performance and failure can yield important, actionable information for a range of stakeholders, including local CCE technicians, the ministry of health, equipment manufacturers, and international partners such as the United Nations Children's Fund, World Health Organization, and Gavi, the Vaccine Alliance. Collaborative efforts to systematically collect and communicate data on CCE performance and causes of failure will help to improve the efficiency and reach of immunization programs in low- and middle-income countries. Copyright © 2016 The Author(s). Published by Elsevier Ltd.. All rights reserved.
Avanços na abordagem do carcinoma precoce de esôfago
Directory of Open Access Journals (Sweden)
Vitor Arantes
Full Text Available Nos países ocidentais, o carcinoma de células escamosas de esôfago (CCE geralmente é detectado em estágio avançado, quando as possibilidades de cura são remotas e o prognóstico reservado. Entretanto, nos anos recentes, ocorreu uma série de avanços na abordagem do CCE de esôfago, tais como a identificação dos grupos de risco para o surgimento desta neoplasia; o uso da endoscopia de alta resolução e cromoendoscopia com lugol favorecendo o diagnóstico do CCE em estágios iniciais; e o desenvolvimento de técnicas endoscópicas de ressecção tumoral endoluminal em monobloco denominada dissecção endoscópica de submucosa. Este progresso tem possibilitado a aplicação do tratamento endoscópico minimamente invasivo com potencial curativo em pacientes selecionados com CCE superficial de esôfago. O presente artigo de revisão, elaborado por um grupo multicêntrico internacional, tem como objetivo primário contribuir para o entendimento dos principais avanços recentes ocorridos no manejo do CCE precoce de esôfago. Como objetivo secundário, pretende propiciar uma revisão detalhada e minuciosa da estratégia técnica de DES desenvolvida pelos experts japoneses, de forma a colaborar para a difusão deste conceito e a incorporação destas tecnologias na Medicina Brasileira e Latino-americana.
International Nuclear Information System (INIS)
Verbitskaya, E.; Abreu, M.; Anbinderis, P.; Anbinderis, T.; D'Ambrosio, N.; Boer, W. de; Borchi, E.; Borer, K.; Bruzzi, M.; Buontempo, S.; Casagrande, L.; Chen, W.; Cindro, V.; Dezillie, B.; Dierlamm, A.; Eremin, V.; Gaubas, E.; Gorbatenko, V.; Granata, V.; Grigoriev, E.; Grohmann, S.; Hauler, F.; Heijne, E.; Heising, S.; Hempel, O.; Herzog, R.; Haerkoenen, J.; Ilyashenko, I.; Janos, S.; Jungermann, L.; Kalesinskas, V.; Kapturauskas, J.; Laiho, R.; Li, Z.; Mandic, I.; De Masi, Rita; Menichelli, D.; Mikuz, M.; Militaru, O.; Niinikoski, T.O.; O'Shea, V.; Pagano, S.; Palmieri, V.G.; Paul, S.; Perea Solano, B.; Piotrzkowski, K.; Pirollo, S.; Pretzl, K.; Rato Mendes, P.; Ruggiero, G.; Smith, K.; Sonderegger, P.; Sousa, P.; Tuominen, E.; Vaitkus, J.; Da Via, C.; Wobst, E.; Zavrtanik, M.
2003-01-01
The recovery of the charge collection efficiency (CCE) at low temperatures, the so-called 'Lazarus effect', was studied in Si detectors irradiated by fast reactor neutrons, by protons of medium and high energy, by pions and by gamma-rays. The experimental results show that the Lazarus effect is observed: (a) after all types of irradiation; (b) before and after space charge sign inversion; (c) only in detectors that are biased at voltages resulting in partial depletion at room temperature. The experimental temperature dependence of the CCE for proton-irradiated detectors shows non-monotonic behaviour with a maximum at a temperature defined as the CCE recovery temperature. The model of the effect for proton-irradiated detectors agrees well with that developed earlier for detectors irradiated by neutrons. The same midgap acceptor-type and donor-type levels are responsible for the Lazarus effect in detectors irradiated by neutrons and by protons. A new, abnormal 'zigzag'-shaped temperature dependence of the CCE was observed for detectors irradiated by all particles (neutrons, protons and pions) and by an ultra-high dose of γ-rays, when operating at low bias voltages. This effect is explained in the framework of the double-peak electric field distribution model for heavily irradiated detectors. The redistribution of the space charge region depth between the depleted regions adjacent to p + and n + contacts is responsible for the 'zigzag'- shaped curves. It is shown that the CCE recovery temperature increases with reverse bias in all detectors, regardless of the type of radiation
Isopropyl alcohol tank installed at A-3 Test Stand
2009-01-01
An isopropyl alcohol (IPA) tank is lifted into place at the A-3 Test Stand being built at NASA's John C. Stennis Space Center. Fourteen IPA, water and liquid oxygen (LOX) tanks are being installed to support the chemical steam generators to be used on the A-3 Test Stand. The IPA and LOX tanks will provide fuel for the generators. The water will allow the generators to produce steam that will be used to reduce pressure inside the stand's test cell diffuser, enabling operators to simulate altitudes up to 100,000 feet. In that way, operators can perform the tests needed on rocket engines being built to carry humans back to the moon and possibly beyond. The A-3 Test Stand is set for completion and activation in 2011.
A simple semipaced 3-minute chair rise test for routine exercise tolerance testing in COPD
Directory of Open Access Journals (Sweden)
Aguilaniu B
2014-09-01
Full Text Available Bernard Aguilaniu,1,2 Hubert Roth,3 Jesus Gonzalez-Bermejo,4 Marie Jondot,5 Jocelyne Maitre,5 François Denis,6 Thomas Similowski4,7 1Medicine Faculty, Université Joseph Fourier, Grenoble, France; 2McGill University, Montreal, Canada; 3Centre de Recherche en Nutrition Humaine Rhône-Alpes, CHU Grenoble, France; 4Assistance Publique-Hôpitaux de Paris, Groupe Hospitalier Pitié-Salpêtrière, Respiratory and Intensive Care Medicine, Paris, France; 5Clinique Universitaire de Pneumologie, CHU Grenoble, France, Grenoble, France; 6Boehringer Ingelheim, 7Université Paris, Paris, France Abstract: The functional work capacity of chronic obstructive pulmonary disease (COPD patients is usually assessed with walk tests such as the 6-minute walk test (6MWT or the shuttle test. Because these exercise modalities require a controlled environment which limits their use by pulmonologists and severely restricts their use among general practitioners, different modalities of a short (1 minute or less sit-to-stand test were recently proposed. In this study, we evaluated a new modality of a semipaced 3-minute chair rise test (3CRT in 40 patients with COPD, and compared the reproducibility of physiological responses and symptoms during the 3CRT and their interchangeability with the 6MWT. The results demonstrate that physiological variables, heart rate, pulse oxygen saturation, work done, and symptoms (Borg dyspnea and fatigue scores, during the 3CRT were highly reproducible, and that the physiological responses and symptoms obtained during the 3CRT and the 6MWT were interchangeable for most patients. Moreover, these preliminary data suggest that patients able to perform more than 50 rises during 3 minutes had no significant disability. The simplicity and ease of execution of the 3CRT will facilitate the assessment of exercise symptoms and disability in COPD patients during routine consultations with pulmonologists and general practitioners, and will thus contribute
Nebraska Prostate Cancer Research Program
2014-10-01
Music tinyurl.co m/cce7atz :30 pm...Book Club Tempo of Twilight tinyurl.co m/7wqzx pq 7PM Fireside Chat Ayman El- Mohandes Arts Festival tinyurl.com /7fgzp5g Arts Festival ...t a n d T a le n t S h o w :30 pm 06 :00 pm VP Music tinyurl.co m/cce7atz :30 pm Book
Evaluation report on SCTF Core-III Test S3-22
International Nuclear Information System (INIS)
Okubo, Tsutomu; Iguchi, Tadashi; Iwamura, Takamichi; Akimoto, Hajime; Ohnuki, Akira; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.
1991-07-01
Two tests (Tests S3-20 and S3-22) were conducted with JAERI's Slab Core Test Facility (SCTF) Core-III in order to investigate water break-through and core cooling behaviors under the intermittent ECC water delivery from the hot legs to one location in the upper plenum and the alternate ECC water delivery to two locations in the upper plenum during reflooding, respectively. This report presents an analysis on Test S3-22 (the alternate case). Subcooled ECC water was injected alternately just above the upper core support plate above Bundles 7 and 8 and Bundles 3 and 4. The total injection rate from both injection ports was the same as that in SCTF Test S3-20 and Test S3-13. Analyzing the test data together with those of Tests S3-13 and S3-20 the following has been found: (1) Alternate break-through occurred immediately corresponding to the alternate ECC water injection except for one period, during which no break-through was observed. However, there observed a difference in break-through behavior that break-through was strong above the low power region, whereas weak above the high power region. (2) Although its break-through behavior was different, nearly the same core cooling as in the continuous or intermittent ECC water delivery case was observed except for the period around quench. (3) Around quench time, degraded core cooling comparing to the continuous or intermittent ECC water delivery case was observed. That is, quench time at the midplane level of the present test was 35 s later than in the continuous case. This is considered to result from decrease in core water inventory caused by water sealing at the cross-over leg. (J.P.N.)
Evaluation report on SCTF Core-III tests S3-14, S3-15 and S3-16
International Nuclear Information System (INIS)
Iwamura, Takamichi; Iguchi, Tadashi; Akimoto, Hajime; Okubo, Tsutomu; Ohnuki, Akira; Sakaki, Isao; Adachi, Hiromichi; Murao, Yoshio
1988-03-01
It was revealed from previous reflood tests using Slab Core Test Facility (SCTF) that the heat transfer was enhanced in high power bundles and degraded in low power bundles due to the radial power distribution. In the present study, the effects of local power ratio itself and the shape of radial power distribution were separately investigated by comparing three tests: S3-14 (flat power distribution), S3-15 (inclined power distribution) and S3-16 (steep power distribution). Those three tests were performed under the same boundary conditions, total power and initial stored energy. The emergency core cooling (ECC) water was injected into the lower plenum. The test results indicated that the heat transfer enhancement and degradation was governed mainly by the bundlewise radial power ratio and less dependent on the shape of radial power distribution when the difference in power ratios between adjacent bundles is less than 0.44. The degree of heat transfer enhancement at high power bundles was increased with the radial peak power ratio. Even at an average power bundle, the heat transfer was enhanced in the non-uniform radial power distribution tests. (author)
Ceridono, Mara; Tellner, Pär; Bauer, Daniel; Barroso, João; Alépée, Nathalie; Corvi, Raffaella; De Smedt, Ann; Fellows, Mick D; Gibbs, Neil K; Heisler, Eckhard; Jacobs, Abigail; Jirova, Dagmar; Jones, David; Kandárová, Helena; Kasper, Peter; Akunda, Jacqueline Kinyamu; Krul, Cyrille; Learn, Douglas; Liebsch, Manfred; Lynch, Anthony M; Muster, Wolfgang; Nakamura, Kazuichi; Nash, J Frank; Pfannenbecker, Uwe; Phillips, Gareth; Robles, Catherine; Rogiers, Vera; Van De Water, Femke; Liminga, Ulla Wändel; Vohr, Hans-Werner; Wattrelos, Olivier; Woods, Julie; Zuang, Valérie; Kreysa, Joachim; Wilcox, Phil
2012-08-01
This is the report from the "ECVAM-EFPIA workshop on 3T3 NRU Phototoxicity Test: Practical Experience and Implications for Phototoxicity Testing", jointly organized by ECVAM and EFPIA and held on the 25-27 October 2010 in Somma Lombardo, Italy. The European Centre for the Validation of Alternative Methods (ECVAM) was established in 1991 within the European Commission Joint Research, based on a Communication from the European Commission (1991). The main objective of ECVAM is to promote the scientific and regulatory acceptance of alternative methods which are of importance to the biosciences and which reduce, refine and replace the use of laboratory animals. The European Federation of Pharmaceuticals Industries and Association (EFPIA) represent the pharmaceutical industry operating in Europe. Through its direct membership of 31 national associations and 40 leading pharmaceutical companies, EFPIA is the voice on the EU scene of 2200 companies committed to researching, developing and bringing to patients new medicines that improve health and the quality of life around the world. The workshop, co-chaired by Joachim Kreysa (ECVAM) and Phil Wilcox (GSK, EFPIA) involved thirty-five experts from academia, regulatory authorities and industry, invited to contribute with their experiences in the field of phototoxicology. The main objectives of the workshop were: -to present 'in use' experience of the pharmaceutical industry with the 3T3 Neutral Red Uptake Phototoxicity Test (3T3 NRU-PT), -to discuss why it differs from the results in the original validation exercise, -to discuss technical issues and consider ways to improve the usability of the 3T3 NRU-PT for (non-topical) pharmaceuticals, e.g., by modifying the threshold of chemical light absorption to trigger photo-toxicological testing, and by modifying technical aspects of the assay, or adjusting the criteria used to classify a positive response. During the workshop, the assay methodology was reviewed by comparing the OECD
International Nuclear Information System (INIS)
Schonfeld, F.W.; George, T.G.
1984-07-01
The General-Purpose Heat Source(GPHS) provides power for space missions by transmitting the heat of 238 PuO 2 decay to thermoelectric elements. Because of the inevitable return of certain aborted missions, the heat source must be designed and constructed to survive both re-entry and Earth impact. The Design Iteration Test (DIT) series is part of an ongoing test program. In the third test (DIT-3), a full GPHS module was impacted at 58 m/s and 930 0 C. The module impacted the target at an angle of 30 0 to the pole of the large faces. The four capsules used in DIT-3 survived impact with minimal deformation; no internal cracks other than in the regions indicated by Savannah River Plant (SRP) preimpact nondestructive testing were observed in any of the capsules. The 30 0 impact orientation used in DIT-3 was considerably less severe than the flat-on impact utilized in DIT-1 and DIT-2. The four capsules used in DIT-1 survived, while two of the capsules used in DIT-2 breached; a small quantity (approx. = 50 μg) of 238 PuO 2 was released from the capsules breached in the DIT-2 impact. All of the capsules used in DIT-1 and DIT-2 were severely deformed and contained large internal cracks. Postimpact analyses of the DIT-3 test components are described, with emphasis on weld structure and the behavior of defects identified by SRP nondestructive testing
Radiation hardness of GaAs sensors against gamma-rays, neutrons and electrons
Energy Technology Data Exchange (ETDEWEB)
Šagátová, Andrea, E-mail: andrea.sagatova@stuba.sk [Institute of Nuclear and Physical Engineering, Faculty of Electrical Engineering and Information Technology, Slovak University of Technology, Ilkovičova 3, 812 19 Bratislava (Slovakia); University Centre of Electron Accelerators, Slovak Medical University, Ku kyselke 497, 911 06 Trenčín (Slovakia); Zaťko, Bohumír; Dubecký, František [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, 841 04 Bratislava (Slovakia); Ly Anh, Tu [Faculty of Applied Science, University of Technology VNU HCM, 268 Ly Thuong Kiet Street, District 10, Ho Chi Minh City (Viet Nam); Nečas, Vladimír; Sedlačková, Katarína; Pavlovič, Márius [Institute of Nuclear and Physical Engineering, Faculty of Electrical Engineering and Information Technology, Slovak University of Technology, Ilkovičova 3, 812 19 Bratislava (Slovakia); Fülöp, Marko [University Centre of Electron Accelerators, Slovak Medical University, Ku kyselke 497, 911 06 Trenčín (Slovakia)
2017-02-15
Highlights: • Radiation hardness of SI GaAs detectors against gamma-rays, neutrons and electrons was compared. • Good agreement was achieved between the experimental results and displacement damage factor of different types of radiation. • CCE and FWHM first slightly improved (by 1–8%) and just then degraded with the cumulative dose. • An increase of detection efficiency with cumulative dose was observed. - Abstract: Radiation hardness of semi-insulating GaAs detectors against {sup 60}Co gamma-rays, fast neutrons and 5 MeV electrons was compared. Slight improvements in charge collection efficiency (CCE) and energy resolution in FWHM (Full Width at Half Maximum) were observed at low doses with all kinds of radiation followed by their degradation. The effect occurred at a dose of about 10 Gy of neutrons (CCE improved by 1%, FWHM by 5% on average), at 1 kGy of electrons (FWHM decreased by 3% on average) and at 10 kGy of gamma-rays (CCE raised by 5% and FWHM dropped by 8% on average), which is in agreement with the relative displacement damage of the used types of radiation. Gamma-rays of MeV energies are 1000-times less damaging than similar neutrons and electrons about 10-times more damaging than photons. On irradiating the detectors with neutrons and electrons, we observed a global increase in their detection efficiency, which was caused probably by enlargement of the active detector area as a consequence of created radiation defects in the base material. Detectors were still functional after a dose of 1140 kGy of ∼1 MeV photons, 104 kGy of 5 MeV electrons but only up to 0.576 kGy of fast (∼2 to 30 MeV) neutrons.
Anderson, K.; Lundsten, E. M.; Caress, D. W.; Thomas, H. J.; Paull, C. K.; Maier, K. L.; Gales, J. A.; Gwiazda, R.; Talling, P.; Xu, J.; Parsons, D. R.
2017-12-01
The Coordinated Canyon Experiment (CCE), a multi-institutional collaboration effort, was designed to monitor the passage of sediment density flows along the axis of Monterey Canyon, offshore California, between 200 and 1850 m water depth. An array of moorings and sensors were deployed for three 6-month periods from October 2015 to April 2017. Aligned with the CCE deployments, repeat high-resolution multibeam bathymetric surveys of the Monterey Canyon floor were conducted with a mapping AUV (Autonomous Underwater Vehicle). The AUV carried a Reson 7125 multibeam echosounder (vertical precision of 0.15 m and horizontal resolution of 1.0 m). An inertial navigation system combined with a Doppler velocity logger allowed the AUV to fly pre-programmed grids at 3 knots, while maintaining an altitude of 50 m above the seafloor, to obtain a nominal line spacing of 130 m. The floor and lower flanks of the canyon between 200 to 540 m and 1350 to 1880 m water depths were mapped six times during the CCE. These repeat maps are subtracted to create bathymetry difference grids to show morphological change. Coupling the sensor observations with the bathymetric surveys, the CCE successfully documented sediment density flow events as well as the associated changes in seafloor morphology. Between repeat surveys, three sediment density flow events reached the lower canyon, extending to at least 1850 m water depth. On January 15, 2016, a particularly large density flow traveled more than 50 km down Monterey Canyon. Unlike in the upper canyon where this event caused wholesale reorganization of geomorphological features, changes to the lower canyon morphology involved a more moderate re-sculpting of the features. The effect of a sediment density flow of known magnitude and duration on the seafloor morphology has never been documented in a deep-sea setting before.
Experimental Program for the CLIC test facility 3 test beam line
Adli, E; Dobert, S; Olvegaard, M; Schulte, D; Syratchev, I; Lillestol, Reidar
2010-01-01
The CLIC Test Facility 3 Test Beam Line is the first prototype for the CLIC drive beam decelerator. Stable transport of the drive beam under deceleration is a mandatory component in the CLIC two-beam scheme. In the Test Beam Line more than 50% of the total energy will be extracted from a 150 MeV, 28 A electron drive beam, by the use of 16 power extraction and transfer structures. A number of experiments are foreseen to investigate the drive beam characteristics under deceleration in the Test Beam Line, including beam stability, beam blow up and the efficiency of the power extraction. General benchmarking of decelerator simulation and theory studies will also be performed. Specially designed instrumentation including precision BPMs, loss monitors and a time-resolved spectrometer dump will be used for the experiments. This paper describes the experimental program foreseen for the Test Beam Line, including the relevance of the results for the CLIC decelerator studies.
Quench tests of Nb3Al small racetrack magnets
International Nuclear Information System (INIS)
Yamada, R.; Kikuchi, A.; Tartaglia, Michael Albert; Ambrosio, G.; Andreev, N.; Barzi, E.; Carcagno, R.; Feher, S.; Kashikhin, V.V.; Kotelnikov, S.; Lamm, Michael J.; Fermilab; NIMC, Tsukuba; KEK, Tsukuba
2007-01-01
Two Cu stabilized Nb3Al strands, F1 (Nb matrixed) and F3 (Ta matrixed), have been made at NIMS and their Rutherford cables were made at Fermilab in collaboration with NIMS. A Small Race-track magnet using F1 Rutherford cable, the first Nb3Al dipole magnet in the world, was constructed and tested to full current at Fermilab. This magnet was tested extensively to full short sample data and its quench characteristics were studied and reported. The 3-D magnetic field calculation was done with ANSYS to find the peak field. The quench characteristics of the magnet are explained with the characteristics of the Nb3Al strand and Rutherford cable. The other Small Race-track magnet using Ta matrixed F3 strand was constructed and will be tested in the near future. The advantages and disadvantages of these Nb3Al cables are discussed
Quench tests of Nb3Al small racetrack magnets
Energy Technology Data Exchange (ETDEWEB)
Yamada, R.; Kikuchi, A.; Tartaglia, Michael Albert; Ambrosio, G.; Andreev, N.; Barzi, E.; Carcagno, R.; Feher, S.; Kashikhin, V.V.; Kotelnikov, S.; Lamm, Michael J.; /Fermilab /NIMC, Tsukuba /KEK, Tsukuba
2007-08-01
Two Cu stabilized Nb3Al strands, F1 (Nb matrixed) and F3 (Ta matrixed), have been made at NIMS and their Rutherford cables were made at Fermilab in collaboration with NIMS. A Small Race-track magnet using F1 Rutherford cable, the first Nb3Al dipole magnet in the world, was constructed and tested to full current at Fermilab. This magnet was tested extensively to full short sample data and its quench characteristics were studied and reported. The 3-D magnetic field calculation was done with ANSYS to find the peak field. The quench characteristics of the magnet are explained with the characteristics of the Nb3Al strand and Rutherford cable. The other Small Race-track magnet using Ta matrixed F3 strand was constructed and will be tested in the near future. The advantages and disadvantages of these Nb3Al cables are discussed.
The interaction of substituted benzamides with brain benzodiazepine binding sites in vitro.
Horton, R W; Lowther, S; Chivers, J; Jenner, P; Marsden, C D; Testa, B
1988-08-01
1. The interaction of substituted benzamides with brain benzodiazepine (BDZ) binding sites was examined by their ability to displace [3H]-flunitrazepam ([3H]-FNM) from specific binding sites in bovine cortical membranes in vitro. 2. Clebopride, Delagrange 2674, Delagrange 2335 and BRL 20627 displayed concentration-dependent displacement of [3H]-FNM with IC50 values of 73 nM, 132 nM, 7.7 microM and 5.9 microM, respectively. Other substituted benzamides including metoclopramide, sulpiride, tiapride, sultopride and cisapride were inactive at 10(-5) M. 3. Inhibition by clebopride and Delagrange 2674 of [3H]-FNM binding was apparently competitive and readily reversible. 4. In the presence of gamma-aminobutyric acid (GABA), the ability of diazepam and Delagrange 2674 to displace [3H]-Ro 15-1788 binding was increased 3.6 and 1.6 fold respectively, compared to the absence of GABA, while ethyl beta-carboline-3-carboxylate (beta CCE) and clebopride were less potent in the presence of GABA. 5. Diazepam was 30 fold less potent at displacing [3H]-Ro 15-1788 in membranes that had been photoaffinity labelled with FNM than in control membranes, whereas the potency of beta CCE did not differ. Clebopride and Delagrange 2674 showed a less than two fold loss of potency in photoaffinity labelled membranes. 6. The pattern of binding of clebopride and Delagrange 2674 in these in vitro tests is similar to that found previously with partial agonists or antagonists at BDZ binding sites. 7. Clebopride and Delagrange 2674 inhibited [3H]-FNM binding with similar potency in rat cerebellar and hippocampal membranes, suggesting they have no selectivity for BDZ1 and BDZ2 binding sites. 8. Clebopride and Delagrange 2674 are structurally dissimilar to other BDZ ligands and represent another chemical structure to probe brain BDZ binding sites.
Sodium-water reaction test facility (SWAT-3)
International Nuclear Information System (INIS)
Shimazu, Hisashi; Ukechi, Kazutoshi; Sasakura, Kazutake; Kusunoki, Junichi
1976-01-01
In the development of the liquid metal cooled fast breeder reactor (LMFBR), the steam generator (SG) is considered one of the most important components. The Power Reactor and Nuclear Fuel Development Corporation (PNC) is now promoting the research and development of the SG system used with the prototype fast breeder reactor ''Monju''. In this research, the phenomena of the sodium-water reaction in the SG are the key which must be investigated for the solution of problems. The test facility (SWAT-3) simulating Monju's SG on the scale of 1/2.5 was designed, fabricated and installed by IHI at Oarai Engineering Center of PNC, its pre-operation being accomplished in February 1975. The purpose of SWAT-3 is summarized as follows: (1) To perform an overall test on the safety of Monju's SG and intermediate heat transport system under the design condition against sodium-water reaction accidents. (2) To investigate the damage of the SG structure caused by the sodium-water reaction, and the possibility of repair and recovery operations. The first test was accomplished successfully on June 9, 1975. As a result of the test, the fundamental function of this test facility was proven to be satisfactory as expected. (auth.)
1/3-scale model testing program
International Nuclear Information System (INIS)
Yoshimura, H.R.; Attaway, S.W.; Bronowski, D.R.; Uncapher, W.L.; Huerta, M.; Abbott, D.G.
1989-01-01
This paper describes the drop testing of a one-third scale model transport cask system. Two casks were supplied by Transnuclear, Inc. (TN) to demonstrate dual purpose shipping/storage casks. These casks will be used to ship spent fuel from DOEs West Valley demonstration project in New York to the Idaho National Engineering Laboratory (INEL) for long term spent fuel dry storage demonstration. As part of the certification process, one-third scale model tests were performed to obtain experimental data. Two 9-m (30-ft) drop tests were conducted on a mass model of the cask body and scaled balsa and redwood filled impact limiters. In the first test, the cask system was tested in an end-on configuration. In the second test, the system was tested in a slap-down configuration where the axis of the cask was oriented at a 10 degree angle with the horizontal. Slap-down occurs for shallow angle drops where the primary impact at one end of the cask is followed by a secondary impact at the other end. The objectives of the testing program were to (1) obtain deceleration and displacement information for the cask and impact limiter system, (2) obtain dynamic force-displacement data for the impact limiters, (3) verify the integrity of the impact limiter retention system, and (4) examine the crush behavior of the limiters. This paper describes both test results in terms of measured deceleration, post test deformation measurements, and the general structural response of the system
Dynamic tests at the Outardes 3 dam
International Nuclear Information System (INIS)
Proulx, J.; Paultre, P.; Duron, Z.; Tai Mai Phat; Im, O.
1992-01-01
At the Outardes 3 gravity dam, part of the Manicouagan-Outardes hydroelectric complex in northeastern Quebec, forced vibration tests were carried out using an eccentric mass shaker attached to the dam crest at three different locations. Accelerations were measured along the crest and in the inspection galleries, and hydrodynamic pressures were measured along the upstream dam face and at various locations in the reservoir. The tests were designed to analyze the effects of gravity dam-reservoir interactions and to generate a data base for calibrating finite element models used in studying the dynamic behavior of gravity dams. Experimental results are presented in order to demonstrate the quality of the data obtained and the effectiveness of the experimental procedures. Modes of vibration were observed which corresponded to those obtained by finite element analysis. It is shown that techniques recently developed for dynamic tests on large dams can be successfully used on gravity dams. 3 refs., 6 figs
40 CFR 205.171-3 - Test motorcycle sample selection.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test motorcycle sample selection. 205... ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.171-3 Test motorcycle sample selection. A test motorcycle to be used for selective enforcement audit testing...
Charge losses in silicon sensors and electric-field studies at the Si-SiO2 interface
International Nuclear Information System (INIS)
Poehlsen, Thomas
2013-07-01
accumulation layer and when the accumulation layer returns to steady state is investigated. Irradiated silicon pad sensors are used to study the charge-collection efficiency (CCE) of charge carriers generated using laser light of 1063 nm wavelength, as a function of bulk material, active sensor thickness, voltage, temperature, particle type (for the irradiation) and fluence. As a cross check the CCE is also determined for charge carriers generated by electrons from a 90 Sr-source. A precision of 3 % in the CCE is achieved. Sensors of n-doped and p-doped silicon are compared, as well as sensors of different crystal-growing methods (magnetic Czochralski (MCz) and float zone (FZ)). The sensor thickness varies from 200 μm (MCz and FZ) to 320 μm (FZ). The 320 μm thick FZ sensors underwent a dopant-diffusion process (dd-FZ) to reduce the active sensor thickness. For the irradiation both protons of different energies (23 MeV and 23 GeV) and reactor neutrons (∝1 MeV) are used. The achieved fluences are between 3.10 14 cm -2 and 1.3.10 16 cm -2 1 MeV-neutron equivalent. The CCE is used to calculate the signal corresponding to a minimum-ionising particle (mip) traversing the sensor and to calculate the effective distance the generated charge carriers drift. While little difference in CCE between the 200 m thick MCz and FZ materials is found, the dd-FZ materials of both ∝200 μm and ∝300 μm active thickness have a lower CCE, corresponding also to a shorter effective drift distance. The CCE and the effective drift distance are also calculated for eh pairs generated close to the sensor surface using laser light of 660 nm wavelength. The measurements are not compatible with a position-independent trapping probability, and qualitative agreement with a position-dependent occupation of radiation-induced trapping centres due to the dark current is found.
Charge losses in silicon sensors and electric-field studies at the Si-SiO{sub 2} interface
Energy Technology Data Exchange (ETDEWEB)
Poehlsen, Thomas
2013-07-15
added to the accumulation layer and when the accumulation layer returns to steady state is investigated. Irradiated silicon pad sensors are used to study the charge-collection efficiency (CCE) of charge carriers generated using laser light of 1063 nm wavelength, as a function of bulk material, active sensor thickness, voltage, temperature, particle type (for the irradiation) and fluence. As a cross check the CCE is also determined for charge carriers generated by electrons from a {sup 90}Sr-source. A precision of 3 % in the CCE is achieved. Sensors of n-doped and p-doped silicon are compared, as well as sensors of different crystal-growing methods (magnetic Czochralski (MCz) and float zone (FZ)). The sensor thickness varies from 200 {mu}m (MCz and FZ) to 320 {mu}m (FZ). The 320 {mu}m thick FZ sensors underwent a dopant-diffusion process (dd-FZ) to reduce the active sensor thickness. For the irradiation both protons of different energies (23 MeV and 23 GeV) and reactor neutrons ({proportional_to}1 MeV) are used. The achieved fluences are between 3.10{sup 14} cm{sup -2} and 1.3.10{sup 16} cm{sup -2} 1 MeV-neutron equivalent. The CCE is used to calculate the signal corresponding to a minimum-ionising particle (mip) traversing the sensor and to calculate the effective distance the generated charge carriers drift. While little difference in CCE between the 200 m thick MCz and FZ materials is found, the dd-FZ materials of both {proportional_to}200 {mu}m and {proportional_to}300 {mu}m active thickness have a lower CCE, corresponding also to a shorter effective drift distance. The CCE and the effective drift distance are also calculated for eh pairs generated close to the sensor surface using laser light of 660 nm wavelength. The measurements are not compatible with a position-independent trapping probability, and qualitative agreement with a position-dependent occupation of radiation-induced trapping centres due to the dark current is found.
Characteristics of rainfall triggering of debris flows in the Chenyulan watershed, Taiwan
Directory of Open Access Journals (Sweden)
J. C. Chen
2013-04-01
Full Text Available This paper reports the variation in rainfall characteristics associated with debris flows in the Chenyulan watershed, central Taiwan, between 1963 and 2009. The maximum hourly rainfall Im, the maximum 24 h rainfall Rd, and the rainfall index RI (defined as the product RdIm were analysed for each rainfall event that triggered a debris flow within the watershed. The corresponding number of debris flows initiated by each rainfall event (N was also investigated via image analysis and/or field investigation. The relationship between N and RI was analysed. Higher RI of a rainfall event would trigger a larger number of debris flows. This paper also discusses the effects of the Chi-Chi earthquake (CCE on this relationship and on debris flow initiation. The results showed that the critical RI for debris flow initiation had significant variations and was significantly lower in the years immediately following the CCE of 1999, but appeared to revert to the pre-earthquake condition about five years later. Under the same extreme rainfall event of RI = 365 cm2 h−1, the value of N in the CCE-affected period could be six times larger than that in the non-CCE-affected periods.
Cao, Bin; Li, Shuiming; Hu, Run; Zhou, Shengjun; Sun, Yi; Gan, Zhiying; Liu, Sheng
2013-10-21
Current crowding effects (CCEs) on light extraction efficiency (LEE) of conventional GaN-based light-emitting diodes (LEDs) are analyzed through Monte Carlo ray-tracing simulation. The non-uniform radiative power distribution of the active layer of the Monte Carlo model is obtained based on the current spreading theory and rate equation. The simulation results illustrate that CCE around n-pad (n-CCE) has little effect on LEE, while CCE around p-pad (p-CCE) results in a notable LEE droop due to the significant absorption of photons emitted under p-pad. LEE droop is alleviated by a SiO₂ current blocking layer (CBL) and reflective p-pad. Compared to the conventional LEDs without CBL, the simulated LEE of LEDs with CBL at 20 A/cm² and 70 A/cm² is enhanced by 7.7% and 19.0%, respectively. It is further enhanced by 7.6% and 11.4% after employing a reflective p-pad due to decreased absorption. These enhancements are in accordance with the experimental results. Output power of LEDs with CBL is enhanced by 8.7% and 18.2% at 20 A/cm² and 70 A/cm², respectively. And the reflective p-pad results in a further enhancement of 8.9% and 12.7%.
Energy Technology Data Exchange (ETDEWEB)
Hodgson, M., E-mail: michael.hodgson@becq.co.uk [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Lohstroh, A.; Sellin, P. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Thomas, D. [NPL, Teddington TW11 0LW (United Kingdom)
2017-03-01
The benefits of neutron detection and spectroscopy with carbon based, wide band gap, semiconductor detectors have previously been discussed within the literature. However, at the time of writing there are still limitations with these detectors related to availability, cost, size and perceived quality. This study demonstrates that lower quality materials—indicated by lower charge collection efficiency (CCE), poor resolution and polarisation effect—available at wafer scale and lower cost, can fulfil requirements for fast neutron detection and spectroscopy for fluxes over several orders of magnitude, where only coarse energy discrimination is required. In this study, a single crystal diamond detector (D-SC, with 100% CCE), a polycrystalline diamond (D-PC, with ≈4% CCE) and semi-insulating silicon carbide (SiC-SI, with ≈35% CCE) have been compared for alpha and fast neutron performance. All detectors demonstrated alpha induced polarisation effects in the form of a change of both energy peak position and count rate with irradiation time. Despite these operational issues the ability to detect fast neutrons and distinguish neutron energies was observed. This performance was demonstrated over a wide dynamic range (500–40,000 neutrons/s), with neutron induced polarisation being demonstrated in D-PC and SiC-SI at high fluxes.
Energy Technology Data Exchange (ETDEWEB)
Berglin, E.J.
1997-07-24
This report contains the quantitative and qualitative data and information collected during performance of the Track 3 System testing protocol. Information contained herein focuses on the data collected during performance ofthe following Tests Procedures. *Test Procedure-1, Position Management Test Procedure-2, Waste Dislodging, Retrieval, and Conveyance and Decontamination *Test Procedure-3, Dynamic Response Test procedures, Safety Demonstration
International Nuclear Information System (INIS)
Berglin, E.J.
1997-01-01
This report contains the quantitative and qualitative data and information collected during performance of the Track 3 System testing protocol. Information contained herein focuses on the data collected during performance of the following Tests Procedures. *Test Procedure-1, Position Management Test Procedure-2, Waste Dislodging, Retrieval, and Conveyance and Decontamination *Test Procedure-3, Dynamic Response Test procedures, Safety Demonstration
Superior radiation tolerance of thin epitaxial silicon detectors
Kramberger, G; Fretwurst, E; Honniger, F; Lindström, G; Pintilie, I; Röder, R; Schramm, A; Stahl, J
2003-01-01
For the LHC upgrade (fluences up to 10**1**6 p/cm**2) epi-Si devices are shown to be a viable solution. No type inversion was measured up to 1.3 multiplied by 10**1**524 GeV/c protons/cm**2 and the charge collection efficiency (CCE) remained close to 100%. For reactor neutrons CCE was measured to be 60% at 8 multiplied by 10**1**5 n/cm **2. Annealing measurements have shown that only moderate cooling during beam off periods would be necessary. As a tentative explanation for the superior quality of these devices, we assume that radiation-induced donor generation leads to compensation effects of deep acceptors. In the future, we will extend the experiments to fluences up to 10**1**6 p/cm**2 and use also different variants of the epi-Si material and device geometry.
Analysis of Alcove 8/Niche 3 Flow and Transport Tests
International Nuclear Information System (INIS)
H.H. Liu
2006-01-01
The purpose of this report is to document analyses of the Alcove 8/Niche 3 flow and transport tests, with a focus on the large-infiltration-plot tests and compare pre-test model predictions with the actual test observations. The tests involved infiltration that originated from the floor of Alcove 8 (located in the Enhanced Characterization of Repository Block (ECRB) Cross Drift) and observations of seepage and tracer transport at Niche 3 (located in the Main Drift of the Exploratory Studies Facility (ESF)). The test results are relevant to drift seepage and solute transport in the unsaturated zone (UZ) of Yucca Mountain. The main objective of this analysis was to evaluate the modeling approaches used and the importance of the matrix diffusion process by comparing simulation and actual test observations. The pre-test predictions for the large plot test were found to differ from the observations and the reasons for the differences were documented in this report to partly address CR 6783, which concerns unexpected test results. These unexpected results are discussed and assessed with respect to the current baseline unsaturated zone radionuclide transport model in Sections 6.2.4, 6.3.2, and 6.4
Gearbox Reliability Collaborative Phase 3 Gearbox 3 Test Report
Energy Technology Data Exchange (ETDEWEB)
Keller, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wallen, Robb [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-02-24
Many gearboxes in wind turbines do not achieve their expected design life; they do, however, commonly meet or exceed the design criteria specified in current standards in the gear, bearing, and wind turbine industry as well as third-party certification criteria. The cost of gearbox replacements and rebuilds, as well as the downtime associated with these failures, increases the cost of wind energy. In 2007, the U.S. Department of Energy established the National Renewable Energy Laboratory (NREL) Gearbox Reliability Collaborative (GRC). Its goals are to understand the root causes of premature gearbox failures and to improve their reliability. The GRC is examining a hypothesis that the gap between design-estimated and actual wind turbine gearbox reliability is caused by underestimation of loads, inaccurate design tools, the absence of critical elements in the design process, or insufficient testing. This report describes the recently completed tests of GRC Gearbox 3 in the National Wind Technology Center dynamometer and documents any modifications to the original test plan. In this manner, it serves as a guide for interpreting the publicly released data sets with brief analyses to illustrate the data. The primary test objective was to measure the planetary load-sharing characteristics in the same conditions as the original GRC gearbox design. If the measured load-sharing characteristics are close to the design model, the projected improvement in planetary section fatigue life and the efficacy of preloaded TRBs in mitigating the planetary bearing fatigue failure mode will have been demonstrated. Detailed analysis of that test objective will be presented in subsequent publications.
Acceptance test report for core sample trucks 3 and 4
International Nuclear Information System (INIS)
Corbett, J.E.
1996-01-01
The purpose of this Acceptance Test Report is to provide documentation for the acceptance testing of the rotary mode core sample trucks 3 and 4, designated as HO-68K-4600 and HO-68K-4647, respectively. This report conforms to the guidelines established in WHC-IP-1026, ''Engineering Practice Guidelines,'' Appendix M, ''Acceptance Test Procedures and Reports.'' Rotary mode core sample trucks 3 and 4 were based upon the design of the second core sample truck (HO-68K-4345) which was constructed to implement rotary mode sampling of the waste tanks at Hanford. Successful completion of acceptance testing on June 30, 1995 verified that all design requirements were met. This report is divided into four sections, beginning with general information. Acceptance testing was performed on trucks 3 and 4 during the months of March through June, 1995. All testing was performed at the ''Rock Slinger'' test site in the 200 West area. The sequence of testing was determined by equipment availability, and the initial revision of the Acceptance Test Procedure (ATP) was used for both trucks. Testing was directed by ICF-KH, with the support of WHC Characterization Equipment Engineering and Characterization Project Operations. Testing was completed per the ATP without discrepancies or deviations, except as noted
Economic Cost and Benefits of Subsidizing Western Credits to the East: Executive Briefing.
1985-02-01
REORT DOCUMEkTATION PA%’ :. . DEPOnE COMPLEZflG PORN . ROTMUMek GOT.V3M ccE aLoN CIPIRNTS CAT ALOO NUNSER R-3129/l-USDP 4. rIm (amd $,;me#*.) L. TYPI...1981 March 1983 Japan - Tunisia 3.49 1.89 Switzerland - - United Arab Emirates 1.94 1.98 West Germany - - Venezuela 1.56 12.08) United States - .07
Energy Technology Data Exchange (ETDEWEB)
1993-05-01
The objective of Phase 3 of the Prototypical Rod consolidation Demonstration Project (PRCDP) was to procure, fabricate, assemble, and test the Prototypical Rod consolidation System as described in the NUS Phase 2 Final Design Report. This effort required providing the materials, components, and fabricated parts which makes up all of the system equipment. In addition, it included the assembly, installation, and setup of this equipment at the Cold Test Facility. During the Phase 3 effort the system was tested on a component, subsystem, and system level. This volume 1, discusses the PRCDP Phase 3 Test Program that was conducted by the HALLIBURTON NUS Environmental Corporation under contract AC07-86ID12651 with the United States Department of Energy. This document, Volume 1, Book 3 discusses the following topics: Downender Test Results and Analysis Report; NFBC Canister Upender Test Results and Analysis Report; Fuel Assembly Handling Fixture Test Results and Analysis Report; and Fuel Canister Upender Test Results and Analysis Report.
International Nuclear Information System (INIS)
Khomazyuk, I.N.
1992-01-01
Physical efficiency and factors affecting it for persons exposed to irradiation (the radiation dose being in the range up to 0.75 Gy) has been studied. 670 participants of liquidating the consequences of ChNPP accident have been examined. Depending on the radiation doses to which the people have been exposed the liquidators have been subdivided into 4 groups: for the 1st group the radiation doses ranging from 0.25 to 0.75 Gy; for the 2nd group the radiation doses ranging from 0.10 to 0.24 Gy; for the 3rd group the radiation doses ranging from 0.05 to 0.10 Gy; for the 4th group the radiation dose being up to 0.05 Gy. The physical load was ensured with veloergometer. The results have made it possible to estimate one of the basic health criterion for liquidators of consequences of ChNPP accident (i.e. exercise (effort) tolerance). No direct relationship of the exercise magnitude and the radiation dose within the range up to 0.75 Gy and the irradiation time have been observed. The correlation of the exercise magnitude with due account to age has been provided. 15 refs.; 2 tabs
Impact of the clinical context on the 14-3-3 test for the diagnosis of sporadic CJD
Directory of Open Access Journals (Sweden)
Sierra-Moros Maríajosé
2006-07-01
Full Text Available Abstract Background The 14-3-3 test appears to be a valuable aid for the clinical diagnosis of sporadic Creutzfeldt-Jakob disease (sCJD in selected populations. However, its usefulness in routine practice has been challenged. In this study, the influence of the clinical context on the performance of the 14-3-3 test for the diagnosis of sCJD is investigated through the analysis of a large prospective clinical series. Methods Six hundred seventy-two Spanish patients with clinically suspected sCJD were analyzed. Clinical classification at sample reception according to the World Health Organization's (WHO criteria (excluding the 14-3-3 test result was used to explore the influence of the clinical context on the pre-test probabilities, and positive (PPV and negative (NPV predictive values of the 14-3-3 test. Results Predictive values of the test varied greatly according to the initial clinical classification: PPV of 98.8%, 96.5% and 45.0%, and NPV of 26.1%, 66.6% and 100% for probable sCJDi (n = 115, possible sCJDi (n = 73 and non-sCJDi (n = 484 cases, respectively. According to multivariate and Bayesian analyses, these values represent an improvement of diagnostic certainty compared to clinical data alone. Conclusion In three different contexts of sCJD suspicion, the 14-3-3 assay provides useful information complementary to clinical and electroencephalographic (EEG data. The test is most useful supporting a clinical impression, whilst it may show deceptive when it is not in agreement with clinical data.
Optical Fiber Grating based Sensors
DEFF Research Database (Denmark)
Michelsen, Susanne
2003-01-01
In this thesis differenct optical fiber gratings are used for sensor purposes. If a fiber with a core concentricity error (CCE) is used, a directional dependent bend sensor can be produced. The CCE direction can be determined by means of diffraction. This makes it possible to produce long......-period gratings in a fiber with a CCE direction parallel or perpendicular to the writing direction. The maximal bending sensitivity is independent on the writing direction, but the detailed bending response is different in the two cases. A temperature and strain sensor, based on a long-period grating and two...... sampled gratings, was produced and investigated. It is based on the different temperature and strain response of these gratings. Both a transfer matrix method and an overlap calculation is performed to explain the sensor response. Another type of sensor is based on tuning and modulation of a laser...
Da Vià, C; Berglund, P; Borchi, E; Borer, K; Bruzzi, Mara; Buontempo, S; Casagrande, L; Chapuy, S; Cindro, V; Dimcovski, Zlatomir; D'Ambrosio, N; de Boer, Wim; Dezillie, B; Esposito, A P; Granat, V; Grigoriev, E; Heijne, Erik H M; Heising, S; Janos, S; Koivuniemi, J H; Konotov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; Pagano, S; Palmieri, V G; Paul, S; Pirollo, S; Pretzl, Klaus P; Ropotar, I; Ruggiero, G; Salmi, J; Seppä, H; Suni, I; Smith, K; Sonderegger, P; Valtonen, M J; Zavrtanik, M
1998-01-01
The charge collection efficiency (CCE) of high resistivity silicon detectors, previously neutron irradiated up to 2*10/sup 15/ n/cm/sup 2/, was measured at different cryogenic temperatures and different bias voltages. In order to $9 study reverse annealing (RA) effects, a few samples were heated to 80 degrees C and kept at room temperature for several months after irradiation. For comparison other samples (NRA) where kept at -10 C after irradiation. The RA and $9 NRA samples, measured at 250 V forward and reverse bias voltage, present a common temperature threshold at 150 K. Below 120 K the CCE is constant and ranges between 55and 65 0.000000or the RA and NRA sample respectively. Similar CCE $9 was measured for a device processed with low resistivity contacts (OHMIC), opening the prospect for a consistent reduction of the cost of large area particle tracking. (7 refs).
Capacity-coupled multidischarge for atmospheric plasma production
International Nuclear Information System (INIS)
Mase, Hiroshi; Fujiwara, Tamiya; Sato, Noriyoshi
2003-01-01
We propose a method of plasma production by capacity-coupled multidischarge (CCMD) at atmospheric pressure. The discharge gaps in the CCMD consist of a common electrode and a number of compact electrodes (CCE) which are directly coupled with small capacitors for quenching the discharge. A simple CCE structure is provided by a cylindrical capacitor, the inner conductor of which is used as a gap electrode. A short pulse discharge is observed to appear homogeneously at each CCE. A charge transfer for the single-pulsed discharge is 10-100 times as large as that of the conventional dielectric barrier discharge. A high efficiency of ozone production has been confirmed in the CCMD using O 2 gas. A device configuration of the CCMD is quite flexible with respect to its geometrical shape and size. The CCMD could be used to produce plasmas for various kinds of industrial applications at atmospheric pressure
Irradiation and examination results of the AC-3 mixed-carbide test
International Nuclear Information System (INIS)
Mason, R.E.; Hoth, C.W.; Stratton, R.W.; Botta, F.
1992-01-01
The AC-3 test was a cooperative Swiss/US irradiation test of mixed-carbide, (U,Pr)C, fuel pins in the Fast Flux Test Facility. The test included 25 Swiss-fabricated sphere-pac-type fuel pins and 66 U.S. fabricated pellet-type fuel pins. The test was designed to operate at prototypical fast reactor conditions to provide a direct comparison of the irradiation performance of the two fuel types. The test design and fuel fabrication processes used for the AC-3 test are presented
Department of Defense Technology Transfer (T2) Program
2014-04-08
January February (1st Monday) Disposal System Performance Spec Production Representative Articles CARD – Cost Analysis Requirements Description CCE...Supportability Objectives Exit Criteria Met APB MTA FMECA FTA LORA RCM MS B Threshold/objective tradeoffs – Revised Performance Attributes MS C MS A...Evaluation FTA – Failure Tree Analysis IOT&E – Initial Operational Test & Evaluation ISR – In-Service Review ISP – Information Support Plan ITR – Initial
Directory of Open Access Journals (Sweden)
Yan Liangzhen
2012-11-01
Full Text Available Abstract Background The genomes of three major mosquito vectors of human diseases, Anopheles gambiae, Aedes aegypti, and Culex pipiens quinquefasciatus, have been previously sequenced. C. p. quinquefasciatus has the largest number of predicted protein-coding genes, which partially results from the expansion of three detoxification gene families: cytochrome P450 monooxygenases (P450, glutathione S-transferases (GST, and carboxyl/cholinesterases (CCE. However, unlike An. gambiae and Ae. aegypti, which have large amounts of gene expression data, C. p. quinquefasciatus has limited transcriptomic resources. Knowledge of complete gene expression information is very important for the exploration of the functions of genes involved in specific biological processes. In the present study, the three detoxification gene families of C. p. quinquefasciatus were analyzed for phylogenetic classification and compared with those of three other dipteran insects. Gene expression during various developmental stages and the differential expression responsible for parathion resistance were profiled using the digital gene expression (DGE technique. Results A total of 302 detoxification genes were found in C. p. quinquefasciatus, including 71 CCE, 196 P450, and 35 cytosolic GST genes. Compared with three other dipteran species, gene expansion in Culex mainly occurred in the CCE and P450 families, where the genes of α-esterases, juvenile hormone esterases, and CYP325 of the CYP4 subfamily showed the most pronounced expansion on the genome. For the five DGE libraries, 3.5-3.8 million raw tags were generated and mapped to 13314 reference genes. Among 302 detoxification genes, 225 (75% were detected for expression in at least one DGE library. One fourth of the CCE and P450 genes were detected uniquely in one stage, indicating potential developmentally regulated expression. A total of 1511 genes showed different expression levels between a parathion-resistant and a
Test Results of the 3.9 GHz Cavity at Fermilab
Solyak, N
2004-01-01
Fermilab is developing two types of 3.9 GHz superconducting cavities to improve performances of A0 and TTF photoinjectors. In frame of this project we have built and tested two nine-cell copper models and one 3-cell niobium accelertating cavity and series of deflecting cavities. Properties of the high order modes were carefully studied in a chain of two copper cavities at room temperature. High gradient performance were tested at helium temperature. Achieved gradients and surface resistances are exceed goal parameters. In paper we discuss results of cold tests of the 3-cell accelerating and deflecting cavities.
New stereoacuity test using a 3-dimensional display system in children.
Directory of Open Access Journals (Sweden)
Sang Beom Han
Full Text Available The previously developed 3-dimensional (3D display stereoacuity tests were validated only at distance. We developed a new stereoacuity test using a 3D display that works both at near and distance and evaluated its validity in children with and without strabismus. Sixty children (age range, 6 to 18 years with variable ranges of stereoacuity were included. Side-by-side randot images of 4 different simple objects (star, circle, rectangle, and triangle with a wide range of crossed horizontal disparities (3000 to 20 arcsec were randomly displayed on a 3D monitor with MATLAB (Matworks, Inc., Natick, MA, USA and were presented to subjects wearing shutter glasses at 0.5 m and 3 m. The 3D image was located in front of (conventional or behind (proposed the background image on the 3D monitor. The results with the new 3D stereotest (conventional and proposed were compared with those of the near and distance Randot stereotests. At near, the Bland-Altman plots of the conventional and proposed 3D stereotest did not show significant difference, both of which were poorer than the Randot test. At distance, the results of the proposed 3D stereotest were similar to the Randot test, but the conventional 3D stereotest results were better than those of the other two tests. The results of the proposed 3D stereotest and Randot stereotest were identical in 83.3% at near and 88.3% at distance. More than 95% of subjects showed concordance within 2 grades between the 2 tests at both near and distance. In conclusion, the newly proposed 3D stereotest shows good concordance with the Randot stereotests in children with and without strabismus.
Energy Technology Data Exchange (ETDEWEB)
Ohnuma, Tomokazu; Matsumoto, Takashi; Itoi, Ayano; Kawana, Ayako; Nishiyama, Takahito; Ogura, Kenichiro [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan); Hiratsuka, Akira, E-mail: hiratuka@toyaku.ac.jp [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan)
2011-10-07
Highlights: {yields} We found a novel inhibitor of Nrf2 known as a chemoresistance factor. {yields} Overexpressed Nrf2 in lung cancer cells was suppressed by Cinnamomi Cortex extract. {yields} Cytotoxic action of anticancer drugs in cells treated with the extract was enhanced. {yields} Procyanidin tetramers and pentamers were active components in suppressing Nrf2. -- Abstract: Nuclear factor-E2-related factor 2 (Nrf2) is an important cytoprotective transcription factor because Nrf2-regulated enzymes play a key role in antioxidant and detoxification processes. Recent studies have reported that lung cancer cells overexpressing Nrf2 exhibit increased resistance to chemotherapy. Suppression of overexpressed Nrf2 is needed for a new therapeutic approach against lung cancers. In the present study, we found that Cinnamomi Cortex extract (CCE) has an ability to suppress Nrf2-regulated enzyme activity and Nrf2 expression in human lung cancer A549 cells with high Nrf2 activity. Moreover, we demonstrated that CCE significantly enhances sensitivity of A549 cells to the cytotoxic action of doxorubicin and etoposide as well as increasing the intracellular accumulation of both drugs. These results suggest that CCE might be an effective concomitant agent to reduce anticancer drug resistance derived from Nrf2 overexpression. Bioactivity-guided fractionation revealed that procyanidin tetramers and pentamers contained in CCE were active components in suppressing Nrf2.
Directory of Open Access Journals (Sweden)
S.A.O. Bedoya
2016-02-01
Full Text Available O carcinoma de células escamosas (CCE é uma neoplasia epitelial maligna que acomete cães e diversas outras espécies, incluindo a humana. O CCE afeta vários sítios anatômicos e pode desenvolver metástase. O objetivo deste estudo foi a caracterização das fibras de colágenos tipos I e III no estroma do CCE cutâneo de cães. Para este trabalho, utilizaram-se 44 amostras de pele incluídas em parafina e que tiveram prévio diagnóstico de CCE. As amostras foram processadas histologicamente e coradas com hematoxilina/eosina para confirmação do diagnóstico e classificação do grau de diferenciação tumoral e com a coloração histoquímica de picrosirius para observação dos colágenos tipos I e III. O colágeno tipo III mostrou maior expressão nos CCEs cutâneos bem diferenciados. O papel do colágeno do tipo III nas neoplasias não está bem esclarecido, e outros fatores além do grau de diferenciação celular podem estar envolvidos em sua expressão e determinar sua importância na biologia tumoral.
Test Beam Results of a 3D Diamond Detector
Dunser, Marc
2015-01-01
3D pixel technology has been used successfully in the past with silicon detectors for tracking applications. Recently, a first prototype of the same 3D technology has been produced on a chemical vapour deposited single-crystal diamond sensor. This device has been subsequently tested in a beam test at CERN’s SPS accelerator in a beam of 120 GeV protons. Details on the production and results of testbeam data are presented.
Safety demonstration test (SR-3/S1C-3/S2C-3/SF-2) plan using the HTTR. Contract research
International Nuclear Information System (INIS)
Nakagawa, Shigeaki; Sakaba, Nariaki; Takamatsu, Kuniyoshi; Takada, Eiji; Tochio, Daisuke; Ohwada, Hiroyuki
2005-03-01
Safety demonstration tests using the HTTR are to be conducted from the FY2002 to verify the inherent safety features and to improve the safety design and evaluation technologies for HTGRs, as well as to contribute to not only the commercial HTGRs but also the research and development for the VHTR that is one of the Generation IV reactor candidates. This paper describes the reactivity insertion test (SR-3), the coolant flow reduction test by tripping of gas circulators (S1C-3, S2C-3), and the partial flow loss of coolant test (SF-2) planned in March 2005 with their detailed test method, procedure and results of pre-test analysis. From the analytical results, it was verified that the negative reactivity feedback effect of the core brings the reactor power safely to a stable level without a reactor scram. (author)
Experiment data report for LOFT nonnuclear test L1-3
International Nuclear Information System (INIS)
Millar, G.M.
1977-04-01
Test L1-3 was the third in a series of five nonnuclear isothermal blowdown tests conducted by the Loss of Fluid Test (LOFT) Program. For this test the LOFT Facility was configured to simulate a loss-of-coolant accident in a large pressurized water reactor resulting from a 200 percent double-ended shear break in a cold leg of the primary coolant system. A hydraulic core simulator assembly was installed in place of the nuclear core. The initial conditions in the primary coolant system intact loop were: temperature at 540 0 F, pressure at 2256 psig, and loop flow at 2.34 x 10 6 lbm/hr. During system depressurization, emergency core cooling water was specified to be injected into the lower plenum of the reactor vessel using an accumulator, a low-pressure injection system pump, and a high-pressure injection system pump to provide data on the effects of emergency core cooling on the system thermal-hydraulic response. Injection into the lower plenum was initiated from the high- and low-pressure injection systems. Injection from the accumulator, however, was not initiated because a valve was inadvertently left closed. The experiment, therefore, was not completely successful in that one of the objectives outlined in the experiment operating specification for this test was not accomplished. Test L1-3 was repeated at Test L1-3A to meet the experimental requirements. Despite these difficulties, Test L1-3 did provide very valuable data to verify experiment repeatability
Experiment data report for Semiscale Mod-1 test S-28-3 (steam generator tube rupture test)
International Nuclear Information System (INIS)
Gillins, R.L.; Sackett, K.E.
1977-10-01
Recorded test data are presented for Test S-28-3 of the Semiscale Mod-1 steam generator tube rupture test series. These tests are among several Semiscale Mod-1 experiments conducted to investigate the thermal and hydraulic phenomena accompanying a hypothesized loss-of-coolant accident in a pressurized water reactor (PWR) system. Test S-28-3 was conducted from initial conditions of 15621 kPa and 555 K to investigate the response of the Semiscale Mod-1 system to a depressurization and reflood transient following a simulated double-ended offset shear of the broken loop cold leg piping. During the test, cooling water was injected into the cold leg of the intact and broken loops to simulate emergency core coolant injection in a PWR. Twelve steam generator tube ruptures were simulated by a controlled injection from a heated accumulator into the intact loop hot leg
Carum carvi Linn (Umbelliferae) Attenuates Lipopolysaccharide ...
African Journals Online (AJOL)
http://dx.doi.org/10.4314/tjpr.v14i6.15 ... CCE also inhibited the production of inflammatory mediators such as iNOS, COX-2, ... carvi, Anti-oxidant, Neuroinflammation, Microglia, Nitric oxide, Interleukin .... Nitrite concentrations were determined by using standard solutions of .... Data are presented as the mean ± S.E.M. (n = 3).
DEFF Research Database (Denmark)
Lynggaard, Hans Jørgen Birk; Alting, Leo
1996-01-01
The engineering process of creating cell control systems is described, and a Cell Control Engineering (CCE) concept is defined. The purpose is to assist people, representing different disciplines in the organisation, to implement cell controllers by addressing the complexity of having many systems...... in physically and logically different and changing manufacturing environments. The defined CCE concept combines state-of-the-art of commercially available enabling technologies for automation system software development, generic cell control models and guidelines for the complete engineering process...
Equation-of-State Test Suite for the DYNA3D Code
Energy Technology Data Exchange (ETDEWEB)
Benjamin, Russell D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-11-05
This document describes the creation and implementation of a test suite for the Equationof- State models in the DYNA3D code. A customized input deck has been created for each model, as well as a script that extracts the relevant data from the high-speed edit file created by DYNA3D. Each equation-of-state model is broken apart and individual elements of the model are tested, as well as testing the entire model. The input deck for each model is described and the results of the tests are discussed. The intent of this work is to add this test suite to the validation suite presently used for DYNA3D.
FT 3 Flight Test Cards for Export
Marston, Michael L.
2015-01-01
These flight test cards will be made available to stakeholders who participated in FT3. NASA entered into the relationship with our stakeholders, including the FAA, to develop requirements that will lead to routine flights of unmanned aircraft systems flying in the national airspace system.
Test report for the run-in acceptance testing of the hydrogen mitigation retrieval Pump-3
International Nuclear Information System (INIS)
Berglin, B.G.; Nash, Ch.R.
1997-01-01
This report will provide the findings of the demonstration test conducted on the Double-Shell Tank (DST) 241-SY-101 HMR Pump-3 in accordance with WHC-SDWM-TP-434 ''Test plan for run-in acceptance testing of hydrogen mitigation/retrieval pump-3'' at the 400 Area Maintenance and Storage Facility (MASF) building from 7 June 1996 through 30 July 1996 per work package 4A-96-92/W. The DST 241-SY-101 hydrogen mitigation retrieval Pump-3 is a 200-HP submersible electric driven pump that has been modified for use in the DST 241-SY-101 containing mixed waste located in the 200W area. The pump has a motor driven rotation mechanism that allows the pump column to rotate through 355 degree. Prior to operation, pre-operational checks were performed which included loop calibration grooming and alignment of instruments, learning how plumb HMR-3 assembly hung in a vertical position and bump test of the motor to determine rotation direction. The pump was tested in the MASF Large Diameter Cleaning Vessel (LDCV) with process water at controlled temperatures and levels. In addition, the water temperature of the cooling water to the motor oil heat exchanger was recorded during testing. A 480-volt source powered a Variable Frequency Drive (VFD). The VFD powered the pump at various frequencies and voltages to control speed and power output of the pump. A second VFD powered the oil cooling pump. A third VFD was not available to operate the rotational drive motor during the 72 hour test, so it was demonstrated as operational before and after the test. A Mini Acquisition and Control System (Mini-DACS) controls pump functions and monitoring of the pump parameters. The Mini-DACS consists of three computers, software and some Programmable Logic Controllers (PLC). Startup and shutdown of either the pump motor or the oil cooling pump can be accomplished by the Mini-DACS. When the pump was in operation, the Mini-DACS monitors automatically collects data electronically. However, some required data
Kassel, Florian; Dabrowski, Anne; de Boer, Wim
2016-01-01
The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field,...
Benchmark test of JENDL-3T and -3T/Rev.1
International Nuclear Information System (INIS)
Takano, Hideki; Kaneko, Kunio.
1989-10-01
The fast reactor 70-group constant set JFS-3-J3T has been generated by using the JENDL-3T nuclear data. One-dimensional 21-benchmark cores and the ZPPR-9 core were analysed with the JFS-3-J3T set. The results obtained are summarized as follows: (1) The values of keff are underestimated by 0.6% for Pu-fueled cores and overestimated by 2% for U-fueled cores. (2) The central reaction rate ratio 239 σ f φ/ 235 σ f φ is in a good agreement with the experimental value, though 238 σ c φ/ 239 σ f φ and 238 σ f φ/ 235 σ f φ are overestimated. (3) Doppler and Na-void reactivities are in a good agreement with the measured data. (4) The prediction accuracy of radial reaction rate distributions are improved in the comparison of the results obtained with the JENDL-2 data. Furthermore, the benchmark test of JENDL-3T/Rev. 1 which was revised from JENDL-3T for several important nuclides has been again performed. It was shown that JENDL-3T/Rev. 1 would predict nuclear characteristics more satisfactorily than JENDL-3T. (author)
EQ3/6 software test and verification report 9/94
International Nuclear Information System (INIS)
Kishi, T.
1996-02-01
This document is the Software Test and Verification Report (STVR) for the EQ3/6 suite of codes as stipulated in the Individual Software Plan for Initial Qualification of EQ3/6 (ISP-NF-07, Revision 1, 11/25/92). The software codes, EQPT, EQ3NR, EQ6, and the software library EQLIB constitute the EQ3/6 software package. This software test and verification project for EQ3/6 was started under the requirements of the LLNL Yucca Mountain Project Software Quality Assurance Plan (SQAP), Revision 0, December 14, 1989, but QP 3.2, Revision 2, June 21, 1994 is now the operative controlling procedure. This is a ''V and V'' report in the language of QP 3.2, Revision 2. Because the author of this report does not have a background in geochemistry, other technical sources were consulted in order to acquire some familiarity with geochemisty, the terminology minology involved, and to review comparable computational methods especially, geochemical aqueous speciation-solubility calculations. The software for the EQ3/6 package consists of approximately 47,000 lines of FORTRAN77 source code and nine on platforms ranging from workstations to supercomputers. The physical control of EQ3/6 software package and documentation is on a SUN SPARC station. Walkthroughs of each principal software packages, EQPT, EQ3NR, and EQ6 were conducted in order to understand the computational procedures involved, to determine any commonality in procedures, and then to establish a plan for the test and verification of EQ3/6. It became evident that all three phases depended upon solving an n x n matrix by the Newton-Raphson Method. Thus, a great deal of emphasis on the test and verification of this procedure was carried out on the first code in the software package EQPT
EQ3/6 software test and verification report 9/94
Energy Technology Data Exchange (ETDEWEB)
Kishi, T.
1996-02-01
This document is the Software Test and Verification Report (STVR) for the EQ3/6 suite of codes as stipulated in the Individual Software Plan for Initial Qualification of EQ3/6 (ISP-NF-07, Revision 1, 11/25/92). The software codes, EQPT, EQ3NR, EQ6, and the software library EQLIB constitute the EQ3/6 software package. This software test and verification project for EQ3/6 was started under the requirements of the LLNL Yucca Mountain Project Software Quality Assurance Plan (SQAP), Revision 0, December 14, 1989, but QP 3.2, Revision 2, June 21, 1994 is now the operative controlling procedure. This is a ``V and V`` report in the language of QP 3.2, Revision 2. Because the author of this report does not have a background in geochemistry, other technical sources were consulted in order to acquire some familiarity with geochemisty, the terminology minology involved, and to review comparable computational methods especially, geochemical aqueous speciation-solubility calculations. The software for the EQ3/6 package consists of approximately 47,000 lines of FORTRAN77 source code and nine on platforms ranging from workstations to supercomputers. The physical control of EQ3/6 software package and documentation is on a SUN SPARC station. Walkthroughs of each principal software packages, EQPT, EQ3NR, and EQ6 were conducted in order to understand the computational procedures involved, to determine any commonality in procedures, and then to establish a plan for the test and verification of EQ3/6. It became evident that all three phases depended upon solving an n x n matrix by the Newton-Raphson Method. Thus, a great deal of emphasis on the test and verification of this procedure was carried out on the first code in the software package EQPT.
TRH and T3 suppression tests after 131I therapy of thyrotoxicosis
International Nuclear Information System (INIS)
Tamai, Hajime; Tsushimi, Takashi; Shizume, Kazuo; Kuma, Kanji; Suematsu, Hiroyuki.
1976-01-01
TRH and T 3 suppression tests were performed on patients (124 cases) with Graves' disease who underwent radiotherapy. TRH test was performed at 4 - 6 months (Group I), 6 - 12 months (Group II), 12 - 24 months (Group III) and 24 - 50 months (Group IV) after final radiotherapy, and T 3 suppression test was performed just after each TRH test. Among 124 patients in Group I to IV who were clinically euthyroid and whose T 3 -RU and T 4 values were normal, compared with other groups, Group IV (2 - 4.2 Y) showed a significantly higher percentage of positive responses to both TRH and T 3 suppression tests. However, among 49 of 124 patients whose T 3 was also normal, there were no significant differences between the groups. The value of triiodothyronine was above the normal range in many cases up to 2 years after radiotherapy (in Group I, II, III). There were no significant differences in the percentage of hyperresponses between any of the four groups. Half of the patients who showed positive responses to TRH test showed exaggerated responses. In all cases when the responses to TRH and T 3 suppression tests changed from negative to positive, thyroxine and triiodothyronine concentrations must be within the normal range. In particular, the major determinant seems to be the value of triiodothyronine. As in more than 30% of cases TRH and T 3 suppression tests remained negative even though their T 3 -RU, T 4 , T 3 , values became normal after radiotherapy, the regulation of hypothalamo-hypophyseal thyroid axis do not always return to normal even though circulating thyroidal hormone level return to an euthyroid state. (J.P.N.)
Test of 6-in.-thick pressure vessels. Series 3: intermediate test vessel V-7
International Nuclear Information System (INIS)
Merkle, J.G.; Robinson, G.C.; Holz, P.P.; Smith, J.E.; Bryan, R.H.
1976-08-01
The test of intermediate test vessel V-7 was a crack-initiation fracture test of a 152-mm-thick (6-in.), 990-mm-OD (39-in.) vessel of ASTM A533, grade B, class 1 steel plate with a sharp outside surface flaw 457 mm (18 in.) long and about 135 mm (5.3 in.) deep. The vessel was heated to 91 0 C (196 0 F) and pressurized hydraulically until leakage through the flaw terminated the test at a peak pressure of 147 MPa (21,350 psi). Fracture toughness data obtained by testing precracked Charpy-V and compact-tension specimens machined from a prolongation of the cylindrical test shell were used in pretest analyses of the flawed vessel. The vessel, as expected, did not burst. Upon depressurization, the ruptured ligament closed so as to maintain static pressure without leakage at about 129 MPa
46 CFR 61.35-3 - Required tests and checks.
2010-10-01
... heaters without water level controls) must be tested by interrupting the feed water supply. Manual reset... alarm and visible indicator must be verified. The shutdown times must be verified. (3) Fuel supply... draft loss interlock switch must be tested to ensure proper operation. The draft limit control must...
Start-up test of Fukushima Daini Nuclear Power Station Unit No.3
International Nuclear Information System (INIS)
Inomata, Toshio; Umezu, Akira; Kajikawa, Makoto; Koibuchi, Hiroshi; Netsu, Nobuhiko.
1986-01-01
In Unit 3 of the Fukushima Nuclear Power Station II (daini), a BWR power plant of output 1,100 MW, commercial operation was started in June 1985. Its start-up test was finished successfully in about nine months. That is, new equipments introduced were demonstration tested. Though the items of testing are increased, the start-up test took short time, resulting in construction period only 54.7 months of the Unit 3, the shortest in the world. During the test, there was no scramming other than the planned. Described are the following: an outline of the Unit 3, the items of its improvement and standardization, including the new equipments, preparations for the start-up test, the start-up test and its evaluation. (Mori, K.)
Post test analysis of TEPSS tests -P2-, -P3-, -P5- and -P7- using the system code RELAP5/MOD 3.2
International Nuclear Information System (INIS)
Luebbesmeyer, D.
2000-01-01
For the PANDA-Test-Facility (TEPSS configuration) post-test calculations and analyses have been performed for experiment -P2- (Early Start), -P3- (PCC start up), -P5- (Symmetric case, Two PCCs only) and -P7- (Severe Accident). Post test calculations have been performed with the system code RELAP5/Mod 3.2 using two different nodalization of the PANDA facility namely a basis nodalization and a much reduced one. The general trend of the calculations can be summarised: RELAP5/Mod3.2 calculated the general trends of the experiments sufficiently accurate; Using the reduced nodalization the results seem to be slightly more accurate than for the basic nodalization; On the other hand, calculations based on the reduced nodalization are not significantly faster than those with basic nodalization; The mass error is in the order of 200 to 900 kg. (author)
Protein (Viridiplantae): 145354532 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 436017:4420 predicted protein Ostreococcus lucimarinus CCE9901 MSTRRPTTRARADDGFARDDDEDDGAHDDVAANTIVVYTKPGCCLCDGLKDKLDAAVDAAARAPPGASL...ECLRDFALCVRDVSTNAAWAESYAGSVPRVFVRVAVDAASTERSSVVSREFARPPPKRAAARVAEDLASLVRRACAPARAGWTVVTTTAWDAPSSSF ...
GSETT-3: testing the experimental international seismic monitoring system
International Nuclear Information System (INIS)
Ringdal, Frode
1995-01-01
Global seismic monitoring system has been developed by the Conference on Disarmaments (CDs) ad hoc group of scientific experts to consider international cooperative measures to detect and identify seismic events (the GSE), based in Geneva. In the course of its work, the GSE has conducted two large-scale global technical tests, Global Seismic Events Technical Test-1 (GSETT-1) in 1984 and GSETT-2 in 1991. The GSE has now embarked upon its third and most ambitious technical test, GSETT-3, which will encompass the development, testing and evaluation of a working prototype of the eventual Comprehensive Test Ban Treaty (CTBT) seismic monitoring system
Salter, Robert S; Douglas, David; McRobbie, Lindsey; Quintana, Julio; Legg, David; Schwartz, Janine; Conaway, David; McPhee, Carla; Saul, Steven; Markovsky, Robert
2011-01-01
The Charm 3 SL3 beta-Lactam Test is a 3 min receptor-based lateral-flow Rapid One-Step Assay (ROSA) that detects the six beta-lactam drugs of concern approved for dairy cattle in the United States. The method is a biochemical formulation change of the SL3 beta-Lactam Test evaluated and approved in 2007. The Charm 3 SL3 was evaluated under the AOAC Research Institute Performance Tested Method (PTM) program following the protocol of the U.S. Food and Drug Administration, Center for Veterinary Medicine. The method was approved as PTM 071002 on May 8, 2009. The following drugs were detected in three combined lots: penicillin G at 3.8 ppb, ampicillin at 8.0 ppb, amoxicillin at 8.4 ppb, cephapirin at 20.0 ppb, ceftiofur (total metabolites) at 79 ppb, and cloxacillin at 8.6 ppb > or = 90% of the time with 95% confidence. These detection levels are lower than, but within 75% of, the U.S. Safe Level/Tolerances. Lot-to-lot repeatability was typically within 20% of these determined levels. The test kit was found to be suitable for testing thawed frozen samples. It was also found to respond with equal or better sensitivity to samples that contained incurred analytes, i.e., both the microbiologically active parent drug and its active metabolites. There were no interferences from somatic cells at 1.1 million/mL, bacterial cells at 300 000 CFU/mL, or 32 other non-beta-lactam drugs at 100 ppb. Ruggedness experiments indicated that the test procedure is robust. These results meet the fit-for-purpose approval criteria for inclusion in the National Conference for Interstate Milk Shipments milk testing program.
Wang, Xin-jie; Huang, Jin-lou; Liu, Zhi-qiang; Yue, Xi
2013-09-01
This research chose five lead-contaminated sites of a lead-acid battery factory to analyze the speciation distribution and concentration of lead. Under the same conditions (0.1 mol x L(-1) EDTA,30 min, 25 degrees C), the removal effect of heavy metal was compared between ultrasonic-assisted chemical extraction (UCE) and conventional chemical extraction ( CCE), and the variation of lead speciation was further explored. The results showed that the lead removal efficiency of UCE was significantly better than CCE. The lead removal efficiency of WS, A, B, C and BZ was 10.06%, 48.29%, 48.69%, 53.28% and 36.26% under CCE. While the removal efficiency of the UCE was 22.42%, 69.31%, 71.00%, 74.49% and 71.58%, with the average efficiency higher by 22%. By comparing the speciation distribution of the two washing methods, it was found that the acid extractable content maintained or decreased after UCE, whereas it showed an increasing trend after CCE. The reduction effect of the reducible was as high as 98% by UCE. UCE also showed a more efficient reduction effect of the organic matter-sulfite bounded form and the residual form. Hence, it is feasible to improve the washing efficiency of heavy metal contained in soil by conducting the cleaning process with the help of ultrasonic wave, which is a simple and fast mean to remove lead from contaminated sites.
Tests of BF3 counters with getter
International Nuclear Information System (INIS)
Comte, R.; Dauphin, G.
1968-01-01
BF 3 counters with addition of a getter have been developed to improve operation characteristics of these detectors in presence of strong gamma flows. The getter is made of an active coal deposit on the cathode. As noticed by other studies, the degradation of these counters is related to the exposure to strong neutron flows and to gamma radiations. The authors report tests performed on these counters with a brief presentation of the counters, and a presentation of the test installation. A threshold curve and an amplitude spectrum are obtained, and counting is performed for a fixed threshold before and after the exposure of detectors to variable doses of γ radiation. The results after a first 2 hour long irradiation, a 230 hour long second irradiation, and a third irradiation under high voltage (2100 V) are discussed. Thermal tests are then performed and commented
THE THIRD GRAVITATIONAL LENSING ACCURACY TESTING (GREAT3) CHALLENGE HANDBOOK
International Nuclear Information System (INIS)
Mandelbaum, Rachel; Kannawadi, Arun; Simet, Melanie; Rowe, Barnaby; Kacprzak, Tomasz; Bosch, James; Miyatake, Hironao; Chang, Chihway; Gill, Mandeep; Courbin, Frederic; Jarvis, Mike; Armstrong, Bob; Lackner, Claire; Leauthaud, Alexie; Nakajima, Reiko; Rhodes, Jason; Zuntz, Joe; Bridle, Sarah; Coupon, Jean; Dietrich, Jörg P.
2014-01-01
The GRavitational lEnsing Accuracy Testing 3 (GREAT3) challenge is the third in a series of image analysis challenges, with a goal of testing and facilitating the development of methods for analyzing astronomical images that will be used to measure weak gravitational lensing. This measurement requires extremely precise estimation of very small galaxy shape distortions, in the presence of far larger intrinsic galaxy shapes and distortions due to the blurring kernel caused by the atmosphere, telescope optics, and instrumental effects. The GREAT3 challenge is posed to the astronomy, machine learning, and statistics communities, and includes tests of three specific effects that are of immediate relevance to upcoming weak lensing surveys, two of which have never been tested in a community challenge before. These effects include many novel aspects including realistically complex galaxy models based on high-resolution imaging from space; a spatially varying, physically motivated blurring kernel; and a combination of multiple different exposures. To facilitate entry by people new to the field, and for use as a diagnostic tool, the simulation software for the challenge is publicly available, though the exact parameters used for the challenge are blinded. Sample scripts to analyze the challenge data using existing methods will also be provided. See http://great3challenge.info and http://great3.projects.phys.ucl.ac.uk/leaderboard/ for more information
Quality assurance: Fundamental reproducibility tests for 3D treatment‐planning systems
Able, Charles M.; Thomas, Michael D.
2005-01-01
The use of image‐based 3D treatment planning has significantly increased the complexity of commercially available treatment‐planning systems (TPSs). Medical physicists have traditionally focused their efforts on understanding the calculation algorithm; this is no longer possible. A quality assurance (QA) program for our 3D treatment‐planning system (ADAC Pinnacle3) is presented. The program is consistent with the American Association of Physicists in Medicine Task Group 53 guidelines and balances the cost‐versus‐benefit equation confronted by the clinical physicist in a community cancer center environment. Fundamental reproducibility tests are presented as required for a community cancer center environment using conventional and 3D treatment planning. A series of nondosimetric tests, including digitizer accuracy, image acquisition and display, and hardcopy output, is presented. Dosimetric tests include verification of monitor units (MUs), standard isodoses, and clinical cases. The tests are outlined for the Pinnacle3 TPS but can be generalized to any TPS currently in use. The program tested accuracy and constancy through several hardware and software upgrades to our TPS. This paper gives valuable guidance and insight to other physicists attempting to approach TPS QA at fundamental and practical levels. PACS numbers: 87.53.Tf, 87.53.Xd PMID:16143788
PIE Report on the KOMO-3 Irradiation Test Fuels
International Nuclear Information System (INIS)
Park, Jong Man; Ryu, H. J.; Yang, J. H.
2009-04-01
In the KOMO-3, in-reactor irradiation test had been performed for 12 kinds of dispersed U-Mo fuel rods, a multi wire fuel rod and a tube fuel rod. In this report we described the PIE results on the KOMO-3 irradiation test fuels. The interaction layer thickness between fuel particle and matrix could be reduced by using a large size U-Mo fuel particle or introducing Al-Si matrix or adding the third element in the U-Mo particle. Monolithic fuel rod of multi-wire or tube fuel was also effective in reducing the interaction layer thickness
E3 Testing of Directed Energy Systems: A Challenging Future
National Research Council Canada - National Science Library
Brown, Lyndell R
2009-01-01
.... Compatibility testing and susceptibility to electromagnetic radiation is required. Standards, such as MIL-STD-464 and MIL-STD-237D, are being revised to include HPM levels and frequencies for E3 tests...
Integral data testing of JENDL-3.2 for fusion reactor and shielding applications
International Nuclear Information System (INIS)
Oyama, Yukio
1995-01-01
Integral data testing of JENDL-3.2 is being performed in the activities of two working groups of the Japanese Nuclear Data Committee. The continuous and group-wise libraries prepared from JENDL-3.2 are planned to be tested by the working groups. In this paper, the continuous library FSXLIB-J3R2 processed from JENDL-3.2 for MCNP was tested for fission and fusion neutrons using data of integral experiments and compared to the results of JENDL-3.1. The results of integral data testing of JENDL-3.2 for fusion and shielding application are reviewed. (author)
International Nuclear Information System (INIS)
Strait, S.R.; Spane, F.A. Jr.
1982-11-01
This report presents preliminary results and description of hydrologic test activities for the composite Umtanum basalt flow top (3,568--3,781 feet) at Borehole RRL-2. Hydrologic tests conducted include two constant discharge air-lift and four slug tests. Preliminary results indicate an observed hydraulic head for the test interval of 405.7 feet above mean sea level. Transmissivity values determined from hydrologic tests performed, range between 244 to 481 ft 2 /day, with an assigned best estimate of 480 ft 2 /day. The best estimate of equivalent hydraulic conductivity, based on an effective test thickness of 157 feet, is 3.1 ft/day. 7 refs., 9 figs., 3 tabs
Application of startup/core management code system to YGN 3 startup testing
International Nuclear Information System (INIS)
Chi, Sung Goo; Hah, Yung Joon; Doo, Jin Yong; Kim, Dae Kyum
1995-01-01
YGN 3 is the first nuclear power plant in Korea to use the fixed incore detector system for startup testing and core management. The startup/core management code system was developed from existing ABB-C-E codes and applied for YGN 3 startup testing, especially for physics and CPC(Core Protection Calculator)/COLSS (Core Operating Limit Supervisory System) related testing. The startup/core management code system consists of startup codes which include the CEBASE, CECOR, CEFAST and CEDOPS, and startup data reduction codes which include FLOWRATE, COREPERF, CALMET, and VARTAV. These codes were implemented on an HP/Apollo model 9000 series 400 workstation at the YGN 3 site and successfully applied to startup testing and core management. The startup codes made a great contribution in upgrading the reliability of test results and reducing the test period by taking and analyzing core data automatically. The data reduction code saved the manpower and time for test data reduction and decreased the chance for error in the analysis. It is expected that this code system will make similar contributions for reducing the startup testing duration of YGN 4 and UCN3,4
Evaluation of the control system checkout test results for YGN 3
International Nuclear Information System (INIS)
Hong, Eon Young; Shon, Suk Whun; Kim, Shim Whan; Sung, Kang Sik; Seo, Jong Tae.
1996-11-01
During the Yonggwang Nuclear Power Plant Unit 3 (YGN3) Power Ascension Test (PAT) period, the Control System Checkout tests were performed at 10%, 20%, 50%, 80%, and 100% respectively. This test evaluates the performance of the feedwater control system, reactor regulating system, pressurizer level and pressure control system in controlling their respective parameters within specified control bands at different power levels. The first test evaluates the ability of the FWCS to control steam generator 1 and 2 water levels during steady and transient conditions. The SG level setpoint was changed from normal SG level. The FWCS no.1 and no.2 controlled the SG water level to the new setpoint within the acceptable band. The second test evaluates the ability of the reactor regulating system (RRS) to control reactor coolant system (RCS) average temperature with respect to the reference temperature. The final test evaluates the ability of all of the control systems to work in an integrated manner controlling their respective parameters while the plant is at steady state conditions. The FWCS, RRS, SBCS, PLCS control their respective parameters within the control bands. The tests performed at Unit 3 were successful by meeting all of the test acceptable criteria. The measured test data for the major plant parameters were collected and evaluated. (author). 14 tabs., 217 figs., 7 refs
International Nuclear Information System (INIS)
Gillespie, S.
2000-01-01
This report describes the tests performed to validate the CRWMS ''Analysis and Logistics Visually Interactive'' Model (CALVIN) Version 3.0 (V3.0) computer code (STN: 10074-3.0-00). To validate the code, a series of test cases was developed in the CALVIN V3.0 Validation Test Plan (CRWMS M and O 1999a) that exercises the principal calculation models and options of CALVIN V3.0. Twenty-five test cases were developed: 18 logistics test cases and 7 cost test cases. These cases test the features of CALVIN in a sequential manner, so that the validation of each test case is used to demonstrate the accuracy of the input to subsequent calculations. Where necessary, the test cases utilize reduced-size data tables to make the hand calculations used to verify the results more tractable, while still adequately testing the code's capabilities. Acceptance criteria, were established for the logistics and cost test cases in the Validation Test Plan (CRWMS M and O 1999a). The Logistics test cases were developed to test the following CALVIN calculation models: Spent nuclear fuel (SNF) and reactivity calculations; Options for altering reactor life; Adjustment of commercial SNF (CSNF) acceptance rates for fiscal year calculations and mid-year acceptance start; Fuel selection, transportation cask loading, and shipping to the Monitored Geologic Repository (MGR); Transportation cask shipping to and storage at an Interim Storage Facility (ISF); Reactor pool allocation options; and Disposal options at the MGR. Two types of cost test cases were developed: cases to validate the detailed transportation costs, and cases to validate the costs associated with the Civilian Radioactive Waste Management System (CRWMS) Management and Operating Contractor (M and O) and Regional Servicing Contractors (RSCs). For each test case, values calculated using Microsoft Excel 97 worksheets were compared to CALVIN V3.0 scenarios with the same input data and assumptions. All of the test case results compare with
Description of radiation damage in diamond sensors using an effective defect model
International Nuclear Information System (INIS)
Kassel, Florian; Guthoff, Moritz; Dabrowski, Anne; Boer, Wim de
2017-01-01
The Beam Condition Monitoring Leakage (BCML) system is a beam monitoring device in the CMS experiment at the LHC consisting of 32 poly-crystalline (pCVD) diamond sensors. The BCML sensors, located in rings around the beam, are exposed to high particle rates originating from the colliding beams. These particles cause lattice defects, which act as traps for the ionized charge carrier leading to a reduced charge collection efficiency (CCE). The radiation induced CCE degradation was, however, much more severe than expected from low rate laboratory measurements. Measurement and simulations presented in this paper show that this discrepancy is related to the rate of incident particles. At high particle rates, the trapping rate of the ionization is strongly increased compared to the detrapping rate leading to an increased build-up of space charge. This space charge locally reduces the internal electric field increasing the trapping rate and hence reducing the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge, the TCAD simulation program SILVACO was used. It allows to introduce the defects as effective donor and acceptor levels, and can calculate the electric field from Transient Current Technique (TCT) signals and CCE as a function of the effective trap properties, like density, energy level, and trapping cross section. After each irradiation step, these properties were fitted to the data on the electric field from the TCT signals and CCE. Two effective acceptor and donor levels were needed to fit the data after each step. It turned out that the energy levels and cross sections could be kept constant and the trap density was proportional to the cumulative fluence of the irradiation steps. The highly non-linear rate dependent diamond polarization and the resulting signal loss can be simulated using this effective defect model and is in agreement with the measurement results
Description of radiation damage in diamond sensors using an effective defect model
Energy Technology Data Exchange (ETDEWEB)
Kassel, Florian [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany); CERN, Meyrin (Switzerland); Guthoff, Moritz; Dabrowski, Anne [CERN, Meyrin (Switzerland); Boer, Wim de [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany)
2017-11-15
The Beam Condition Monitoring Leakage (BCML) system is a beam monitoring device in the CMS experiment at the LHC consisting of 32 poly-crystalline (pCVD) diamond sensors. The BCML sensors, located in rings around the beam, are exposed to high particle rates originating from the colliding beams. These particles cause lattice defects, which act as traps for the ionized charge carrier leading to a reduced charge collection efficiency (CCE). The radiation induced CCE degradation was, however, much more severe than expected from low rate laboratory measurements. Measurement and simulations presented in this paper show that this discrepancy is related to the rate of incident particles. At high particle rates, the trapping rate of the ionization is strongly increased compared to the detrapping rate leading to an increased build-up of space charge. This space charge locally reduces the internal electric field increasing the trapping rate and hence reducing the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge, the TCAD simulation program SILVACO was used. It allows to introduce the defects as effective donor and acceptor levels, and can calculate the electric field from Transient Current Technique (TCT) signals and CCE as a function of the effective trap properties, like density, energy level, and trapping cross section. After each irradiation step, these properties were fitted to the data on the electric field from the TCT signals and CCE. Two effective acceptor and donor levels were needed to fit the data after each step. It turned out that the energy levels and cross sections could be kept constant and the trap density was proportional to the cumulative fluence of the irradiation steps. The highly non-linear rate dependent diamond polarization and the resulting signal loss can be simulated using this effective defect model and is in agreement with the measurement results
Powder-based 3D printing application for geomechanical testing
Williams, M.; Yoon, H.; Choens, R. C., II; Martinez, M. J.; Dewers, T. A.; Lee, M.
2017-12-01
3D printing of fractured and porous analog geomaterials has the potential to enhance hydrogeological and mechanical interpretations by generating engineered samples in testable configurations with reproducible microstructures and tunable surface and mechanical properties. For geoscience applications, 3D printing technology can be co-opted to print reproducible structures derived from CT-imaging of actual rocks and theoretical algorithms. In particular, the use of 3D printed samples allows us to overcome sample-to-sample heterogeneity that plague rock physics testing and to test material response independent from material variability. In this work, gypsum powder-based 3D printing was used to print cylindrical core samples and block samples with a pre-existing flaw geometry. All samples are printed in three different directions to evaluate the impact of printing direction on mechanical properties. For the cylindrical samples, unconfined compression testing has been performed. For compressive strength, the samples printed perpendicular to the loading direction show stronger than those printed parallel to the loading and at 45 degree. Micro-CT images of the printed samples reveal the uneven spreading of binder, resulting in soft inner core surrounded by stronger outer shell. In particular, the layered feature with binder causes the strong anisotropic properties. This was also confirmed by the wave velocity. For the small block samples ( 6.1cm wide, 10cm high, and 1.25cm thick) with an inclined flaw, uniaxial tests coupled with an array of acoustic emission sensors and digital image correlation revealed that cracks were developed at/near the tip of flaw as expected. Although acoustic events were detected, localization was not detectable mainly due to strong attenuation. Advantage and disadvantage of power-based 3D printing for mechanical testing will be discussed and a few attempts will be presented to improve the applicability of powder-based printing technique. Sandia
Testing of the 3M Company ACCR Conductor
Energy Technology Data Exchange (ETDEWEB)
Stovall, J.P.; RIzy, D.T.; Kisner, R.A.; Deve, H.E. (3M Comp.)
2010-09-15
The 3M Company has developed a high-temperature low-sag conductor referred to as Aluminum- Conductor Composite-Reinforced or ACCR. The conductor uses an aluminum metal matrix material to replace the steel in conventional conductors so the core has a lower density and higher conductivity. The objective of this work is to accelerate the commercial acceptance by electric utilities of these new conductor designs by testing four representative conductor classes in controlled conditions. Overhead transmission lines use bare aluminum conductor strands wrapped around a steel core strands to transmit electricity. The typical cable is referred to as aluminum-conductor steel-reinforced (ACSR). The outer strands are aluminum, chosen for its conductivity, low weight, and low cost. The center strand is of steel for the strength required to support the weight without stretching the aluminum due to its ductility. The power density of a transmission corridor has been directly increased by increasing the voltage level. Transmission voltages have increased from 115-kV to 765- kV over the past 80 years. In the United States, further increasing the voltage level is not feasible at this point in time, so in order to further increase the power density of a transmission corridor, conductor designs that increase the current carrying capability have been examined. One of the key limiting factors in the design of a transmission line is the conductor sag which determines the clearance of the conductor above ground or underlying structures needed for electrical safety. Increasing the current carrying capability of a conductor increases the joule heating in the conductor which increases the conductor sag. A conductor designed for high-temperature and lowsag operation requires an engineered modification of the conductor materials. To make an advanced cable, the 3M Company solution has been the development of a composite conductor consisting of Nextel ceramic fibers to replace the steel core and
Total dose tests for the PROMICS-3 instrument
International Nuclear Information System (INIS)
Verkasalo, R.
1991-01-01
The sensitivity of some analog and digital integrated circuits (IC's) to ionizing radiation was tested in order to evaluate their potential usefulness especially in the PROMICS-3 instrument. The PROMICS-3 is a plasma instrument to be flown on the Russian Interball satellites. The radiation tolerance requirement of the auroral Interball satellite is about 45 krad/year inside a shielding of 4 mm Aluminium. The IC's tested were: AD571 A/D- converter, ADDAC80 D/A-converter, LF442A and PM108A operational amplifiers, MPREF0l voltage reference, STC SPXO 6 MHZ oscillator,4N55 optocoupler, MC5lC98 and CY7C164 16k*4 static CMOS RAM. Co-60 was used as the irradiation source. The test methods and results are described in the paper. The RAM-circuits failed between 10 and 20 krad. D/A- and A/D-converters degraded only slightly after 100 krad, but one of the A/D-converters failed functionally at 190 krad. The LF442A began to degrade in the test connection at 100 krad, and PM108A at 30 krad. The output voltage of the voltage reference MPREF01 increased about 20 mV after 100 krad. No change was observed in the output frequency of the STC SPXD oscillator even after 300 krad. The current tansfer ratio of the 4N55 decreased continuously to about 75 % of the initial value after 100 krad
T3i: A Tool for Generating and Querying Test Suites for Java
Prasetya, I.S.W.B.
2015-01-01
T3i is an automated unit-testing tool to test Java classes. To expose interactions T3i generates test-cases in the form of sequences of calls to the methods of the target class. What separates it from other testing tools is that it treats test suites as first class objects and allows users to e.g.
Shielding benchmark tests of JENDL-3
International Nuclear Information System (INIS)
Kawai, Masayoshi; Hasegawa, Akira; Ueki, Kohtaro; Yamano, Naoki; Sasaki, Kenji; Matsumoto, Yoshihiro; Takemura, Morio; Ohtani, Nobuo; Sakurai, Kiyoshi.
1994-03-01
The integral test of neutron cross sections for major shielding materials in JENDL-3 has been performed by analyzing various shielding benchmark experiments. For the fission-like neutron source problem, the following experiments are analyzed: (1) ORNL Broomstick experiments for oxygen, iron and sodium, (2) ASPIS deep penetration experiments for iron, (3) ORNL neutron transmission experiments for iron, stainless steel, sodium and graphite, (4) KfK leakage spectrum measurements from iron spheres, (5) RPI angular neutron spectrum measurements in a graphite block. For D-T neutron source problem, the following two experiments are analyzed: (6) LLNL leakage spectrum measurements from spheres of iron and graphite, and (7) JAERI-FNS angular neutron spectrum measurements on beryllium and graphite slabs. Analyses have been performed using the radiation transport codes: ANISN(1D Sn), DIAC(1D Sn), DOT3.5(2D Sn) and MCNP(3D point Monte Carlo). The group cross sections for Sn transport calculations are generated with the code systems PROF-GROUCH-G/B and RADHEAT-V4. The point-wise cross sections for MCNP are produced with NJOY. For comparison, the analyses with JENDL-2 and ENDF/B-IV have been also carried out. The calculations using JENDL-3 show overall agreement with the experimental data as well as those with ENDF/B-IV. Particularly, JENDL-3 gives better results than JENDL-2 and ENDF/B-IV for sodium. It has been concluded that JENDL-3 is very applicable for fission and fusion reactor shielding analyses. (author)
RELAP5-3D version 4.0.3: installation and tests for applications to space reactors
International Nuclear Information System (INIS)
Lobo, Paulo D.C.; Braz Filho, Francisco A.; Borges, Eduardo M.; Guimaraes, Lamartine N.F.; Sabundjian, Gaiane
2013-01-01
To attend the TERRA project (Tecnologia de Reatores Rapidos Avancados), currently conducted by the Nuclear Energy Division (ENU) of the IEAv, this work presents the RELAP5-3D, Version 4.0.3, prepared in July 12, 2012, also known as r3d403is, received recently by the IEAv from the Idaho National Laboratory (INL). This version of RELAP5-3D is configured for the International User Group source Code Group and is developed and maintained at the INL for the US Department of Energy. RELAP5-3D, the latest in the series of RELAP5 codes, is a highly generic code that, in addition to calculating the behavior of a reactor coolant system during a transient, can be used for simulation of a wide variety of hydraulic and thermal transients in both nuclear and nonnuclear systems involving mixtures of vapor, liquid, noncondensable gases, and nonvolatile solute. Enhancements include all features and models previously available in the ATHENA configuration version of the code which are as follows: addition of new work fluids and a magneto-hydrodynamic mode. Following the instructions from the README file, the RELAP5-3D, version 4.0.3 was installed creating the necessaries subdirectories, by using the LINUX platform and applying both Intel Fortran 95 and C-language compilers. Many input examples were executed and the same results were observed as compared to the received documentation. A sample of the Edwards-O'Brien test was evaluated to verify if the code could simulate a LOCA type accident properly. The test executed by the RELAP5-3D demonstrated good agreement with test data including a new output involving the mass flow during the test. (author)
RELAP5-3D version 4.0.3: installation and tests for applications to space reactors
Energy Technology Data Exchange (ETDEWEB)
Lobo, Paulo D.C.; Braz Filho, Francisco A.; Borges, Eduardo M.; Guimaraes, Lamartine N.F., E-mail: plobo.a@uol.com.br, E-mail: fbraz@ieav.cta.br, E-mail: eduardo@ieav.cta.br, E-mail: guimarae@ieav.cta.br [Instituto de Estudos Avancados (IEAv), Sao Jose dos Campos, SP (Brazil); Sabundjian, Gaiane, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
To attend the TERRA project (Tecnologia de Reatores Rapidos Avancados), currently conducted by the Nuclear Energy Division (ENU) of the IEAv, this work presents the RELAP5-3D, Version 4.0.3, prepared in July 12, 2012, also known as r3d403is, received recently by the IEAv from the Idaho National Laboratory (INL). This version of RELAP5-3D is configured for the International User Group source Code Group and is developed and maintained at the INL for the US Department of Energy. RELAP5-3D, the latest in the series of RELAP5 codes, is a highly generic code that, in addition to calculating the behavior of a reactor coolant system during a transient, can be used for simulation of a wide variety of hydraulic and thermal transients in both nuclear and nonnuclear systems involving mixtures of vapor, liquid, noncondensable gases, and nonvolatile solute. Enhancements include all features and models previously available in the ATHENA configuration version of the code which are as follows: addition of new work fluids and a magneto-hydrodynamic mode. Following the instructions from the README file, the RELAP5-3D, version 4.0.3 was installed creating the necessaries subdirectories, by using the LINUX platform and applying both Intel Fortran 95 and C-language compilers. Many input examples were executed and the same results were observed as compared to the received documentation. A sample of the Edwards-O'Brien test was evaluated to verify if the code could simulate a LOCA type accident properly. The test executed by the RELAP5-3D demonstrated good agreement with test data including a new output involving the mass flow during the test. (author)
Experiment data report for semiscale Mod-1 test S-02-3 (blowdown heat transfer test)
International Nuclear Information System (INIS)
Crapo, H.S.; Jensen, M.F.; Sackett, K.E.
1975-09-01
Recorded test data are presented for Test S-02-3 of the Semiscale Mod-1 blowdown heat transfer test series. Test S-02-3 was conducted from an initial cold leg fluid temperature of 544 0 F and an initial pressure of 2,263 psig. A simulated double-ended offset shear cold leg break was used to investigate the system response to a depressurization transient with a moderately heated core (75 percent design power level). An electrically heated core was used in the pressure vessel to simulate the effects of a nuclear core. System flow was also set at the 75 percent design level to achieve full core temperature differential. The flow resistance of the intact loop was based on core area scaling. During system depressurization, core power was reduced from the initial level of 1.2 MW in such a manner as to simulate the surface heat flux response of the LOFT nuclear fuel rods until such time that departure from nucleate boiling (DNB) occurs. Blowdown to the pressure suppression system was accomplished without simulated emergency core coolant injection or pressure suppression system coolant spray
Validation of the 3-day rule for stool bacterial tests in Japan.
Kobayashi, Masanori; Sako, Akahito; Ogami, Toshiko; Nishimura, So; Asayama, Naoki; Yada, Tomoyuki; Nagata, Naoyoshi; Sakurai, Toshiyuki; Yokoi, Chizu; Kobayakawa, Masao; Yanase, Mikio; Masaki, Naohiko; Takeshita, Nozomi; Uemura, Naomi
2014-01-01
Stool cultures are expensive and time consuming, and the positive rate of enteric pathogens in cases of nosocomial diarrhea is low. The 3-day rule, whereby clinicians order a Clostridium difficile (CD) toxin test rather than a stool culture for inpatients developing diarrhea >3 days after admission, has been well studied in Western countries. The present study sought to validate the 3-day rule in an acute care hospital setting in Japan. Stool bacterial and CD toxin test results for adult patients hospitalized in an acute care hospital in 2008 were retrospectively analyzed. Specimens collected after an initial positive test were excluded. The positive rate and cost-effectiveness of the tests were compared among three patient groups. The adult patients were divided into three groups for comparison: outpatients, patients hospitalized for ≤3 days and patients hospitalized for ≥4 days. Over the 12-month period, 1,597 stool cultures were obtained from 992 patients, and 880 CD toxin tests were performed in 529 patients. In the outpatient, inpatient ≤3 days and inpatient ≥4 days groups, the rate of positive stool cultures was 14.2%, 3.6% and 1.3% and that of positive CD toxin tests was 1.9%, 7.1% and 8.5%, respectively. The medical costs required to obtain one positive result were 9,181, 36,075 and 103,600 JPY and 43,200, 11,333 and 9,410 JPY, respectively. The 3-day rule was validated for the first time in a setting other than a Western country. Our results revealed that the "3-day rule" is also useful and cost-effective in Japan.
Lundsten, E. M.; Anderson, K.; Caress, D. W.; Thomas, H. J.; Paull, C. K.; Maier, K. L.; Gwiazda, R.; Gales, J. A.; Talling, P.; Xu, J.; Parsons, D. R.
2017-12-01
As part of a multi-institution submarine canyon study, the Coordinated Canyon Experiment (CCE), high-resolution multibeam bathymetric surveys of the floor of Monterey Canyon, offshore California, were conducted to capture the changes in seafloor morphology directly related to the passage of sediment density flows documented during the study. The goals of this study were to monitor the passage of sediment density flows as they move through the axis of a submarine canyon in order to understand the velocity structure of these flows and to document the associated changes in seafloor morphology and the resultant deposits. The CCE consisted of an array of moorings and sensors deployed on the canyon floor during the 18-month period between October 2015 and April 2017. In addition, a mapping AUV (Autonomous Underwater Vehicle) repeatedly surveyed two sites along the canyon during the study. Differencing the repeat grids quantified the morphological changes directly related to specifically documented, individual flow events. The AUV carried a Reson 7125 multibeam echosounder (vertical precision of 0.15 m and horizontal resolution of 1.0 m). An inertial navigation system combined with a Doppler velocity logger allowed the AUV to fly pre-programmed grids at 3 knots while maintaining an altitude of 50 m above the seafloor and obtain a nominal line spacing of 130 m. The axial channel between 200 and 540 m water depth was surveyed six times. At least fifteen density flow events were captured by the array of CCE instruments within this AUV survey area. These events caused moorings as well as several large and small instruments to move down canyon significant distances at least 30 times. Difference grids show the canyon experienced erosion and deposition of up to +/- 3 m between surveys. The pair of surveys that straddle a sediment transport event on December 1, 2015 show the seafloor was altered only down to 420 m water depth, consistent with the observations on the CCE
Colombia's space policy: An analysis of six years of progress and challenges
Becerra, Jairo
2014-07-01
This paper analyzes Colombia's space policy: its successes, its failures and what it still needs to achieve. The paper examines the interaction among the different players, and how this policy contributes to economic and social development of the country. And postulates that, unless a real national plan of action, with specific milestones and budget as well as a managing agency are developed, this policy may be in danger of disappearing. The Colombian Space Commission (Comisión Colombiana del Espacio, or CCE) was created by Presidential Decree 2442 in 2006. It is a multi-sectorial entity, in charge of coordinating, planning, and leading in the implementation of national policies for the development and application of space technologies. The CCE was also charged with the drafting of plans and programs in this field. The CCE began with only a few members (15) and today is comprised of 47 members: 13 ministries, 4 administrative departments, another 21 governmental entities and 9 universities, the latter acting as consultants. The Vice-President of the Republic is the President of the CCE. These different actors gave great importance to the development of Colombia's space sector, and 6 years later, they are continuing support and development the country's space policy. This analysis takes into account three aspects: first, achieving the objectives of the CCE: the creation and development of a national space policy for Colombia; secondly, focussing on “target groups” and “end users”; and thirdly, the “outcomes” or achievements to date. Some conclusions are worth highlighting: first, the warm reception and support of the CCE by both the public and private sectors on high levels, but the poor knowledge of the national space policy by the Colombian people and the small and medium companies. Secondly, in the context of public policy [9], the strategic plan called “National Policy in regard to Space Activities”, is caught between two phases: the formulation
SIMS prototype System 3 test results: engineering analysis
Energy Technology Data Exchange (ETDEWEB)
1978-08-01
The results obtained during testing of a closed hydronic drain down solar system designed for space and hot water heating are presented. Data analysis is included which documents the system performance and verifies the suitability of SIMS Prototype System 3 for field installation.
SIMS prototype system 3 test results: Engineering analysis
1978-01-01
The results obtained during testing of a closed hydronic drain down solar system designed for space and hot water heating is presented. Data analysis is included which documents the system performance and verifies the suitability of SIMS Prototype System 3 for field installation.
Operability test report for rotary mode core sampling system number 3
International Nuclear Information System (INIS)
Corbett, J.E.
1996-01-01
This report documents the successful completion of operability testing for the Rotary Mode Core Sampling (RMCS) system number-sign 3. The Report includes the test procedure (WHC-SD-WM-OTP-174), exception resolutions, data sheets, and a test report summary
Integrated Test and Evaluation Flight Test 3 Flight Test Plan
Marston, Michael Lawrence
2015-01-01
The desire and ability to fly Unmanned Aircraft Systems (UAS) in the National Airspace System (NAS) is of increasing urgency. The application of unmanned aircraft to perform national security, defense, scientific, and emergency management are driving the critical need for less restrictive access by UAS to the NAS. UAS represent a new capability that will provide a variety of services in the government (public) and commercial (civil) aviation sectors. The growth of this potential industry has not yet been realized due to the lack of a common understanding of what is required to safely operate UAS in the NAS. NASA's UAS Integration into the NAS Project is conducting research in the areas of Separation Assurance/Sense and Avoid Interoperability, Human Systems Integration (HSI), and Communication to support reducing the barriers of UAS access to the NAS. This research is broken into two research themes namely, UAS Integration and Test Infrastructure. UAS Integration focuses on airspace integration procedures and performance standards to enable UAS integration in the air transportation system, covering Sense and Avoid (SAA) performance standards, command and control performance standards, and human systems integration. The focus of Test Infrastructure is to enable development and validation of airspace integration procedures and performance standards, including the integrated test and evaluation. In support of the integrated test and evaluation efforts, the Project will develop an adaptable, scalable, and schedulable relevant test environment capable of evaluating concepts and technologies for unmanned aircraft systems to safely operate in the NAS. To accomplish this task, the Project will conduct a series of Human-in-the-Loop and Flight Test activities that integrate key concepts, technologies and/or procedures in a relevant air traffic environment. Each of the integrated events will build on the technical achievements, fidelity and complexity of the previous tests and
Launch Environmental Test for KITSAT-3 FM
Directory of Open Access Journals (Sweden)
Sang-Hyun Lee
1999-06-01
Full Text Available The satellite experiences the severe launch environment such as vibration, acceleration, shock, and acoustics induced by rocket. Therefore, the satellite should be designed and manufactured to endure such severe launch environments. In this paper, we describe the structure of the KITSAT-3 FM(Flight Model and the processes and results of the launch environmental test to ensure the reliability during launch period.
Hydrocoin level 3 - Testing methods for sensitivity/uncertainty analysis
International Nuclear Information System (INIS)
Grundfelt, B.; Lindbom, B.; Larsson, A.; Andersson, K.
1991-01-01
The HYDROCOIN study is an international cooperative project for testing groundwater hydrology modelling strategies for performance assessment of nuclear waste disposal. The study was initiated in 1984 by the Swedish Nuclear Power Inspectorate and the technical work was finalised in 1987. The participating organisations are regulatory authorities as well as implementing organisations in 10 countries. The study has been performed at three levels aimed at studying computer code verification, model validation and sensitivity/uncertainty analysis respectively. The results from the first two levels, code verification and model validation, have been published in reports in 1988 and 1990 respectively. This paper focuses on some aspects of the results from Level 3, sensitivity/uncertainty analysis, for which a final report is planned to be published during 1990. For Level 3, seven test cases were defined. Some of these aimed at exploring the uncertainty associated with the modelling results by simply varying parameter values and conceptual assumptions. In other test cases statistical sampling methods were applied. One of the test cases dealt with particle tracking and the uncertainty introduced by this type of post processing. The amount of results available is substantial although unevenly spread over the test cases. It has not been possible to cover all aspects of the results in this paper. Instead, the different methods applied will be illustrated by some typical analyses. 4 figs., 9 refs
Ceridono, M.; Tellner, P.; Bauer, D.; Barroso, J.; Alépée, N.; Corvi, R.; Smedt, A. de; Fellows, M.D.; Gibbs, N.K.; Heisler, E.; Jacobs, A.; Jirova, D.; Jones, D.; Kandárová,H.; Kasper, P.; Akunda, J.K.; Krul, C.; Learn, D.; Liebsch, M.; Lynch, A.M.; Muster, W.; Nakamura, K.; Nash, J.F.; Pfannenbecker, U.; Phillips, G.; Robles, C.; Rogiers, V.; Water, F. van de; Liminga, U.W.; Vohr, H.W.; Wattrelos, O.; Woods, J.; Zuang, V.; Kreysa, J.; Wilcox, P.
2012-01-01
This is the report from the “ECVAM–EFPIA workshop on 3T3 NRU Phototoxicity Test: Practical Experience and Implications for Phototoxicity Testing”, jointly organized by ECVAM and EFPIA and held on the 25–27 October 2010 in Somma Lombardo, Italy. The European Centre for the Validation of Alternative
Metallographic analysis of irradiated RERTR-3 fuel test specimens
International Nuclear Information System (INIS)
Meyer, M. K.; Hofman, G. L.; Strain, R. V.; Clark, C. R.; Stuart, J. R.
2000-01-01
The RERTR-3 irradiation test was designed to investigate the irradiation behavior of aluminum matrix U-MO alloy dispersion fuels under high-temperature, high-fission-rate conditions. Initial postirradiation examination of RERTR-3 fuel specimens has concentrated on binary U-MO atomized fuels. The rate of matrix aluminum depletion was found to be higher than predictions based on low temperature irradiation data. Wavelength Dispersive X-ray Spectroscopy (WDS) indicates that aluminum is present in the interior of the fuel particles. WDS data is supported by a mass and volume balance calculation performed on the basis of image analysis results. The depletion of matrix aluminum seems to have no detrimental effects on fuel performance under the conditions tested to date
Aquifer test plan for the 100-HR-3 Operable Unit
International Nuclear Information System (INIS)
Swanson, L.C.; Hartman, M.J.
1994-01-01
This test plan directs hydrologic testing activities planned at three existing Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) wells in the 100-HR-3 Operable Unit of the Hanford Site. Three additional wells will be installed near these existing wells and used as additional testing arid observation points during the field activities. Figure 1 shows the locations of the three test sites. A primary objective of the testing program is to provide more detailed hydraulic characterization information for the unconfined aquifer and targeted test sites than provided by the initial reconnaissance-level slug testing of Vukelich. A second objective is to evaluate the applicability of slug interference and dipole flow tests for detailed hydraulic characterization in an unconfined aquifer. This aquifer testing program will also be useful for substantiating hydraulic conductivities reported from previous slug tests and evaluating the effects of filter pack volume/configuration on slug test data. Vukelich recommended additional testing to address the latter two issues
Design and fuel fabrication processes for the AC-3 mixed-carbide irradiation test
International Nuclear Information System (INIS)
Latimer, T.W.; Chidester, K.M.; Stratton, R.W.; Ledergerber, G.; Ingold, F.
1992-01-01
The AC-3 test was a cooperative U.S./Swiss irradiation test of 91 wire-wrapped helium-bonded U-20% Pu carbide fuel pins irradiated to 8.3 at % peak burnup in the Fast Flux Test Facility. The test consisted of 25 pins that contained spherepac fuel fabricated by the Paul Scherrer Institute (PSI) and 66 pins that contained pelletized fuel fabricated by the Los Alamos National Laboratory. Design of AC-3 by LANL and PSI was begun in 1981, the fuel pins were fabricated from 1983 to 1985, and the test was irradiated from 1986 to 1988. The principal objective of the AC-3 test was to compare the irradiation performance of mixed-carbide fuel pins that contained either pelletized or sphere-pac fuel at prototypic fluence and burnup levels for a fast breeder reactor
Point-of-care testing: applications of 3D printing.
Chan, Ho Nam; Tan, Ming Jun Andrew; Wu, Hongkai
2017-08-08
Point-of-care testing (POCT) devices fulfil a critical need in the modern healthcare ecosystem, enabling the decentralized delivery of imperative clinical strategies in both developed and developing worlds. To achieve diagnostic utility and clinical impact, POCT technologies are immensely dependent on effective translation from academic laboratories out to real-world deployment. However, the current research and development pipeline is highly bottlenecked owing to multiple restraints in material, cost, and complexity of conventionally available fabrication techniques. Recently, 3D printing technology has emerged as a revolutionary, industry-compatible method enabling cost-effective, facile, and rapid manufacturing of objects. This has allowed iterative design-build-test cycles of various things, from microfluidic chips to smartphone interfaces, that are geared towards point-of-care applications. In this review, we focus on highlighting recent works that exploit 3D printing in developing POCT devices, underscoring its utility in all analytical steps. Moreover, we also discuss key advantages of adopting 3D printing in the device development pipeline and identify promising opportunities in 3D printing technology that can benefit global health applications.
UTILITY ADVANCED TURBINE SYSTEMS (ATS) TECHNOLOGY READINESS TESTING: PHASE 3R
Energy Technology Data Exchange (ETDEWEB)
None
1999-09-01
The overall objective of the Advanced Turbine System (ATS) Phase 3 Cooperative Agreement between GE and the US Department of Energy (DOE) is the development of the GE 7H and 9H combined cycle power systems. The major effort will be expended on detail design. Validation of critical components and technologies will be performed, including: hot gas path component testing, sub-scale compressor testing, steam purity test trials, and rotational heat transfer confirmation testing. Processes will be developed to support the manufacture of the first system, which was to have been sited and operated in Phase 4 but will now be sited and operated commercially by GE. This change has resulted from DOE's request to GE for deletion of Phase 4 in favor of a restructured Phase 3 (as Phase 3R) to include full speed, no load (FSNL) testing of the 7H gas turbine. Technology enhancements that are not required for the first machine design but will be critical for future ATS advances in performance, reliability, and costs will be initiated. Long-term tests of materials to confirm design life predictions will continue. A schematic of the GE H machine is shown. This report summarizes work accomplished in 2Q99.
International Nuclear Information System (INIS)
Strait, S.R.; Spane, F.A. Jr.
1983-02-01
This report presents preliminary results and description of hydrologic test activities for the Umtanum Basalt Fracture Zone at Borehole RRL-2, within the test interval 3,781 to 3,827 feet. Hydrologic tests conducted include two short-term, constant discharge pumping tests and two slug tests. Preliminary results indicate an observed hydraulic head for the test interval of 406.7 feet above mean sea level. Transmissivity values determined from hydrologic tests performed range between 205 and 881 ft 2 /day. The best estimate of equivalent hydraulic conductivity, based on an effective test thickness of 6 feet, is 147 ft/day. 8 refs., 6 figs., 3 tabs
Thomas, Randy; Stueber, Thomas J.
2013-01-01
The System Identification (SysID) Rack is a real-time hardware-in-the-loop data acquisition (DAQ) and control instrument rack that was designed and built to support inlet testing in the NASA Glenn Research Center 10- by 10-Foot Supersonic Wind Tunnel. This instrument rack is used to support experiments on the Combined-Cycle Engine Large-Scale Inlet for Mode Transition Experiment (CCE? LIMX). The CCE?LIMX is a testbed for an integrated dual flow-path inlet configuration with the two flow paths in an over-and-under arrangement such that the high-speed flow path is located below the lowspeed flow path. The CCE?LIMX includes multiple actuators that are designed to redirect airflow from one flow path to the other; this action is referred to as "inlet mode transition." Multiple phases of experiments have been planned to support research that investigates inlet mode transition: inlet characterization (Phase-1) and system identification (Phase-2). The SysID Rack hardware design met the following requirements to support Phase-1 and Phase-2 experiments: safely and effectively move multiple actuators individually or synchronously; sample and save effector control and position sensor feedback signals; automate control of actuator positioning based on a mode transition schedule; sample and save pressure sensor signals; and perform DAQ and control processes operating at 2.5 KHz. This document describes the hardware components used to build the SysID Rack including their function, specifications, and system interface. Furthermore, provided in this document are a SysID Rack effectors signal list (signal flow); system identification experiment setup; illustrations indicating a typical SysID Rack experiment; and a SysID Rack performance overview for Phase-1 and Phase-2 experiments. The SysID Rack described in this document was a useful tool to meet the project objectives.
48 CFR 52.209-3 - First Article Approval-Contractor Testing.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false First Article Approval... Clauses 52.209-3 First Article Approval—Contractor Testing. As prescribed in 9.308-1 (a) and (b), insert the following clause: First Article Approval—Contractor Testing (SEP 1989) [Contracting Officer shall...
Protein (Viridiplantae): 145355221 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 436017:4609 distinct from photosynthetic electron transfer catalyst, CYC6, partial Ostreococcus lucimarinus CCE9901 RDLERNGVATKEDISNLIERGKGKMPGYGESCAPKGACTFGARLDAEEIDALATYVLDRAAVDW ...
Toward a web-based real-time radiation treatment planning system in a cloud computing environment.
Na, Yong Hum; Suh, Tae-Suk; Kapp, Daniel S; Xing, Lei
2013-09-21
To exploit the potential dosimetric advantages of intensity modulated radiation therapy (IMRT) and volumetric modulated arc therapy (VMAT), an in-depth approach is required to provide efficient computing methods. This needs to incorporate clinically related organ specific constraints, Monte Carlo (MC) dose calculations, and large-scale plan optimization. This paper describes our first steps toward a web-based real-time radiation treatment planning system in a cloud computing environment (CCE). The Amazon Elastic Compute Cloud (EC2) with a master node (named m2.xlarge containing 17.1 GB of memory, two virtual cores with 3.25 EC2 Compute Units each, 420 GB of instance storage, 64-bit platform) is used as the backbone of cloud computing for dose calculation and plan optimization. The master node is able to scale the workers on an 'on-demand' basis. MC dose calculation is employed to generate accurate beamlet dose kernels by parallel tasks. The intensity modulation optimization uses total-variation regularization (TVR) and generates piecewise constant fluence maps for each initial beam direction in a distributed manner over the CCE. The optimized fluence maps are segmented into deliverable apertures. The shape of each aperture is iteratively rectified to be a sequence of arcs using the manufacture's constraints. The output plan file from the EC2 is sent to the simple storage service. Three de-identified clinical cancer treatment plans have been studied for evaluating the performance of the new planning platform with 6 MV flattening filter free beams (40 × 40 cm(2)) from the Varian TrueBeam(TM) STx linear accelerator. A CCE leads to speed-ups of up to 14-fold for both dose kernel calculations and plan optimizations in the head and neck, lung, and prostate cancer cases considered in this study. The proposed system relies on a CCE that is able to provide an infrastructure for parallel and distributed computing. The resultant plans from the cloud computing are
Toward a web-based real-time radiation treatment planning system in a cloud computing environment
International Nuclear Information System (INIS)
Na, Yong Hum; Kapp, Daniel S; Xing, Lei; Suh, Tae-Suk
2013-01-01
To exploit the potential dosimetric advantages of intensity modulated radiation therapy (IMRT) and volumetric modulated arc therapy (VMAT), an in-depth approach is required to provide efficient computing methods. This needs to incorporate clinically related organ specific constraints, Monte Carlo (MC) dose calculations, and large-scale plan optimization. This paper describes our first steps toward a web-based real-time radiation treatment planning system in a cloud computing environment (CCE). The Amazon Elastic Compute Cloud (EC2) with a master node (named m2.xlarge containing 17.1 GB of memory, two virtual cores with 3.25 EC2 Compute Units each, 420 GB of instance storage, 64-bit platform) is used as the backbone of cloud computing for dose calculation and plan optimization. The master node is able to scale the workers on an ‘on-demand’ basis. MC dose calculation is employed to generate accurate beamlet dose kernels by parallel tasks. The intensity modulation optimization uses total-variation regularization (TVR) and generates piecewise constant fluence maps for each initial beam direction in a distributed manner over the CCE. The optimized fluence maps are segmented into deliverable apertures. The shape of each aperture is iteratively rectified to be a sequence of arcs using the manufacture’s constraints. The output plan file from the EC2 is sent to the simple storage service. Three de-identified clinical cancer treatment plans have been studied for evaluating the performance of the new planning platform with 6 MV flattening filter free beams (40 × 40 cm 2 ) from the Varian TrueBeam TM STx linear accelerator. A CCE leads to speed-ups of up to 14-fold for both dose kernel calculations and plan optimizations in the head and neck, lung, and prostate cancer cases considered in this study. The proposed system relies on a CCE that is able to provide an infrastructure for parallel and distributed computing. The resultant plans from the cloud computing are
Project Physics Tests 3, The Triumph of Mechanics.
Harvard Univ., Cambridge, MA. Harvard Project Physics.
Test items relating to Project Physics Unit 3 are presented in this booklet. Included are 70 multiple-choice and 20 problem-and-essay questions. Concepts of mechanics are examined on energy, momentum, kinetic theory of gases, pulse analyses, "heat death," water waves, power, conservation laws, normal distribution, thermodynamic laws, and…
The 1st VIPEX Software Testing Report (Version 3.1)
International Nuclear Information System (INIS)
Choi, Sun Yeong; Jung, Woo Sik; Seo, Jae Seung
2009-09-01
The purposes of this report are (1) to perform a Verification and Validation (V and V) test for the VIPEX(Vital-area Identification Package EXpert) software and (2) to improve a software quality through the V and V test. The VIPEX was developed in Korea Atomic Energy Research Institute (KAERI) for the Vital Area Identification (VAI) of nuclear power plants. The version of the VIPEX which was distributed is 3.1. The VIPEX was revised based on the first V and V test and the second V and V test will be performed. We have performed the following tasks for the first V and V test on Windows XP and VISTA operating systems: - Testing basic function including fault tree editing - Writing formal reports
Potenciální finanční nedostupnost nájemního bydlení po deregulaci nájemného – regionální perspektiva
Czech Academy of Sciences Publication Activity Database
Mikeszová, Martina; Lux, Martin; Morisseau, Anne
2009-01-01
Roč. 45, č. 2 (2009), s. 315-343 ISSN 0038-0288 R&D Projects: GA MMR WD-05-07-3 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing affordability * rental housing * social exclusion Subject RIV: AO - Sociology, Demography Impact factor: 0.562, year: 2009 http://sreview.soc.cas.cz/uploads/38eb91812a91d9a3d1cce947d7149f2802f8fa50_MikeszovaLux2009-2.pdf
Wlodek, C; Penfold, C M; Bourke, J F; Chowdhury, M M U; Cooper, S M; Ghaffar, S; Green, C; Holden, C R; Johnston, G A; Mughal, A A; Reckling, C; Sabroe, R A; Stone, N M; Thompson, D; Wilkinson, S M; Buckley, D A
2017-12-01
There is a significant rate of sensitization worldwide to the oxidized fragrance terpenes limonene and linalool. Patch testing to oxidized terpenes is not routinely carried out; the ideal patch test concentration is unknown. To determine the best test concentrations for limonene and linalool hydroperoxides, added to the British baseline patch test series, to optimize detection of true allergy and to minimize irritant reactions. During 2013-2014, 4563 consecutive patients in 12 U.K. centres were tested to hydroperoxides of limonene in petrolatum (pet.) 0·3%, 0·2% and 0·1%, and hydroperoxides of linalool 1·0%, 0·5% and 0·25% pet. Irritant reactions were recorded separately from doubtful reactions. Concomitant reactions to other fragrance markers and clinical relevance were documented. Limonene hydroperoxide 0·3% gave positive reactions in 241 (5·3%) patients, irritant reactions in 93 (2·0%) and doubtful reactions in 110 (2·4%). Linalool hydroperoxide 1·0% gave positive reactions in 352 (7·7%), irritant reactions in 178 (3·9%) and doubtful reactions in 132 (2·9%). A total of 119 patients with crescendo reactions to 0·3% limonene would have been missed if only tested with 0·1% and 131 patients with crescendo reactions to 1·0% linalool would have been missed if only tested with 0·25%. In almost two-thirds of patients with positive patch tests to limonene and linalool the reaction was clinically relevant. The majority of patients did not react to any fragrance marker in the baseline series. We recommend that limonene hydroperoxides be tested at 0·3% and linalool hydroperoxides at 1·0% in the British baseline patch test series. © 2017 British Association of Dermatologists.
Test results for the Oasis 3C high performance water-pumping windmill
Energy Technology Data Exchange (ETDEWEB)
Eggleston, D.M. [DME Engineering, Midland, TX (United States)
1997-12-31
The WINDTech International, L.L.C. Oasis 3C, a 3 m diameter, high-performance water-pumping windmill, was tested at the DME Engineering Wind Test Site just south of Midland, Texas from August through December, 1996. This machine utilizes a 3:1 gearbox with rotating counterweights, similar to a conventional oilfield pumping unit, driven by a multibladed rotor. The rotating counterweight system balances most of the pumping loads and reduces gear loads and starting torque by a factor of at least two and often by a factor of four or more. The torque reduction substantially extends gear and bearing life, and reduces wind speeds required for starting by 30 to 50% or more. The O3C was tested pumping from a quiescent fluid depth of 12.2 m (40 ft) from a 28.3 m (93 ft)-deep well, with additional pumping depth simulated using a pressure regulator valve system. A 9.53 cm (3.75 in.) diameter Harbison-Fischer seal-less single-acting piston pump was used to eliminate pump seal friction as a variable, and standard O3C stroke lengths of 30.5 and 15.2 cm (12 and 6 inches) were used. The regulator spring was set to give a maximum stroke rate of 33 strokes per minute. The water pumped was returned to the well after flowing through a settling tank. The tests were performed in accordance with AWEA WECS testing standards. Instrumentation provided 16 channels of data to accurately measure machine performance, including starting wind speeds, flow rates, O3C azimuth, tail furl angle, wind direction tracking errors, RPM, sucker rod loads, and other variables. The most significant performance data is summarized herein. A mathematical model of machine performance was developed that fairly accurately predicts performance for each of three test conditions. The results verify that the O3C is capable of pumping water at wind speeds from 30% to more than 50% lower than comparable un-counterbalanced units.
Pazos, John T.; Chandler, Craig A.; Raines, Nickey G.
2009-01-01
This paper will provide the reader a broad overview of the current upgraded capabilities of NASA's John C. Stennis Space Center E-3 Test Facility to perform testing for rocket engine combustion systems and components using liquid and gaseous oxygen, gaseous and liquid methane, gaseous hydrogen, hydrocarbon based fuels, hydrogen peroxide, high pressure water and various inert fluids. Details of propellant system capabilities will be highlighted as well as their application to recent test programs and accomplishments. Data acquisition and control, test monitoring, systems engineering and test processes will be discussed as part of the total capability of E-3 to provide affordable alternatives for subscale to full scale testing for many different requirements in the propulsion community.
DiagTest3Grp: An R Package for Analyzing Diagnostic Tests with Three Ordinal Groups
Directory of Open Access Journals (Sweden)
Jingqin Luo
2012-10-01
Full Text Available Medical researchers endeavor to identify potentially useful biomarkers to develop marker-based screening assays for disease diagnosis and prevention. Useful summary measures which properly evaluate the discriminative ability of diagnostic markers are critical for this purpose. Literature and existing software, for example, R packages nicely cover summary measures for diagnostic markers used for the binary case (e.g., healthy vs. diseased. An intermediate population at an early disease stage usually exists between the healthy and the fully diseased population in many disease processes. Supporting utilities for three-group diagnostic tests are highly desired and important for identifying patients at the early disease stage for timely treatments. However, application packages which provide summary measures for three ordinal groups are currently lacking. This paper focuses on two summary measures of diagnostic accuracy—volume under the receiver operating characteristic surface and the extended Youden index, with three diagnostic groups. We provide the R package DiagTest3Grp to estimate, under both parametric and nonparametric assumptions, the two summary measures and the associated variances, as well as the optimal cut-points for disease diagnosis. An omnibus test for multiple markers and a Wald test for two markers, on independent or paired samples, are incorporated to compare diagnostic accuracy across biomarkers. Sample size calculation under the normality assumption can be performed in the R package to design future diagnostic studies. A real world application evaluating the diagnostic accuracy of neuropsychological markers for Alzheimer’s disease is used to guide readers through step-by-step implementation of DiagTest3Grp to demonstrate its utility.
Al-Ghatani, Ali M; Obonsawin, Marc C; Binshaig, Basmah A; Al-Moutaery, Khalaf R
2011-01-01
There are 2 aims for this study: first, to collect normative data for the Wisconsin Card Sorting Test (WCST), Stroop test, Test of Non-verbal Intelligence (TONI-3), Picture Completion (PC) and Vocabulary (VOC) sub-test of the Wechsler Adult Intelligence Scale-Revised for use in a Saudi Arabian culture, and second, to use the normative data provided to generate the regression equations. To collect the normative data and generate the regression equations, 198 healthy individuals were selected to provide a representative distribution for age, gender, years of education, and socioeconomic class. The WCST, Stroop test, TONI-3, PC, and VOC were administrated to the healthy individuals. This study was carried out at the Department of Clinical Neurosciences, Riyadh Military Hospital, Riyadh, Kingdom of Saudi Arabia from January 2000 to July 2002. Normative data were obtained for all tests, and tables were constructed to interpret scores for different age groups. Regression equations to predict performance on the 3 tests of frontal function from scores on tests of fluid (TONI-3) and premorbid intelligence were generated from the data from the healthy individuals. The data collected in this study provide normative tables for 3 tests of frontal lobe function and for tests of general intellectual ability for use in Saudi Arabia. The data also provide a method to estimate pre-injury ability without the use of verbally based tests.
Evaluation tests of treatment planning systems concerning 3D dose calculation
International Nuclear Information System (INIS)
Simonian-Sauve, M.; Smart, C.
1998-01-01
The development of irradiation techniques in radiotherapy shows a clear tendency towards the systematic use of three-dimensional (3D) information. Great efforts are being made to set up 3D conformal radiotherapy. Consequently, in the aim of greater coherence and accuracy, 'the dosimetric tool' must also meet the requirements of 3D radiotherapy, as it plays a role in the treatment chain. To know if the treatment planning system is a '3D', '2D', or even '1D' system, one should not be satisfied with reading the technical documentation and the program algorithm description not entirely trust the constructor's assertions. It is essential to clearly and precisely evaluate the possibilities of the treatment planning system. Even if it is proved not to satisfy perfectly all the tests which would qualify it as a real 3D calculation system, the study of the test results helps to give clear explanations of the dosimetric results. Two series of test cases are proposed. The first series allows us to understand in which conditions the treatment planning system takes into account the scatter influence in a volume. The second series is designed to inform us about the capacity of the dose calculation algorithm when the medium encloses non-homogeneities. These test cases do not constitute an exhaustive 'check-list' able to tackle completely the question of 3D calculation. They are submitted as examples and should be considered as an evaluation methodology for the software implanted in the treatment planning system. (authors)
UAS-NAS Flight Test Series 3: Test Environment Report
Hoang, Ty; Murphy, Jim; Otto, Neil
2016-01-01
The desire and ability to fly Unmanned Aircraft Systems (UAS) in the National Airspace System (NAS) is of increasing urgency. The application of unmanned aircraft to perform national security, defense, scientific, and emergency management are driving the critical need for less restrictive access by UAS to the NAS. UAS represent a new capability that will provide a variety of services in the government (public) and commercial (civil) aviation sectors. The growth of this potential industry has not yet been realized due to the lack of a common understanding of what is required to safely operate UAS in the NAS. NASA's UAS Integration in the NAS Project is conducting research in the areas of Separation Assurance/Sense and Avoid Interoperability (SSI), Human Systems Integration (HSI), and Communications (Comm), and Certification to support reducing the barriers of UAS access to the NAS. This research is broken into two research themes namely, UAS Integration and Test Infrastructure. UAS Integration focuses on airspace integration procedures and performance standards to enable UAS integration in the air transportation system, covering Detect and Avoid (DAA) performance standards, command and control performance standards, and human systems integration. The focus of Test Infrastructure is to enable development and validation of airspace integration procedures and performance standards, including integrated test and evaluation. In support of the integrated test and evaluation efforts, the Project will develop an adaptable, scalable, and schedulable relevant test environment capable of evaluating concepts and technologies for unmanned aircraft systems to safely operate in the NAS. To accomplish this task, the Project is conducting a series of human-in-the-loop (HITL) and flight test activities that integrate key concepts, technologies and/or procedures in a relevant air traffic environment. Each of the integrated events will build on the technical achievements, fidelity, and
Commissioning status of the decelerator test beam line in CTF3
Adli, E; Lillestol, R; Olvegaard, M; Syratchev, I; Carrillo, D; Toral, F; Faus-Golfe, A; Garcia-Garrigos, J J; Kubyshin, Y; Montoro, G
2010-01-01
The CLIC Test Facility (CTF3) at CERN was constructed by the CTF3 collaboration to study the feasibility of the concepts for a compact linear collider. The test beam line (TBL) recently added to the CTF3 machine was designed to study the CLIC decelerator beam dynamics and 12 GHz power production. The beam line consists of a FODO lattice with high precision BPM’s and quadrupoles on movers for precise beam alignment. A total of 16 Power Extraction and Transfer Structures (PETS) will be installed in between the quadrupoles to extract 12 GHz power from the drive beam provided by the CTF3 machine. The CTF3 drive beam with a bunch-train length of 140 ns, 12 GHz bunch repetition frequency and an average current over the train of up to 28 A will be injected into the test beam line. Each PETS structure will produce 135 MW of 12 GHz power at nominal current. The beam will have lost more than 50 % of its initial energy of 150 MeV at the end of the beam line and will contain particles with energies between 65 MeV and 1...
Quick Look Report of the SMART ECC injection performance test I3
Energy Technology Data Exchange (ETDEWEB)
Cho, Seok; Ko, Yong Ju; Cho, Young Il; Kim, Jeong Tak; Choi, Nam Hyun; Park, Choon Kyong; Kwon, Tae Soon; Lee, Sung Jae [KAERI, Daejeon (Korea, Republic of)
2010-12-15
The objective of this report is to describe test results of the Test I3 simulating the 2 inch SBLOCA of the SMART using the SWAT test facility. The Test I3 was performed to produce experimental data for the validation of the TASS/SMR-S thermal hydraulic analysis code, and to investigate the related thermal hydraulic phenomena in the down-comer region during the 2 inch SBLOCA of the safety inject line. The particular phenomena for the observation are ECC bypass and multi-dimensional flow characteristics to verify the effectiveness and performance of the safety injection system. In this report, the corresponding steady state test conditions, including initial and boundary conditions along with major measuring parameters, and related experimental results were described
Directory of Open Access Journals (Sweden)
Anouar ben Saad
2017-01-01
Full Text Available Opuntia ficus indica (family Cactaceae is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days. Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect.
Saad, Anouar Ben; Rjeibi, Ilhem; Ncib, Sana; Zouari, Nacim; Zourgui, Lazhar
2017-01-01
Opuntia ficus indica (family Cactaceae) is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE) against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days). Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect.
Residential energy efficiency: Progress since 1973 and future potential
Rosenfeld, Arthur H.
1985-11-01
Today's 85 million U.S. homes use 100 billion of fuel and electricity (1150/home). If their energy intensity (resource energy/ft2) were still frozen at 1973 levels, they would use 18% more. With well-insulated houses, need for space heat is vanishing. Superinsulated Saskatchewan homes spend annually only 270 for space heat, 150 for water heat, and 400 for appliances, yet they cost only 2000±1000 more than conventional new homes. The concept of Cost of Conserved Energy (CCE) is used to rank conservation technologies for existing and new homes and appliances, and to develop supply curves of conserved energy and a least cost scenario. Calculations are calibrated with the BECA and other data bases. By limiting investments in efficiency to those whose CCE is less than current fuel and electricity prices, the potential residential plus commercial energy use in 2000 AD drops to half of that estimated by DOE, and the number of power plants needed drops by 200. For the whole buildings sector, potential savings by 2000 are 8 Mbod (worth 50B/year), at an average CCE of 10/barrel.
Ncib, Sana
2017-01-01
Opuntia ficus indica (family Cactaceae) is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE) against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days). Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect. PMID:29376078
Charge collection efficiency of irradiated silicon detector operated at cryogenic temperatures
International Nuclear Information System (INIS)
Borer, K.; Janos, S.; Palmieri, V.G.; Dezillie, B.; Li, Z.; Collins, P.; Niinikoski, T.O.; Lourenco, C.; Sonderegger, P.; Borchi, E.; Bruzzi, M.; Pirollo, S.; Granata, V.; Pagano, S.; Chapuy, S.; Dimcovski, Z.; Grigoriev, E.; Bell, W.; Devine, S.R.H.; O'Shea, V.; Smith, K.; Berglund, P.; Boer, W. de; Hauler, F.; Heising, S.; Jungermann, L.; Casagrande, L.; Cindro, V.; Mikuz, M.; Zavartanik, M.; Via, C. da; Esposito, A.; Konorov, I.; Paul, S.; Schmitt, L.; Buontempo, S.; D'Ambrosio, N.; Pagano, S.; Ruggiero, G.; Eremin, V.; Verbitskaya, E.
2000-01-01
The charge collection efficiency (CCE) of heavily irradiated silicon diode detectors was investigated at temperatures between 77 and 200 K. The CCE was found to depend on the radiation dose, bias voltage value and history, temperature, and bias current generated by light. The detector irradiated to the highest fluence 2x10 15 n/cm 2 yields a MIP signal of at least 15000 e - both at 250 V forward bias voltage, and at 250 V reverse bias voltage in the presence of a light-generated current. The 'Lazarus effect' was thus shown to extend to fluences at least ten times higher than was previously studied
Nuclear power plant Olkiluoto 3. Containment leakage test under extreme conditions
Energy Technology Data Exchange (ETDEWEB)
Fleckenstein, Tobias [TUEV SUED Industrie Service GmbH, Munich (Germany). Measaruement Technology Dept.
2015-01-15
Modern nuclear power plants place high demands on the design and execution of safety checks. TUEV SUED supported the containment leakage test for the largest- capacity third generation nuclear power plant in the world - Olkiluoto 3 in Finland. The experts successfully met the challenges presented by exceptional parameters of the project. The containment of Olkiluoto 3 is unique in that the vessel's volume is 80,000 m{sup 3} while measurements were carried out over a period of ten days. To execute the test, 75 temperature and 15 humidity sensors had to be installed and correctly interlinked by more than ten kilometres of cable. These instruments also needed to withstand an absolute pressure of 6 bar, ambient temperatures of 30 C and high levels of humidity. These conditions required comprehensive preparation and a high amount of qualification tests. Parts of the qualifications were carried out at the autoclave system of the Technical University in Munich, Germany, where the project test conditions could be simulated. The software required to determine the tests was developed by TUEV SUED and verified by German's national accreditation body DAkkS under ISO 17025. TUEV SUED enabled the test schedule to continue without delay by analysing all recorded data continuously on site, including pressure, temperature, humidity and leakage mass flow curves. With the comprehensive preparation, data acquisition system recording measurements continuously and the on-time result calculation, all components of the leak-tightness assessment were successfully completed in accordance with requirements.
Testing of TAMU3: a Nb3Sn Block–Coil Dipole with Stress Management
Energy Technology Data Exchange (ETDEWEB)
McIntyre, Peter [Texas A & M Univ., College Station, TX (United States)
2015-09-20
The Accelerator Research Lab (ARL) at Texas A&M has recently concluded the construction and testing of a superconducting block-coil dipole TAMU3. TAMU3 reached 85% of the resistive-onset short sample critical current (0.1 μV/cm criterion) that was measured on extracted strands at the National High Magnetic Field Lab. Peak magnet current was 6603 amps, and all with quenches originated in the vicinity of the hard-way chicane near the exit lead of the TAMU3c inner winding. Leading up to the testing we discovered that we had made two grievous mistakes in the fabrication (we mistakenly used the wrong superconducting wire for the cables of the inner windings) and the heat treatment (we used a heat treatment that was too hot and too long). We extracted strands from the leads of the inner and outer windings, and colleagues at NHMFL performed short-sample measurements upon them. The NHMFL measurements indicated RRR ~ 2-5, which gives very little stability against microquenches. The short-sample tests of the extracted strands exhibited a long resistive transition, in which there was a current Isc(B) beyond which it became resistive, then a higher current In(B) at which it went fully normal. Using the Isc(B) data we predicted a short-sample limit for the revised load line of TAMU3 of 7700 A (9 T) – a disappointing reduction from the 14 T objective. On those unhappy notes we undertook the testing of the dipole. The first quench occurred at 5695 A, and the dipole trained thereafter to a maximum quench current of 6600 A (7.6 T), 85% of the compromised short-sample limit. All quenches occurred at a single location, in the region of the S-bend transition and outer lead of one inner winding. Data was collected from stress transducers on the outer windings to evaluate stress management, and on the coil ends to evaluate capture of axial forces by staticfriction lock. The low field reached prevented us from extending those tests to the stress levels where they
Omega-3 fatty acids have antidepressant activity in forced swimming test in Wistar rats.
Lakhwani, Lalit; Tongia, Sudheer K; Pal, Veerendra S; Agrawal, Rajendra P; Nyati, Prem; Phadnis, Pradeep
2007-01-01
Forced swimming test is used to induce a characteristic behavior of immobility in rats, which resembles depression in humans to some extent. We evaluated the effect of omega-3 fatty acids alone as well as compared it with the standard antidepressant therapy with fluoxetine in both acute and chronic studies. In both the studies, rats were divided into 4 groups and subjected to the following drug interventions - Group 1- control: Group 2- fluoxetine in dose of 10 mg/kg subcutaneously 23.5, 5 and 1 h before the test: Group 3- omega-3 fatty acids in dose of 500 mg/kg orally; Group 4- fluoxetine plus omega-3 fatty acids both. In acute study, omega-3 fatty acids were given in single dose 2 h prior to the test while in chronic study omega-3 fatty acids were given daily for a period of 28 days. All animals were subjected to a 15-min pretest followed 24 h later by a 5-min test. A time sampling method was used to score the behavioral activity in each group. The results revealed that in acute study, omega-3 fatty acids do not have any significant effect in forced swimming test. However, in chronic study, omega-3 fatty acids affect the immobility and swimming behavior significantly when compared with control (p fluoxetine is significantly more than that of fluoxetine alone in changing the behavioral activity of rats in forced swimming test. It leads to the conclusion that omega-3 fatty acids have antidepressant activity per se, and the combination of fluoxetine and omega-3 fatty acids has more antidepressant efficacy than fluoxetine alone in forced swimming test in Wistar rats.
EOL3 M0 X-ray Tomography Test Results
Avramidou, R; Bozhko, N; Borisov, A; Goriatchev, V; Goriatchev, S; Gushin, V; Fakhroutdinov, R; Kojine, A; Kononov, A; Larionov, A; Salomatin, Yu I; Schuh, S; Sedykh, Yu; Tchougouev, A
2001-01-01
Results of X-ray tomography test of EOL3 module 0 chamber is presented in the note. Peculiarities of the X-ray tomography of the chamber are discussed. Comparison of the tomography results with predictions of the production site measurements is made.
International Nuclear Information System (INIS)
Kang, D. I.; Kim, K. Y.; Yang, Z. A.; Ha, J. J.
2002-01-01
We optimized the test interval for check valves of Ulchin Unit 3 using the risk-informed in-service testing (IST) approach. First, we categorized the IST check valves for Ulchin Unit 3 according to their contributions to the safety of Ulchin Unit 3. Next, we performed the risk analysis on the relaxation of test interval for check valves identified as relatively low important to the safety of Ulchin Unit 3 to identify the maximum increasable test interval of them. Finally, we estimated the number of tests of IST check valves to be performed due to the changes of test interval. These study results are as follows: The categorization of IST check valve importance; the number of the HSSCs is 24(11.48%), the ISSCs is 40 (19.14%), and the LSSCs is 462(69.38%). The maximum increasable test interval; 6 times of current test interval of ISSCs2 and 40 times of that of LSSCs. The number of tests of IST check valves to be performed during 6 refueling time can be reduced from 7692 to 1333 ( 82.7%)
International Nuclear Information System (INIS)
Serrato, M. G.
2013-01-01
located at the Florida International University Applied Research Center, Miami, FL (FIU-ARC). A follow-on fluid injection test was developed to detect fluid and ion migration in a cementitious material/grouted test cube using a limited number of existing embedded sensor systems. This In Situ Decommissioning Sensor Network, Meso-Scale Test Bed (ISDSN-MSTB) - Phase 3 Fluid Injection Test Summary Report summarizes the test implementation, acquired and processed data, and results from the activated embedded sensor systems used during the fluid injection test. The ISDSN-MSTB Phase 3 Fluid Injection Test was conducted from August 27 through September 6, 2013 at the FIU-ARC ISDSN-MSTB test cube. The fluid injection test activated a portion of the existing embedded sensor systems in the ISDSN-MSTB test cube: Electrical Resistivity Tomography-Thermocouple Sensor Arrays, Advance Tensiometer Sensors, and Fiber Loop Ringdown Optical Sensors. These embedded sensor systems were activated 15 months after initial placement. All sensor systems were remotely operated and data acquisition was completed through the established Sensor Remote Access System (SRAS) hosted on the DOE D&D Knowledge Management Information Tool (D&D DKM-IT) server. The ISDN Phase 3 Fluid Injection Test successfully demonstrated the feasibility of embedding sensor systems to assess moisture-fluid flow and resulting transport potential for contaminate mobility through a cementitious material/grout monolith. The ISDSN embedded sensor systems activated for the fluid injection test highlighted the robustness of the sensor systems and the importance of configuring systems in-depth (i.e., complementary sensors and measurements) to alleviate data acquisition gaps
Energy Technology Data Exchange (ETDEWEB)
Serrato, M. G.
2013-09-27
located at the Florida International University Applied Research Center, Miami, FL (FIU-ARC). A follow-on fluid injection test was developed to detect fluid and ion migration in a cementitious material/grouted test cube using a limited number of existing embedded sensor systems. This In Situ Decommissioning Sensor Network, Meso-Scale Test Bed (ISDSN-MSTB) - Phase 3 Fluid Injection Test Summary Report summarizes the test implementation, acquired and processed data, and results from the activated embedded sensor systems used during the fluid injection test. The ISDSN-MSTB Phase 3 Fluid Injection Test was conducted from August 27 through September 6, 2013 at the FIU-ARC ISDSN-MSTB test cube. The fluid injection test activated a portion of the existing embedded sensor systems in the ISDSN-MSTB test cube: Electrical Resistivity Tomography-Thermocouple Sensor Arrays, Advance Tensiometer Sensors, and Fiber Loop Ringdown Optical Sensors. These embedded sensor systems were activated 15 months after initial placement. All sensor systems were remotely operated and data acquisition was completed through the established Sensor Remote Access System (SRAS) hosted on the DOE D&D Knowledge Management Information Tool (D&D DKM-IT) server. The ISDN Phase 3 Fluid Injection Test successfully demonstrated the feasibility of embedding sensor systems to assess moisture-fluid flow and resulting transport potential for contaminate mobility through a cementitious material/grout monolith. The ISDSN embedded sensor systems activated for the fluid injection test highlighted the robustness of the sensor systems and the importance of configuring systems in-depth (i.e., complementary sensors and measurements) to alleviate data acquisition gaps.
Results of testing the frontal AK-3 extraction unit
Energy Technology Data Exchange (ETDEWEB)
Yakovlev, N I; Dolinskii, A M; Kolesnikov, M A
1978-10-01
From August to November 1970, on site testing of a protype frontal AK excavating rig developed by Giprouglemesh for use on gentle sloping seams was conducted in the Novaya mine of the Kuzbass Ugol Consolidated. The AK-3 consists of a cutting assembly in the form of a ring frontal slicer with two drives, hydraulic operated sectionalized support timbers of the enclosed lift type, conjugated timbering with ventilation and conveyor shafts, personnel elevator and hydraulic and electrical ancillary equipment. The production capacity of the rig in longwalls is 2.2 times greater on the average than by using drillhole blasting methods. Tests demonstrated that the main advantage of the Ak-3 was the single operation, continuous flow mode of coal extraction and remote frontal movement of timber sections, which ensured high capacity loading at the face and the capability of automating all procedures and eliminating all workers from the extraction face.
Performance Test of BF3 Neutron Detection System
Energy Technology Data Exchange (ETDEWEB)
Choi, Yu Sun; Shin, Ho Cheol [KHNP-CRI, Daejeon (Korea, Republic of); Cho, Jin Bok; Oh, Sae Hyun; Ryou, Seok Jean [USERS, Daejeon (Korea, Republic of)
2015-10-15
The neutron detecting system of First-of-a-kind plant such an APR1400 at Shin Kori should have been verified in the condition of low operating temperature and pressure of the primary coolant system before receiving the operation license. Auxiliary Ex-core Neutron Flux Monitoring System (AENFMS) is supposed to be installed using BF3 neutron detector in Shin Kori plant. The performance test of AENFMS was conducted to measure neutron sensitivity, moderation ratio and count rate in the same condition with Ex-core Neutron Flux Monitoring System (ENFMS) of APR1400 to verify its detection characteristics in compliance with the functional requirement. Performance test has been conducted for AENFMS of APR1400 to verify BF3 neutron sensitivity, moderation ration of PE, expecting neutron signal count rate from AENFMS, possible extending cable length from detector to pre-amplifier. As a result of measurement, the neutron sensitivity of 34.246±0.168(95%CI)cps/nv, moderation ratio of 11.343±0.039(95%CI) and AENFMS expecting count rate related to ENFMS of 17.8 times are acceptable in compliance with functional requirement, respectively.
Fabrication and testing of the Nb3Sn superconductor for High-Field Test Facility (HFTF)
International Nuclear Information System (INIS)
Spencer, C.; Adam, E.; Gregory, E.; Marancik, W.; Sanger, P.; Scanlan, R.; Cornish, D.
1979-01-01
A 5000 A-12 T fully stable Nb 3 Sn superconductor has to be produced for the insert magnet of the high-field test facility being built at Lawrence Livermore Laboratory. A process is described which permits the fabrication of long lengths of large fully transposed monolithic superconductors containing in excess of 100,000 filaments of Nb 3 Sn. Measurements of critical current as a function of magnetic field and longitudinal strain on prototype samples are reported
Procedure guideline for radioiodine test (version 3)
International Nuclear Information System (INIS)
Dietlein, M.; Schicha, H.; Eschner, W.; Deutsche Gesellschaft fuer Medizinische Physik; Koeln Univ.; Lassmann, M.; Deutsche Gesellschaft fuer Medizinische Physik; Wuerzburg Univ.; Leisner, B.; Allgemeines Krankenhaus St. Georg, Hamburg; Reiners, C.; Wuerzburg Univ.
2007-01-01
The version 3 of the procedure guideline for radioiodine test is an update of the guideline previously published in 2003. The procedure guideline discusses the pros and cons of a single measurement or of repeated measurements of the iodine-131 uptake and their optimal timing. Different formulas are described when one, two or three values of the radioiodine kinetic are available. The probe with a sodium-iodine crystal, alternatively or additionally the gamma camera using the ROI-technique are instrumentations for the measurement of iodine-131 uptake. A possible source of error is an inappropriate measurement (sonography) of the target volume. The patients' preparation includes the withdrawal of antithyroid drugs 2-3 days before radioiodine administration. The patient has to avoid iodine-containing medication and the possibility of additives of iodine in vitamin- and electrolyte-supplementation has to be considered. (orig.)
DYNA3D/ParaDyn Regression Test Suite Inventory
Energy Technology Data Exchange (ETDEWEB)
Lin, Jerry I. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-09-01
The following table constitutes an initial assessment of feature coverage across the regression test suite used for DYNA3D and ParaDyn. It documents the regression test suite at the time of preliminary release 16.1 in September 2016. The columns of the table represent groupings of functionalities, e.g., material models. Each problem in the test suite is represented by a row in the table. All features exercised by the problem are denoted by a check mark (√) in the corresponding column. The definition of “feature” has not been subdivided to its smallest unit of user input, e.g., algorithmic parameters specific to a particular type of contact surface. This represents a judgment to provide code developers and users a reasonable impression of feature coverage without expanding the width of the table by several multiples. All regression testing is run in parallel, typically with eight processors, except problems involving features only available in serial mode. Many are strictly regression tests acting as a check that the codes continue to produce adequately repeatable results as development unfolds; compilers change and platforms are replaced. A subset of the tests represents true verification problems that have been checked against analytical or other benchmark solutions. Users are welcomed to submit documented problems for inclusion in the test suite, especially if they are heavily exercising, and dependent upon, features that are currently underrepresented.
Diagnostic Accuracy of 3 Physical Examination Tests in the Assessment of Hip Microinstability.
Hoppe, Daniel J; Truntzer, Jeremy N; Shapiro, Lauren M; Abrams, Geoffrey D; Safran, Marc R
2017-11-01
Hip microinstability is a diagnosis gaining increasing interest. Physical examination tests to identify microinstability have not been objectively investigated using intraoperative confirmation of instability as a reference standard. To determine the test characteristics and diagnostic accuracy of 3 physical examination maneuvers in the detection of hip microinstability. Cohort study (diagnosis); Level of evidence, 2. A review was conducted of 194 consecutive hip arthroscopic procedures performed by a sports medicine surgeon at a tertiary-care academic center. Physical examination findings of interest, including the abduction-hyperextension-external rotation (AB-HEER) test, the prone instability test, and the hyperextension-external rotation (HEER) test, were obtained from prospectively collected data. The reference standard was intraoperative identification of instability based on previously published objective criteria. Test characteristics, including sensitivity, specificity, positive and negative predictive values, and accuracy, were calculated for each test as well as for combinations of tests. A total of 109 patients were included in the analysis. The AB-HEER test was most accurate, with a sensitivity of 80.6% (95% CI, 70.8%-90.5%) and a specificity of 89.4% (95% CI, 80.5%-98.2%). The prone instability test had a low sensitivity (33.9%) but a very high specificity (97.9%). The HEER test performed second in both sensitivity (71.0%) and specificity (85.1%). The combination of multiple tests with positive findings did not yield significantly greater accuracy. All tests had high positive predictive values (range, 86.3%-95.5%) and moderate negative predictive values (range, 52.9%-77.8%). When all 3 tests had positive findings, there was a 95.0% (95% CI, 90.1%-99.9%) chance that the patient had microinstability. The AB-HEER test most accurately predicted hip instability, followed by the HEER test and the prone instability test. However, the high specificity of the
Fabrication of the instrumented fuel rods for the 3-Pin Fuel Test Loop at HANARO
International Nuclear Information System (INIS)
Sohn, Jae Min; Park, Sung Jae; Shin, Yoon Tag; Lee, Jong Min; Ahn, Sung Ho; Kim, Soo Sung; Kim, Bong Goo; Kim, Young Ki; Lee, Ki Hong; Kim, Kwan Hyun
2008-09-01
The 3-Pin Fuel Test Loop(hereinafter referred to as the '3-Pin FTL') facility has been installed at HANARO(High-flux Advanced Neutron Application Reactor) and the 3-Pin FTL is under a test operation. The purpose of this report is to fabricate the instrumented fuel rods for the 3-Pin FTL. The fabrication of these fuel rods was based on experiences and technologies of the instrumented fuel rods for an irradiation fuel capsule. The three instrumented fuel rods of the 3-Pin FTL have been designed. The one fuel rod(180 .deg. ) was designed to measure the centerline temperature of the nuclear fuels and the internal pressure of the fuel rod, and others(60 .deg. and 300 .deg. ) were designed to measure the centerline temperature of the fuel pellets. The claddings were made of the reference material 1 and 2 and new material 1 and 2. And nuclear fuel was used UO 2 (2.0w/o) pellet type with large grain and standard grain. The major procedures of fabrication are followings: (1) the assembling and weld of fuel rods with the pellet mockups and the sensor mockups for the qualification tests, (2) the qualification tests(dimension measurements, tensile tests, metallography examinations and helium leak tests) of weld, (3) the assembling and weld of instrumented fuel rods with the nuclear pellets and the sensors for the irradiation test, and (4) the qualification tests(the helium leak test, the dimensional measurement, electric resistance measurements of sensors) of test fuel rods. Satisfactory results were obtained for all the qualification tests of the instrumented fuel rods for the 3-Pin FTL. Therefore the three instrumented fuel rods for the 3-Pin FTL have been fabricated successfully. These will be installed in the In-Pile Section of 3-Pin FTL. And the irradiation test of these fuel rods is planned from the early next year for about 3 years at HANARO
International Nuclear Information System (INIS)
Bryan, R.H.; Cate, T.M.; Holz, P.P.; King, T.A.; Merkle, J.G.; Robinson, G.C.; Smith, G.C.; Smith, J.E.; Whitman, G.D.
1978-01-01
HSST intermediate test vessel V-7 was repaired after being tested hydrostatically to leakage and was retested pneumatically as vessel V-7A. Except for the method of applying the load, the conditions in both tests were nearly identical. In each case, a sharp outside surface flaw 547 mm long (18 in.) by about 135 mm deep (5.3 in.) was prepared in the 152-mm-thick (6-in.) test cylinder of A533, grade B, class 1 steel. The inside surface of vessel V-7A was sealed in the region of the flaw by a thin metal patch so that pressure could be sustained after rupture. Vessel V-7A failed by rupture of the flaw ligament without burst, as expected. Rupture occurred at 144.3 MPa (20.92 ksi), after which pressure was sustained for 30 min without any indication of instability. The rupture pressure of vessel V-7A was about 2 percent less than that of vessel V-7
Pre- and post-test analyses of a KKL turbine trip test at 109% power using RETRAN-3D
Energy Technology Data Exchange (ETDEWEB)
Coddington, P
2001-03-01
As part of the PSI/HSK STARS project, pre-test calculations have been performed for a KKL turbine trip test at 109% power using the RETRAN-3D code. In this paper, we first present the results of these calculations, together with a description of the test and a comparison of the results with the measured plant data, and then discuss in more detail the differences between the pre-test results and the plant measurements, including the differences in the initial and boundary conditions, and how these differences influenced the calculated results. Finally, we comment on a series of post-test and sensitivity analyses, which were performed to resolve some of the discrepancies. The results of the pre-test (blind) calculations show good overall agreement with the experimental data, particularly for the maximum in the steam-line mass flow rate following the opening of the turbine bypass valves. This is of critical importance, since the steam-line flow has the least margin to the reactor scram limit. The agreement is especially good since the control rod banks used for the selected rod insertion were changed from those given in the test specification. Following a review of the comparison of the pre-test calculations with the measured data, several deficiencies in the RETRAN-3D model for KKL were identified and corrected as part of the post-test analysis. This allowed for both an improvement in the calculated results, and a deeper understanding of the behaviour of the turbine trip transient. (author)
Pre- and post-test analyses of a KKL turbine trip test at 109% power using RETRAN-3D
International Nuclear Information System (INIS)
Coddington, P.
2001-01-01
As part of the PSI/HSK STARS project, pre-test calculations have been performed for a KKL turbine trip test at 109% power using the RETRAN-3D code. In this paper, we first present the results of these calculations, together with a description of the test and a comparison of the results with the measured plant data, and then discuss in more detail the differences between the pre-test results and the plant measurements, including the differences in the initial and boundary conditions, and how these differences influenced the calculated results. Finally, we comment on a series of post-test and sensitivity analyses, which were performed to resolve some of the discrepancies. The results of the pre-test (blind) calculations show good overall agreement with the experimental data, particularly for the maximum in the steam-line mass flow rate following the opening of the turbine bypass valves. This is of critical importance, since the steam-line flow has the least margin to the reactor scram limit. The agreement is especially good since the control rod banks used for the selected rod insertion were changed from those given in the test specification. Following a review of the comparison of the pre-test calculations with the measured data, several deficiencies in the RETRAN-3D model for KKL were identified and corrected as part of the post-test analysis. This allowed for both an improvement in the calculated results, and a deeper understanding of the behaviour of the turbine trip transient. (author)
Understanding overpressure in the FAA aerosol can test by C3H2F3Br (2-BTP).
Linteris, Gregory Thomas; Babushok, Valeri Ivan; Pagliaro, John Leonard; Burgess, Donald Raymond; Manion, Jeffrey Alan; Takahashi, Fumiaki; Katta, Viswanath Reddy; Baker, Patrick Thomas
2016-05-01
Thermodynamic equilibrium calculations, as well as perfectly-stirred reactor (PSR) simulations with detailed reaction kinetics, are performed for a potential halon replacement, C 3 H 2 F 3 Br (2-BTP, C 3 H 2 F 3 Br, 2-Bromo-3,3,3-trifluoropropene), to understand the reasons for the unexpected enhanced combustion rather than suppression in a mandated FAA test. The high pressure rise with added agent is shown to depend on the amount of agent, and is well-predicted by an equilibrium model corresponding to stoichiometric reaction of fuel, oxygen, and agent. A kinetic model for the reaction of C 3 H 2 F 3 Br in hydrocarbon-air flames has been applied to understand differences in the chemical suppression behavior of C 3 H 2 F 3 Br vs. CF 3 Br in the FAA test. Stirred-reactor simulations predict that in the conditions of the FAA test, the inhibition effectiveness of C 3 H 2 F 3 Br at high agent loadings is relatively insensitive to the overall stoichiometry (for fuel-lean conditions), and the marginal inhibitory effect of the agent is greatly reduced, so that the mixture remains flammable over a wide range of conditions. Most important, the flammability of the agent-air mixtures themselves (when compressively preheated), can support low-strain flames which are much more difficult to extinguish than the easy-to extinguish, high-strain primary fireball from the impulsively released fuel mixture. Hence, the exothermic reaction of halogenated hydrocarbons in air should be considered in other situations with strong ignition sources and low strain flows, especially at preheated conditions.
High power tests of dressed supconducting 1.3 GHz RF cavities
Energy Technology Data Exchange (ETDEWEB)
Hocker, A.; Harms, E.R.; Lunin, A.; Sukhanov, A.; /Fermilab
2011-03-01
A single-cavity test cryostat is used to conduct pulsed high power RF tests of superconducting 1.3 GHz RF cavities at 2 K. The cavities under test are welded inside individual helium vessels and are outfitted ('dressed') with a fundamental power coupler, higher-order mode couplers, magnetic shielding, a blade tuner, and piezoelectric tuners. The cavity performance is evaluated in terms of accelerating gradient, unloaded quality factor, and field emission, and the functionality of the auxiliary components is verified. Test results from the first set of dressed cavities are presented here.
Driving simulator test results Deliverable no D6.3. Final draft
Weiland, J.; Mattes, S.; Kuhn, F.; Gelau, Ch.; Schindhelm, R.; Hoedemaeker, D.D.M.
2003-01-01
Deliverable 6.3 reports the procedure and results from a driving simulator study. This study was carried out to test the efficiency of the principles of the in-vehicle information manager, which was developed within the Comunicar project. Thirty-six subjects were tested in a fixed-base driving
Fabrication and component testing results for a Nb3Sn dipole magnet
International Nuclear Information System (INIS)
Dell'Orco, D.; Scanlan, R.M.; Taylor, C.E.; Lietzke, A.; Caspi, S.; van Oort, J.M.; McInturff, A.D.
1994-10-01
At present, the maximum field achieved in accelerator R ampersand D dipoles is slightly over 10T, with NbTi conductor at 1.8 K. Although Nb 3 Sn has the potential to achieve much higher fields, none of the previous dipoles constructed from Nb 3 Sn have broken the 10T barrier. We report here on the construction of a dipole with high current density Nb 3 Sn with a predicted short sample limit of 13T. A wind and react technique, followed by epoxy impregnation of the fiberglass insulated coils, was used. The problems identified with the use of Nb 3 SD in earlier dipole magnets were investigated in a series of supplemental tests. This includes measurement of the degradation of J c with transverse strain, cabling degradation, joint resistance measurements, and epoxy strength tests. In addition, coff assembly techniques were developed to ensure that adequate prestress could be applied without damaging the reacted Nb 3 Sn cable. We report here the results of these tests and the construction status of this 50 mm bore dipole
Titan TTCN-3 Based Test Framework for Resource Constrained Systems
Directory of Open Access Journals (Sweden)
Yushev Artem
2016-01-01
Full Text Available Wireless communication systems more and more become part of our daily live. Especially with the Internet of Things (IoT the overall connectivity increases rapidly since everyday objects become part of the global network. For this purpose several new wireless protocols have arisen, whereas 6LoWPAN (IPv6 over Low power Wireless Personal Area Networks can be seen as one of the most important protocols within this sector. Originally designed on top of the IEEE802.15.4 standard it is a subject to various adaptions that will allow to use 6LoWPAN over different technologies; e.g. DECT Ultra Low Energy (ULE. Although this high connectivity offers a lot of new possibilities, there are several requirements and pitfalls coming along with such new systems. With an increasing number of connected devices the interoperability between different providers is one of the biggest challenges, which makes it necessary to verify the functionality and stability of the devices and the network. Therefore testing becomes one of the key components that decides on success or failure of such a system. Although there are several protocol implementations commonly available; e.g., for IoT based systems, there is still a lack of according tools and environments as well as for functional and conformance testing. This article describes the architecture and functioning of the proposed test framework based on Testing and Test Control Notation Version 3 (TTCN-3 for 6LoWPAN over ULE networks.
Complete braided adsorbent for marine testing to demonstrate 3g-U/kg-adsorbent
Energy Technology Data Exchange (ETDEWEB)
Janke, Chris [ORNL; Yatsandra, Oyola [ORNL; Mayes, Richard [ORNL; none,; Gill, Gary [PNNL; Li-Jung, Kuo [PNNL; Wood, Jordana [PNNL; Sadananda, Das [ORNL
2014-04-30
ORNL has manufactured four braided adsorbents that successfully demonstrated uranium adsorption capacities ranging from 3.0-3.6 g-U/kg-adsorbent in marine testing at PNNL. Four new braided and leno woven fabric adsorbents have also been prepared by ORNL and are currently undergoing marine testing at PNNL.
Phased Startup Initiative Phase 3 and 4 Test Procedure (OCRWM)
International Nuclear Information System (INIS)
PAJUNEN, A.L.
2000-01-01
The purpose of this test procedure is to safely operate the Fuel Retrieval System (FRS) and Integrated Water Treatment System (IWTS) with specific fuel canisters, and show that canisters containing fuel can be retrieved from the canister queue, decapped in the Canister Decapper, and loaded into the Primary Clean Machine (PCM) for fuel cleaning; and that fuel can be sorted on the Process Table, then loaded back into fuel canisters and relocated in basin storage. An option is included to load selected elements into multi-canister overpack (MCO) Fuel Baskets. Additional Data are collected during this test, beyond that collected during production operations. These data support qualifying the cleaning performance of the PCM, assessing the quantity of scrap generated during the cleaning, and evaluating the impact of fuel retrieval operations on the Basin water quality. The additional data collected primarily consist of weighing fuel and scrap at selected points in the operation, as well as photographing fuel and scrap as it is processed. The time to perform operations is also monitored for comparison with design predictions. Water quality data are collected to establish a baseline to predict the effectiveness of equipment design for control of contamination and visibility during production operation. The scope of this test procedure is to validate the operation of FRS and IWTS components as a complete system. Fuel canisters shall be processed in accordance with this test procedure such that fuel inspection results are clearly attributed to a particular set of PCM operating parameters. The Phase 3 test sequence processes a minimum of six canisters. Twenty-four contingency canisters have been identified, and will be processed if additional performance data are required. The Phase 4 test sequence processes a minimum of 29 specific canisters. Twenty-nine contingency canisters have been identified for Phase 4 activities and will be processed to complete process validation, if
International Nuclear Information System (INIS)
Nakamura, Takehiko; Yoshinaga, Makio; Fujishiro, Toshio; Kobayashi, Shinsho; Yamahara, Takeshi; Sukegawa, Tomohide; Kikuchi, Teruo; Sobajima, Makoto.
1993-09-01
This report presents experimental data for Test TS-3 which was the third test in a series of Reactivity Initiated Accident (RIA) tests using pre-irradiated BWR fuel rods, performed in the Nuclear Safety Research Reactor (NSRR) in September, 1990. Test fuel rod used in the Test TS-3 was a short-sized BWR (7 x 7) type rod which was re-fabricated from a commercial rod irradiated in the Tsuruga Unit 1 power reactor of Japan Atomic Power Co. The fuel had an initial enrichment of 2.79 % and a burnup of 26 Gwd/tU. A pulse irradiation of the test fuel rod was performed under a cooling condition of stagnant water at atmospheric pressure and at ambient temperature which simulated a BWR's cold start-up RIA event. The energy deposition of the fuel rod in this test was evaluated to be 94 ± 4 cal/g · fuel (88 ± 4 cal/g · fuel in peak fuel enthalpy) and no fuel failure was observed. Descriptions on test conditions, test procedures, transient behavior of the test rod during the pulse irradiation, and results of pre-pulse and post-pulse irradiation examinations are described in this report. (author)
International Nuclear Information System (INIS)
Mullins, C.B.; Felde, D.K.; Sutton, A.G.; Gould, S.S.; Morris, D.G.; Robinson, J.J.
1982-05-01
Thermal-Hydraulic Test Facility (THTF) test series 3.07.9 was conducted by members of the Oak Ridge National Laboratory Pressurized-Water Reactor (ORNL-PWR) Blowdown Heat Transfer (BDHT) Separate-Effects Program on September 11, September 18, and October 1, 1980. The objective of the program is to investigate heat transfer phenomena believed to occur in PWRs during accidents, including small- and large-break loss-of-coolant accidents. Test series 3.07.9 was designed to provide steady-state film boiling data in rod bundle geometry under reactor accident-type conditions. This report presents the reduced instrument responses for THTF test series 3.07.9. Also included are uncertainties in the instrument responses, calculated mass flows, and calculated rod powers
36 CFR 3.11 - When is testing for alcohol or drugs required?
2010-07-01
..., DEPARTMENT OF THE INTERIOR BOATING AND WATER USE ACTIVITIES § 3.11 When is testing for alcohol or drugs... procedures of the blood, breath, saliva or urine for the purpose of determining blood alcohol and/or drug... admissible in any related judicial proceeding. (2) Any test or tests for the presence of alcohol and drugs...
CENRTC Project number-sign 2F3EOA, OCB A-386, acceptance test procedure
International Nuclear Information System (INIS)
Akerson, A.W.
1995-01-01
This test procedure provides the steps necessary to verify correct functional operation of controls, annunciators, alarms, protective relays and related systems impacted by CENRTC number-sign 2F3EOA, Microwave Transfer Trip Project, modification work performed under work package 6B-93-00043/M (CENRTC 2F3EOA MWTT OCB A-386 PACKAGE). This procedure separates four tests into separate sections: Energization of A-386 Duplex Panel and Circuits; Local RFL 6750 function tests and start-up; SCADA tests; and A-386 local trip tests
Testing QoE in Different 3D HDTV Technologies
Directory of Open Access Journals (Sweden)
M. Slanina
2012-04-01
Full Text Available The three dimensional (3D display technology has started flooding the consumer television market. There is a number of different systems available with different marketing strategies and different advertised advantages. The main goal of the experiment described in this paper is to compare the systems in terms of achievable Quality of Experience (QoE in different situations. The display systems considered are the liquid crystal display using polarized light and passive lightweight glasses for the separation of the left- and right-eye images, a plasma display with time multiplexed images and active shutter glasses and a projection system with time multiplexed images and active shutter glasses. As no standardized test methodology has been defined for testing of stereoscopic systems, we develop our own approach to testing different aspects of QoE on different systems without reference using semantic differential scales. We present an analysis of scores with respect to different phenomena under study and define which of the tested aspects can really express a difference in the performance of the considered display technologies.
Baroreflex Coupling Assessed by Cross-Compression Entropy
Directory of Open Access Journals (Sweden)
Andy Schumann
2017-05-01
Full Text Available Estimating interactions between physiological systems is an important challenge in modern biomedical research. Here, we explore a new concept for quantifying information common in two time series by cross-compressibility. Cross-compression entropy (CCE exploits the ZIP data compression algorithm extended to bivariate data analysis. First, time series are transformed into symbol vectors. Symbols of the target time series are coded by the symbols of the source series. Uncoupled and linearly coupled surrogates were derived from cardiovascular recordings of 36 healthy controls obtained during rest to demonstrate suitability of this method for assessing physiological coupling. CCE at rest was compared to that of isometric handgrip exercise. Finally, spontaneous baroreflex interaction assessed by CCEBRS was compared between 21 patients suffering from acute schizophrenia and 21 matched controls. The CCEBRS of original time series was significantly higher than in uncoupled surrogates in 89% of the subjects and higher than in linearly coupled surrogates in 47% of the subjects. Handgrip exercise led to sympathetic activation and vagal inhibition accompanied by reduced baroreflex sensitivity. CCEBRS decreased from 0.553 ± 0.030 at rest to 0.514 ± 0.035 during exercise (p < 0.001. In acute schizophrenia, heart rate, and blood pressure were elevated. Heart rate variability indicated a change of sympathovagal balance. The CCEBRS of patients with schizophrenia was reduced compared to healthy controls (0.546 ± 0.042 vs. 0.507 ± 0.046, p < 0.01 and revealed a decrease of blood pressure influence on heart rate in patients with schizophrenia. Our results indicate that CCE is suitable for the investigation of linear and non-linear coupling in cardiovascular time series. CCE can quantify causal interactions in short, noisy and non-stationary physiological time series.
Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival
Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.
2017-01-01
Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastesspp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.
Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival
Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.
2017-10-01
Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastes spp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.
Energy Technology Data Exchange (ETDEWEB)
Wen, N; Lu, S; Qin, Y; Huang, Y; Zhao, B; Liu, C; Chetty, I [Henry Ford Health System, Detroit, MI (United States)
2016-06-15
Purpose: To evaluate the dosimetric uncertainty associated with Gafchromic (EBT3) films and establish an absolute dosimetry protocol for Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiotherapy (SBRT). Methods: EBT3 films were irradiated at each of seven different dose levels between 1 and 15 Gy with open fields, and standard deviations of dose maps were calculated at each color channel for evaluation. A scanner non-uniform response correction map was built by registering and comparing film doses to the reference diode array-based dose map delivered with the same doses. To determine the temporal dependence of EBT3 films, the average correction factors of different dose levels as a function of time were evaluated up to four days after irradiation. An integrated film dosimetry protocol was developed for dose calibration, calibration curve fitting, dose mapping, and profile/gamma analysis. Patient specific quality assurance (PSQA) was performed for 93 SRS/SBRT treatment plans. Results: The scanner response varied within 1% for the field sizes less than 5 × 5 cm{sup 2}, and up to 5% for the field sizes of 10 × 10 cm{sup 2}. The scanner correction method was able to remove visually evident, irregular detector responses found for larger field sizes. The dose response of the film changed rapidly (∼10%) in the first two hours and plateaued afterwards, ∼3% change between 2 and 24 hours. The mean uncertainties (mean of the standard deviations) were <0.5% over the dose range 1∼15Gy for all color channels for the OD response curves. The percentage of points passing the 3%/1mm gamma criteria based on absolute dose analysis, averaged over all tests, was 95.0 ± 4.2. Conclusion: We have developed an absolute film dose dosimetry protocol using EBT3 films. The overall uncertainty has been established to be approximately 1% for SRS and SBRT PSQA. The work was supported by a Research Scholar Grant, RSG-15-137-01-CCE from the American Cancer Society.
Outline of sodium-water reaction test in case of large leak with SWAT-3 testing equipments
International Nuclear Information System (INIS)
Sato, Minoru
1978-01-01
The key component in sodium-cooled fast reactors in steam generators, and the sodium-water reaction owing to the break of heating tubes may cause serious damages in equipments and pipings. The main factor controlling this phenomenon is the rate of leak of water. When the rate of water leak is small, the propagation of heating tube breaking may occur owing to ''wastage phenomenon'', on the other hand, when the rate of water leak is large, the phenomena of explosive pressure and flow occur due to the reaction heat and a large quantity of hydrogen generated by the reaction. In PNC, the testing equipments of SWAT-2 for small water leak and SWAT-1 for large leak were constructed, and the development test has been carried out to establish the method of safety design experimentally. The synthetic test equipment for the safety of steam generators, SWAT-3, was constructed to carry out the large water leak test in the scale close to actual plants. The object of the test, the outline of the test equipment, the phenomena of pressure and flow in the water injection test, the confirmation of the occurrence of secondary breaking of adjacent heating tubes, and the disposal of reaction products are described in this paper. This test is till going on, and the final conclusion will be reported later. (Kako, I.)
AGR 3/4 Irradiation Test Final As Run Report
Energy Technology Data Exchange (ETDEWEB)
Collin, Blaise P. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-06-01
Several fuel and material irradiation experiments have been planned for the Idaho National Laboratory Advanced Reactor Technologies Technology Development Office Advanced Gas Reactor Fuel Development and Qualification Program (referred to as the INL ART TDO/AGR fuel program hereafter), which supports the development and qualification of tristructural-isotropic (TRISO) coated particle fuel for use in HTGRs. The goals of these experiments are to provide irradiation performance data to support fuel process development, qualify fuel for normal operating conditions, support development and validation of fuel performance and fission product transport models and codes, and provide irradiated fuel and materials for post irradiation examination and safety testing (INL 05/2015). AGR-3/4 combined the third and fourth in this series of planned experiments to test TRISO coated low enriched uranium (LEU) oxycarbide fuel. This combined experiment was intended to support the refinement of fission product transport models and to assess the effects of sweep gas impurities on fuel performance and fission product transport by irradiating designed-to-fail fuel particles and by measuring subsequent fission metal transport in fuel-compact matrix material and fuel-element graphite. The AGR 3/4 fuel test was successful in irradiating the fuel compacts to the burnup and fast fluence target ranges, considering the experiment was terminated short of its initial 400 EFPD target (Collin 2015). Out of the 48 AGR-3/4 compacts, 42 achieved the specified burnup of at least 6% fissions per initial heavy-metal atom (FIMA). Three capsules had a maximum fuel compact average burnup < 10% FIMA, one more than originally specified, and the maximum fuel compact average burnup was <19% FIMA for the remaining capsules, as specified. Fast neutron fluence fell in the expected range of 1.0 to 5.5×1025 n/m2 (E >0.18 MeV) for all compacts. In addition, the AGR-3/4 experiment was globally successful in keeping the
Testing CP in K/sub μ/3 decays
International Nuclear Information System (INIS)
Leurer, M.
1989-01-01
K factories will open the way for high-precision CP tests in K/sub μ/ 3 decays. The standard model does not predict CP breaking in this process. We consider here the effects of nonstandard interactions mediated by vector and scalar particles and by leptoquarks. We show that, for the only experimentally measurable quantity, vector particles alone never induce CP violation, and give a general expression for the CP breaking induced by scalars and leptoquarks
Westinghouse-GOTHIC modeling of NUPEC's hydrogen mixing and distribution test M-4-3
International Nuclear Information System (INIS)
Ofstun, R.P.; Woodcock, J.; Paulsen, D.L.
1994-01-01
NUPEC (NUclear Power Engineering Corporation) ran a series of hydrogen mixing and distribution tests which were completed in April 1992. These tests were performed in a 1/4 linearly scaled model containment and were specifically designed to be used for computer code validation. The results of test M-4-3, along with predictions from several computer codes, were presented to the participants of ISP-35 (a blind test comparison of code calculated results with data from NUPEC test M-7-1) at a meeting in March 1993. Test M-4-3, which was similar to test M-7-1, released a mixture of steam and helium into a steam generator compartment located on the lower level of containment. The majority of codes did well at predicting the global pressure and temperature trends, however, some typical lumped parameter modeling problems were identified at that time. In particular, the models had difficulty predicting the temperature and helium concentrations in the so called 'dead ended volumes' (pressurizer compartment and in-core chase region). Modeling of the dead-ended compartments using a single lumped parameter volume did not yield the appropriate temperature and helium response within that volume. The Westinghouse-GOTHIC (WGOTHIC) computer code is capable of modeling in one, two or three dimensions (or any combination thereof). This paper describes the WGOTHIC modeling of the dead-ended compartments for NUPEC test M-4-3 and gives comparisons to the test data. 1 ref., 1 tab., 14 figs
Evaluation report on SCTF Core-III test S3-06
International Nuclear Information System (INIS)
Iwamura, Takamichi; Iguchi, Tadashi; Akimoto, Hajime; Okubo, Tsutomu; Ohnuki, Akira; Adachi, Hiromichi; Murao, Yoshio; Minato, Akihiko; Sakaki, Isao.
1988-10-01
In order to investigate the effect of radial power distribution on the thermal-hydraulic characteristics during the reflood phase of a PWR-LOCA with a combined injection type ECCS, a core cooling separate effect test S3-06 and a combined injection test S3-16-Phase 2 were performed using the Slab Core Test Facility (SCTF) Core-III. The radial power distributions in these two tests simulated a reference distribution for a PWR with a combined injection type ECCS and a steep distribution for a PWR with a cold leg injection type ECCS, respectively. Under the radial power distribution of a PWR with a combined injection type ECCS, the radial power distribution had little effect on the thermal-hydraulic behavior in the two-phase up-flow region due to the approximately flat power distribution in this region (power ratio = 1.04 ∼ 1.08). The overall fluid behavior in the pressure vessel was also little affected by the radial power distribution. On the other hand, under the steep radial power distribution (peak power ratio = 1.36), the degree of heat transfer enhancement in high power bundles in the two-phase up-flow region was dominated by the bundlewise radial power ratio as in the case of a PWR with a cold leg injection type ECCS. (author)
Energy Technology Data Exchange (ETDEWEB)
Dietlein, M.; Schicha, H. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Koeln Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Dressler, J. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Nuklearmedizinische Klinik der Henriettenstiftung, Hannover (Germany); Eschner, W. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Deutsche Gesellschaft fuer Medizinische Physik (DGMP) (Germany); Koeln Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Lassmann, M. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Deutsche Gesellschaft fuer Medizinische Physik (DGMP) (Germany); Wuerzburg Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Leisner, B. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Allgemeines Krankenhaus St. Georg, Hamburg (Germany). Abt. fuer Nuklearmedizin; Reiners, C. [Deutsche Gesellschaft fuer Nuklearmedizin (DGN) (Germany); Wuerzburg Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin
2007-07-01
The version 3 of the procedure guideline for radioiodine test is an update of the guideline previously published in 2003. The procedure guideline discusses the pros and cons of a single measurement or of repeated measurements of the iodine-131 uptake and their optimal timing. Different formulas are described when one, two or three values of the radioiodine kinetic are available. The probe with a sodium-iodine crystal, alternatively or additionally the gamma camera using the ROI-technique are instrumentations for the measurement of iodine-131 uptake. A possible source of error is an inappropriate measurement (sonography) of the target volume. The patients' preparation includes the withdrawal of antithyroid drugs 2-3 days before radioiodine administration. The patient has to avoid iodine-containing medication and the possibility of additives of iodine in vitamin- and electrolyte-supplementation has to be considered. (orig.)
Update on the Active Magnetospheric Particle Tracer Explorers (AMPTE) program
International Nuclear Information System (INIS)
Mcentire, R.W.
1987-01-01
The principles involved in the AMPTE mission's active experiments are discussed together with the role of the AMPTE satellites (the Germany's Ion Release Module, IRM, the United Kingdom Subsatellite, and the U.S Charge Composition Explorer, CCE) in and the results of the ion-release experiments. The AMPTE orbit profile is described, with the times of solar-wind and magnetotail ion releases (two barium and two lithium releases were carried out as the IRM precessed through the magnetosheath) shown schematically. In addition to the results on the Van Allen radiation belts obtained through the ion-release experiments, studies of the radiation belts with the new generation of sensors aboard the CCE and IRM are described. 25 references
The mass of sup 3 sup 2 Ar and sup 3 sup 3 Ar for fundamental tests
Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S
2003-01-01
Masses of the short-lived radionuclides sup 3 sup 2 Ar (T sub 1 sub / sub 2 = 98 ms) sup 3 sup 3 Ar (T sub 1 sub / sub 2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10 sup - sup 8 (delta m = 1.8 keV) and 1.4 x 10 sup - sup 8 (delta m = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of sup 3 sup 2 Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for sup 4 sup 4 Ar and sup 4 sup 5 Ar, and a 20 sigma deviation for sup 4 sup 4 Ar from the literature value was found and interpreted.
Automatic control of NASA Langley's 0.3-meter cryogenic test facility
Thibodeaux, J. J.; Balakrishna, S.
1980-01-01
Experience during the past 6 years of operation of the 0.3-meter transonic cryogenic tunnel at the NASA Langley Research Center has shown that there are problems associated with efficient operation and control of cryogenic tunnels using manual control schemes. This is due to the high degree of process crosscoupling between the independent control variables (temperature, pressure, and fan drive speed) and the desired test condition (Mach number and Reynolds number). One problem has been the inability to maintain long-term accurate control of the test parameters. Additionally, the time required to change from one test condition to another has proven to be excessively long and much less efficient than desirable in terms of liquid nitrogen and electrical power usage. For these reasons, studies have been undertaken to: (1) develop and validate a mathematical model of the 0.3-meter cryogenic tunnel process, (2) utilize this model in a hybrid computer simulation to design temperature and pressure feedback control laws, and (3) evaluate the adequacy of these control schemes by analysis of closed-loop experimental data. This paper will present the results of these studies.
Gearbox Reliability Collaborative Phase 3 Gearbox 2 Test Report
Energy Technology Data Exchange (ETDEWEB)
Keller, Jonathan; Wallen, Robb
2015-06-10
Many gearboxes in wind turbines have not been achieving their expected design life [1]; they do, however, commonly meet or exceed the design criteria specified in current standards in the gear, bearing, and wind turbine industry as well as third-party certification criteria. The cost of gearbox replacements and rebuilds, as well as the downtime associated with these failures, has elevated the cost of wind energy. In 2006, the U.S. Department of Energy established the National Renewable Energy Laboratory (NREL) Gearbox Reliability Collaborative (GRC). Its key goal is to understand the root causes of premature gearbox failures and improve their reliability [2]. The GRC is examining a hypothesis that the gap between design-estimated and actual wind turbine gearbox reliability is caused by underestimation of loads, inaccurate design tools, the absence of critical elements in the design process, or insufficient testing. This test report describes the recent tests of GRC gearbox (GB) 2 in the National Wind Technology Center (NWTC) dynamometer and documents any modifications to the original test plan [3]. In this manner, it serves as a guide for interpreting the publicly released data sets with brief analyses to illustrate the data. Specific objectives of the test were to assess the effect of dynamic nontorque load (NTL) on the planetary section, generator misalignment on the highspeed shaft (HSS), and field representative conditions on the gearbox in general. Detailed analysis of those test objectives will be presented in subsequent publications.
Pilot-scale treatability test plan for the 100-HR-3 operable unit
International Nuclear Information System (INIS)
1994-08-01
This document presents the treatability test plan for pilot-scale pump-and-treat testing at the 100-HR-3 Operable Unit. The test will be conducted in fulfillment of interim Milestone M-15-06E to begin pilot-scale pump-and-treat operations by August 1994. The scope of the test was determined based on the results of lab/bench-scale tests (WHC 1993a) conducted in fulfillment of Milestone M-15-06B. These milestones were established per agreement between the U.S. Department of Energy (DOE), the Washington State Department of Ecology and the U.S. Environmental Protection Agency (EPA), and documented on Hanford Federal of Ecology Facility Agreement and Consent Order Change Control Form M-15-93-02. This test plan discusses a pilot-scale pump-and-treat test for the chromium plume associated with the D Reactor portion of the 100-HR-3 Operable Unit. Data will be collected during the pilot test to assess the effectiveness, operating parameters, and resource needs of the ion exchange (IX) pump-and-treat system. The test will provide information to assess the ability to remove contaminants by extracting groundwater from wells and treating extracted groundwater using IX. Bench-scale tests were conducted previously in which chromium VI was identified as the primary contaminant of concern in the 100-D reactor plume. The DOWEX 21K trademark resin was recommended for pilot-scale testing of an IX pump-and-treat system. The bench-scale test demonstrated that the system could remove chromium VI from groundwater to concentrations less than 50 ppb. The test also identified process parameters to monitor during pilot-scale testing. Water will be re-injected into the plume using wells outside the zone of influence and upgradient of the extraction well
Multi-satellite observations of magnetic fields in space plasmas
International Nuclear Information System (INIS)
Potemra, T.A.; Zanetti, L.J.; Bythrow, P.F.; Erlandson, R.E.
1987-01-01
The most common method of detecting electric currents in space has been by virtue of the magnetic perturbations they produce. A satellite can pass through a field-aligned ''Birkeland'' current and measure the in-situ magnetic perturbations. Satellite-borne magnetic field experiments may also be used to observe characteristics of resonant oscillations of the Earth's magnetic field at ULF frequencies. Examples of such measurements with magnetic field experiments on the Viking, AMPTE/CCE, and DMSP-F7 satellites will be presented. The Viking satellite, launched in February, 1986, is Sweden's first satellite and is in a polar orbit with 3.1 R/sub e/ apogee. AMPTE/CCE was launched in August, 1984, with satellites from West Germany and the United Kingdom, for the purpose of creating artificial comets in space. It is in an equatorial orbit with a 8.8 R/sub e/ apogee. The Defense Meteorological Satellite Program (DMSP)-F7 satellite was launched in October, 1983 into an 800 km circular sun-synchronous orbit in the 0830-2030 magnetic local time plane. Viking and AMPTE/CCE observed harmonic ULF pulsations when they were near the same flux tube, but separated by about 10 R/sub e/. These unique observations are used to investigate the characteristics and sources of multiple field line resonances of Alfven waves. On another occasion, Viking and DMSP-F7 observed similar magnetic perturbations at widely separated locations. The authors interpret these perturbations as due to a complicated system of large-scale stable Birkeland currents in the morning sector. This multi-satellite data set is in the early stages of exploration, but already confirms the usefulness of coordinated multi-position observations of magnetic fields in space
O'Reilly, T. C.; Kieft, B.; Chaffey, M. R.; Wolfson-Schwehr, M.; Herlien, R.; Bird, L.; Klimov, D.; Paull, C. K.; Gwiazda, R.; Lundsten, E. M.; Anderson, K.; Caress, D. W.; Sumner, E. J.; Simmons, S.; Parsons, D. R.; Talling, P.; Rosenberger, K. J.; Xu, J.; Maier, K. L.; Gales, J. A.
2017-12-01
The Monterey Coordinated Canyon Experiment (CCE) deployed an array of instruments along the Monterey Canyon floor to characterize the structure, velocity and frequency of sediment flows. CCE utilized novel technologies developed at MBARI to capture sediment flow data in unprecedented detail. 1. The Seafloor Instrument Node (SIN) at 1850 meters depth housed 3 ADCPs at 3 different frequencies, CTD, current meter, oxygen optode, fluorometer/backscatter sensor, and logged data at 10 second intervals or faster. The SIN included an acoustic modem for communication with shore through a Wave Glider relay, and provided high-resolution measurements of three flow events during three successive deployments over 1.5 years. 2. Beachball-sized Benthic Event Detectors (BEDs) were deployed on or under the seafloor to measure the characteristics of sediment density flows. Each BED recorded data from a pressure sensor and a 3-axis accelerometer and gyro to characterize motions during transport events (e.g. tumble vs rotation). An acoustic modem capable of operating through more than a meter of sediment enabled communications with a ship or autonomous surface vehicle. Multiple BEDs were deployed at various depths in the canyon during CCE, detecting and measuring many transport events; one BED moved 9 km down canyon in 50 minutes during one event. 3. Wave Glider Hot Spot (HS), equipped with acoustic and RF modems, acted as data relay between SIN, BEDs and shore, and acoustically located BEDs after sediment density flows.. In some cases HS relayed BED motion data to shore within a few hours of the event. HS provided an acoustic console to the SIN, allowing shore-based users to check SIN health and status, perform maintenance, etc. 4. Mapping operations were conducted 4 times at the SIN site to quantify depositional and erosional patterns, utilizing a prototype ultra-high-resolution mapping system on the ROV Doc Ricketts. The system consists of a 400-kHz Reson 7125 multibeam sonar, a 3
Electric field deformation in diamond sensors induced by radiation defects
Energy Technology Data Exchange (ETDEWEB)
Kassel, Florian; Boer, Wim de; Boegelspacher, Felix; Dierlamm, Alexander; Mueller, Thomas; Steck, Pia [Institut fuer Experimentelle Kernphysik (IEKP), Karlsruher Institut fuer Technologie (KIT) (Germany); Dabrowski, Anne; Guthoff, Moritz [CERN (Switzerland)
2016-07-01
The BCML system is a beam monitoring device in the CMS experiment at the LHC. As detectors 32 poly-crystalline CVD diamond sensors are positioned in a ring around the beam pipe at a distance of ±1.8 m and ±14.4 m from the interaction point. The radiation hardness of the diamond sensors in terms of measured signal during operation was significantly lower than expected from laboratory measurements. At high particle rates, such as those occurring during the operation of the LHC, a significant fraction of the defects act as traps for charge carriers. This space charge modifies the electrical field in the sensor bulk leading to a reduction of the charge collection efficiency (CCE). A diamond irradiation campaign was started to investigate the rate dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the Transient Current Technique, the CCE was measured. The experimental results were used to create an effective trap model that takes the radiation damage into account. Using this trap model the rate dependent electrical field deformation and the CCE were simulated with the software ''SILVACO TCAD''. This talk compares the experimental measurement results with the simulations.
Semiconductor pixel detectors for digital mammography
International Nuclear Information System (INIS)
Novelli, M.; Amendolia, S.R.; Bisogni, M.G.; Boscardin, M.; Dalla Betta, G.F.; Delogu, P.; Fantacci, M.E.; Quattrocchi, M.; Rosso, V.; Stefanini, A.; Venturelli, L.; Zucca, S.
2003-01-01
We present some results obtained with silicon and gallium arsenide pixel detectors to be applied in the field of digital mammography. Even though GaAs is suitable for medical imaging applications thanks to its atomic number, which allows a very good detection efficiency, it often contains an high concentrations of traps which decrease the charge collection efficiency (CCE). So we have analysed both electrical and spectroscopic performance of different SI GaAs diodes as a function of concentrations of dopants in the substrate, in order to find a material by which we can obtain a CCE allowing the detection of all the photons that interact in the detector. Nevertheless to be able to detect low contrast details, efficiency and CCE are not the only parameters to be optimized; also the stability of the detection system is fundamental. In the past we have worked with Si pixel detectors; even if its atomic number does not allow a good detection efficiency at standard thickness, it has a very high stability. So keeping in mind the need to increase the Silicon detection efficiency we performed simulations to study the behaviour of the electrical potential in order to find a geometry to avoid the risk of electrical breakdown
Semiconductor pixel detectors for digital mammography
Energy Technology Data Exchange (ETDEWEB)
Novelli, M. E-mail: marzia.novelli@pi.infn.it; Amendolia, S.R.; Bisogni, M.G.; Boscardin, M.; Dalla Betta, G.F.; Delogu, P.; Fantacci, M.E.; Quattrocchi, M.; Rosso, V.; Stefanini, A.; Venturelli, L.; Zucca, S
2003-08-21
We present some results obtained with silicon and gallium arsenide pixel detectors to be applied in the field of digital mammography. Even though GaAs is suitable for medical imaging applications thanks to its atomic number, which allows a very good detection efficiency, it often contains an high concentrations of traps which decrease the charge collection efficiency (CCE). So we have analysed both electrical and spectroscopic performance of different SI GaAs diodes as a function of concentrations of dopants in the substrate, in order to find a material by which we can obtain a CCE allowing the detection of all the photons that interact in the detector. Nevertheless to be able to detect low contrast details, efficiency and CCE are not the only parameters to be optimized; also the stability of the detection system is fundamental. In the past we have worked with Si pixel detectors; even if its atomic number does not allow a good detection efficiency at standard thickness, it has a very high stability. So keeping in mind the need to increase the Silicon detection efficiency we performed simulations to study the behaviour of the electrical potential in order to find a geometry to avoid the risk of electrical breakdown.
Understanding overpressure in the FAA aerosol can test by C3H2F3Br (2-BTP)✩
Linteris, Gregory Thomas; Babushok, Valeri Ivan; Pagliaro, John Leonard; Burgess, Donald Raymond; Manion, Jeffrey Alan; Takahashi, Fumiaki; Katta, Viswanath Reddy; Baker, Patrick Thomas
2018-01-01
Thermodynamic equilibrium calculations, as well as perfectly-stirred reactor (PSR) simulations with detailed reaction kinetics, are performed for a potential halon replacement, C3H2F3Br (2-BTP, C3H2F3Br, 2-Bromo-3,3,3-trifluoropropene), to understand the reasons for the unexpected enhanced combustion rather than suppression in a mandated FAA test. The high pressure rise with added agent is shown to depend on the amount of agent, and is well-predicted by an equilibrium model corresponding to stoichiometric reaction of fuel, oxygen, and agent. A kinetic model for the reaction of C3H2F3Br in hydrocarbon-air flames has been applied to understand differences in the chemical suppression behavior of C3H2F3Br vs. CF3Br in the FAA test. Stirred-reactor simulations predict that in the conditions of the FAA test, the inhibition effectiveness of C3H2F3Br at high agent loadings is relatively insensitive to the overall stoichiometry (for fuel-lean conditions), and the marginal inhibitory effect of the agent is greatly reduced, so that the mixture remains flammable over a wide range of conditions. Most important, the flammability of the agent-air mixtures themselves (when compressively preheated), can support low-strain flames which are much more difficult to extinguish than the easy-to extinguish, high-strain primary fireball from the impulsively released fuel mixture. Hence, the exothermic reaction of halogenated hydrocarbons in air should be considered in other situations with strong ignition sources and low strain flows, especially at preheated conditions. PMID:29628525
Evaluation of Load Rejection to house load test at 50% power for UCN 3
Energy Technology Data Exchange (ETDEWEB)
Lee, Chang Gyun; Sohn, Suk Whun; Sohn, Jong Joo; Seo, Jong Tae; Lee, Sang Keun [Korea Power Engineering Company, Inc., Seoul (Korea, Republic of); Kim, Yong Sung; Nam, Kyu Won; Jung, Yang Mook; Chae, Kyeong Sik; Koh, Bum Jae; Oh, Chul Sung; Park, Hee Chool [Korea Electric Power Corporation, Taejon (Korea, Republic of)
1999-12-31
The Load Rejection to House Load test at 50% power was successfully performed during the UCN 3 PAT period. In this test, all plant control systems automatically controlled the plant from 50% power to house load operation mode. The KISPAC code, which was used in the performance analysis during the design process of UCN 3 and 4, predictions of the test agreed with the measured data demonstrating the validity of the code as well as the completeness of the plant design. 3 refs., 8 figs., 1 tab. (Author)
Evaluation of Load Rejection to house load test at 50% power for UCN 3
Energy Technology Data Exchange (ETDEWEB)
Lee, Chang Gyun; Sohn, Suk Whun; Sohn, Jong Joo; Seo, Jong Tae; Lee, Sang Keun [Korea Power Engineering Company, Inc., Seoul (Korea, Republic of); Kim, Yong Sung; Nam, Kyu Won; Jung, Yang Mook; Chae, Kyeong Sik; Koh, Bum Jae; Oh, Chul Sung; Park, Hee Chool [Korea Electric Power Corporation, Taejon (Korea, Republic of)
1998-12-31
The Load Rejection to House Load test at 50% power was successfully performed during the UCN 3 PAT period. In this test, all plant control systems automatically controlled the plant from 50% power to house load operation mode. The KISPAC code, which was used in the performance analysis during the design process of UCN 3 and 4, predictions of the test agreed with the measured data demonstrating the validity of the code as well as the completeness of the plant design. 3 refs., 8 figs., 1 tab. (Author)
46 CFR 159.007-3 - Production inspections and tests: Independent laboratory's procedures.
2010-10-01
...'s procedures. 159.007-3 Section 159.007-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... meets the inspection and test procedures of the laboratory; and (3) Are accepted by the Commandant under...
International Nuclear Information System (INIS)
Morris, R.N.; Baldwin, C.A.; Wilson, D.F.
1998-07-01
The Fissile Materials Disposition Program (FMDP) is investigating the use of weapons grade plutonium in mixed oxide (MOX) fuel for light-water reactors (LWR). Commercial MOX fuel has been successfully used in overseas reactors for many years; however, weapons derived fuel may differ from the previous commercial fuels because of small amounts of gallium impurities. A concern presently exists that the gallium may migrate out of the fuel, react with and weaken the clad, and thereby promote loss of fuel pin integrity. Phases 1 and 2 of the gallium task are presently underway to investigate the types of reactions that occur between gallium and clad materials. This is a Level-2 document as defined in the Fissile Materials Disposition Program Light-Water Reactor Mixed-Oxide Fuel Irradiation Test Project Plan. This Plan summarizes the projected Phase 3 Gallium-Cladding compatibility heating test and the follow-on post test examination (PTE). This work will be performed using centrally-heated surrogate pellets, to avoid unnecessary complexities and costs associated with working with plutonium and an irradiation environment. Two sets of rodlets containing pellets prepared by two different methods will be heated. Both sets will have an initial bulk gallium content of approximately 10 ppm. The major emphasis of the PTE task will be to examine the material interactions, particularly indications of gallium transport from the pellets to the clad
The UK MT-3 ballooning test in the Battelle NRU loop
International Nuclear Information System (INIS)
Gibson, I.H.; Coddington, P.; Healey, T.; Mann, C.A.
1982-04-01
The ballooning response of PWR fuel rods under postulated LOCA conditions has been the subject of intensive investigations. The UK MT-3 ballooning test was a co-operative international exercise which was technically very successful. This report describes the pre-test planning and calculations carried out in the UK and then describes in some detail the thermal hydraulic and clad deformation results. (U.K.)
Plan for 3-D full-scale earthquake testing facility
International Nuclear Information System (INIS)
Ohtani, K.
2001-01-01
Based on the lessons learnt from the Great Hanshin-Awaji Earthquake, National Research Institute for Earth Science and Disaster Prevention plan to construct the 3-D Full-Scale Earthquake Testing Facility. This will be the world's largest and strongest shaking table facility. This paper describes the outline of the project for this facility. This facility will be completed in early 2005. (author)
MAC Version 3.3, MBA Version 1.3 acceptance test summary report
International Nuclear Information System (INIS)
Russell, V.K.
1994-01-01
The K Basins Materials Accounting (MAC) and Materials Balance (MBA) programs had the Paradox Code Cleanup ATP run to check out the systems. This report describes the results of the test and provides the signoff sheets associated with the testing. The Acceptance Test results indicate that the MAC and MBA systems are ready for operation using the cleaned up code. The final codes were removed to the production space on the customer server on April 15th
Performance testing of 3D point cloud software
Varela-González, M.; González-Jorge, H.; Riveiro, B.; Arias, P.
2013-10-01
LiDAR systems are being used widely in recent years for many applications in the engineering field: civil engineering, cultural heritage, mining, industry and environmental engineering. One of the most important limitations of this technology is the large computational requirements involved in data processing, especially for large mobile LiDAR datasets. Several software solutions for data managing are available in the market, including open source suites, however, users often unknown methodologies to verify their performance properly. In this work a methodology for LiDAR software performance testing is presented and four different suites are studied: QT Modeler, VR Mesh, AutoCAD 3D Civil and the Point Cloud Library running in software developed at the University of Vigo (SITEGI). The software based on the Point Cloud Library shows better results in the loading time of the point clouds and CPU usage. However, it is not as strong as commercial suites in working set and commit size tests.
Performance testing of 3D point cloud software
Directory of Open Access Journals (Sweden)
M. Varela-González
2013-10-01
Full Text Available LiDAR systems are being used widely in recent years for many applications in the engineering field: civil engineering, cultural heritage, mining, industry and environmental engineering. One of the most important limitations of this technology is the large computational requirements involved in data processing, especially for large mobile LiDAR datasets. Several software solutions for data managing are available in the market, including open source suites, however, users often unknown methodologies to verify their performance properly. In this work a methodology for LiDAR software performance testing is presented and four different suites are studied: QT Modeler, VR Mesh, AutoCAD 3D Civil and the Point Cloud Library running in software developed at the University of Vigo (SITEGI. The software based on the Point Cloud Library shows better results in the loading time of the point clouds and CPU usage. However, it is not as strong as commercial suites in working set and commit size tests.
FE-I4 pixel chip characterization with USBpix3 test system
Energy Technology Data Exchange (ETDEWEB)
Filimonov, Viacheslav; Gonella, Laura; Hemperek, Tomasz; Huegging, Fabian; Janssen, Jens; Krueger, Hans; Pohl, David-Leon; Wermes, Norbert [University of Bonn, Bonn (Germany)
2015-07-01
The USBpix readout system is a small and light weighting test system for the ATLAS pixel readout chips. It is widely used to operate and characterize FE-I4 pixel modules in lab and test beam environments. For multi-chip modules the resources on the Multi-IO board, that is the central control unit of the readout system, are coming to their limits, which makes the simultaneous readout of more than one chip at a time challenging. Therefore an upgrade of the current USBpix system has been developed. The upgraded system is called USBpix3 - the main focus of the talk. Characterization of single chip FE-I4 modules was performed with USBpix3 prototype (digital, analog, threshold and source scans; tuning). PyBAR (Bonn ATLAS Readout in Python scripting language) was used as readout software. PyBAR consists of FEI4 DAQ and Data Analysis Libraries in Python. The presentation describes the USBpix3 system, results of FE-I4 modules characterization and preparation for the multi-chip module and multi-module readout with USBpix3.
Operability test procedure for the Rotary Mode Core Sampling System Exhausters 3 and 4
International Nuclear Information System (INIS)
WSaldo, E.J.
1995-01-01
This document provides a procedure for performing operability testing of the Rotary Mode Core Sampling System Exhausters 3 ampersand 4. Upon completion of testing activities an operability testing report will be issued
Energy Technology Data Exchange (ETDEWEB)
Goncalves, Leandro R.; Pieri, Karen; Silva, Marco A.; Santos, Gabriela R.; Sales, Camila P.; Rubo, Rodrigo A.; Nakandakari, Marcos V.N.; Cunha, Ana Paula V; Santos, Caroline Z.; Rodrigues, Laura N.; Furnari, Laura, E-mail: leandrorg11@hotmail.com [Universidade de Sao Paulo (USP), SP (Brazil). Hospital das Clinicas. Servico de Radioterapia
2012-12-15
The radiotherapy evolution from 2D treatments to 3D conformal treatments was possible after the advent the treatment planning systems commercially available and tridimensional images techniques like computed tomography. These systems have tools that allow delineate anatomical structures from tomographic images. Calculations dose tools allow the planner evaluate the dose received in the anatomical structures. When these systems are acquired or an upgrade is made many dosimetric and non-dosimetric tests need to be performed to know the system limitations and correct functioning and to verify the correct dosimetric data insertion. This study was based in International Atomic Energy Agency protocols, Task Groups documents from American Association of Physics in Medicine, and other papers. A dosimetric test set was done to commissioning the Eclipse 10.0.28 (Varian Medical Systems) treatments planning system This version has two photon calculation algorithm (Pencil Beam Convolution and Analytical Anisotropic Algorithm – AAA) and Gaussian Pencil Beam algorithm for electron beams. However, tests for AAA it was not performed. In this study was possible to conclude that the dosimetric data was correctly added in the treatment planning system. Some results allowed to understand the algorithm limitations to calculate dose distributions in specifics situations, that was not clinically relevant in our routine. (author)
3D Tests on Overtopping for SSG Wave Energy Converter
DEFF Research Database (Denmark)
Margheritini, Lucia; Kofoed, Jens Peter
This report presents the results of the first study based on laboratory tests of the behaviour of the SSG pilot module in 3D wave conditions. This study was recommended already during Phase 2 of the Co-operation agreement between WEVEnergy AS (Norway) and Aalborg University, Department of Civil...... of the individual reservoirs have been measured and the hydraulic efficiency calculated. The results are given in terms of overtopping rates for the 3 reservoirs and hydraulic efficiency....
Simulation software support (S3) system a software testing and debugging tool
International Nuclear Information System (INIS)
Burgess, D.C.; Mahjouri, F.S.
1990-01-01
The largest percentage of technical effort in the software development process is accounted for debugging and testing. It is not unusual for a software development organization to spend over 50% of the total project effort on testing. In the extreme, testing of human-rated software (e.g., nuclear reactor monitoring, training simulator) can cost three to five times as much as all other software engineering steps combined. The Simulation Software Support (S 3 ) System, developed by the Link-Miles Simulation Corporation is ideally suited for real-time simulation applications which involve a large database with models programmed in FORTRAN. This paper will focus on testing elements of the S 3 system. In this paper system support software utilities are provided which enable the loading and execution of modules in the development environment. These elements include the Linking/Loader (LLD) for dynamically linking program modules and loading them into memory and the interactive executive (IEXEC) for controlling the execution of the modules. Features of the Interactive Symbolic Debugger (SD) and the Real Time Executive (RTEXEC) to support the unit and integrated testing will be explored
40 CFR Table 3 to Subpart Jjjjj of... - Requirements for Performance Tests
2010-07-01
... pressure drop across the DLA, determine and record the block average pressure drop values for the three test runs, and determine and record the 3-hour block average of the recorded pressure drop measurements for the three test runs. b. Establish the operating limit for the limestone feeder setting Data from...
Lillestøl, R L; Olvegård, M; Rabiller, A N; Sterbini, G; Adli, E
2012-01-01
The Test Beam Line in the CLIC Test Facility 3 is the first prototype of the CLIC drive beam decelerator. The main purpose of the experiment is to demonstrate efficient 12 GHz rf power production and stable transport of an electron drive beam during deceleration. The Test Beam Line consists of a FODO structure with high precision BPMs and quadrupoles mounted on mechanical movers for precisebeam alignment. Nine out of the planned 16 Power Extraction and Transfer Structures have currently been installed and commissioned. We correlate rf power production measurements with the drive beam deceleration measurements, and compare the two measurements to the theoretical predictions. We also discuss the impact of the drive beam bunch length and bunch combination on the measurements.
Tests of a 3 meter curved superconducting beam transport dipole magnet
International Nuclear Information System (INIS)
Allinger, J.E.; Carroll, A.S.; Danby, G.T.; DeVito, B.; Jackson, J.W.; Leonhardt, W.J.; Prodell, A.G.; Weisenbloom, J.
1981-01-01
Initial tests of one of the curved 3 m long superconducting dipole magnets intended to generate 6.0 T and produce a 20.4 0 bend in the primary proton beam to a new D-target station at the Brookhaven National Laboratory AGS have been completed. Although this magnet, whose window frame design generally follows that of the successful 8 0 and Model T superconducting dipoles, demonstrates many of the desirable characteristics of these earlier magnets such as excellent quench propagation and good ramping properties, it has only reached a disappointingly low magnetic field of 3.5 to 4.0 T. Because of the great interest in superconducting magnet technology, this report will describe the diagnostic tests performed and plans for future modifications
Sensitivity and specificity of the 3-item memory test in the assessment of post traumatic amnesia.
Andriessen, Teuntje M J C; de Jong, Ben; Jacobs, Bram; van der Werf, Sieberen P; Vos, Pieter E
2009-04-01
To investigate how the type of stimulus (pictures or words) and the method of reproduction (free recall or recognition after a short or a long delay) affect the sensitivity and specificity of a 3-item memory test in the assessment of post traumatic amnesia (PTA). Daily testing was performed in 64 consecutively admitted traumatic brain injured patients, 22 orthopedically injured patients and 26 healthy controls until criteria for resolution of PTA were reached. Subjects were randomly assigned to a test with visual or verbal stimuli. Short delay reproduction was tested after an interval of 3-5 minutes, long delay reproduction was tested after 24 hours. Sensitivity and specificity were calculated over the first 4 test days. The 3-word test showed higher sensitivity than the 3-picture test, while specificity of the two tests was equally high. Free recall was a more effortful task than recognition for both patients and controls. In patients, a longer delay between registration and recall resulted in a significant decrease in the number of items reproduced. Presence of PTA is best assessed with a memory test that incorporates the free recall of words after a long delay.
Successful flow testing of a gas reservoir in 3,500 feet of water
International Nuclear Information System (INIS)
Shaughnessy, J.M.; Carpenter, R.S.; Coleman, R.A.; Jackson, C.W.
1992-01-01
The test of Viosca Knoll Block 957 Well No. 1 Sidetrack No. 2 was Amoco Production Co.'s deepest test from a floating rig. Viosca Knoll 957 is 115 miles southeast of New Orleans in 3,500 ft of water. The test, at a record water depth for the Gulf of Mexico, also set a world water-depth record for testing a gas reservoir. Safety to crew and the environmental were top priorities during the planning. A team consisting of drilling, completion, reservoir, and facilities engineers and a foreman were assigned to plan and implement the test. Early planning involved field, service company, and engineering groups. Every effort was made to identify potential problems and to design the system to handle them. This paper reports that the goals of the test were to determine reservoir properties and reservoir limits. Several significant challenges were involved in the well test. The reservoir was gas with a potentially significant condensate yield. The ability to dispose of the large volumes of produced fluids safely without polluting was critical to maintaining uninterrupted flow. Potential shut-in surface pressure was 6,500 psi. Seafloor temperature in 3,500 ft of water was 39 degrees F
Test of sup 3 He-based neutron polarizers at NIST
Jones, G L; Thompson, A K; Chowdhuri, Z; Dewey, M S; Snow, W M; Wietfeldt, F E
2000-01-01
Neutron spin filters based on polarized sup 3 He are useful over a wide neutron energy range and have a large angular acceptance among other advantages. Two optical pumping methods, spin-exchange and metastability-exchange, can produce the volume of highly polarized sup 3 He gas required for such neutron spin filters. We report a test of polarizers based on each of these two methods on a new cold, monochromatic neutron beam line at the NIST Center for Neutron Research.
Simulation and test of 3D silicon radiation detectors
International Nuclear Information System (INIS)
Fleta, C.; Pennicard, D.; Bates, R.; Parkes, C.; Pellegrini, G.; Lozano, M.; Wright, V.; Boscardin, M.; Dalla Betta, G.-F.; Piemonte, C.; Pozza, A.; Ronchin, S.; Zorzi, N.
2007-01-01
The work presented here is the result of the collaborative effort between the University of Glasgow, ITC-IRST (Trento) and IMB-CNM (Barcelona) in the framework of the CERN-RD50 Collaboration to produce 3D silicon radiation detectors and study their performance. This paper reports on two sets of 3D devices. IRST and CNM have fabricated a set of single-type column 3D detectors, which have columnar electrodes of the same doping type and an ohmic contact located at the backplane. Simulations of the device behaviour and electrical test results are presented. In particular, current-voltage, capacitance-voltage and charge collection efficiency measurements are reported. Other types of structures called double-sided 3D detectors are currently being fabricated at CNM. In these detectors the sets of n and p columns are made on opposite sides of the device. Electrical and technological simulations and first processing results are presented
Performance test on 2-dimensional PIV and 3-dimensional PIV using standard images
International Nuclear Information System (INIS)
Hwang, Tae Gyu; Doh, Deog Hee
2004-01-01
Quantitative performance test on the conventional 2D-PIV and the hybrid angular 3D-PIV (Stereoscopic PIV) was carried out. LES Data sets on an impinging jet which are provided on the webpage(http://www.vsj.or.jp/piv) for the PIV Standard Project were used for the generation of virtual images. The generated virtual images were used for the 2D-PIV and 3D-PIV measurements test. It has been shown that the results obtained by 2D-PIV on average values are slightly closer to the LES data than those obtained by 3D-PIV, but the turbulent properties obtained by 2D-PIV are largely underestimated than those obtained by 3D-PIV
Evaluation of load rejection to house load test at 50% power for UCN 3
International Nuclear Information System (INIS)
Lee, Chang Gyun; Sohn, Suk Whun; Sohn, Jong Joo; Seo, Jong Tae; Lee, Sang Keun; Kim, Yong Sung; Nam, Kyu Won; Jung, Yang Mook; Chae, Kyeong Sik; Koh, Bum Jae; Oh, Chul Sung; Park, Hee Chool
1998-01-01
The Load Rejection to House Load test at 50% power was successfully performed during the UCN 3 PAT period. In this test, all plant control systems automatically controlled the plant from 50% power to house load operation mode. The KISPAC code, which was used in the performance analysis during the design process of UCN 3 and 4, predictions of the test agreed with the measured data demonstrating the validity of the code as well as completeness of the plant design
SWFSC/MMTD/CCE: California Harbor Porpoise Survey (CAHPS) 1995
National Oceanic and Atmospheric Administration, Department of Commerce — A ship-based marine mammal survey in California from Point Conception, California to the California-Oregon border, with the survey extent limited to waters from the...
Antidepressant-Like Effect of 1α-Hydroxyvitamin D3 on Mice in the Forced Swimming Test.
Kawaura, Akihiko; Kitamura, Yoshihisa; Tanida, Noritoshi; Akiyama, Junichi; Mizutani, Masatoshi; Harada, Kazuhiro; Morishita, Motoyoshi; Inoue, Shigeki; Kano, Yoshio; Okano, Toshio; Takeda, Eiji
2017-01-01
We examined the effect of 1α-hydroxyvitamin D 3 [1α(OH)D 3 ] on mice in the forced swimming test. Intragastric administration of 1.0 μg/kg of 1α(OH)D 3 reduced immobility time in the forced swimming test. At all concentrations tested (0.5, 1.0, 2.0 μg/kg), 1α(OH)D 3 had no effect on locomotor activity, compared with controls. These results suggest that 1α(OH)D 3 may have antidepressant-like activity.
International Nuclear Information System (INIS)
Warinner, D.K.
1983-01-01
This paper compares the predictions of the revised 3D-AIRLOCA computer code to those data available from the Aerospace Systems Test Reactor's (ASTR's) loss-of-coolant-accident (LOCA) tests run in 1964. The theoretical and experimental hot-spot temperature responses compare remarkably well. In the thirteen cases studied, the irradiation powers varied from 0.4 to 8.87 MW; the irradiation times were 300, 1540, 1800, and 10 4 s. The degrees of agreement between the data and predictions provide an experimental validation of the 3D-AIRLOCA code
International Nuclear Information System (INIS)
Warinner, D.K.
1984-01-01
This paper compares the predictions of the revised 3D-AIRLOCA computer code to those data available from the Aerospace Systems Test Reactor's (ASTR's) loss-of-coolant-accident (LOCA) tests run in 1964. The theoretical and experimental hot-spot temperature responses compare remarkably well. In the thirteen cases studied, the irradiation powers varied from 0.4 to 8.87 MW; the irradiation times were 300, 1540, 1800, and 10 4 s. The degrees of agreement between the data and predictions provide an experimental validation of the 3D-AIRLOCA code. (author)
The Initial Test Programme Features for the Advanced Korean NPPs (Shin–Kori NPP Units 3&4)
International Nuclear Information System (INIS)
Sul, Y.S.
2015-01-01
Korea has developed the Advanced Power Reactor 1400 (APR1400), an evolutionary pressurised water reactor and has obtained the standard design approval in 2002. As of 2014, eight nuclear power plants (NPPs) are in preparation for operation or under construction, four in Korea (SKN 3&4, SUN 1&2) and four in UAE (BNPP 1, 2, 3&4), and four NPPs are in planning in Korea (SKN 5&6, SUN 3&4). Especially, SKN Units 3&4 are the first construction NPPs for the APR1400 and are currently in the final stage to get Operating Licence (OL). The initial test programme for NPPs begins as systems and components are turned over to the startup organization and ends with completion of the Power Ascension Tests (PATs). For SKN Unit 3, the Pre-core Hot Functional Testing has been successfully completed and the initial fuel loading would proceed after getting OL. The SKN Unit 4 is preparing for the CHT (Cold Hydrostatic Test). The SKN 3&4 has many new and advanced design features and so has developed the test programmes to demonstrate that those advanced design features can be safely operated and the performance levels can be maintained in accordance with approved safety requirements. Among those test programs, the examples of test programs, newly introduced ones compared to the previous NPPs are as follows; – SIT (Safety Injection Tank) Blowdown Test with FD (Fluidic Device) – IRWST (In-Containment Refueling Water Storage Tank) In-Plant Test – POSRV (Pilot Operated Safety Relief Valve) Test – Low Power Physics Testing and PAT considering FOAK (First Of A Kind) unit – Safe Shutdown Test with DCS (Distrubuted Control System) Fail and CMF (Common Mode Failure) for Safety Instrumentation and Control System. (author)
LOFT/L3-, Loss of Fluid Test, 7. NRC L3 Small Break LOCA Experiment
International Nuclear Information System (INIS)
1992-01-01
1 - Description of test facility: The LOFT Integral Test Facility is a scale model of a LPWR. The intent of the facility is to model the nuclear, thermal-hydraulic phenomena which would take place in a LPWR during a LOCA. The general philosophy in scaling coolant volumes and flow areas in LOFT was to use the ratio of the LOFT core [50 MW(t)] to a typical LPWR core [3000 MW(t)]. For some components, this factor is not applied; however, it is used as extensively as practical. In general, components used in LOFT are similar in design to those of a LPWR. Because of scaling and component design, the LOFT LOCA is expected to closely model a LPWR LOCA. 2 - Description of test: This was the seventh in the NRC L3 Series of small-break LOCA experiments. A 2.5-cm (10-in.) cold-leg non-communicative-break LOCA was simulated. The experiment was conducted on 20 June 1980
Deville, Craig; O'Neill, Thomas; Wright, Benjamin D.; Woodcock, Richard W.; Munoz-Sandoval, Ana; Gershon, Richard C.; Bergstrom, Betty
1998-01-01
Articles in this special section consider (1) flow in test taking (Craig Deville); (2) testwiseness (Thomas O'Neill); (3) test length (Benjamin Wright); (4) cross-language test equating (Richard W. Woodcock and Ana Munoz-Sandoval); (5) computer-assisted testing and testwiseness (Richard Gershon and Betty Bergstrom); and (6) Web-enhanced testing…
Assessment of RELAP5 MOD3.3 and CATHARE 2 V1.5A against a full scale test of PERSEO device
International Nuclear Information System (INIS)
Bianchi, F.; Meloni, P.; Ferri, R.; Achilli, A.
2004-01-01
PERSEO device was developed in the framework of a domestic research program on innovative safety systems, with the purpose to increase the reliability of passive Decay Heat Removal Systems implementing in-pool heat exchangers. The device was tested at SIET Thermal-hydraulic Research Centre by modifying the existing PANTHERS IC-PCC facility. Two types of tests were performed: integral tests and stability tests. The experimental data acquired in the test campaign allowed a validation of a RELAP5/mod 3.3 beta release and CATHARE2 V1.5a/Mod8.1 full scale model of the PERSEO device. The paper deals with the comparison between the two codes against an integral test considered representative from the point of view of the PERSEO functioning and it highlights capabilities and limits of the codes in simulating such kind of test. (authors)
42 CFR 84.100 - Man tests 1, 2, 3, and 4; requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests 1, 2, 3, and 4; requirements. 84.100 Section 84.100 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.100 Man tests 1...
U3Si2 Fabrication and Testing for Implementation into the BISON Fuel Performance Code
Energy Technology Data Exchange (ETDEWEB)
Knight, Travis W.
2018-04-23
A creep test stand was designed and constructed for compressive creep testing of U3Si2 pellets. This is described in Chapter 3.
Virtual rough samples to test 3D nanometer-scale scanning electron microscopy stereo photogrammetry.
Villarrubia, J S; Tondare, V N; Vladár, A E
2016-01-01
The combination of scanning electron microscopy for high spatial resolution, images from multiple angles to provide 3D information, and commercially available stereo photogrammetry software for 3D reconstruction offers promise for nanometer-scale dimensional metrology in 3D. A method is described to test 3D photogrammetry software by the use of virtual samples-mathematical samples from which simulated images are made for use as inputs to the software under test. The virtual sample is constructed by wrapping a rough skin with any desired power spectral density around a smooth near-trapezoidal line with rounded top corners. Reconstruction is performed with images simulated from different angular viewpoints. The software's reconstructed 3D model is then compared to the known geometry of the virtual sample. Three commercial photogrammetry software packages were tested. Two of them produced results for line height and width that were within close to 1 nm of the correct values. All of the packages exhibited some difficulty in reconstructing details of the surface roughness.
The 4th surveillance testing for Kori unit 3 reactor vessel materials
Energy Technology Data Exchange (ETDEWEB)
Chang, Kee Ok; Kim, Byoung Chul; Lee, Sam Lai; Choi, Kwun Jae; Gong, Un Sik; Chang, Jong Hwa; Joo, Yong Sun; Ahn, Sang Bok; Hong, Joon Hwa [Korea Atomic Energy Research Institute, Taejeon (Korea)
2000-10-01
Surveillance testing for reactor vessel materials is performed in order to evaluate the irradiation embrittlement due to neutrons during operation and set the condition of safe operation of nuclear reactor. The 4th surveillance testing was performed completely by Korea Atomic Energy Research Institute at Taejeon after the capsule was transported from Kori site including its removal from reactor. Fast neutron fluences for capsules were calculated and various testing including mechanical and chemistry analysis were performed in order to evaluate the integrity of Kori unit 3 reactor vessel during the operation until life time. The evaluation results are as follows; Fast neutron fluences for capsules U, V, X and W are 4.983E+18, 1.641E+19, 3.158E+19, and 4.469E+19n/cm{sup 2}, respectively. The bias factor, the ratio of calculation/measurement, was 0.840 for the 1st through 4th testing and the calculational uncertainty, 12% satisfied the requirement of USNRC Reg.Guide DG-1053, 20%. The best estimated neutron fluence for reactor vessel inside surface was 1.362E+19n/cm{sup 2} based on the end of 12th fuel cycle and it was predicted that the fluences of vessel inside surface at 32, 40, 48 and 56EFPY would reach 3.481E+19, 4.209E+19, 5.144E+19 and 5.974E+19n/cm{sup 2} based on the current calculation. The result through this analysis for Kori unit 3 showed that there would be no problem for the pressurized thermal shock(PTS) during the operation until design life. 48 refs., 35 figs., 41 tabs. (Author)
Tran, Quoc Anh; Chevalier, Bastien; Benz, Miguel; Breul, Pierre; Gourvès, Roland
2017-06-01
The recent technological developments made on the light dynamic penetration test Panda 3 ® provide a dynamic load-penetration curve σp - sp for each impact. This curve is influenced by the mechanical and physical properties of the investigated granular media. In order to analyze and exploit the load-penetration curve, a numerical model of penetration test using 3D Discrete Element Method is proposed for reproducing tests in dynamic conditions in granular media. All parameters of impact used in this model have at first been calibrated by respecting mechanical and geometrical properties of the hammer and the rod. There is a good agreement between experimental results and the ones obtained from simulations in 2D or 3D. After creating a sample, we will simulate the Panda 3 ®. It is possible to measure directly the dynamic load-penetration curve occurring at the tip for each impact. Using the force and acceleration measured in the top part of the rod, it is possible to separate the incident and reflected waves and then calculate the tip's load-penetration curve. The load-penetration curve obtained is qualitatively similar with that obtained by experimental tests. In addition, the frequency analysis of the measured signals present also a good compliance with that measured in reality when the tip resistance is qualitatively similar.
Geier, Johannes; Ballmer-Weber, Barbara K; Dickel, Heinrich; Frosch, Peter J; Bircher, Andreas; Weisshaar, Elke; Hillen, Uwe
2013-07-01
Being a contact allergen of general relevance, p-phenylenediamine (PPD) is patch tested in the baseline series. However, PPD 1% in petrolatum may actively sensitize. Patch testing with PPD at 0.35% pet. proved to be safe, as far as active sensitization is concerned. To determine whether PPD 0.3% pet. reliably detects PPD sensitization. Patch testing with PPD 0.3% pet. and 1% pet. synchronously was performed in consecutive patients in a multicentre study within the Information Network of Departments of Dermatology. Altogether, 2042 patients were patch tested. PPD 1% pet. yielded 6.0% positive reactions (n = 123), and PPD 0.3% pet. yielded 4.7% (n = 95). The synchronous reproducibility of PPD reactions was similar as known from parallel patch tests with identical PPD concentrations. The diagnostic properties of PPD 0.3% pet. expressed as reaction index and positivity ratio were good. Of the 123 patients reacting to PPD 1% pet., 32 (26%) had no positive reaction to PPD 0.3% pet. In 22 of these 32 patients (69%), no clinical relevance could be found. As patch testing with PPD 0.3% pet. is reliable according to our results, we recommend replacing PPD 1% pet. in the baseline series with PPD 0.3% pet. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Park, Dongkeun; Bascuñán, Juan; Michael, Philip C; Lee, Jiho; Hahn, Seungyong; Iwasa, Yukikazu
2018-04-01
We present construction and test results of Coils 2 and 3 of a 3-coil 800-MHz REBCO insert (H800) for the MIT 1.3 GHz LTS/HTS NMR magnet currently under construction. Each of three H800 coils (Coils 1-3) is a stack of no-insulation REBCO double pancakes (DPs). The innermost 8.67-T Coil 1 (26 DPs) was completed in 2016; the middle 5.64-T Coil 2 (32 DPs) has been wound, assembled, and tested; and for the outermost 4.44-T Coil 3, its 38 DPs have been wound and preliminary tests were performed to characterize each DP at 77 K. Included for Coil 2 are: 1) 77-K data of critical current, index, and turn-to-turn characteristic resistivity of each DP; 2) stacking order of the 32 DPs optimized to maximize the Coil 2 current margin and minimize its Joule dissipation in the pancake-to-pancake joints; 3) procedure to experimentally determine and apply a room-temperature preload to the DP stack; 4) 77-K and 4.2-K test results after each of 64 pancakes was over-banded with 75-μm-thick stainless steel tape for a radial thickness of 5 mm. Presented for each DP in Coil 3 are 77-K dada of critical current, index, and turn-to-turn characteristic resistivity.
Test Series 3: seismic-fragility tests of naturally-aged Class 1E C and D LCU-13 battery cells
International Nuclear Information System (INIS)
Bonzon, L.L.; Hente, D.B.; Kukreti, B.M.; Schendel, J.; Tulk, J.D.; Janis, W.J.; Black, D.A.; Paulsen, G.D.; Aucoin, B.D.
1985-03-01
This report, the third in a test series of an extensive seismic research program, covers the testing of 10-year old lead-calcium C and D LCU-13 cells from the North Anna Nuclear Power Station operated by the Virginia Electric and Power Company. The C and D cells were tested in two configurations using a triaxial shake table: single-cell tests, both rigidly and loosely mounted; and multicell (three-cell) tests, mounted in a typical battery rack. A total of seven electrically active cells was used in the two different cell configurations. None of the seven cells failed in the first stage tests during the actual seismic test up to the 1.5 g ZPAs imposed. Subsequent discharge capacity tests showed that while these cells suffered some loss of discharge capacity, all cells could deliver the accepted standard of 80% of their rated electrical capacity for 3 hours. When two of the same cells were exposed to the second stage, higher g-level tests, both cells again provided instantaneous uninterrupted power. Subsequent capacity tests showed both of these cells to have capacities well below the accepted standard of 80%. Four of the cells were disassembled for examination and metallurgical analyses. The examination showed that all plates and separators were in very good condition
Physics calculations for the RIA 1-3 irradiated rod test
International Nuclear Information System (INIS)
Young, T.E.
1981-06-01
The RIA 1-3 test would employ a square array of four pre-irradiated BWR rods to provide information on fuel failure modes and consequences of postulated Reactivity Initiated Accidents in power reactors. Calculations were done to: (1) predict R-O power distributions in the test rods for thermal-hydraulic and fuel-failure analysis; and (2) predict the steady-state and transient ratios of test fuel energy deposition to core energy deposition (Figures of Merit). Fission distributions for the test were computed with the RAFFL Monte Carlo code using an external neutron current source from a complete-reactor radial calculation with the SCAMP S/sub n/ code. Energies per fission for the rods were computed using the SINBAD buildup and depletion code, the GAMSOR gamma ray source code, and the QAD-BSA point-kernel shielding code. The calculated rod average-to-test average energy deposition ratios are 0.99, 0.99, and 0.97 for the rods irradiated to approximately 12 CWd/tu, and 1.04 for the rod irradiated to 4.8 GWd/tu. The maximum deviation of the power density of 1/12-rod azimuthal segments from the rod average is 4%. For an estimated control rod position of 0.591 m withdrawn the predicted radial average energy deposition at the axial peak in an average test rod is 1.71 (kW/m)/MW during preconditioning, and 1.84 (kJ/kg UO 2 ) MW.S during the burst. 16 figures, 7 tables
Comparison of ASTECV1.3.2 and ASTECV2 results for QUENCH 12 test
International Nuclear Information System (INIS)
Stefanova, A.
2010-01-01
This paper presents a comparison of QUENCH 12 test calculated results with ASTECv1.3R2 and ASTECv2 computer codes. The test was performed to investigate the behavior of VVER fuel assemblies. This investigation is a part of the 6th and 7th framework programs of the EC supported ISTC program. The test facility is located at Forschungszentrum in Karlsruhe. The structure of the test facility allows experimental studies under transient and accident conditions. The ASTEC1.3R2 and ASTECv2 computer codes have been used to simulate the investigated test. The base line input model for ASTEC was provided from Forschungszentrum, Karlsruhe. During the preparation of QUENCH - 12 experiment, the input deck was adapted to new initial and boundary conditions. The comparison show good agreement between measured data and ASTEC calculated results. (author)
Experimental Results of OECD-ATLAS A3.1 Test
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung Wook; Kang, Kyung Ho; Bae, Byoung Uhn; Park, Yu Sun; Choi, Nam Hyun; Kim, Kyung Doo; Choi, Ki Yong [KAERI, Daejeon (Korea, Republic of)
2016-05-15
After the Fukushima accident, design extension conditions (DECs) such as a station black-out (SBO) and a TLOFW attracted a wide international attention in a sense that such high-risk multiple failure accidents should be revisited from a viewpoint of the reinforcement of the 'defense in depth' concept. In particular, a TLOFW event has been considered as one of the typical beyond design basis accident (bDBA) in a safety analysis of the pressurized water reactors. From a conservative point of view, however, failure of the active safety components needs to be considered in the safety analysis. During a TLOFW accident the most effective safety-related active components are the safety injection pumps (SIPs) and the pilot-operated safety relief valves (POSRVs) which are used in a feed and bleed operation. OECD-ATLAS A3.1 test was performed to simulate a TLOFW with additional failures such as partial failure of the SIPs and POSRVs. This test was performed with two temporal phases with an aim of investigating the effect of feed and bleed operation as an accident mitigation measure. Major findings of the A3.1 test are summarized as follows: - Following the termination of the feedwater supply, the SGs became dried out due to the cyclic opening and closing of the MSSVs. However, the coolant discharge from the secondary side of steam generators through MSSVs resulted in removing the decay heat and establishing the natural circulation in the primary system. - A large coolant inventory loss of the primary system through the POSRV during a feed and bleed operation resulted in a reduction of the core collapsed level but the minimum core level was still above the top of the active core. As a result, the excursion of the maximum PCT was not observed.
Drilling and testing specifications for RRL-6, RRL-14, RRL-15 and DC-3
International Nuclear Information System (INIS)
Moak, D.J.
1982-07-01
RRL-6, RRL-14, RRL-15, and DC-3 will provide data for characterization of the stratigraphy and intraflow structures in the Reference Repository Location. This test specification includes details for the drilling and testing of the boreholes. It includes the predicted stratigraphy, the drilling requirements, description of tests to be conducted, intervals selected for hydrologic testing and a schedule of the drilling and testing activities. 14 refs., 8 figs., 12 tabs
3D Modeling and Simulation for Electromagnetic Non-Destructive Testing- Problems and Limitations
International Nuclear Information System (INIS)
Ilham Mukriz Zainal Abidin; Nurul Ain Ahmad Latif
2011-01-01
Non-Destructive Testing (NDT) plays a critical role in nuclear power plants (NPPs) for life cycle management; such testing requires specialists with various NDT related expertise with specific equipment. This paper will discuss the importance of 3D modeling and simulation for electromagnetic NDT for critical and complex components in terms of engineering reasoning and physical trials. Results from simulation are presented which show the link established between the measurements and information relating to defects, such as 3D shape, size and location, which facilitates not only forward problem but also inverse modeling involving experimental system specification and configuration; and pattern recognition for 3D defect information. Subsequently, the problems and limitations pertinent to 3D modeling and simulation are then highlighted and areas of improvement are discussed. (author)
Communication Test for ‘MatrikonOPC Server for SCADA DNP 3’ with RTDS
DEFF Research Database (Denmark)
Wu, Qiuwei; Cha, Seung-Tae; Saleem, Arshad
2010-01-01
The purpose of the communication test for ‘MatrikonOPC server for SCADA DNP 3’ with RTDS is to verify the data exchange between the ‘MatrikonOPC server for SCADA DNP 3’ and the RTDS using the DNP 3 protocol.The communication test is part of the work for the ‘Wind in Øresund’ project. The objective...... of the ‘Wind in Øresund’ project is to build a demonstration and education system of power system operation and control with a RTDS and a SCADA system....
Accelerated Leach Testing of GLASS: ALTGLASS Version 3.0
Energy Technology Data Exchange (ETDEWEB)
Trivelpiece, Cory L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jantzen, Carol M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Crawford, Charles L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2016-12-31
The Accelerated Leach Testing of GLASS (ALTGLASS) database is a collection of data from short- and long-term product consistency tests (PCT, ASTM C1285 A and B) on high level waste (HLW) as well as low activity waste (LAW) glasses. The database provides both U.S. and international researchers with an archive of experimental data for the purpose of studying, modeling, or validating existing models of nuclear waste glass corrosion. The ALTGLASS database is maintained and updated by researchers at the Savannah River National Laboratory (SRNL). This newest version, ALTGLASS Version 3.0, has been updated with an additional 503 rows of data representing PCT results from corrosion experiments conducted in the United States by the Savannah River National Laboratory, Pacific Northwest National Laboratory, Argonne National Laboratory, and the Vitreous State Laboratory (SRNL, PNNL, ANL, VSL, respectively) as well as the National Nuclear Laboratory (NNL) in the United Kingdom.
Accelerated Leach Testing of GLASS: ALTGLASS Version 3.0
International Nuclear Information System (INIS)
Trivelpiece, Cory L.; Jantzen, Carol M.; Crawford, Charles L.
2016-01-01
The Accelerated Leach Testing of GLASS (ALTGLASS) database is a collection of data from short- and long-term product consistency tests (PCT, ASTM C1285 A and B) on high level waste (HLW) as well as low activity waste (LAW) glasses. The database provides both U.S. and international researchers with an archive of experimental data for the purpose of studying, modeling, or validating existing models of nuclear waste glass corrosion. The ALTGLASS database is maintained and updated by researchers at the Savannah River National Laboratory (SRNL). This newest version, ALTGLASS Version 3.0, has been updated with an additional 503 rows of data representing PCT results from corrosion experiments conducted in the United States by the Savannah River National Laboratory, Pacific Northwest National Laboratory, Argonne National Laboratory, and the Vitreous State Laboratory (SRNL, PNNL, ANL, VSL, respectively) as well as the National Nuclear Laboratory (NNL) in the United Kingdom.
Irradiation of MEU and LEU test fuel elements in DR 3
International Nuclear Information System (INIS)
Haack, K.
1984-01-01
Irradiation of three MEU and three LEU fuel elements in the Danish reactor DR 3. Thermal and fast neutron flux density scans of the core have been made and the results, related to the U235-content of each fuel element, are compared with the values from HEU fuel elements. The test elements were taken to burn-up percentages of 50-60%. Reactivity values of the test elements at charge and at discharge have been measured and the values are compared with those of HEU fuel elements. (author)
Results from the Astronomy Diagnostic Test: 3 Years at MiraCosta College
Sirbaugh French, Rica
2007-12-01
The Astronomy Diagnostic Test 2.0 (ADT) was administered to 26 sections of ASTR 101 at MiraCosta College (MCC) from fall 2004 through summer 2007. MiraCosta is a two-year community college located in Oceanside, CA, USA (roughly 40 miles north of San Diego) with an enrollment of approximately 11,000 students. ASTR 101 is MiraCosta's introductory astronomy survey course for non-science majors and has no math prerequisite. Class sizes ranged from 10 to 38 students. Comparison with the ADT National Project results indicates similar pre- and post-course averages: 31.8% (MCC) vs. 32.4% (National) for pre-course tests and 49.3% (MCC) vs. 47.3% (National) for post-course tests. The sample sizes are 709 and 530 students for the pre- and post-tests, respectively. The normalized gain for the entire data set is 0.256 and the effect size (ES) is 1.04, meaning that approximately 85% of the post-test scores are above the average of the pre-test scores. Previous studies have shown the ADT to be a reliable indicator of pre-course misconceptions while post-course scores are useful for comparing modes of instruction and assessing student learning on a limited number of concepts. Additional analyses of the MCC data probe for trends with variables such as gender, class size, and implementation of materials designed for a more "learner-centered” approach (such as Lecture Tutorials, Ranking Tasks, and Think-Pair-Share questions), as well as gains for a particular subset of concepts.
The earth's ring current - Present situation and future thrusts
Williams, D. J.
1987-01-01
Particle distributions, currents, and the ring current situation prior to the August 1984 launch of the AMPTE Charge Composition Explorer (CCE) are discussed. CCE results which demonstrate the capability of these new measurements to pursue questions of ring current sources, energization, and transport are presented. Consideration is given to various ring current generation mechanisms which have been discussed in the literature, and a two-step generation process which to a certain extent unifies the previous mechanisms is presented. The first in-situ global observations of ring current decay as obtained through the detection of energetic neutral atoms generated by charge exchange interactions between the ring current and hydrogen geocorona are discussed, as well as the possibility of using the detection of energetic neutral atoms to obtain global images of the earth's ring current.
International Nuclear Information System (INIS)
Jacob, J.D.; Cattell, C.
1993-01-01
This paper presents preliminary analysis of six flux transfer events which were observed simultaneously by IRM and CCE. IRM was able to measure magnetic fields and pressures far from the earth, while CCE made observations at the earth's magnetopause. The objective is to better understand the coupling of energy and momentum into the earth's magnetosphere, by in this case trying to better understand the processes active in flux transfer events. For three of the events the observations were made on common field lines, and IRM observed fluctuations in B z large enough to cause a south to north swing in the interplanetary magnetic field (IMF). Pressure pulses were observed during two of these events. For the other three events there was no such consistent behavior of IMF direction or pressure pulses
World-Wide Benchmarking of ITER Nb$_{3}$Sn Strand Test Facilities
Jewell, MC; Takahashi, Yoshikazu; Shikov, Alexander; Devred, Arnaud; Vostner, Alexander; Liu, Fang; Wu, Yu; Jewell, Matthew C; Boutboul, Thierry; Bessette, Denis; Park, Soo-Hyeon; Isono, Takaaki; Vorobieva, Alexandra; Martovetsky, Nicolai; Seo, Kazutaka
2010-01-01
The world-wide procurement of Nb$_{3}$Sn and NbTi for the ITER superconducting magnet systems will involve eight to ten strand suppliers from six Domestic Agencies (DAs) on three continents. To ensure accurate and consistent measurement of the physical and superconducting properties of the composite strand, a strand test facility benchmarking effort was initiated in August 2008. The objectives of this effort are to assess and improve the superconducting strand test and sample preparation technologies at each DA and supplier, in preparation for the more than ten thousand samples that will be tested during ITER procurement. The present benchmarking includes tests for critical current (I-c), n-index, hysteresis loss (Q(hys)), residual resistivity ratio (RRR), strand diameter, Cu fraction, twist pitch, twist direction, and metal plating thickness (Cr or Ni). Nineteen participants from six parties (China, EU, Japan, South Korea, Russia, and the United States) have participated in the benchmarking. This round, cond...
Gravitational wave extraction based on Cauchy-characteristic extraction and characteristic evolution
Energy Technology Data Exchange (ETDEWEB)
Babiuc, Maria [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Szilagyi, Bela [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Max-Planck-Institut fuer Gravitationsphysik, Albert-Einstein-Institut, Am Muehlenberg 1, D-14476 Golm (Germany); Hawke, Ian [Max-Planck-Institut fuer Gravitationsphysik, Albert-Einstein-Institut, Am Muehlenberg 1, D-14476 Golm (Germany); School of Mathematics, University of Southampton, Southampton SO17 1BJ (United Kingdom); Zlochower, Yosef [Department of Physics and Astronomy, and Center for Gravitational Wave Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States)
2005-12-07
We implement a code to find the gravitational news at future null infinity by using data from a Cauchy code as boundary data for a characteristic code. This technique of Cauchy-characteristic extraction (CCE) allows for the unambiguous extraction of gravitational waves from numerical simulations. We first test the technique on non-radiative spacetimes: Minkowski spacetime, perturbations of Minkowski spacetime and static black hole spacetimes in various gauges. We show the convergence and limitations of the algorithm and illustrate its success in cases where other wave extraction methods fail. We further apply our techniques to a standard radiative test case for wave extraction, a linearized Teukolsky wave, presenting our results in comparison to the Zerilli technique, and we argue for the advantages of our method of extraction.
Manufacture and Test of a Small Ceramic-Insulated Nb$_{3}$Sn Split Solenoid
Bordini, B; Rossi, L; Tommasini, D
2008-01-01
A small split solenoid wound with high-Jc Nb$_{3}$Sn conductor, constituted by a 0.8 mm Rod Re-stack Process (RRP®) strand, was built and tested at CERN in order to study the applicability of: 1) ceramic wet glass braid insulation without epoxy impregnation of the magnet; 2) a new heat treatment devised at CERN and particularly suitable for reacting RRP® Nb$_{3}$Sn strands. This paper briefly describes the solenoid and the experimental results obtained during 4.4 K and 1.9 K tests. The split solenoid consists of two coils (25 mm inner diameter, 51.1 mm outer diameter, 12.9 mm height). The coils were initially separately tested, in an iron mirror configuration, and then tested together in split solenoid configuration. In all the tests at 4.4 K the coils reached a current higher than 95 % of their short sample limits at the first quench; in split solenoid configuration the maximum field values in the coils and in the aperture were respectively 10.7 T and 12.5 T. At 1.9 K the coils had premature quenches due ...
CENRTC Project number-sign 2F3EOA, OCB A-376, acceptance test procedure
International Nuclear Information System (INIS)
Akerson, A.W.
1995-01-01
This test procedure provides the steps necessary to verify correct functional operation of controls, annunciators, alarms, protective relays and related systems impacted by CENRTC number-sign 2F3E0A, Microwave Transfer Trip Project, modification work performed under work package 6B-93-00041/M. This procedure separates three tests into separate sections: energization of A-376 duplex panel and circuits; SCADA tests; and A-376 local trip tests
Long-term field test of solar PV power generation using one-axis 3-position sun tracker
Huang, B.J.; Ding, W.L.; Huang, Y.C.
2011-01-01
The 1 axis-3 position (1A-3P) sun tracking PV was built and tested to measure the daily and long-term power generation of the solar PV system. A comparative test using a fixed PV and a 1A-3P tracking PV was carried out with two identical stand
Korhonen, Johan; Nyroos, Mikaela; Jonsson, Bert; Eklöf, Hanna
2018-01-01
The aim of this study was to investigate the interplay between test anxiety and working memory (WM) on mathematics performance in younger children. A sample of 624 grade 3 students completed a test battery consisting of a test anxiety scale, WM tasks and the Swedish national examination in mathematics for grade 3. The main effects of test anxiety…
LOFT/L3-6, Loss of Fluid Test, 6. NRC L3 Small Break LOCA Experiment
International Nuclear Information System (INIS)
1992-01-01
1 - Description of test facility: The LOFT Integral Test Facility is a scale model of a LPWR. The intent of the facility is to model the nuclear, thermal-hydraulic phenomena which would take place in a LPWR during a LOCA. The general philosophy in scaling coolant volumes and flow areas in LOFT was to use the ratio of the LOFT core [50 MW(t)] to a typical LPWR core [3000 MW(t)]. For some components, this factor is not applied; however, it is used as extensively as practical. In general, components used in LOFT are similar in design to those of a LPWR. Because of scaling and component design, the LOFT LOCA is expected to closely model a LPWR LOCA. 2 - Description of test: This was the sixth in the NRC L3 Series of small-break LOCA experiments. A 10-cm (2.5-in.) cold-leg non-communicative-break LOCA was simulated. Pumps were running. The experiment was conducted on 10 December 1980
LOFT/L3-5, Loss of Fluid Test, 5. NRC L3 Small Break LOCA Experiment
International Nuclear Information System (INIS)
1991-01-01
1 - Description of test facility: The LOFT Integral Test Facility is a scale model of a LPWR. The intent of the facility is to model the nuclear, thermal-hydraulic phenomena which would take place in a LPWR during a LOCA. The general philosophy in scaling coolant volumes and flow areas in LOFT was to use the ratio of the LOFT core [50 MW(t)] to a typical LPWR core [3000 MW(t)]. For some components, this factor is not applied; however, it is used as extensively as practical. In general, components used in LOFT are similar in design to those of a LPWR. Because of scaling and component design, the LOFT LOCA is expected to closely model a LPWR LOCA. 2 - Description of test: This was the fifth in the NRC L3 Series of small-break LOCA experiments. A 10-cm (2.5-in.) cold-leg non-communicative-break LOCA was simulated. Pumps were shut off. The experiment was conducted on 29 September 1980
TASK 3: PILOT PLANT GASIFIER TESTING
Energy Technology Data Exchange (ETDEWEB)
Fusselman, Steve
2015-11-01
Aerojet Rocketdyne (AR) has developed an innovative gasifier concept incorporating advanced technologies in ultra-dense phase dry feed system, rapid mix injector, and advanced component cooling to significantly improve gasifier performance, life, and cost compared to commercially available state-of-the-art systems. Design, fabrication and initial testing of the pilot plant compact gasifier was completed in 2011 by a development team led by AR. Findings from this initial test program, as well as subsequent gasifier design and pilot plant testing by AR, identified a number of technical aspects to address prior to advancing into a demonstration-scale gasifier design. Key among these were an evaluation of gasifier ability to handle thermal environments with highly reactive coals; ability to handle high ash content, high ash fusion temperature coals with reliable slag discharge; and to develop an understanding of residual properties pertaining to gasification kinetics as carbon conversion approaches 99%. The gasifier did demonstrate the ability to withstand the thermal environments of highly reactive Powder River Basin coal, while achieving high carbon conversion in < 0.15 seconds residence time. Continuous operation with the high ash fusion temperature Xinyuan coal was demonstrated in long duration testing, validating suitability of outlet design as well as downstream slag discharge systems. Surface area and porosity data were obtained for the Xinyuan and Xinjing coals for carbon conversion ranging from 85% to 97%, and showed a pronounced downward trend in surface area per unit mass carbon as conversion increased. Injector faceplate measurements showed no incremental loss of material over the course of these experiments, validating the commercially traceable design approach and supportive of long injector life goals. Hybrid testing of PRB and natural gas was successfully completed over a wide range of natural gas feed content, providing test data to anchor predictions
Development of 3-Pin Fuel Test Loop and Utilization Technology
International Nuclear Information System (INIS)
Lee, Chung Young; Sim, B. S.; Lee, C. Y.
2007-06-01
The principal contents of this project are to design, fabricate and install the steady-state fuel test loop in HANARO for nuclear technology development. Procurement and, fabrication of main equipment, licensing and installation for fuel test loop have been performed. Following contents are described in the report. 1. Design - Design of the In-pile system and Out pile system 2. Fabrication and procurement of the equipment - Fabrication of the In-pile system and In-pool piping - Fabrication and procurement of the equipment of the out-pile system 3. Acquisition of the license - Preparation of the safety analysis report and acquisition of the license - Pre-service inspection of the facility 4. Installation and commissioning - Installation of the FTL - Development of the commissioning procedure
TRAC posttest calculations of Semiscale Test S-06-3
International Nuclear Information System (INIS)
Ireland, J.R.; Bleiweis, P.B.
1980-01-01
A comparison of Transient Reactor Analysis Code (TRAC) steady-state and transient results with Semiscale Test S-06-3 (US Standard Problem 8) experimental data is discussed. The TRAC model used employs fewer mesh cells than normal data comparison models so that TRAC's ability to obtain reasonable results with less computer time can be assessed. In general, the TRAC results are in good agreement with the data and the major phenomena found in the experiment are reproduced by the code with a substantial reduction in computing times
Vertical and horizontal test results of 3.9-GHz accelerating cavities at FNAL
Energy Technology Data Exchange (ETDEWEB)
Khabiboulline, T.; Edwards, H.; Foley, M.; Harms, E.; Hocker, James Andrew; Mitchell, D.; Rowe, A.; Solyak, N.; /Fermilab
2008-06-01
The 3rd harmonic 3.9GHz accelerating cavity was proposed to improve the beam performance of the VUV FEL, FLASH. In the frame of a collaborative agreement, Fermilab will provide DESY with a cryomodule containing a string of four cavities. Seven 9-cell Nb cavities were tested and six of them did reach accelerating gradient up to 24 MV/m almost twice more than design value of 14 MV/m. Two of these cavities are with new HOM couplers with improved design. In this paper we present all results of the vertical and horizontal tests.
International Nuclear Information System (INIS)
Kim, Shin Whan; Lee, Joo Han; Baek, Jong Man; Seo, Jong Tae; Lee, Sang Keun; Kang, In Koo; Ju, Hee Wan; Min, Kyung Soo; Kim, Byung Gon
1995-01-01
Control system checkout tests at various powers for Yonggwang Nuclear Power Plant Unit 3(YGN3) were performed to demonstrate the accuracies and proper performances of the control systems of the plant. Tested control systems included the feedwater control system, steam bypass control system, reactor regulation system, control element drive mechanism control system, pressurizer level control system, and pressurizer pressure control system. The measured test data during the control system checkout test at 100% power are evaluated. The test results showed that the control systems of YGN 3 properly control system was simulated by using the LTC code which is the performance analysis code for YGN 3 and 4 design. Comparisons of the predicted results with the measured data confirmed that the feedwater control system controls the steam generator level as designed
International Nuclear Information System (INIS)
Kistler, L.M.
1987-01-01
Using the University of Maryland/Max Planck Institute for Aeronomy Charge Energy Mass (CHEM) spectrometer on the AMPTE Charge Composition Explorer (CCE) spacecraft, the author examined the near-equatorial storm-time energy spectra of four major magnetospheric ions, H + , O + , He + , and He ++ over the energy range 1-300 keV/e in the L-range 3-6. The data were obtained during the main phase of all geomagnetic storms with minimum Dst less than -50 in the time period September 1984 to November 1985. During this period, the orbit of the CCE precessed such that the full range of local times was covered. When the spectra are organized by local time, certain features emerge. In particular, there is a dip in the spectra of all ions at 10-20 keV/e in the drawn-to-noon sector, while in the noon-to-dusk sector the proton distribution function drops off sharply below ∼5 keV. These spectra were compared with those predicted by a model of ion drift and loss in the magnetosphere. It was found that the spectra are most consistent with a Volland-Stern electric field with γ = 2 and with a rotation of the nominal dawn-to-dusk electric field eastward by two hours local time
Elemental Water Impact Test: Phase 3 Plunge Depth of a 36-Inch Aluminum Tank Head
Vassilakos, Gregory J.
2014-01-01
Spacecraft are being designed based on LS-DYNA water landing simulations. The Elemental Water Impact Test (EWIT) series was undertaken to assess the accuracy of LS-DYNA water impact simulations. Phase 3 featured a composite tank head that was tested at a range of heights to verify the ability to predict structural failure of composites. To support planning for Phase 3, a test series was conducted with an aluminum tank head dropped from heights of 2, 6, 10, and 12 feet to verify that the test article would not impact the bottom of the test pool. This report focuses on the comparisons of the measured plunge depths to LS-DYNA predictions. The results for the tank head model demonstrated the following. 1. LS-DYNA provides accurate predictions for peak accelerations. 2. LS-DYNA consistently under-predicts plunge depth. An allowance of at least 20% should be added to the LS-DYNA predictions. 3. The LS-DYNA predictions for plunge depth are relatively insensitive to the fluid-structure coupling stiffness.
(--Catechin in Cocoa and Chocolate: Occurence and Analysis of an Atypical Flavan-3-ol Enantiomer
Directory of Open Access Journals (Sweden)
Rudolf Galensa
2007-07-01
Full Text Available Cocoa contains high levels of different flavonoids. In the present study, the enantioseparation of catechin and epicatechin in cocoa and cocoa products by chiral capillary electrophoresis (CCE was performed. A baseline separation of the catechin and epicatechin enantiomers was achieved by using 0.1 mol·L−1 borate buffer (pH 8.5 with 12 mmol·L-1 (2-hydroxypropyl-γ-cyclodextrin as chiral selector, a fused-silica capillary with 50 cm effective length (75 μm I.D., +18 kV applied voltage, a temperature of 20°C and direct UV detection at 280 nm. To avoid comigration or coelution of other similar substances, the flavan-3-ols were isolated and purified using polyamide-solid-phase-extraction and LC-MS analysis. As expected, we found (--epicatechin and (+-catechin inunfermented, dried, unroasted cocoa beans. In contrast, roasted cocoa beans and cocoa products additionally contained the atypical flavan-3-ol (--catechin. This is generally formed during the manufacturing process by an epimerization which converts (--epicatechin to its epimer (--catechin. High temperatures during the cocoa bean roasting process and particularly the alkalization of the cocoa powder are the main factors inducing the epimerization reaction. In addition to the analysis of cocoa and cocoa products, peak ratios were calculated for a better differentiation of the cocoa products.
Am/Cm TTR testing - 3/8-inch glass beads evaluation in CIM5
International Nuclear Information System (INIS)
Witt, D. C.
2000-01-01
To facilitate the procurement and handling of the glass former for Am/Cm vitrification in the F-Canyon MPPF, 1/4 inch and 3/8 inch diameter glass beads were purchased from Corning for evaluation in the 5 inch Cylindrical Induction Melter (CIM5). Prior to evaluating the beads in the CIM5, tests were conducted in the Drain Tube Test Stand (DTTS) with 1/4 inch beads, 3/8 inch beads, and a 50/50 mixture to identify any process concerns. Results of the DTTS tests are summarized in Attachment 1. A somewhat larger volume expansion was experienced in all three DTTS runs as compared to a standard run using cullet. Further testing of the use of glass beads in the CIM5 was requested by the Design Authority as Task 1.02 of Technical Task Request 99-MNSS/SE-006. Since the Technical Task Plan was not yet approved, the completion of this task was conducted under an authorization request approved by the SRTC Laboratory Director, S. Wood. This request is included as Attachment 2
International Nuclear Information System (INIS)
Zender, S.N.
1975-03-01
Recorded test data are presented for Test S-01-3 of the semiscale Mod-1 isothermal blowdown test series. Test S-01-3 is one of several semiscale Mod-1 experiments which are counterparts of the planned Loss-of-Fluid Test (LOFT) nonnuclear experiments. System hardware is of the LOFT design, selected using volumetric scaling methods, and initial conditions duplicate those identified for the LOFT nonnuclear tests. Test S-01-3 employed an intact loop resistance that was low relative to that of the first test in the series (Test S-01-2) to establish the importance of intact loop resistance on system response during blowdown. An orificed structure was used in the pressure vessel to simulate the LOFT core simulator. The test was initiated at isothermal conditions of 2245 psig and 538 0 F by a simulated offset shear of the cold-leg broken loop piping. During system depressurization, coolant was injected into the lower plenum of the pressure vessel to provide data on the effects of emergency core cooling on system response. Additionally, to aid in determination of the effects of accumulator gas on pressure suppression system response, the nitrogen used to charge the accumulator systems for Test S-01-3 was allowed to vent into the lower plenum following depletion of the coolant. (U.S.)
Operational Overview for UAS Integration in the NAS Project Flight Test Series 3
Valkov, Steffi B.; Sternberg, Daniel; Marston, Michael
2018-01-01
The National Aeronautics and Space Administration Unmanned Aircraft Systems Integration in the National Airspace System Project has conducted a series of flight tests intended to support the reduction of barriers that prevent unmanned aircraft from flying without the required waivers from the Federal Aviation Administration. The 2015 Flight Test Series 3, supported two separate test configurations. The first configuration investigated the timing of Detect and Avoid alerting thresholds using a radar equipped unmanned vehicle and multiple live intruders flown at varying encounter geometries.
High-throughput 3D spheroid culture and drug testing using a 384 hanging drop array.
Tung, Yi-Chung; Hsiao, Amy Y; Allen, Steven G; Torisawa, Yu-suke; Ho, Mitchell; Takayama, Shuichi
2011-02-07
Culture of cells as three-dimensional (3D) aggregates can enhance in vitro tests for basic biological research as well as for therapeutics development. Such 3D culture models, however, are often more complicated, cumbersome, and expensive than two-dimensional (2D) cultures. This paper describes a 384-well format hanging drop culture plate that makes spheroid formation, culture, and subsequent drug testing on the obtained 3D cellular constructs as straightforward to perform and adapt to existing high-throughput screening (HTS) instruments as conventional 2D cultures. Using this platform, we show that drugs with different modes of action produce distinct responses in the physiological 3D cell spheroids compared to conventional 2D cell monolayers. Specifically, the anticancer drug 5-fluorouracil (5-FU) has higher anti-proliferative effects on 2D cultures whereas the hypoxia activated drug commonly referred to as tirapazamine (TPZ) are more effective against 3D cultures. The multiplexed 3D hanging drop culture and testing plate provides an efficient way to obtain biological insights that are often lost in 2D platforms.
Rapid lymphocyte immunoreactivity test utilizing [3H]uridine in vitro
International Nuclear Information System (INIS)
Pienkowski, M.M.; Lyerly, M.M.; Miller, H.C.
1978-01-01
A microculture assay utilizing [ 3 H]uridine incorporation was developed to test murine spleen lymphocyte immunoreactivity in vitro. Parameters of the culture technique which included cell density, doses of LPS, Con A, PHA, [ 3 H]uridine levels, and length of culture time were investigated. Responses were detectable at 4 h for all 3 mitogens, with labelling ranging up to 180% of the control value. By 8 h there was a 200-350% increase in mitogen-induced incorporation of radioactivity. Similar increases were observed in a serum-free system. The responses were the result of increased incorporation of label by stimulated cultures rather than decreased labeling of non-mitogen treated cultures over time. The [ 3 H]uridine incorporation was demonstrated to be the selective response of T or B cell populations when stimulated with appropriate lectins. This assay detects early RNA synthesis, as supported by experimental observations in which accumulation of radioactivity in stimulated lymphocytes was TCA precipitable, resistant to SDS treatment, and inhibited by actinomycin D. (Auth.)
Development of a test and flight engineering oriented language. Phase 3: Presentation
Kamsler, W. F.; Case, C. W.; Kinney, E. L.; Gyure, J.
1970-01-01
The format material used in an oral presentation of the phase 3 study effort is given. The material includes a description of the language ALOFT and a terminology comparison with other test languages.
International Nuclear Information System (INIS)
Chen Zhenyu; Dai Changsong; Wu Gang; Nelson, Mark; Hu Xinguo; Zhang Ruoxin; Liu Jiansheng; Xia Jicai
2010-01-01
Li 3 V 2 (PO 4 ) 3 /C composite cathode material was synthesized via carbothermal reduction process in a pilot scale production test using battery grade raw materials with the aim of studying the feasibility for their practical applications. XRD, FT-IR, XPS, CV, EIS and battery charge-discharge tests were used to characterize the as-prepared material. The XRD and FT-IR data suggested that the as-prepared Li 3 V 2 (PO 4 ) 3 /C material exhibits an orderly monoclinic structure based on the connectivity of PO 4 tetrahedra and VO 6 octahedra. Half cell tests indicated that an excellent high-rate cyclic performance was achieved on the Li 3 V 2 (PO 4 ) 3 /C cathodes in the voltage range of 3.0-4.3 V, retaining a capacity of 95% (96 mAh/g) after 100 cycles at 20C discharge rate. The low-temperature performance of the cathode was further evaluated, showing 0.5C discharge capacity of 122 and 119 mAh/g at -25 and -40 o C, respectively. The discharge capacity of graphite//Li 3 V 2 (PO 4 ) 3 batteries with a designed battery capacity of 14 Ah is as high as 109 mAh/g with a capacity retention of 92% after 224 cycles at 2C discharge rates. The promising high-rate and low-temperature performance observed in this work suggests that Li 3 V 2 (PO 4 ) 3 /C is a very strong candidate to be a cathode in a next-generation Li-ion battery for electric vehicle applications.
Final report of the borehole, shaft, and tunnel sealing test. Vol. 3
International Nuclear Information System (INIS)
Pusch, R.; Boergesson, L.; Ramqvist, G.
1987-02-01
Like the borehole and shaft plugging tests, the tunnel test gave evidence of the very effective sealing power of Na betonite. The test arrangement consisted of a 9 m long 1.5 m diameter steel tube surrounded by sand and cast in concrete plugs at each end. These plugs contained bentonite forming 'O-ring' sealings at the concrete/rock interface. The test had the form of injecting water into the sand and measuring the leakage that took place through the adjacent rock and along the plug. It was concluded that the drop in leakage from more than 200 l at 100 kPa water pressure early in the test to 75 l at 3 MPa pressure at the end was due partly to the swelling pressure exerted by the bentonite on the rock and by penetration of bentonite into water-bearing rock fractures. The major sealing process appears to be the establishment of a very tight bentonite/rock interface. (orig./HP)
Recent Results from Beam Tests of 3D and Pad pCVD Diamond Detectors
Wallny, Rainer
2017-01-01
Results from prototypes of a detector using chemical vapor deposited (CVD) diamond with embedded resistive electrodes in the bulk forming a 3D diamond device are presented. A detector system consisting of 3D devices based on poly-crystalline CVD (pCVD) diamond was connected to a multi-channel readout and successfully tested in a 120 GeV/c proton beam at CERN proving for the first time the feasibility of the 3D detector concept in pCVD for particle tracking applications. We also present beam test results on the dependence of signal size on incident particle rate in charged particle detectors based on poly-crystalline CVD diamond. The detectors were tested in a 260 MeV/c pion beam over a range of particle fluxes from 2 kHz/cm2 to 10 MHz/cm2 . The pulse height of the sensors was measured with pad readout electronics at a peaking time of 7 ns. Our data from the 2015 beam tests at PSI indicate that the pulse height of poly-crystalline CVD diamond sensor irradiated to 5×1014 neq/cm2 is independent of particle flux...
Results of crack-arrest tests on irradiated a 508 class 3 steel
International Nuclear Information System (INIS)
Iskander, S.K.; Milella, P.P.; Pini, M.A.
1998-02-01
Ten crack-arrest toughness values for irradiated specimens of A 508 class 3 forging steel have been obtained. The tests were performed according to the American Society for Testing and Materials (ASTM) Standard Test Method for Determining Plane-Strain Crack-Arrest Fracture Toughness, K la of Ferritic Steels, E 1221-88. None of these values are strictly valid in all five ASTM E 1221-88 validity criteria. However, they are useful when compared to unirradiated crack-arrest specimen toughness values since they show the small (averaging approximately 10 degrees C) shifts in the mean and lower-bound crack-arrest toughness curves. This confirms that a low copper content in ASTM A 508 class 3 forging material can be expected to result in small shifts of the transition toughness curve. The shifts due to neutron irradiation of the lower bound and mean toughness curves are approximately the same as the Charpy V-notch (CVN) 41-J temperature shift. The nine crack-arrest specimens were irradiated at temperatures varying from 243 to 280 degrees C, and to a fluence varying from 1.7 to 2.7 x 10 19 neutrons/cm 2 (> 1 MeV). The test results were normalized to reference values that correspond to those of CVN specimens irradiated at 284 degrees C to a fluence of 3.2 x 10 19 neutrons/cm 2 (> 1 MeV) in the same capsule as the crack-arrest specimens. This adjustment resulted in a shift to lower temperatures of all the data, and in particular moved two data points that appeared to lie close to or lower than the American Society of Mechanical Engineers K la curve to positions that seemed more reasonable with respect to the remaining data. A special fixture was designed, fabricated, and successfully used in the testing. For reasons explained in the text, special blocks to receive the Oak Ridge National Laboratory clip gage were designed, and greater-than-standard crack-mouth opening displacements measured were accounted for. 24 refs., 13 figs., 12 tabs
Implementation and testing of the CFDS-FLOW3D code
International Nuclear Information System (INIS)
Smith, B.L.
1994-03-01
FLOW3D is a multi-purpose, transient fluid dynamics and heat transfer code developed by Computational Fluid Dynamics Services (CFDS), a branch of AEA Technology, based at Harwell. The code is supplied with a SUN-based operating environment consisting of an interactive grid generator SOPHIA and a post-processor JASPER for graphical display of results. Both SOPHIA and JASPER are extensions of the support software originally written for the ASTEC code, also promoted by CFDS. The latest release of FLOW3D contains well-tested turbulence and combustion models and, in a less-developed form, a multi-phase modelling potential. This document describes briefly the modelling capabilities of FLOW3D (Release 3.2) and outlines implementation procedures for the VAX, CRAY and CONVEX computer systems. Additional remarks are made concerning the in-house support programs which have been specially written in order to adapt existing ASTEC input data for use with FLOW3D; these programs operate within a VAX-VMS environment. Three sample calculations have been performed and results compared with those obtained previously using the ASTEC code, and checked against other available data, where appropriate. (author) 35 figs., 3 tabs., 42 refs
9 CFR 80.3 - Movement of domestic animals that are positive to an official Johne's disease test.
2010-01-01
... positive to an official Johne's disease test. 80.3 Section 80.3 Animals and Animal Products ANIMAL AND... animals that are positive to an official Johne's disease test. (a) Movement of domestic animals for slaughter. Domestic animals that are positive to an official Johne's disease test may be moved interstate...
46 CFR 164.008-3 - Testing procedure.
2010-10-01
... control. (1) The furnace temperature shall be determined by at least four mineral insulated thermocouples... further definition of the time-temperature curve, see Appendix I of the ASTM Standard E119, “Fire Tests of... openings are formed during the test, an ignition test as prescribed in § 164.008-4(b) shall take place...
Energy Technology Data Exchange (ETDEWEB)
Van Zomeren, A.; Dijkstra, J.J. [ECN Environment and Energy Engineering, Petten (Netherlands); Mesman, M.; Spijker, J. [National Institute for Public Health and the Environment RIVM, Bilthoven (Netherlands); Eikelboom, R. [Ministry of Infrastructure and Environment IenM, Den Haag (Netherlands)
2013-10-15
The enforcement of the European Construction Products Directive (and the more actual Construction Products Regulation) has led to the development of European harmonised standards for assessment of the emission of 'dangerous substances' from construction materials. According to Basic Working Requirement (BWR) number 3, the emissions from construction products to soil and groundwater should not have an unacceptable impact on the environmental quality over the life cycle of the product. In this paper the technical needs and boundary conditions of leaching tests to obtain meaningful and reliable test results are explained. Although this paper will not go into detail on 'impact assessment' and the resulting development of regulatory criteria, we will show that the technical needs and boundary conditions of a test are to some extent dependent on what type of information is needed by regulators for environmental impact assessment. This short paper focuses on explaining the principles of testing leaching behaviour of aggregates, and briefly explains the leaching of size reduced and non-size reduced particles. It provides information for the actual discussions on size reduction before leaching tests.
Hasanbeigi, Ali; Lobscheid, Agnes; Lu, Hongyou; Price, Lynn; Dai, Yue
2013-08-01
In 2010, China's cement industry accounted for more than half of the world's total cement production. The cement industry is one of the most energy-intensive and highest carbon dioxide (CO2)-emitting industries, and thus a key industrial contributor to air pollution in China. For example, it is the largest source of particulate matter (PM) emissions in China, accounting for 40% of industrial PM emissions and 27% of total national PM emissions. In this study, we quantify the co-benefits of PM10 and sulfur dioxide (SO2) emission reductions that result from energy-saving measures in the cement industry in Shandong Province, China. We use a modified form of the cost of conserved energy (CCE) equation to incorporate the value of these co-benefits. The results show that more than 40% of the PM and SO2 emission reduction potential of the electricity-saving measures is cost effective even without taking into account the co-benefits for the electricity-saving measures. The results also show that including health benefits from PM10 and/or SO2 emission reductions reduces the CCE of the fuel-saving measures. Two measures that entail changing products (production of blended cement and limestone Portland cement) result in the largest reduction in CCE when co-benefits were included, since these measures can reduce both PM10 and SO2 emissions, whereas the other fuel-saving measures do not reduce PM10. Published by Elsevier B.V.
Testbeam and laboratory test results of irradiated 3D CMS pixel detectors
Energy Technology Data Exchange (ETDEWEB)
Bubna, Mayur [Purdue University, Department of Physics, West Lafayette, IN 47907-1396 (United States); Purdue University, School of Electrical and Computer Engineering, West Lafayette, IN 47907-1396 (United States); Alagoz, Enver, E-mail: enver.alagoz@cern.ch [Purdue University, Department of Physics, West Lafayette, IN 47907-1396 (United States); Cervantes, Mayra; Krzywda, Alex; Arndt, Kirk [Purdue University, Department of Physics, West Lafayette, IN 47907-1396 (United States); Obertino, Margherita; Solano, Ada [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, 10125 Torino (Italy); Dalla Betta, Gian-Franco [INFN Padova (Gruppo Collegato di Trento) (Italy); Dipartimento di Ingegneria e Scienzadella Informazione, Universitá di Trento, I-38123 Povo di Trento (Italy); Menace, Dario; Moroni, Luigi [Istituto Nazionale di Fisica Nucleare, Sezione di Milano Bicocca (Italy); Universitá degli Studi di Milano Bicocca, 20126 Milano (Italy); Uplegger, Lorenzo; Rivera, Ryan [Fermi National Accelerator Laboratory, Batavia, IL 60510-0500 (United States); Osipenkov, Ilya [Texas A and M University, Department of Physics, College Station, TX 77843-4242 (United States); Andresen, Jeff [Fermi National Accelerator Laboratory, Batavia, IL 60510-0500 (United States); Bolla, Gino; Bortoletto, Daniela [Purdue University, Department of Physics, West Lafayette, IN 47907-1396 (United States); Boscardin, Maurizio [Centro per i Materiali e i Microsistemi Fondazione Bruno Kessler (FBK), Trento, I-38123 Povo di Trento (Italy); Marie Brom, Jean [Strasbourg IPHC, Institut Pluriedisciplinaire Hubert Curien, F-67037 Strasbourg Cedex (France); Brosius, Richard [State University of New York at Buffalo (SUNY), Department of Physics, Buffalo, NY 14260-1500 (United States); Chramowicz, John [Fermi National Accelerator Laboratory, Batavia, IL 60510-0500 (United States); and others
2013-12-21
The CMS silicon pixel detector is the tracking device closest to the LHC p–p collisions, which precisely reconstructs the charged particle trajectories. The planar technology used in the current innermost layer of the pixel detector will reach the design limit for radiation hardness at the end of Phase I upgrade and will need to be replaced before the Phase II upgrade in 2020. Due to its unprecedented performance in harsh radiation environments, 3D silicon technology is under consideration as a possible replacement of planar technology for the High Luminosity-LHC or HL-LHC. 3D silicon detectors are fabricated by the Deep Reactive-Ion-Etching (DRIE) technique which allows p- and n-type electrodes to be processed through the silicon substrate as opposed to being implanted through the silicon surface. The 3D CMS pixel devices presented in this paper were processed at FBK. They were bump bonded to the current CMS pixel readout chip, tested in the laboratory, and testbeams carried out at FNAL with the proton beam of 120 GeV/c. In this paper we present the laboratory and beam test results for the irradiated 3D CMS pixel devices. -- Highlights: •Pre-irradiation and post-irradiation electrical properties of 3D sensors and 3D diodes from various FBK production batches were measured and analyzed. •I–T measurements of gamma irradiated diodes were analyzed to understand leakage current generation mechanism in 3D diodes. •Laboratory measurements: signal to noise ratio and charge collection efficiency of 3D sensors before and after irradiation. •Testbeam measurements: pre- and post-irradiation pixel cell efficiency and position resolution of 3D sensors.
Application study of EPICS-based redundant method for reactor control system
International Nuclear Information System (INIS)
Zhang Ning; Han Lifeng; Chen Yongzhong; Guo Bing; Yin Congcong
2013-01-01
In the reactor control system prototype development of TMSR (Thorium Molten Salt Reactor system, CAS) project, EPICS (Experimental Physics and Industrial Control System) is adopted as Instrument and Control software platform. For the aim of IOC (Input/Output Controller) redundancy and data synchronization of the system, the EPICS-based RMT (Redundancy Monitor Task ) software package and its data-synchronization component CCE (Continuous Control Executive) were introduced. By the development of related IOC driver, redundant switch-over control of server IOC was implemented. The method of redundancy implementation using RMT in server and redundancy performance test for power control system are discussed in this paper. (authors)
Validation of JENDL-3.3 by criticality benchmark testing
International Nuclear Information System (INIS)
Takano, Hideki; Nakagawa, Tsuneo
2001-01-01
In the thermal uranium core, the keff-values of STACY, TRACY and JRR-4 overestimated with JENDL-3.2 were improved significantly by decreasing of about 0.6% with JENDL-3.3. This is due to modification of the fission spectrum and thermal fission cross section of 235 U from JENDL-3.2 to JENDL-3.3 data. For the uranium fast cores, the discrepancies of keff values between JENDL-3.2 and 3.3 were very small. In the thermal Pu cores of TCA, the keff-values calculated with JENDL-3.3 were in good agreement with the experimental values. For Pu fuel cores of ZPPR-9 and FCA-XVII, the keff values calculated with JENDL-3.3 became larger 0.2% than those for JENDL-3.2. In small fast cores with U-233 fuel, the keff-values overestimated with JENDL-3.2 were improved considerably with JENDL-3.3, due to reevaluation of U-233 fission cross sections in the high energy region. (author)
Characterization of semiconductor and frontier materials by nuclear microprobe technology
International Nuclear Information System (INIS)
Zhu Jieqing; Li Xiaolin; Yang Changyi; Lu Rongrong; Wang Jiqing; Guo Panlin
2002-01-01
The nuclear microprobe technology is used to characterize the properties of semiconductor and other frontier materials at the stages of their synthesis, modification, integration and application. On the basis of the beam current being used, the analytical nuclear microprobe techniques being used in this project can be divided into two categories: high beam current (PIXE, RBS, PEB) or low beam current (IBIC, STIM) techniques. The material properties measured are the thickness and composition of a composite surface on a SiC ceramic, the sputtering-induced surface segregation and depth profile change in a Ag-Cu binary alloy, the irradiation effects on the CCE of CVD diamond, the CCE profile at a polycrystalline CVD diamond film and a GaAs diode at different voltage biases and finally, the characterization of individual sample on an integrated material chip. (author)
Electromagnetic ion cyclotron waves observed in the plasma depletion layer
Anderson, B. J.; Fuselier, S. A.; Murr, D.
1991-01-01
Observations from AMPTE/CCE in the earth's magnetosheath on October 5, 1984 are presented to illustrate 0.1 - 4.0 Hz magnetic field pulsations in the subsolar plasma depletion layer (PDL) for northward sheath field during a magnetospheric compression. The PDL is unambiguously identified by comparing CCE data with data from IRM in the upstream solar wind. Pulsations in the PDL are dominated by transverse waves with F/F(H+) 1.0 or less and a slot in spectral power at F/F(H+) = 0.5. The upper branch is left hand polarized while the lower branch is linearly polarized. In the sheath the proton temperature anisotropy is about 0.6 but it is about 1.7 in the PDL during wave occurrence. The properties and correlation of waves with increased anisotropy indicate that they are electromagnetic ion cyclotron waves.
International Nuclear Information System (INIS)
Correa, P.N.; Bard, V.; Axelrad, A.A.
1990-01-01
We have used countercurrent centrifugal elutriation (CCE) to determine the distribution of cells with respect to cell volume and buoyant density for an erythroleukemia cell line (JG6) transformed by the polycythemia strain of Friend virus (FV-P), and to determine the effect of inducing the cells to differentiate with dimethylsulfoxide (DMSO) on this distribution. CCE made it possible to obtain suspensions of modal JG6 populations virtually free of dead cells and uniform with respect to volume and buoyant density. These modal populations were assayed for specific binding of erythropoietin (Epo). Between 500 and 550 Epo receptors per cell were detected. These belonged to a single class having a dissociation constant of 0.36 nM. DMSO induction of differentiation of the JG6 cells had no effect on the number of Epo receptors expressed
International Nuclear Information System (INIS)
Horiuchi, Rie; Akimoto, Takayuki; Hong, Zhang; Ushida, Takashi
2012-01-01
Mechanical strain has been reported to affect the proliferation/differentiation of many cell types; however, the effects of mechanotransduction on self-renewal as well as pluripotency of embryonic stem (ES) cells remains unknown. To investigate the effects of mechanical strain on mouse ES cell fate, we examined the expression of Nanog, which is an essential regulator of self-renewal and pluripotency as well as Nanog-associated intracellular signaling during uniaxial cyclic mechanical strain. The mouse ES cell line, CCE was plated onto elastic membranes, and we applied 10% strain at 0.17 Hz. The expression of Nanog was reduced during ES cell differentiation in response to the withdrawal of leukemia inhibitory factor (LIF); however, two days of cyclic mechanical strain attenuated this reduction of Nanog expression. On the other hand, the cyclic mechanical strain promoted PI3K-Akt signaling, which is reported as an upstream of Nanog transcription. The cyclic mechanical strain-induced Akt phosphorylation was blunted by the PI3K inhibitor wortmannin. Furthermore, cytochalasin D, an inhibitor of actin polymerization, also inhibited the mechanical strain-induced increase in phospho-Akt. These findings imply that mechanical force plays a role in regulating Nanog expression in ES cells through the actin cytoskeleton-PI3K-Akt signaling. -- Highlights: ► The expression of Nanog, which is an essential regulator of “stemness” was reduced during embryonic stem (ES) cell differentiation. ► Cyclic mechanical strain attenuated the reduction of Nanog expression. ► Cyclic mechanical strain promoted PI3K-Akt signaling and mechanical strain-induced Akt phosphorylation was blunted by the PI3K inhibitor and an inhibitor of actin polymerization.
Roberts, B. C.; Carrasquillo, R. L.; Dubiel, M. Y.; Ogle, K. Y.; Perry, J. L.; Whitley, K. M.
1990-01-01
A description of the phase 3 simplified integrated test (SIT) conducted at the Marshall Space Flight Center (MSFC) Core Module Integration Facility (CMIF) in 1989 is presented. This was the first test in the phase 3 series integrated environmental control and life support systems (ECLSS) tests. The basic goal of the SIT was to achieve full integration of the baseline air revitalization (AR) subsystems for Space Station Freedom. Included is a description of the SIT configuration, a performance analysis of each subsystem, results from air and water sampling, and a discussion of lessons learned from the test. Also included is a full description of the preprototype ECLSS hardware used in the test.
3D printed drug delivery and testing systems - a passing fad or the future?
Lim, Seng Han; Kathuria, Himanshu; Tan, Justin Jia Yao; Kang, Lifeng
2018-05-18
The US Food and Drug Administration approval of the first 3D printed tablet in 2015 has ignited growing interest in 3D printing, or additive manufacturing (AM), for drug delivery and testing systems. Beyond just a novel method for rapid prototyping, AM provides key advantages over traditional manufacturing of drug delivery and testing systems. These includes the ability to fabricate complex geometries to achieve variable drug release kinetics; ease of personalising pharmacotherapy for patient and lowering the cost for fabricating personalised dosages. Furthermore, AM allows fabrication of complex and micron-sized tissue scaffolds and models for drug testing systems that closely resemble in vivo conditions. However, there are several limitations such as regulatory concerns that may impede the progression to market. Here, we provide an overview of the advantages of AM drug delivery and testing, as compared to traditional manufacturing techniques. Also, we discuss the key challenges and future directions for AM enabled pharmaceutical applications. Copyright © 2018 Elsevier B.V. All rights reserved.
GfW-handbook for data compilation of irradiation tested electronic components. Vol. 3
International Nuclear Information System (INIS)
Wulf, F.; Braeunig, D.; Boden, A.
1984-05-01
The 2nd edition is a continuation of the 1st edition and is published as a loose-leaf handbook. The 1st edition contained 190 test reports. In the volume 1 and volume 2 of the 2nd edition 120 test reports have been published so far. The present volume 3 of the 2nd edition provides further 53 test reports. These test reports of currently in space projects used electronic components have a standardized format. The results are given in a comprehensive but easily to handle graphical and tabular presentation. Statistical values are given in order to facilitate the components life time evaluation in a radiative environment. (orig./HP) [de
Directory of Open Access Journals (Sweden)
Erdem Carsanba
2018-04-01
Full Text Available The purpose of this study was to investigate optimum test conditions of acoustical-mechanical measurement of wafer analysed by Acoustic Envelope Detector attached to the Texture Analyser. Force-displacement and acoustic signals were simultaneously recorded applying two different methods (3-point bending and cutting test. In order to study acoustical-mechanical behaviour of wafers, the parameters “maximum sound pressure”, “total count peaks” and “mean sound value” were used and optimal test conditions of microphone position and test speed were examined. With a microphone position of 45° angle and 1 cm distance and at a low test speed of 0.5 mm/s wafers of different quality could be distinguished best. The angle of microphone did not have significant effect on acoustic results and the number of peaks of the force and acoustic signal decreased with increasing distance and test speed.
An Injector for the CLIC Test Facility (CTF3)
Braun, H; Rinolfi, Louis; Zhou, F; Mouton, B; Miller, R; Yeremian, A D
2000-01-01
The CLIC Test Facility (CTF3) is an intermediate step to demonstrate the technical feasibility of the key concepts of the new RF power source for CLIC. CTF3 will use electron beams with an energy range adjustable from 170 MeV (3.5 A) to 380 MeV (with low current). The injector is based on a thermionic gun followed by a classical bunching system embedded in a long solenoidal field. As an alternative, an RF photo-injector is also being studied. The beam dynamics studies on how to reach the stringent beam parameters at the exit of the injector are presented. Simulations performed with the EGUN code showed that a current of 7 A can be obtained with an emittance less than 10 mm.mrad at the gun exit. PARMELA results are presented and compared to the requested beam performance at the injector exit. Sub-Harmonic Bunchers (SHB) are foreseen, to switch the phase of the bunch trains by 180 degrees from even to odd RF buckets. Specific issues of the thermionic gun and of the SHB with fast phase switch are discussed.
An Injector for the CLIC Test Facility (CTF3)
International Nuclear Information System (INIS)
Miller, Roger H.
2001-01-01
The CLIC Test Facility (CTF3) is an intermediate step to demonstrate the technical feasibility of the key concepts of the new RF power source for CLIC. CTF3 will use electron beams with an energy range adjustable from 170 MeV (3.5 A) to 380 MeV (with low current). The injector is based on a thermionic gun followed by a classical bunching system embedded in a long solenoidal field. As an alternative, an RF photo-injector is also being studied. The beam dynamics studies on how to reach the stringent beam parameters at the exit of the injector are presented. Simulations performed with the EGUN code showed that a current of 7 A can be obtained with an emittance less than 10 mm.mrad at the gun exit. PARMELA results are presented and compared to the requested beam performance at the injector exit. Sub-Harmonic Bunchers (SHB) are foreseen, to switch the phase of the bunch trains by 180 degrees from even to odd RF buckets. Specific issues of the thermionic gun and of the SHB with fast phase switch are discussed
An injector for the CLIC test Facility (CTF3)
Braun, Hans-Heinrich; Rinolfi, L.; Zhou, F.; Mouton, B.; Miller, R.; Yeremian, D.
2008-01-01
The CLIC Test Facility (CTF3) is an intermediate step to demonstrate the technical feasibility of the key concepts of the new RF power source for CLIC. CTF3 will use electron beams with an energy range adjustable from 170 MeV (3.5 A) to 380 MeV (with low current). The injector is based on a thermionic gun followed by a classical bunching system embedded in a long solenoidal field. As an alternative, an RF photo-injector is also being studied. The beam dynamics studies on how to reach the stringent beam parameters at the exit of the injector are presented. Simulations performed with the EGUN code showed that a current of 7 A can be obtained with an emittance less than 10 mm.mrad at the gun exit. PARMELA results are presented and compared to the requested beam performance at the injector exit. Sub-Harmonic Bunchers (SHB) are foreseen, to switch the phase of the bunch trains by 180 degrees from even to odd RF buckets. Specific issues of the thermionic gun and of the SHB with fast phase switch are discussed.
The 3rd irradiation test plan of DUPIC fuel
Energy Technology Data Exchange (ETDEWEB)
Yang, Myung Seung; Song, K. C.; Park, J. H. and others
2001-05-01
The objective of the 3rd irradiation test of DUPIC fuel at the HANARO is to estimate the in-core behaviour of a DUPIC pellet that is irradiated up to more than average burnup of CANDU fuel. The irradiation of DUPIC fuel is planned to start at May 21, 2001, and will be continued at least for 8 months. The burnup of DUPIC fuel through this irradiation test is thought to be more than 7,000 MWd/tHE. The DUPIC irradiation rig instrumented with three SPN detectors will be used to accumulate the experience for the instrumented irradiation and to estimate the burnup of irradiated DUPIC fuel more accurately. Under normal operating condition, the maximum linear power of DUPIC fuel was estimated as 55.06 kW/m, and the centerline temperature of a pellet was calculated as 2510 deg C. In order to assess the integrity of DUPIC fuel under the accident condition postulated at the HANARO, safety analyses on the locked rotor and reactivity insertion accidents were carried out. The maximum centerline temperature of DUPIC fuel was estimated 2590 deg C and 2094 deg C for each accident, respectively. From the results of the safety analysis, the integrity of DUPIC fuel during the HANARO irradiation test will be secured. The irradiated DUPIC fuel will be transported to the IMEF. The post-irradiation examinations are planned to be performed at the PIEF and IMEF.
National Guard and Reserve Equipment Report for Fiscal Year 2013 (NGRER FY 2013)
2012-02-01
Trucks and 83 percent of its Semitrailer Tankers. The Army Reserve has highlighted shortfalls in the modernization of its 5-ton Dump Trucks and Heavy...C61597 $3,000,000 20 21 21 21 22 Hoist High Performance: H39331 $142,338 217 230 230 230 431 Power Unit Aux: Aviation Multi-Output GTED (AGPU) P44627...324,218 130 130 130 130 92 Scraper Earth Moving: SP 14-18 cu yd (CCE) S56246 $149,523 369 384 398 436 402 Excavator: Hydraulic (HYEX) Type I E27792
CENRTC Project No. 2F3EOA, OCB A-372, acceptance test procedure
International Nuclear Information System (INIS)
Akerson, A.W.
1995-01-01
This test procedure provides the steps necessary to verify correct functional operation of controls, annunciators, alarms, protective relays and related systems impacted by CENRTC No. 2F3EOA, Microwave Transfer Trip Project, modification work performed under work package 6B-93-00038/M (CENRTC 2F3EOA MWTT OCB A-372 PACKAGE)
Validation of US3D for Capsule Aerodynamics using 05-CA Wind Tunnel Test Data
Schwing, Alan
2012-01-01
Several comparisons of computational fluid dynamics to wind tunnel test data are shown for the purpose of code validation. The wind tunnel test, 05-CA, uses a 7.66% model of NASA's Multi-Purpose Crew Vehicle in the 11-foot test section of the Ames Unitary Plan Wind tunnel. A variety of freestream conditions over four Mach numbers and three angles of attack are considered. Test data comparisons include time-averaged integrated forces and moments, time-averaged static pressure ports on the surface, and Strouhal Number. The applicability of the US3D code to subsonic and transonic flow over a bluff body is assessed on a comprehensive data set. With close comparison, this work validates US3D for highly separated flows similar to those examined here.
Implementing a Modern Warfighting Supply-Chain for Information Technology Acquisitions
2011-03-10
enforcing information standards that help regulate inf01mation definitions; emphasizing compliance; and rationalizing performance requirements. 52...developed a prototype PISR PLAto coinmence realizing that CCE in the context of the first MCISR-E objective: "The synergistic integration of all
Independent verification and validation testing of the FLASH computer code, Versiion 3.0
International Nuclear Information System (INIS)
Martian, P.; Chung, J.N.
1992-06-01
Independent testing of the FLASH computer code, Version 3.0, was conducted to determine if the code is ready for use in hydrological and environmental studies at various Department of Energy sites. This report describes the technical basis, approach, and results of this testing. Verification tests, and validation tests, were used to determine the operational status of the FLASH computer code. These tests were specifically designed to test: correctness of the FORTRAN coding, computational accuracy, and suitability to simulating actual hydrologic conditions. This testing was performed using a structured evaluation protocol which consisted of: blind testing, independent applications, and graduated difficulty of test cases. Both quantitative and qualitative testing was performed through evaluating relative root mean square values and graphical comparisons of the numerical, analytical, and experimental data. Four verification test were used to check the computational accuracy and correctness of the FORTRAN coding, and three validation tests were used to check the suitability to simulating actual conditions. These tests cases ranged in complexity from simple 1-D saturated flow to 2-D variably saturated problems. The verification tests showed excellent quantitative agreement between the FLASH results and analytical solutions. The validation tests showed good qualitative agreement with the experimental data. Based on the results of this testing, it was concluded that the FLASH code is a versatile and powerful two-dimensional analysis tool for fluid flow. In conclusion, all aspects of the code that were tested, except for the unit gradient bottom boundary condition, were found to be fully operational and ready for use in hydrological and environmental studies
Drive beam stabilisation in the CLIC Test Facility 3
Malina, L.; Corsini, R.; Persson, T.; Skowroński, P. K.; Adli, E.
2018-06-01
The proposed Compact Linear Collider (CLIC) uses a high intensity, low energy drive beam to produce the RF power needed to accelerate a lower intensity main beam with 100 MV/m gradient. This scheme puts stringent requirements on drive beam stability in terms of phase, energy and current. The consequent experimental work was carried out in CLIC Test Facility CTF3. In this paper, we present a novel analysis technique in accelerator physics to find beam drifts and their sources in the vast amount of the continuously gathered signals. The instability sources are identified and adequately mitigated either by hardware improvements or by implementation and commissioning of various feedbacks, mostly beam-based. The resulting drive beam stability is of 0.2°@ 3 GHz in phase, 0.08% in relative beam energy and about 0.2% beam current. Finally, we propose a stabilisation concept for CLIC to guarantee the main beam stability.
RF Breakdown Studies Using a 1.3 GHZ Test Cell
International Nuclear Information System (INIS)
Sah, R.; Johnson, R.P.; Neubauer, M.; Conde, M.; Gai, W.; Moretti, A.; Popovic, M.; Yonehara, K.; Byrd, J.; Li, D.; BastaniNejad, M.
2009-01-01
Many present and future particle accelerators are limited by the maximum electric gradient and peak surface fields that can be realized in RF cavities. Despite considerable effort, a comprehensive theory of RF breakdown has not been achieved and mitigation techniques to improve practical maximum accelerating gradients have had only limited success. Recent studies have shown that high gradients can be achieved quickly in 805 MHz RF cavities pressurized with dense hydrogen gas without the need for long conditioning times, because the dense gas can dramatically reduce dark currents and multipacting. In this project we use this high pressure technique to suppress effects of residual vacuum and geometry found in evacuated cavities to isolate and study the role of the metallic surfaces in RF cavity breakdown as a function of magnetic field, frequency, and surface preparation. A 1.3-GHz RF test cell with replaceable electrodes (e.g. Mo, Cu, Be, W, and Nb) and pressure barrier capable of operating both at high pressure and in vacuum has been designed and built, and preliminary testing has been completed. A series of detailed experiments is planned at the Argonne Wakefield Accelerator. At the same time, computer simulations of the RF Breakdown process will be carried out to help develop a consistent physics model of RF Breakdown. In order to study the effect of the radiofrequency on RF Breakdown, a second test cell will be designed, fabricated, and tested at a lower frequency, most likely 402.5 MHz.
Practical End-to-End Performance Testing Tool for High Speed 3G-Based Networks
Shinbo, Hiroyuki; Tagami, Atsushi; Ano, Shigehiro; Hasegawa, Toru; Suzuki, Kenji
High speed IP communication is a killer application for 3rd generation (3G) mobile systems. Thus 3G network operators should perform extensive tests to check whether expected end-to-end performances are provided to customers under various environments. An important objective of such tests is to check whether network nodes fulfill requirements to durations of processing packets because a long duration of such processing causes performance degradation. This requires testers (persons who do tests) to precisely know how long a packet is hold by various network nodes. Without any tool's help, this task is time-consuming and error prone. Thus we propose a multi-point packet header analysis tool which extracts and records packet headers with synchronized timestamps at multiple observation points. Such recorded packet headers enable testers to calculate such holding durations. The notable feature of this tool is that it is implemented on off-the shelf hardware platforms, i.e., lap-top personal computers. The key challenges of the implementation are precise clock synchronization without any special hardware and a sophisticated header extraction algorithm without any drop.
Galvez-Ruiz, Alberto; Galindo-Ferreiro, Alicia; Schatz, Patrik
2018-04-01
In this study, the authors present a sample of 71 patients with hereditary optic neuropathy and negative genetic test results for OPA1/OPA3/LHON. All of these patients later underwent genetic testing to rule out WFS. As a result, 53 patients (74.7%) were negative and 18 patients (25.3%) were positive for some type of mutation or variation in the WFS gene. The authors believe that this study is interesting because it shows that a sizeable percentage (25.3%) of patients with hereditary optic 25 neuropathy and negative genetic test results for OPA1/OPA3/LHON had WFS mutations or variants.
Working in partnership to advance the 3Rs in toxicity testing
International Nuclear Information System (INIS)
Holmes, Anthony M.; Creton, Stuart; Chapman, Kathryn
2010-01-01
Toxicological assessment of pharmaceutical and non-pharmaceutical chemicals is a regulatory requirement to ensure all compounds likely to be exposed to humans or the environment are safe. These studies rely on the use of large numbers of animals and involve a number of assumptions and extrapolations that remain controversial in assuring consumer safety. The UK's National Centre for the Replacement, Refinement and Reduction of Animals in Research (NC3Rs) has taken a collaborative approach to identify opportunities for implementation of the 3Rs principles (Replacement, Reduction and Refinement) to drive innovation and support animal welfare in toxicity testing. This review highlights the mechanisms by which the NC3Rs is working with the pharmaceutical and chemical industries and regulatory authorities to achieve these goals.
2013-10-30
... NUCLEAR REGULATORY COMMISSION [Docket No. 052-00026; NRC-2008-0252] Inspections, Tests, Analyses, and Acceptance Criteria; Vogtle Electric Generating Plant, Unit 3 AGENCY: Nuclear Regulatory Commission. ACTION: Determination of inspections, tests, analyses, and acceptance criteria completion...
International Nuclear Information System (INIS)
2001-01-01
The CCE-FU endorses the findings of the FTC on the European Domestic Assessment of the ITER-FEAT Outline Design Review, and expresses the opinion that: The machine, ITER-FEAT, the design of which is presented in the Outline Design Report and accompanying document (Technical Basis for the ITER-FEAT Outline Design) successfully responds, in broad terms, to the requirements set by the Special Working Group, established by the ITER Council, in response to Task No. 1 and adopted by the Council; The parameters chosen represent convergence towards a coherent design, based upon preserving adequate margins within the cost target against the new objectives and yet retaining flexibility to exploit advances in physics understanding; ITER-FEAT can meet its objectives of extended burn in induction operation with power amplification Q>10 at the reference operating values of Ip=15MA, Paux=40MW, thus providing 400 MW of fusion power. The margins to achieve this objective are in the range of 15-25%. The design also has sufficient flexibility to explore hybrid scenarios with long pulse capability (> 2000 seconds), and scenarios aiming at demonstrating steady state operation with the ratio of fusion power to input power for current drive of at least 5, provided further confinement enhancement can be achieved; Although most of the components of ITER-FEAT are still in a preliminary design state, the new design appears suitable to be developed into the final design stage, the new design appears suitable to be developed into the final design of a machine capable of achieving the objectives set by the ITER Council; The target cost for the realisation of ITER-FEAT was set by the ITER Council at about half of the 1998 ITER cost estimates. The present preliminary analysis provides confidence that this target will be reached. By the end of 2000, the detailed cost estimates will be provided from the detailed design specifications and manufacturing studies in the industries of the three Parties
Glass composition effects on the results of MCC-1, MCC-3 and pulsed-flow leach tests
International Nuclear Information System (INIS)
Barkatt, A.; Adiga, R.; Adel-Hadadi, M.A.; Barkatt, A.; Feng, X.; Sousanpour, W.
1989-01-01
Glass composition effects on the results of MCC-1, MCC-3 and pulsed-flow leach tests are summarized. Major components of the glasses studied are included. The leachant in all cases was de-ionized water and the temperature was 90 degree C. Test duration of the MCC-1 and MCC-3 was 28 days. The total time in the pulsed-flow test was 112 days. In the MCC-1 test, the results indicate that the forward rate characteristic of the kinetics of leaching in unsaturated environments is relatively independent (within a factor of 2) of such variations. The MCC-3 results reflect the extent of glass dissolution under conditions where the extent of interaction is large enough to cause the solution in contact with the glass to approach saturation with respect to silica and other scarcely soluble components. The pulsed-flow results show that at longer periods of time the dependence of leachate composition on glass composition decreases again and that leachate concentrations approach stabilization at levels which are much lower than the MCC-3 limits
SWFSC/MMTD/CCE: Leatherback Use of Temperate Habitat (LUTH) 2008
National Oceanic and Atmospheric Administration, Department of Commerce — The Leatherback Use of Temperate Habitat (LUTH) survey is an ecosystem assessment of temperate foraging habitats of endangered leatherback turtles off the coast of...
2D/3D program. Upper plenum test facility - UPTF. Test No. 1
International Nuclear Information System (INIS)
1987-01-01
Test No.1 was a quasi-steady state, separate effect test involving the UPTF-System with blocked break valves and blocked pump simulators. Initially the test vessel, the cold and hot leg nozzels as well as the pump seals were completely filled witht hot water in this test. This test was designed to investigate the fluid-fluid mixing phenomena and the development of the fluid and wall temperature fields in the cold leg and downcomer region of a PWR. The experiment was performed by injecting a cold water stream into one cold leg of UPTF while the system was initially filled with stagnant hot water. (orig.)
Safety Assessment of Multi Purpose Small Payload Rack(MSPR)
Mizutani, Yoshinobu; Takada, Satomi; Murata, Kosei; Ozawa, Daisaku; Kobayashi, Ryoji; Nakamura, Yasuhiro
2010-09-01
We are reporting summary of preliminary safety assessment for Multi Purpose Small Payload Rack(MSPR), which is one of the micro gravity experiment facilities that are being developed for the 2nd phase JEM utilization(JEM: Japanese Experiment Module) that will be launched on H-II Transfer Vehicle(HTV) 2nd flight in 2011. MSPR is used for multi-purpose micro-g experiment providing experimental spaces and work stations. MSPR has three experimental spaces; first, there is a space called Work Volume(WV) with capacity volume of approximately 350 litters, in which multiple resources including electricity, communication, and moving image functions can be used. Within this space, installation of devices can be done by simple, prompt attachment by Velcro and pins with high degree of flexibility. Second, there is Small Experiment Area(SEA), with capacity volume of approximately 70 litters, in which electricity, communication, and moving image functions can also be used in the same way as WV. These spaces protect experiment devices and specimens from contingent loads by the crewmembers. Third, there is Work Bench with area of 0.5 square meters, on which can be used for maintenance, inspection and data operations of installed devices, etc. This bench can be stored in the rack during contingency. Chamber for Combustion Experiment(CCE) that is planned to be installed in WV is a pressure-resistant experimental container that can be used to seal hazardous materials from combustion experiments. This CCE has double sealing design in chamber itself, which resist gas leakage under normal the temperature and pressure. Electricity, communication, moving image function can be used in the same way as WV. JAXA Phase 2 Safety Review Panel(SRP) has been held in April, 2010. For safety analysis of MSPR, hazards were identified based on Fault Tree Analysis methodology and then these hazards were classified into either eight ISS standard-type hazards or eight unique-type hazards that requires
Energy Technology Data Exchange (ETDEWEB)
Johannesson, Lars-Erik; Sanden, Torbjoern; Dueck, Ann; Ohlsson, Lars (Clay Technology AB, Lund (Sweden))
2010-01-15
A backfill candidate material, IBECO-RWC-BF, which origin from Milos, Greece, has been investigated. The material was delivered both as granules and as pellets. The investigation described in this report aimed to characterize the material and evaluate if it can be used in a future repository. The following investigations have been done and are presented in this report: 1. Standard laboratory tests. Water content, liquid limit and swelling potential are examples on standard tests that have been performed. 2. Block manufacturing. The block compaction properties of the material have been determined. A first test was performed in laboratory but also tests in large scale have been performed. After finishing the test phase, 60 tons of blocks were manufactured at Hoeganaes Bjuf AB. The blocks will be used in large scale laboratory tests at Aespoe HRL. 3. Mechanical parameters. The compressibility of the material was investigated with oedometer tests (four tests) where the load was applied in steps after saturation. The evaluated oedometer modulus varied between 34.50 MPa. Tests were made to evaluate the elastic parameters of the material (E, nu). Altogether three tests were made on specimens with dry densities of about 1,710 kg/m3. The evaluated E-modulus and Poisson's ratio varied between 231-263 MPa and 0.16-0.19 respectively. The strength of the material, both the compressive strength and the tensile strength were measured on specimens compacted to different dry densities. The test results yielded a relation between density and the two types of strength. Furthermore, tests have been made in order to determine the compressibility of the unsaturated filling of pellets. Two tests were made where the pellets were loosely filled in a Proctor cylinder and then compressed at a constant rate of strain during continuously measurement of the applied load. 4. Swelling pressure and hydraulic conductivity. There is, as expected, a very clear influence of the dry density on the
2013-08-29
... NUCLEAR REGULATORY COMMISSION [Docket No. 052-00025; NRC-2008-0252] Inspections, Tests, Analyses, and Acceptance Criteria; Vogtle Electric Generating Plant, Unit 3 AGENCY: Nuclear Regulatory Commission. ACTION: Determination of inspections, tests, analyses, and acceptance criteria (ITAAC) completion...
Energy Technology Data Exchange (ETDEWEB)
J. L. Smith
2001-08-01
This Closure Report (CR) has been prepared for the Area 3 Radioactive Waste Management Site (RWMS) U-3ax/bl Disposal Unit Corrective Action Unit (CAU) 110 in accordance with the reissued (November 2000) Resource Conservation and Recovery Act (RCRA) Part B operational permit NEV HW009 (Nevada Division of Environmental Protection [NDEP], 2000) and the Federal Facility and Consent Order (FFACO) (NDEP et al., 1996). CAU 110 consists of one Corrective Action Site 03-23-04, described as the U-3ax/bl Subsidence Crater. Certifications of closure are located in Appendix A. The U-3ax/bl is a historic disposal unit within the Area 3 RWMS located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit was closed under the RCRA, as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10{sup 5} cubic meters (m{sup 3}) (8.12 x 10{sup 6} cubic feet [ft{sup 3}]) of waste. NTS atmospheric nuclear device testing generated approximately 95% of the total waste volume disposed of in U-3ax/bl; 80% of the total volume was generated from the Waste Consolidation Project. Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is normally in a state of moisture deficit.
Post-test analysis of semiscale large-break test S-06-3 using TRAC-PF1
International Nuclear Information System (INIS)
Boyack, B.E.
1982-01-01
The Transient Reactor Analysis Code (TRAC) is an advanced systems code for light-water-reactor accident analysis. The code was developed originally to analyze large-break loss-of-coolant accidents (LOCAs) and running time was not a primary development criterion. TRAC-PF1 was developed because increased application of the code to long transients such as small-break LOCAs required a faster-running code version. Although developed for long transients, its performance on large-break transients is still important. This paper assesses the ability of TRAC-PF1 to predict large-break-LOCA Test S-06-3 conducted in the Semiscale Mod-1 facility
JRR-3 cold neutron source facility H2-O2 explosion safety proof testing
International Nuclear Information System (INIS)
Hibi, T.; Fuse, H.; Takahashi, H.; Akutsu, C.; Kumai, T.; Kawabata, Y.
1990-01-01
A cold Neutron Source (CNS) will be installed in Japan Research Reactor-3 (JRR-3) in Japan Atomic Energy Research Institute (JAERI) during its remodeling project. This CNS holds liquid hydrogen at a temperature of about 20 K as a cold neutron source moderator in the heavy water area of the reactor to moderate thermal neutrons from the reactor to cold neutrons of about 5 meV energy. In the hydrogen circuit of the CNS safety measures are taken to prevent oxygen/hydrogen reaction (H 2 -O 2 explosion). It is also designed in such manner that, should an H 2 -O 2 explosion take place, the soundness of all the components can be maintained so as not to harm the reactor safety. A test hydrogen circuit identical to that of the CNS (real components designed by TECHNICATOME of France) was manufactured to conduct the H 2 -O 2 explosion test. In this test, the detonation that is the severest phenomenon of the oxygen/hydrogen reaction took place in the test hydrogen circuit to measure the exerted pressure on the components and their strain, deformation, leakage, cracking, etc. Based on the results of this measurement, the structural strength of the test hydrogen circuit was analyzed. The results of this test show that the hydrogen circuit components have sufficient structural strength to withstand an oxygen/hydrogen reaction
MAC mini acceptance test procedures, software Version 3.3
International Nuclear Information System (INIS)
Russell, V.K.
1994-01-01
The K Basins Materials Accounting (MAC) programs had some improvements made to it to to change slightly the access authorized users had to the modification of critical data. This ATP describes how the code was to be tested to verify its correctness
Wester, A.J.; Herten, J.C. van; Egger, J.I.; Kessels, R.P.C.
2013-01-01
PURPOSE: To examine the applicability of the newly developed Rivermead Behavioural Memory Test - Third Edition (RBMT-3) as an ecologically-valid memory test in patients with alcohol-related cognitive disorders. PATIENTS AND METHODS: An authorized Dutch translation of the RBMT-3 was developed,
International Nuclear Information System (INIS)
Tempelmeyer, K.E.; Sokolov, Y.N.
1979-04-01
The third joint test with a Soviet U-25B MHD generator and a US superconducting magnet system (SCMS) was conducted in the Soviet U-25B Facility. The primary objectives of the 3rd test were: (1) to operate the facility and MHD channel over a wider range of test parameters, and (2) to study the performance of all components and systems of the flow train at increased mass flow rates of combustion products (up to 4 kg/s), at high magnetic-field induction (up to 5 T), and high values of the electrical field in the MHD generator. The third test has demonstrated that all components and systems of the U-25B facility performed reliably. The electric power generated by the MHD generaor reached a maximum of 575 kW during this test. The MHD generator was operated under electrical loading conditions for 9 hours, and the combustor for a total of approximately 14 hours. Very high Hall fields (2.1 kV/m) were produced in the MHD channel, with a total Hall voltage of 4.24 kV. A detailed description is given of (1) performance of all components and systems of the U-25B facility, (2) analysis of the thermal, gasdynamic, and electrical characteristics of the MHD generator, (3) results of plasma diagnostic studies, (4) studies of vibrational characteristics of the flow train, (5) fluctuation of electrodynamic and gasdynamic parameters, (6) interaction of the MHD generator with the superconducting magnet, and (7) an operational problem, which terminated the test
Assessment of RELAP5-3D copyright using data from two-dimensional RPI flow tests
International Nuclear Information System (INIS)
Davis, C.B.
1998-01-01
The capability of the RELAP5-3D copyright computer code to perform multi-dimensional thermal-hydraulic analysis was assessed using data from steady-state flow tests conducted at Rensselaer Polytechnic Institute (RPI). The RPI data were taken in a two-dimensional test section in a low-pressure air/water loop. The test section consisted of a thin vertical channel that simulated a two-dimensional slice through the core of a pressurized water reactor. Single-phase and two-phase flows were supplied to the test section in an asymmetric manner to generate a two-dimensional flow field. A traversing gamma densitometer was used to measure void fraction at many locations in the test section. High speed photographs provided information on the flow patterns and flow regimes. The RPI test section was modeled using the multi-dimensional component in RELAP5-3D Version BF06. Calculations of three RPI experiments were performed. The flow regimes predicted by the base code were in poor agreement with those observed in the tests. The two-phase regions were observed to be in the bubbly and slug flow regimes in the test. However, nearly all of the junctions in the horizontal direction were calculated to be in the stratified flow regime because of the relatively low velocities in that direction. As a result, the void fraction predictions were also in poor agreement with the measured values. Significantly improved results were obtained in sensitivity calculations with a modified version of the code that prevented the horizontal junctions from entering the stratified flow regime. These results indicate that the code's logic in the determination of flow regimes in a multi-dimensional component must be improved. The results of the sensitivity calculations also indicate that RELAP5-3D will provide a significant multi-dimensional hydraulic analysis capability once the flow regime prediction is improved
Dicty_cDB: Contig-U13391-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 587_82( CP000587 |pid:none) Ostreococcus lucimarinus CCE9901 ... 43 0.004 AY092033_1( AY092033 |pid:none) Homo sapiens NALP3 interm...3015498109 Global-Ocean-Sampling_GS-35-01-01-1... 46 0.91 1 ( DU327579 ) 1098473610927 CHORI-243 Ovis aries ...018 2 ( AC188370 ) Glycine max clone gmp1-120k16, complete sequence. 50 0.058 1 ( ER548246 ) 1093016198016 Global-Ocean-Sampli... DKEY-258P11 in ... 38 0.97 3 ( EJ508572 ) 1095407031867 Global-Ocean-Sampling_GS-28-01-01-1... 40 1.0 2 ( E...R418890 ) 1092963689437 Global-Ocean-Sampling_GS-35-01-01-1... 36 1.1 3 ( CR450742 ) Zebrafish DNA sequence
Gong, Chester; Wu, Minghong G.; Santiago, Confesor
2016-01-01
The Unmanned Aircraft Systems Integration in the National Airspace System project, or UAS Integration in the NAS, aims to reduce technical barriers related to safety and operational challenges associated with enabling routine UAS access to the NAS. The UAS Integration in the NAS Project conducted a flight test activity, referred to as Flight Test 3 (FT3), involving several Detect-and-Avoid (DAA) research prototype systems between June 15, 2015 and August 12, 2015 at the Armstrong Flight Research Center (AFRC). This report documents the flight testing and analysis results for the NASA Ames-developed JADEM-Autoresolver DAA system, referred to as 'Autoresolver' herein. Four flight test days (June 17, 18, 22, and July 22) were dedicated to Autoresolver testing. The objectives of this test were as follows: 1. Validate CPA prediction accuracy and detect-and-avoid (DAA, formerly known as self-separation) alerting logic in realistic flight conditions. 2. Validate DAA trajectory model including maneuvers. 3. Evaluate TCAS/DAA interoperability. 4. Inform final Minimum Operating Performance Standards (MOPS). Flight test scenarios were designed to collect data to directly address the objectives 1-3. Objective 4, inform final MOPS, was a general objective applicable to the UAS in the NAS project as a whole, of which flight test is a subset. This report presents analysis results completed in support of the UAS in the NAS project FT3 data review conducted on October 20, 2015. Due to time constraints and, to a lesser extent, TCAS data collection issues, objective 3 was not evaluated in this analysis.
Identification of subpopulations in mesenchymal stem cell-like cultures from human umbilical cord
Directory of Open Access Journals (Sweden)
Majore Ingrida
2009-03-01
Full Text Available Abstract Background A variety of cell types can be identified in the adherent fraction of bone marrow mononuclear cells including more primitive and embryonic-like stem cells, mesenchymal stem cells (MSC, lineage-committed progenitors as well as mature cells such as osteoblasts and fibroblasts. Different methods are described for the isolation of single bone marrow stem cell subpopulations – beginning from ordinary size sieving, long term cultivation under specific conditions to FACS-based approaches. Besides bone marrow-derived subpopulations, also other tissues including human umbilical cord (UC have been recently suggested to provide a potential source for MSC. Although of clinical importance, these UC-derived MSC populations remain to be characterized. It was thus the aim of the present study to identify possible subpopulations in cultures of MSC-like cells obtained from UC. We used counterflow centrifugal elutriation (CCE as a novel strategy to successfully address this question. Results UC-derived primary cells were separated by CCE and revealed differentially-sized populations in the fractions. Thus, a subpopulation with an average diameter of about 11 μm and a small flat cell body was compared to a large sized subpopulation of about 19 μm average diameter. Flow cytometric analysis revealed the expression of certain MSC stem cell markers including CD44, CD73, CD90 and CD105, respectively, although these markers were expressed at higher levels in the small-sized population. Moreover, this small-sized subpopulation exhibited a higher proliferative capacity as compared to the total UC-derived primary cultures and the large-sized cells and demonstrated a reduced amount of aging cells. Conclusion Using the CCE technique, we were the first to demonstrate a subpopulation of small-sized UC-derived primary cells carrying MSC-like characteristics according to the presence of various mesenchymal stem cell markers. This is also supported by the
BETHSY 9.1b Test Calculation with TRACE Using 3D Vessel Component
International Nuclear Information System (INIS)
Berar, O.; Prosek, A.
2012-01-01
Recently, several advanced multidimensional computational tools for simulating reactor system behaviour during real and hypothetical transient scenarios were developed. One of such advanced, best-estimate reactor systems codes is TRAC/RELAP Advanced Computational Engine (TRACE), developed by the U.S. Nuclear Regulatory Commission. The advanced TRACE comes with a graphical user interface called SNAP (Symbolic Nuclear Analysis Package). It is intended for pre- and post-processing, running codes, RELAP5 to TRACE input deck conversion, input deck database generation etc. The TRACE code is still not fully development and it will have all the capabilities of RELAP5. The purpose of the present study was therefore to assess the 3D capability of the TRACE on BETHSY 9.1b test. The TRACE input deck was semi-converted (using SNAP and manual corrections) from the RELAP5 input deck. The 3D fluid dynamics within reactor vessel was modelled and compared to 1D fluid dynamics. The 3D calculation was compared both to TRACE 1D calculation and RELAP5 calculation. Namely, the geometry used in TRACE is basically the same, what gives very good basis for the comparison of the codes. The only exception is 3D reactor vessel model in case of TRACE 3D calculation. The TRACE V5.0 Patch 1 and RELAP5/MOD3.3 Patch 4 were used for calculations. The BETHSY 9.1b test (International Standard Problem no. 27 or ISP-27) was 5.08 cm equivalent diameter cold leg break without high pressure safety injection and with delayed ultimate procedure. BETHSY facility was a 3-loop replica of a 900 MWe FRAMATOME pressurized water reactor. For better presentation of the calculated physical phenomena and processes, an animation model using SNAP was developed. In general, the TRACE 3D code calculation is in good agreement with the BETHSY 9.1b test. The TRACE 3D calculation results are as good as or better than the RELAP5 calculated results. Also, the TRACE 3D calculation is not significantly different from TRACE 1D
Development and test of Nb3sn cos-theta coils made of high-jc rrp strands
Energy Technology Data Exchange (ETDEWEB)
Bossert, R.; Ambrosio, G.; Andreev, N.; Barzi, E.; Carcagno, R.; Feher, S.; Kashikhin, V.S.; Kashikhin, V.V.; Lamm, M.J.; Novitski, I.; Pischalnikov, Yu.; Sylvester, C.; Tartaglia, M.; Turrioni, D.; Yamada, R.; Zlobin, A.V.; /Fermilab
2005-10-01
A series of 1-m long Nb3Sn dipole magnets have been built at Fermilab in an attempt to refine the wind-and-react technology for Nb{sub 3}Sn conductor. Models have been made with MJR and PIT strand with varying degrees of success. Subsequently two new dipole ''mirror'' magnets based on RRP Nb{sub 3}Sn coils were constructed and tested. This paper describes the design, fabrication and test results of those magnets.
Wester, A.J.; Herten, J.C. van; Egger, J.I.M.; Kessels, R.P.C.
2013-01-01
Purpose: To examine the applicability of the newly developed Rivermead Behavioural Memory Test – Third Edition (RBMT-3) as an ecologically-valid memory test in patients with alcohol-related cognitive disorders. Patients and methods: An authorized Dutch translation of the RBMT-3 was developed,
Evidence for plasma effect on charge collection efficiency in proton irradiated GaAs detectors
Nava, F; Canali, C; Vittone, E; Polesello, P; Biggeri, U; Leroy, C
1999-01-01
The radiation damage in 100 mu m thick Schottky diodes made on semi-insulating undoped GaAs materials, were studied using alpha-, beta-, proton- and gamma-spectroscopy as well as I-V measurements. The results have been analysed within the framework of the Hecht model to investigate the influence of the plasma produced by short-range strongly ionising particles on the detector performance after 24 GeV proton irradiation. It has been found that with the mean free drift lengths for electrons and holes determined from alpha-spectra in overdepleted detectors, the charge collection efficiency for beta-particles, cce subbeta, is well predicted in the unirradiated detectors, while in the most irradiated ones, the cce subbeta is underestimated by more than 40%. The observed disagreement can be explained by assuming that the charge carrier recombination in the plasma region of such detectors, becomes significant.
Analysis of the COLIMA CA-U3 test using the ELSA module of ASTEC
International Nuclear Information System (INIS)
Godin-Jacqmin, L.; Journeau, C.; Piluso, P.
2006-01-01
The main purpose of this study is to calculate the COLIMA CA-U3 experimental test with the ELSA module of the ASTEC code. This experimental test was performed to represent the fission product and structural material releases from a VVER-440 magma type configuration. Thus, some additional work is also done on test result analyses and corresponding ASTEC parameter usage to model as closely as possible the test configuration. Code results on fission product releases are compared to experimental results in a qualitative way for all elements that can be evaluated by the ASTEC code. Sensitivity cases are also performed on the gas flow rate carrying the fission product. (author)
International Nuclear Information System (INIS)
Johannesson, Lars-Erik; Sanden, Torbjoern; Dueck, Ann; Ohlsson, Lars
2010-01-01
A backfill candidate material, IBECO-RWC-BF, which origin from Milos, Greece, has been investigated. The material was delivered both as granules and as pellets. The investigation described in this report aimed to characterize the material and evaluate if it can be used in a future repository. The following investigations have been done and are presented in this report: 1. Standard laboratory tests. Water content, liquid limit and swelling potential are examples on standard tests that have been performed. 2. Block manufacturing. The block compaction properties of the material have been determined. A first test was performed in laboratory but also tests in large scale have been performed. After finishing the test phase, 60 tons of blocks were manufactured at Hoeganaes Bjuf AB. The blocks will be used in large scale laboratory tests at Aespoe HRL. 3. Mechanical parameters. The compressibility of the material was investigated with oedometer tests (four tests) where the load was applied in steps after saturation. The evaluated oedometer modulus varied between 34.50 MPa. Tests were made to evaluate the elastic parameters of the material (E, ν). Altogether three tests were made on specimens with dry densities of about 1,710 kg/m 3 . The evaluated E-modulus and Poisson's ratio varied between 231-263 MPa and 0.16-0.19 respectively. The strength of the material, both the compressive strength and the tensile strength were measured on specimens compacted to different dry densities. The test results yielded a relation between density and the two types of strength. Furthermore, tests have been made in order to determine the compressibility of the unsaturated filling of pellets. Two tests were made where the pellets were loosely filled in a Proctor cylinder and then compressed at a constant rate of strain during continuously measurement of the applied load. 4. Swelling pressure and hydraulic conductivity. There is, as expected, a very clear influence of the dry density on the
International Nuclear Information System (INIS)
Boyer, B.D.; Slovik, G.C.; Rohatgl, U.S.
1995-01-01
The Simplified Boiling Water Reactor (SBWR) proposed by General Electric (GE) is an advanced light water reactor (ALWR) design that utilizes passive safety systems. The PCCS is a series of heat exchangers submerged in water and open to the containment. Since the containment is inerted with nitrogen during normal operation, the PCCS must condense the steam in the presence of noncondensable gases during an accident. To model the transient behavior of the SBWR with a system code, the code should properly simulate the expected phenomena. To validate the applicability of RELAP5 MOD 3.1.1, the data from three Phase 1, Step 2 nitrogen venting tests at Toshiba's Gravity-Driven Integral Full-Height Test for Passive Heat Removal facility and RELAP5 calculations of these tests were compared. The comparison of the GIRAFFE data against the results from the RELAP5 calculations showed that it can predict condensation and gas purging phenomena occurring in the long-term decay heat rejection phase. In this phase of the transient, condensation in the PCCS is the only means to reject heat from the SBWR containment. In the two tests where the nitrogen purge vent line was at its deepest submergence in the Suppression Pool (SIP), the RELAP5 results mirrored the behavior of the containment pressures and of the water levels in the Horizontal Vent (HV) and the nitrogen purge line tube of the GIRAFFE data. However, in the test with the shallowest purge line submergence, there was appreciable direct contact condensation on the pool surface of the HV despite modeling efforts to deter these phenomena. This surface condensation, unobserved in the GIRAFFE tests, was a major cause of RELAP5 predicting early containment depressurization and the subsequent early rise in HV and nitrogen purge line water levels. The present RELAP5 MOD3.1.1 interfacial heat and mass transfer model does not properly degrade direct contact steam condensation in the presence of noncondensable gases sitting on a pool
Developmental assessment of RELAP5/MOD3 using the semiscale natural circulation tests
International Nuclear Information System (INIS)
Carlson, K.E.
1990-01-01
A code development effort creating RELAP5/MOD3 from RELAP5/MOD2 has been completed. Upon completion, a developmental assessment task was performed. One of the problems used for the developmental assessment was the Semiscale Natural Circulation Test. Calculated results from RELAP5/MOD3 are compared to measured data and previously calculated results from RELAP5/MOD2. 10 refs., 6 figs., 1 tab
Hamann, Dathan; Hamann, Carsten R; Zimerson, Erik; Bruze, Magnus
2013-01-01
The common practice of preparing patch tests in advance has recently been called into question by researchers. It has been established that fragrance compounds are volatile and their testing efficacy may be affected by storage conditions and preparation. Allergens in fragrance mix I rapidly decrease in concentration after preapplication to test chambers. This study aimed to investigate the volatility of hydroxyisohexyl 3-cyclohexene carboxaldehyde (HICC) in petrolatum when stored in test chambers and to explore the correlation between vapor pressure and allergen loss in petrolatum during preparation and storage. Standardized HICC in petrolatum was prepared and stored in IQ Chambers and Finn Chambers with covers at 5°C, 25°C, and 35°C, and concentration was analyzed at intervals for up to 9 days using gel permeation chromatography. Changes in HICC concentrations were not statistically significant at 8 hours at 5°C, 25°C, and 35°C. After 9 days, HICC concentrations were found to fall approximately 30% when stored at 35°C, 10% at 25°C, and less than 5% at 5°C. There was no significant difference between IQ and Finn chambers. Hydroxyisohexyl 3-cyclohexene carboxaldehyde concentrations are more stable in petrolatum than many other studied fragrance allergens, but HICC is still at risk for decreasing concentration when exposed to ambient air or heat for prolonged periods.
Performance of 3.9 GHz SRF cavities at Fermilab's ILCTA_MDB nhorizontal test stand
Energy Technology Data Exchange (ETDEWEB)
Harms, Elvin; Hocker, Andy; /Fermilab
2008-08-01
Fermilab is building a cryomodule containing four 3.9 GHz superconducting radio frequency (SRF) cavities for the Free electron LASer in Hamburg (FLASH) facility at the Deutsches Elektronen-SYnchrotron (DESY) laboratory. Before assembling the cavities into the cryomodule, each individual cavity is tested at Fermilab's Horizontal Test Stand (HTS). The HTS provides the capability to test fully-dressed SRF cavities at 1.8 K with high-power pulsed RF in order to verify that the cavities achieve performance requirements under these conditions. The performance at the HTS of the 3.9 GHz cavities built for FLASH is presented here.
International Nuclear Information System (INIS)
Jang, Seung Cheol; Lee, Yun Hwan; Lee, Seung Joon; Han, Sang Hoon
2012-05-01
The purpose of this research is the development of various methodologies necessary for the licensing of the risk informed surveillance test interval(STI) improvement for the safety related I and C systems in UCN 3 and 4, for instance, reactor protection system (RPS), engineered safety features actuation system (ESFAS), ESF auxiliary relay cabinet (ARC), and core protection calculator (CPC). The technical adequacy of the methodology was sufficiently verified through the application to the following STI changes. o CPC channel functional test (change from 1 month to 3 months including safety channel and log power test) o RPS channel functional test (change from 1 month to 3 months) o RPS logic and trip channel test (change from 1 month to 3 months. 1 month for RPS manual actuation test) o ESFAS channel functional test (change from 1 month to 3 months) o ESFAS logic and trip channel test (change from 1 month to 3 months) o ESF auxiliary relay test (change from 1 month to 3 months with staggered test. Manual actuation at the ESF ARC is added as a backup of ESF actuation signals during emergency operation
International Nuclear Information System (INIS)
Jang, Seung Cheol; Lee, Yun Hwan; Lee, Seung Joon; Han, Sang Hoon
2012-05-01
The purpose of this research is the development of various methodologies necessary for the licensing of the risk informed surveillance test interval(STI) improvement for the safety related I and C systems in YGN 3 and 4, for instance, reactor protection system (RPS), engineered safety features actuation system (ESFAS), ESF auxiliary relay cabinet (ARC), and core protection calculator (CPC). The technical adequacy of the methodology was sufficiently verified through the application to the following STI changes. o CPC channel functional test (change from 1 month to 3 months including safety channel and log power test) o RPS channel functional test (change from 1 month to 3 months) o RPS logic and trip channel test (change from 1 month to 3 months. 1 month for RPS manual actuation test) o ESFAS channel functional test (change from 1 month to 3 months) o ESFAS logic and trip channel test (change from 1 month to 3 months) o ESF auxiliary relay test (change from 1 month to 3 months with staggered test. Manual actuation at the ESF ARC is added as a backup of ESF actuation signals during emergency operation
Tadapaneni, Ravi Kiran; Yang, Ren; Carter, Brady; Tang, Juming
2017-12-01
In recent years, research studies have shown that the thermal resistance of foodborne pathogens in the low moisture foods is greatly influenced by the water activity (a w ) at temperatures relevant to thermal treatments for pathogen control. Yet, there has been a lack of an effective method for accurate measurement of a w at those temperatures. Thus, the main aim of this study was to evaluate a new method for measuring a w of food samples at elevated temperatures. An improved thermal cell with a relative humidity and temperature sensor was used to measure the a w of the three different food samples, namely, organic wheat flour, almond flour, and non-fat milk powder, over the temperature range between 20 and 80°C. For a constant moisture content, the a w data was used to estimate the net isosteric heat of sorption (q st ). The q st values were then used in the Clausius Clapeyron equation (CCE) equation to estimate the moisture sorption isotherm for all test food samples at different temperatures. For all the tested samples of any fixed moisture content, a w value generally increased with the temperature. The energy for sorption decreased with increasing moisture content. With the experimentally determined q st value, CCE describes well about the changes in a w of the food samples between 20 and 80°C. This study presents a method to obtain a w of a food sample for a specific moisture content at different temperatures which could be extended to obtain q st values for different moisture contents and hence, the moisture sorption isotherm of a food sample at different temperatures. Copyright © 2017 Elsevier Ltd. All rights reserved.
Zitnick-Anderson, Kimberly K; Norland, Jack E; Del Río Mendoza, Luis E; Fortuna, Ann-Marie; Nelson, Berlin D
2017-10-01
Associations between soil properties and Pythium groups on soybean roots were investigated in 83 commercial soybean fields in North Dakota. A data set containing 2877 isolates of Pythium which included 26 known spp. and 1 unknown spp. and 13 soil properties from each field were analyzed. A Pearson correlation analysis was performed with all soil properties to observe any significant correlation between properties. Hierarchical clustering, indicator spp., and multi-response permutation procedures were used to identify groups of Pythium. Logistic regression analysis using stepwise selection was employed to calculate probability models for presence of groups based on soil properties. Three major Pythium groups were identified and three soil properties were associated with these groups. Group 1, characterized by P. ultimum, was associated with zinc levels; as zinc increased, the probability of group 1 being present increased (α = 0.05). Pythium group 2, characterized by Pythium kashmirense and an unknown Pythium sp., was associated with cation exchange capacity (CEC) (α < 0.05); as CEC increased, these spp. increased. Group 3, characterized by Pythium heterothallicum and Pythium irregulare, were associated with CEC and calcium carbonate exchange (CCE); as CCE increased and CEC decreased, these spp. increased (α = 0.05). The regression models may have value in predicting pathogenic Pythium spp. in soybean fields in North Dakota and adjacent states.
New South Wales Dept. of Education, Sydney (Australia).
As part of a series of tests to measure mastery of specific skills in the natural sciences, copies of tests 27 through 38 include: (27) reading a grid plan; (28) identifying common invertebrates; (29) characteristics of invertebrates; (30) identifying elements; (31) using scientific notation part I; (32) classifying minerals; (33) predicting the…
Long-term field test of solar PV power generation using one-axis 3-position sun tracker
Huang, B.J.
2011-09-01
The 1 axis-3 position (1A-3P) sun tracking PV was built and tested to measure the daily and long-term power generation of the solar PV system. A comparative test using a fixed PV and a 1A-3P tracking PV was carried out with two identical stand-alone solar-powered LED lighting systems. The field test in the particular days shows that the 1A-3P tracking PV can generate 35.8% more electricity than the fixed PV in a partly-cloudy weather with daily-total solar irradiation HT=11.7MJ/m2day, or 35.6% in clear weather with HT=18.5MJ/m2day. This indicates that the present 1A-3P tracking PV can perform very close to a dual-axis continuous tracking PV (Kacira et al., 2004). The long-term outdoor test results have shown that the increase of daily power generation of 1A-3P tracking PV increases with increasing daily-total solar irradiation. The increase of monthly-total power generation for 1A-3P sun tracking PV is between 18.5-28.0%. The total power generation increase in the test period from March 1, 2010 to March 31, 2011, is 23.6% in Taipei (an area of low solar energy resource). The long-term performance of the present 1X-3P tracking PV is shown very close to the 1-axis continuous tracking PV in Taiwan (Chang, 2009). If the 1A-3P tracking PV is used in the area of high solar energy resource with yearly-average HT>17MJ/m2day, the increase of total long-term power generation with respect to fixed PV will be higher than 37.5%. This is very close to that of dual-axis continuous tracking PV. The 1A-3P tracker can be easily mounted on the wall of a building. The cost of the whole tracker is about the same as the regular mounting cost of a conventional rooftop PV system. This means that there is no extra cost for 1A-3P PV mounted on buildings. The 1A-3P PV is quite suitable for building-integrated applications. © 2011 Elsevier Ltd.
Enhancing Pre-Service Teachers' Awareness to Pupils' Test-Anxiety with 3D Immersive Simulation
Passig, David; Moshe, Ronit
2008-01-01
This study investigated whether participating in a 3D immersive virtual reality world simulating the experience of test-anxiety would affect preservice teachers' awareness to the phenomenon. Ninety subjects participated in this study, and were divided into three groups. The experimental group experienced a 3D immersive simulation which made…
Prediction of the Long Term Cooling Performance for the 3-Pin Fuel Test Loop
Energy Technology Data Exchange (ETDEWEB)
Park, S. K.; Chi, D. Y.; Sim, B. S.; Park, K. N.; Ahn, S. H.; Lee, J. M.; Lee, C. Y.; Kim, H. R
2005-12-15
In the long term cooling phase that the emergency cooling water injection ends, the performance of the residual heat removal for the 3-pin fuel test loop has been predicted by a simplified heat transfer model. In the long term cooling phase the residual heat is 1323W for PWR fuel test mode and 1449W for CANDU fuel test mode. The each residual heat is assumed as 2% of the fission power of the test fuel used in the anticipated operational occurrence and design basis accident analyses. The each fission power used for the analyses is 105% of the rated fission power in the normal operation. In the long term cooling phase the residual heat is removed to the HANARO pool through the double pressure vessels of the in-pile test section. Saturate pooling boiling is assumed on the test fuel and condensation heat transfer is expected on the inner wall of the fuel carrier and the flow divider. Natural convection heat transfer on a heated vertical wall is also assumed on the outer wall of the outer pressure vessel. The conduction heat transfer is only considered in the gap between the double pressure vessels charged with neon gas and in the downcomer filled with coolant. The heat transfer rate between the coolant temperature of 152 .deg. C in the in-pile test section and the water temperature of 45 .deg. C in the HANARO pool is predicted as about 1666W. The 152 .deg. C is the saturate temperature of the coolant pressure predicted from the MARS code. The cooling capacity of 1666W is greater than the residual heats of 1323W and 1449W. Consequently the long term cooling performance of the 3-pin fuel test loop is sufficient for the anticipated operational occurrences and design basis accidents.
Lokan, Jan; And Others
Developed for the Basic Skills Testing Program (BSTP) in New South Wales, Australia, this teacher's manual describes the Blue Series 3 of the ACER (Australian Council for Educational Research) Tests of Basic Skills. The two tests in the series, Aspects of Literacy and Aspects of Numeracy, were administered statewide by government school classroom…
Lokan, Jan; And Others
Developed for the Basic Skills Testing Program (BSTP) in New South Wales, Australia, this teacher's manual describes the Green Series 3 of the ACER (Australian Council for Educational Research) Tests of Basic Skills. The two tests in this series, Aspects of Literacy and Aspects of Numeracy, were administered statewide by government school…
Dicty_cDB: Contig-U12867-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0.018 CP000581_85( CP000581 |pid:none) Ostreococcus lucimarinus CCE9901 ... 42 0.018 EU020406_1( EU020406 |pid:none) Thulinius steph...aniae clone Thul25f... 42 0.023 AE005673_3627( AE005673 |pid:none) Caulobacter cres
MAC Version 3.2, MBA Version 1.3 acceptance test summary report
International Nuclear Information System (INIS)
Russell, V.K.
1994-01-01
The K Basins Materials Accounting (MAC) and Materials Balance (MBA) programs had the Paradox Conversion to 4.0 ATP run to check out the systems. This report describes the results of the test and provides the signoff sheets associated with the testing. The test primarily concentrated on verifying that MAC and MBA software would run properly in the Paradox 4.0 environment. Changes in the MAC and MBA programs were basically limited to superficial items needed to accommodate the enhanced method of execution
Allen, K. A.; Bredero, B.; Van Damme, T.; Ulrich, D. A.; Simons, J.
2017-01-01
The validity and reliability of the Test of Gross Motor Development-3 (TGMD-3) were measured, taking into consideration the preference for visual learning of children with autism spectrum disorder (ASD). The TGMD-3 was administered to 14 children with ASD (4-10 years) and 21 age-matched typically developing children under two conditions: TGMD-3…
Test Results of a Nb3Sn Wind/React ''Stress-Managed'' Block Dipole
International Nuclear Information System (INIS)
McInturff, A.; Bish, P.; Blackburn, R.; Diaczenko, N.; Elliott, T.; Hafalia Jr., R.; Henchel, W.; Jaisle, A.; Lau, W.; Lietzke, A.; McIntyre, P.; Noyes, P.; Nyman, M.; Sattarov, A.; Sattarov, A.
2006-01-01
A second phase of a highfield dipole technology development has been tested. A Nb3Sn block-coil model dipole was fabricated, using magnetic mirror geometry and wind/react coil technology. The primary objective of this phase was to make a first experimental test of the stress-management strategy pioneered at Texas A and M. In this strategy a high-strength support matrix is integrated with the windings to intercept Lorentz stress from the inner winding so that it does not accumulate in the outer winding. The magnet attained a field that was consistent with short sample limit on the first quench; there was no training. The decoupling of Lorentz stress between inner and outer windings was validated. In ramp rate studies the magnet exhibited a remarkable robustness in rapid ramping operation. It reached 85 percent of short sample(ss) current even while ramping 2-3 T/s. This robustness is attributed to the orientation of the Rutherford cables parallel to the field in the windings, instead of the transverse orientation that characterizes common dipole designs. Test results are presented and the next development phase plans are discussed
Evaluation of LLTR Series II Test A-3 results
International Nuclear Information System (INIS)
Amos, J.C.; Chen, K.; Meyer, R.A.; Odegaard, T.K.; Whipple, J.C.
1980-11-01
Of the five secondary tubes failed in Test A-3, two were failed by impingement wastage, and the other three appear to have been caused by overheating possibly augmented by wastage. Since no secondary tube failures occurred during large leak tests, this spports the hypthesis that a small initial leak can create much more damage on neighboring tubes than an initial large leak. The overheating falures occurred in about 20 seconds after a second large hole had been produced in a thin wall (non-prototypical) primary tube. Continued water injection under static or low sodium flow conditions following an initial small leak will produce high temperatures which can result in deformation (bowing) of 2-1/4 Cr-1 Mo steam tubes and interference at the tube-tubespacer interface. The damage caused by either impingement wastage or overheating will occur at or above the elevation plane of the initial leak. If water/steam injection continues after removal of the sodium, water steam blanketing will cool the tubes heated by the SWR. Additional tube failures can be caused by overheating prior to rupture disc operation when leak rate is increased by secondary tube penetrations caused by wastage. Acoustic emission measurement provides a rapid means of leak detection for intermediate size leaks
Energy Technology Data Exchange (ETDEWEB)
Horiuchi, Rie [Division of Regenerative Medical Engineering, Center for Disease Biology and Integrative Medicine, Graduate School of Medicine, The University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan); Akimoto, Takayuki, E-mail: akimoto@m.u-tokyo.ac.jp [Division of Regenerative Medical Engineering, Center for Disease Biology and Integrative Medicine, Graduate School of Medicine, The University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan); Institute for Biomedical Engineering, Consolidated Research Institute for Advanced Science and Medical Care, Waseda University, 513 Waseda-tsurumaki, Shinjuku, Tokyo 162-0041 (Japan); Hong, Zhang [Institute for Biomedical Engineering, Consolidated Research Institute for Advanced Science and Medical Care, Waseda University, 513 Waseda-tsurumaki, Shinjuku, Tokyo 162-0041 (Japan); Ushida, Takashi [Division of Regenerative Medical Engineering, Center for Disease Biology and Integrative Medicine, Graduate School of Medicine, The University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan)
2012-08-15
Mechanical strain has been reported to affect the proliferation/differentiation of many cell types; however, the effects of mechanotransduction on self-renewal as well as pluripotency of embryonic stem (ES) cells remains unknown. To investigate the effects of mechanical strain on mouse ES cell fate, we examined the expression of Nanog, which is an essential regulator of self-renewal and pluripotency as well as Nanog-associated intracellular signaling during uniaxial cyclic mechanical strain. The mouse ES cell line, CCE was plated onto elastic membranes, and we applied 10% strain at 0.17 Hz. The expression of Nanog was reduced during ES cell differentiation in response to the withdrawal of leukemia inhibitory factor (LIF); however, two days of cyclic mechanical strain attenuated this reduction of Nanog expression. On the other hand, the cyclic mechanical strain promoted PI3K-Akt signaling, which is reported as an upstream of Nanog transcription. The cyclic mechanical strain-induced Akt phosphorylation was blunted by the PI3K inhibitor wortmannin. Furthermore, cytochalasin D, an inhibitor of actin polymerization, also inhibited the mechanical strain-induced increase in phospho-Akt. These findings imply that mechanical force plays a role in regulating Nanog expression in ES cells through the actin cytoskeleton-PI3K-Akt signaling. -- Highlights: Black-Right-Pointing-Pointer The expression of Nanog, which is an essential regulator of 'stemness' was reduced during embryonic stem (ES) cell differentiation. Black-Right-Pointing-Pointer Cyclic mechanical strain attenuated the reduction of Nanog expression. Black-Right-Pointing-Pointer Cyclic mechanical strain promoted PI3K-Akt signaling and mechanical strain-induced Akt phosphorylation was blunted by the PI3K inhibitor and an inhibitor of actin polymerization.
Comparisons of TRAC-PD2 calculations with Semiscale Mod-3 small-break tests
International Nuclear Information System (INIS)
Gilbert, J.S.; Sahota, M.S.; Boyack, B.E.; Booker, C.P.; Meier, J.K.
1981-01-01
Five experiments conducted in the Semiscale Mod-3 facility at the Idaho National Engineering Laboratory (INEL) were calculated using the latest released version of the Transient Reactor Analysis Code (TRAC-PD2). The results were used to assess TRAC-PD2 predictions of thermal-hydraulic phenomena and the effects of pump operation on system response during slow transients. Tests S-SB-P1, S-SB-P2, and S-SB-P7 simulated equivalent 2.5% communicative cold-leg breaks for early pump-trip (pumps-off), intermediate pump-trip (pumps-on), and late pump-trip (pumps-on) operation, respectively. Tests S-SB-P3 and S-SB-P4 simulated equivalent 2.5% communicative hot-leg breaks for pumps-off and pumps-on operation, respectively. Parameters examined in the study included primary system mass distribution, mass inventory, and void fraction distribution
Labelled T{sub 3}, T{sub 4} and TBP for In Vitro Testing of Thyroid Function in Man and Animals
Energy Technology Data Exchange (ETDEWEB)
Czerniak, P.; Boruchowski, Sabina; Shomron, I. [Dept. of Radiotherapy and Isotopes, Tel-Hashomer Hospital, Tel-Aviv University Medical School, Faculty of Continuing Medical Education, Tel-Aviv (Israel)
1970-02-15
Iodothyronines are bound to determined electrophoretic fractions of serum proteins - TBP (TBG, TBA, TBPA). Radioiodine labelled T{sub 3} and T{sub 4} complex the free TBP fractions until saturation. The excess of added in vitro thyronines is then absorbed by the RBC. The changes described can be detected and quantitatively determined by radioisotope tests: radioelectrophoresis - T{sub 3/4} BP test, and RBC - {sup 125}I T{sub 3} test (Hamolsky test). The in vitro tests of the thyroid function can be clinically reliable if the protein fractions are normal, and they may be altered without thyroid pathology if the TBG fractions are abnormal. The electrophoretic fractions vary quantitatively and qualitatively in animals of different classes and orders. We chose these features to study the correlation between iodothyronines, plasma proteins and the above-mentioned thyroid tests. Twenty-two animal species (arranged according to the increasing percentage of the Hamolsky test) were examined: goat (8.6%, cow, lamb, calf, man, camel, goose, hamster, rat, turkey, marmot, duck, horse, donkey, hen, dog, pigeon, rabbit, guinea-pig, mouse, fish and frog (91.5%). The following additional parameters were examined: PBI, serum quantitative electrophoresis, T{sub 3} BP studies. All the tests were performed under identical technical conditions. Results and conclusions: (1) The Hamolsky test in the examined animals ranges from 9% to 92%. It is highest in the poicolothermics, in which much prealbumin and few glubulins are found on electrophoresis. The T{sub 3} BP is low, and about a half of the added {sup 125}I T{sub 3} remains unbound. (2) T{sub 3} and T{sub 4} are complexed with T{sub 3} BP and T{sub 4} BP fractions, which correspond to prealbumin, albumin, alpha 1-2, beta and exceptionally gamma globulin. The fractions are variable but characteristic for each animal species. T{sub 3} BP does not correlate exactly with T{sub 4} BP, and seems to be distributed over more fractions
SIM PlanetQuest: The TOM-3 (Thermo-Optical-Mechanical) Siderostat Mirror Test
Phillips, Charles J.
2006-01-01
This slide presentation reviews the Space Interferometry Mission (SIM) PlanetQuest mission. It describes the mission, shows diagrams of the instrument, the collector bays, the Siderostat mirrors, the COL bay thermal environment, the TOM-3 replicating COL Bay Environment, the thermal hardware for the SID heater control, and the results of the test are shown
High Temperature Test Facility Preliminary RELAP5-3D Input Model Description
Energy Technology Data Exchange (ETDEWEB)
Bayless, Paul David [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-12-01
A RELAP5-3D input model is being developed for the High Temperature Test Facility at Oregon State University. The current model is described in detail. Further refinements will be made to the model as final as-built drawings are released and when system characterization data are available for benchmarking the input model.
International Nuclear Information System (INIS)
Wen, Z.; Liao, Q.; Hu, Y.; You, L.; Zhou, L.; Zhao, Y.
2013-01-01
Current therapy for pancreatic cancer is multimodal, involving surgery and chemotherapy. However, development of pancreatic cancer therapies requires a thorough evaluation of drug efficacy in vitro before animal testing and subsequent clinical trials. Compared to two-dimensional culture of cell monolayer, three-dimensional (3-D) models more closely mimic native tissues, since the tumor microenvironment established in 3-D models often plays a significant role in cancer progression and cellular responses to the drugs. Accumulating evidence has highlighted the benefits of 3-D in vitro models of various cancers. In the present study, we have developed a spheroid-based, 3-D culture of pancreatic cancer cell lines MIAPaCa-2 and PANC-1 for pancreatic drug testing, using the acid phosphatase assay. Drug efficacy testing showed that spheroids had much higher drug resistance than monolayers. This model, which is characteristically reproducible and easy and offers rapid handling, is the preferred choice for filling the gap between monolayer cell cultures and in vivo models in the process of drug development and testing for pancreatic cancer
Directory of Open Access Journals (Sweden)
Z. Wen
2013-08-01
Full Text Available Current therapy for pancreatic cancer is multimodal, involving surgery and chemotherapy. However, development of pancreatic cancer therapies requires a thorough evaluation of drug efficacy in vitro before animal testing and subsequent clinical trials. Compared to two-dimensional culture of cell monolayer, three-dimensional (3-D models more closely mimic native tissues, since the tumor microenvironment established in 3-D models often plays a significant role in cancer progression and cellular responses to the drugs. Accumulating evidence has highlighted the benefits of 3-D in vitro models of various cancers. In the present study, we have developed a spheroid-based, 3-D culture of pancreatic cancer cell lines MIAPaCa-2 and PANC-1 for pancreatic drug testing, using the acid phosphatase assay. Drug efficacy testing showed that spheroids had much higher drug resistance than monolayers. This model, which is characteristically reproducible and easy and offers rapid handling, is the preferred choice for filling the gap between monolayer cell cultures and in vivo models in the process of drug development and testing for pancreatic cancer.
CLUMP-3D: Testing ΛCDM with Galaxy Cluster Shapes
Sereno, Mauro; Umetsu, Keiichi; Ettori, Stefano; Sayers, Jack; Chiu, I.-Non; Meneghetti, Massimo; Vega-Ferrero, Jesús; Zitrin, Adi
2018-06-01
The ΛCDM model of structure formation makes strong predictions on the concentration and shape of dark matter (DM) halos, which are determined by mass accretion processes. Comparison between predicted shapes and observations provides a geometric test of the ΛCDM model. Accurate and precise measurements needs a full three-dimensional (3D) analysis of the cluster mass distribution. We accomplish this with a multi-probe 3D analysis of the X-ray regular Cluster Lensing and Supernova survey with Hubble (CLASH) clusters combining strong and weak lensing, X-ray photometry and spectroscopy, and the Sunyaev–Zel’dovich effect (SZe). The cluster shapes and concentrations are consistent with ΛCDM predictions. The CLASH clusters are randomly oriented, as expected given the sample selection criteria. Shapes agree with numerical results for DM-only halos, which hints at baryonic physics being less effective in making halos rounder.
Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.
1985-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup
Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.
1985-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the REM Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup. (author)
Postirradiation examination of high-U-loaded low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofmann, G.; Snelgrove, J.L.
1984-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examinated, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory poerformance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior during the slight bowing of some plates at about 80% burnup
Effects of zinc injection from hot functional test at Tomari Unit 3
International Nuclear Information System (INIS)
Hayakawa, Hitoshi; Mino, Yoshitaka; Nakahama, Satoshi; Aizawa, Yamato; Shimizu, Yuichi; Umehara, Ryuji; Kogawa, Noritaka
2012-09-01
At Tomari Nuclear Power Station unit 3 (hereafter Tomari unit 3, PWR, commercial operation from December 2009), the zinc injection for dose-rate reduction was started as early as at the Hot Functional Test (hereafter HFT) stage, for the first time in the world. The results of the Steam Generator (hereafter SG) insert plate analysis and the ambient dose-rate measurement till the end of the test operation reported heretofore, show the formation of the robust oxide film on the primary material surfaces and the associated corrosion suppression effect, and a considerable dose-rate reduction of about 40 to 60% lower than a reference plant. (*: Asian Water Chemistry Symposium in Nagoya on 2009 and NPC2010 in Canada). The material of SG tube is Alloy 690TT in Tomari unit 3. Generally, the dose-rates of the plants with Alloy 690TT SG are the highest at the 1. or 2. refueling outage (hereafter RFO), due to the effects of the Ni dissolution from the initial corrosion of Alloy 690TT. Therefore, the dose-rate of Tomari unit 3 at the 1. RFO is compared with those of the other Japanese PWR plants at their 1. RFO. As the result, the dose-rates inside the main components such as SG, Main Coolant Pipe (hereafter MCP) and Reactor Vessel (hereafter RV) are about 50% lower at the 1. RFO of Tomari unit 3 than those of a reference plant (a 3-Loop PWR plant in Japan). Therefore, an additional dose-rate reduction effects is expected by the Ni release rate reduction from Alloy 690TT and the effect of zinc injection. In this report, the actual dose-rates at the primary main components, the trends of the water chemistry and dose rates reduction effect with the zinc injection at the 1. RFO (offline in January 2011) of Tomari unit 3 are introduced. Also, a part of the experiences at the 2. RFO (offline in May 2012) is introduced. (authors)
International Nuclear Information System (INIS)
PITNER, A.L.
2000-01-01
A number of tools and equipment pieces are required to facilitate planned test operations during Phases 3 and 4 of the Phased Startup Initiative (PSI). These items will be used in assessing residual canister sludge quantities on cleaned fuel assemblies, sorting coarse and fine scrap fuel pieces, assessing the size distribution of scrap pieces, loading scrap into a canister, and measuring the depth of the accumulated scrap in a canister. This work plan supercedes those previously issued for development of several of these test items. These items will be considered prototype equipment until testing has confirmed their suitability for use in K West Basin. The process described in AP-EN-6-032 will be used to qualify the equipment for facility use. These items are considered non-OCRWM for PSI Phase 3 applications. The safety classification of this equipment is General Service, with Quality Level 0 (for PSI Phase 3). Quality Control inspections shall be performed to verify basic dimensions and overall configurations of fabricated components, and any special quality control verifications specified in this work plan (Section 3.1.5). These inspections shall serve to approve the test equipment for use in K West Basin (Acceptance Tag). This equipment is for information gathering only during PSI Phases 3 and 4 activities, and will be discarded at the completion of PSI. For equipment needed to support actual production throughput, development/fabrication/testing activities would be more rigorously controlled
TRAC-PF1/MOD1 independent assessment: Semiscale Mod-2A intermediate break test S-IB-3
International Nuclear Information System (INIS)
Kmetyk, L.N.
1986-02-01
The TRAC-PF1/MOD1 independent assessment project at Sandia National Laboratories is part of an overall effort funded by the NRC to determine the ability of various system codes to predict the detailed thermal/hydraulic response of light water reactors during accident and off-normal conditions. The TRAC code is being assessed at SNLA against test data from various integral and separate effects test facilities. As part of this assessment matrix, an intermediate break test (S-IB-3), performed at the Semiscale Mod-2A facility, has been analyzed. Using an input model with a 3-D VESSEL component, the vessel and downcomer inventories during 3-IB-3 were generally well predicted, but the core heatup was underpredicted compared to data. An equivalent calculation with an all 1-D input model ran about twice as fast as our basecase analysis using a 3-D VESSEL in the input model, but the results of the two calculations diverged significantly for many parameters of interest, with the 3-D VESSEL model results in better agreement with data. 22 refs., 100 figs
3D thermography for improving temperature measurements in thermal vacuum testing
Robinson, D. W.; Simpson, R.; Parian, J. A.; Cozzani, A.; Casarosa, G.; Sablerolle, S.; Ertel, H.
2017-09-01
The application of thermography to thermal vacuum (TV) testing of spacecrafts is becoming a vital additional tool in the mapping of structures during thermal cycles and thermal balance (TB) testing. Many of the customers at the European Space Agency (ESA) test centre, European Space Research and Technology Centre (ESTEC), The Netherlands, now make use of a thermal camera during TB-TV campaigns. This complements the use of embedded thermocouples on the structure, providing the prospect of monitoring temperatures at high resolution and high frequency. For simple flat structures with a well-defined emissivity, it is possible to determine the surface temperatures with reasonable confidence. However, for most real spacecraft and sub-systems, the complexity of the structure's shape and its test environment creates inter-reflections from external structures. This and the additional complication of angular and spectral variations of the spacecraft surface emissivity make the interpretation of the radiation detected by a thermal camera more difficult in terms of determining a validated temperature with high confidence and well-defined uncertainty. One solution to this problem is: to map the geometry of the test specimen and thermal test environment; to model the surface temperatures and emissivity variations of the structures and materials; and to use this model to correct the apparent temperatures recorded by the thermal camera. This approach has been used by a team from NPL (National Physical Laboratory), Psi-tran, and PhotoCore, working with ESA, to develop a 3D thermography system to provide a means to validate thermal camera temperatures, based on a combination of thermal imaging photogrammetry and ray-tracing scene modeling. The system has been tested at ESTEC in ambient conditions with a dummy spacecraft structure containing a representative set of surface temperatures, shapes, and spacecraft materials, and with hot external sources and a high power lamp as a sun
International Nuclear Information System (INIS)
MacLellan, J.A.; Traub, R.J.
1988-11-01
Draft American National Standards Institute (ANSI) Standard N13.30 (Performance Criteria for Radiobioassay) was developed for the US Department of Energy and the US Nuclear Regulatory Commission to help ensure that bioassay laboratories provide accurate and consistent results. The draft standard describes the procedures necessary to establish a bioassay performance-testing laboratory and program. The bioassay performance-testing laboratory will conduct tests to evaluate the performance of service laboratories. Pacific Northwest Laboratory helped develop testing procedures as part of an effort to evaluate the draft ANSI N13.30 performance criteria by testing the existing measurement capabilities of various bioassay laboratories. This report recommends guidelines for the preparation, handling, storage, distribution, shipping, and documentation of test phantoms used for calibration of measurement systems for direct bioassay. The data base and recommended records system for documenting radiobioassay performance at the service laboratories are also presented
Summary and evaluation: fuel dynamics loss-of-flow experiments (tests L2, L3, and L4)
International Nuclear Information System (INIS)
Barts, E.W.; Deitrich, L.W.; Eberhart, J.G.; Fischer, A.K.; Meek, C.C.
1975-09-01
Three similar experiments conducted to support the analyses of hypothetical LMFBR unprotected-loss-of-flow accidents are summarized and evaluated. The tests, designated L2, L3, and L4, provided experimental data against which accident-analysis codes could be compared, so as to guide further analysis and modeling of the initiating phases of the hypothetical accident. The tests were conducted using seven-pin bundles of mixed-oxide fuel pins in Mark-II flowing-sodium loops in the TREAT reactor. Test L2 used fresh fuel. Tests L3 and L4 used irradiated fuel pins having, respectively, ''intermediate-power'' (no central void) and ''high-power'' (fully developed central void) microstructure. 12 references
LCLS-II 1.3 GHz cryomodule design - lessons learned from testing at Fermilab
Kaluzny, J.; Hurd, J.; Orlov, Y.; He, Y.; Bossert, R.; Grimm, C.; Schappert, W.; Atassi, O. Al; Wang, R.; Arkan, T.; Theilacker, J.; Klebaner, A.; White, M.; Wu, G.; Makara, J.; Ginsburg, C.; Pei, L.; Holzbauer, J.; Hansen, B.; Stanek, R.; Peterson, T.; Harms, E.
2017-12-01
Fermilab’s 1.3 GHz prototype cryomodule for the Linac Coherent Light Source Upgrade (LCLS-II) has been tested at Fermilab’s Cryomodule Test Facility (CMTF). Aspects of the cryomodule design have been studied and tested. The cooldown circuit was used to quickly cool the cavities through the transition temperature, and a heater on the circuit was used to heat incoming helium for warmup. Due to the 0.5% slope of the cryomodule, the liquid level is not constant along the length of the cryomodule. This slope as well as the pressure profile caused liquid level management to be a challenge. The microphonics levels in the cryomodule were studied and efforts were made to reduce them throughout testing. Some of the design approaches and studies performed on these aspects will be presented. Fermilab is operated by Fermi Research Alliance, LLC under Contract No. De-AC02-07CH11359 with the United States Department of Energy. This work was supported, in part, by the LCLS-II Project.
Assembly and Tests of SQ02, a Nb3Sn Racetrack Quadrupole Magnet for LARP
International Nuclear Information System (INIS)
Ferracin, Paolo; Ambrosio, G.; Barzi, E.; Caspi, S.; Dietderich, D.R.; Feher, S.; Gourlay, S.A.; Hafalia, A.R.; Hannaford, C.R.; Lizarazo, J.; Lietzke, A.F.; McInturff, A.D.; Sabbi, G.L.; Zlobin, A.V.
2007-01-01
The US LHC Accelerator Research Program (LARP) consists of four US laboratories (BNL, FNAL, LBNL, and SLAC) collaborating with CERN to achieve a successful commissioning of the LHC and to develop the next generation of Interaction Region magnets. In 2004, a large aperture Nb 3 Sn racetrack quadrupole magnet (SQ01) has been fabricated and tested at LBNL. The magnet utilized four subscale racetrack coils and was instrumented with strain gauges on the support structure and directly over the coil's turns. SQ01 exhibited training quenches in two of the four coils and reached a peak field in the conductor of 10.4 T at a current of 10.6 kA. After the test, the magnet was disassembled, inspected with pressure indicating films, and reassembled with minor modifications. A second test (SQ01b) was performed at FNAL and included training studies, strain gauge measurements and magnetic measurements. Magnet inspection, test results, and magnetic measurements are reported and discussed, and a comparison between strain gauge measurements and 3D finite element computations is presented
Assembly and Tests of SQ02, a Nb3Sn Racetrack Quadrupole Magnet for LARP
Energy Technology Data Exchange (ETDEWEB)
Ferracin, Paolo; Ambrosio, G.; Barzi, E.; Caspi, S.; Dietderich, D.R.; Feher, S.; Gourlay, S.A.; Hafalia, A.R.; Hannaford, C.R.; Lizarazo, J.; Lietzke, A.F.; McInturff, A.D.; Sabbi, G.L.; Zlobin, A.V.
2007-06-01
The US LHC Accelerator Research Program (LARP) consists of four US laboratories (BNL, FNAL, LBNL, and SLAC) collaborating with CERN to achieve a successful commissioning of the LHC and to develop the next generation of Interaction Region magnets. In 2004, a large aperture Nb{sub 3}Sn racetrack quadrupole magnet (SQ01) has been fabricated and tested at LBNL. The magnet utilized four subscale racetrack coils and was instrumented with strain gauges on the support structure and directly over the coil's turns. SQ01 exhibited training quenches in two of the four coils and reached a peak field in the conductor of 10.4 T at a current of 10.6 kA. After the test, the magnet was disassembled, inspected with pressure indicating films, and reassembled with minor modifications. A second test (SQ01b) was performed at FNAL and included training studies, strain gauge measurements and magnetic measurements. Magnet inspection, test results, and magnetic measurements are reported and discussed, and a comparison between strain gauge measurements and 3D finite element computations is presented.
Ciclo de convesrión de efectivo en las grandes empresas de comercio al detal en Colombia (1998-2002
Directory of Open Access Journals (Sweden)
Néstor Moreno Meza
2004-01-01
Full Text Available El presente artículo estudia las magnitudes y las implicaciones financieras del ciclo de conversión de efectivo (CCE, concepto desarrollado por Richards y Laughlin (1980 para integrar tres indicadores fundamentales del capital de trabajo y de la gestión del circulante en la empresa comercial, como son los días de inventario, los días de cartera y los días de crédito de proveedores. Estimado a partir de los estados financieros de una muestra de cinco grandes empresas del comercio minorista en Colombia (Almacenes Éxito-Cadenalco, Carulla- Vivero, Supertiendas y Droguerías Olímpica, Cacharrería La 14 y Carrefour, las cifras del CCE correspondientes al período 1998-2002 revelan la importancia del apalancamiento financiero basado en la cuenta de proveedores, así como sus implicaciones para el capital de trabajo y el equilibrio financiero de estas cadenas comerciales.
Exposure history determines pteropod vulnerability to ocean acidification along the US West Coast.
Bednaršek, N; Feely, R A; Tolimieri, N; Hermann, A J; Siedlecki, S A; Waldbusser, G G; McElhany, P; Alin, S R; Klinger, T; Moore-Maley, B; Pörtner, H O
2017-07-03
The pteropod Limacina helicina frequently experiences seasonal exposure to corrosive conditions (Ω ar US West Coast and is recognized as one of the species most susceptible to ocean acidification (OA). Yet, little is known about their capacity to acclimatize to such conditions. We collected pteropods in the California Current Ecosystem (CCE) that differed in the severity of exposure to Ω ar conditions in the natural environment. Combining field observations, high-CO 2 perturbation experiment results, and retrospective ocean transport simulations, we investigated biological responses based on histories of magnitude and duration of exposure to Ω ar history of exposure to corrosive conditions. Pteropods from the coastal CCE appear to be at or near the limit of their physiological capacity, and consequently, are already at extinction risk under projected acceleration of OA over the next 30 years. Our results demonstrate that Ω ar exposure history largely determines pteropod response to experimental conditions and is essential to the interpretation of biological observations and experimental results.
International Nuclear Information System (INIS)
Matheson, J.; Moldovan, G.; Clark, A.; Prydderch, M.; Turchetta, R.; Derbyshire, G.; Kirkland, A.; Allinson, N.
2009-01-01
As part of a feasibility study into the use of novel electron detectors for X-ray photoelectron emission microscopes (XPEEM), we have characterised the imaging performance of a back-illuminated monolithic active pixel sensor (MAPS) operating under both integrating and counting modes for electrons in the energy range 10-20 keV. For integrating mode, we present the detective quantum efficiency (DQE), which shows marked improvements over conventional indirect detectors based on microchannel plates. We also present the modulation transfer function (MTF) and noise power spectrum (NPS), again demonstrating significantly improved performance. For counting mode, we present the quantum efficiency (QE) as a function of incident electron energy. We have evaluated the charge collection efficiency (CCE) and we thereby demonstrate the presence of a ∼200 nm thick dead layer that is linked with reduced CCE at low electron energies. Based on our findings, we believe that the MAPS technology is well matched to future XPEEM instruments using aberration correction.
Emerging National Space Launch Programs. Economics and Safeguards
1993-01-01
Husayn (600) plus shorter range missiles South Korea SLV Planned Modified Nike Hercules (240) Pakistan SLV Planned Hatf 3? (600) Hatf 2 (300) Hatf 1...pad aiud support Fiacili. ties. (ColigIVSý’:iol ill lBUdgi’t Of’cce, Envowmginlg Il’ivt’’ hin- vs /c’iit in Spntco Actic’iti’s, 36 4 Of course, one...Based on (i) a typical load of 96 missiles, including reloads, for each ASTRO-.I SS.30 system (lane’s Armour and Artillery 1990-91, p. 694) and (2) a
Daily Magnetograms for 1978 from the AFGL (Air Force Geophysics Laboratory) Network.
1985-01-08
rj4TE Y rCCE#i~nT * 9 vEflEL(6-1"i( LI"ISI( td HEUs 813 7..8... ... .... M 5 3 ... . .. .. .... .. . .. ... .. .. ... .... .. .. .. . .. .. I?’ a 7...Y LS 7 .. .. . .. . . . .. . . . . . . . . .. . - ’ - S U E . . ... . . . .. . . . .. . . . . . . .. . .. . . 534S 4349QO L.~ El jIjI -2 td [w1.2...8M) iHQ ’~LTP FLMAfEOEO EUR FLUNG.ATE X CLVRC8ET 40 HIfMO1SLAM’TVUOR DIVISION 18S33 172707 81%6 TPA 2595 .’g 977 FL-ttTY-C4FLVA()T 40 tbMTES-LAS#1’VUOR
Development and manufacture of a Nb3Sn superconductor for the high-field test facility
International Nuclear Information System (INIS)
Scanlan, R.M.; Cornish, D.N.; Spencer, C.R.; Gregory, E.; Adam, E.
1981-01-01
The High-Field Test Facility (HFTF) project has two primary goals. The first is to establish manufacturing capability for a Nb 3 Sn conductor suitable for use in a mirror fusion coil. The second is to provide a test facility for evaluating other fusion conductor designs at high fields. This paper describes some of the problems encountered and the solutions devised in working toward the first goal. Construction of the test facility coils will be described in a subsequent paper
Bruze, Magnus; Andersen, Klaus Ejner; Goossens, An
2008-03-01
The currently used fragrance mix in the European baseline patch test series (baseline series) fails to detect a substantial number of clinically relevant fragrance allergies. To investigate whether it is justified to include hydroxyisohexyl 3-cyclohexene carboxaldehyde (Lyral) and fragrance mix 2 containing hydroxyisohexyl 3-cyclohexene carboxaldehyde, citral, farnesol, coumarin, citronellol, and alpha-hexyl cinnamal in the European baseline patch test series. Survey of the literature on reported frequencies of contact allergy and allergic contact dermatitis from fragrance mix 2 and hydroxyisohexyl 3-cyclohexene carboxaldehyde (Lyral) as well as reported results of experimental provocation test. Fragrance mix 2 has been demonstrated to be a useful additional marker of fragrance allergy with contact allergy rates up to 5% when included in various national baseline patch test series. Of the fragrance substances present in fragrance mix 2, hydroxyisohexyl 3-cyclohexene carboxaldehyde is the most common sensitizer. Contact allergy rates between 1.5% and 3% have been reported for hydroxyisohexyl 3-cyclohexene carboxaldehyde in petrolatum (pet.) at 5% from various European centres when tested in consecutive dermatitis patients. From 2008, pet. preparations of fragrance mix 2 at 14% w/w (5.6 mg/cm(2)) and hydroxyisohexyl 3-cyclohexene carboxaldehyde at 5% w/w (2.0 mg/cm(2)) are recommended for inclusion in the baseline series. With the Finn Chamber technique, a dose of 20 mg pet. preparation is recommended. Whenever there is a positive reaction to fragrance mix 2, additional patch testing with the 6 ingredients, 5 if there are simultaneous positive reactions to hydroxyisohexyl 3-cyclohexene carboxaldehyde and fragrance mix 2, is recommended.
40 CFR Appendix A-2 to Part 60 - Test Methods 2G through 3C
2010-07-01
... Velocity Decay Near the Stack Wall Method 3—Gas analysis for the determination of dry molecular weight... a tester facing a test port in a vertical stack, the pitch component of flow is the vector of flow moving from the center of the stack toward or away from that test port. The pitch angle is the angle...
IR1 flow tube and In-Pile Test Section Pressure drop test for the 3-Pin Fuel Test Loop
Energy Technology Data Exchange (ETDEWEB)
Lee, H. H.; Park, K. N.; Chi, D. Y.; Sim, B. S.; Park, S. K.; Lee, J. M.; Lee, C. Y.; Kim, H. N
2006-02-15
The in-pile Section (IPS) of 3-pin Fuel Test Loop(FTL) shall be installed in the vertical hole call IR1 of HANARO reactor core. In order to verify the pressure drop and flow rate both the inside region of IPS at the annular region between IPS and IR1 flow tube, a pressure drop was measured by varing the flow rate on both regions. The measured pressure drop in the annular region is 209kpa at 14.9kg/s which meets the limiting condition of operation of 200kpa. The measured pressure drop in side the IPS becomes 260.25kpa which is lower than the designed value of 306.65kpa. As the pressure drop is lower than the design value, it is quite conservative from the safety and operating point of view.
Barrier Performance of CVD Graphene Films Using a Facile P3HT Thin Film Optical Transmission Test
Directory of Open Access Journals (Sweden)
Srinivasa Kartik Nemani
2018-01-01
Full Text Available The barrier performance of CVD graphene films was determined using a poly(3-hexylthiophene (P3HT thin film optical transmission test. P3HT is a semiconducting polymer that photo-oxidatively degrades upon exposure to oxygen and light. The polymer is stable under ambient conditions and indoor lighting, enabling P3HT films to be deposited and encapsulated in air. P3HT’s stability under ambient conditions makes it desirable for an initial evaluation of barrier materials as a complimentary screening method in combination with conventional barrier tests. The P3HT test was used to demonstrate improved barrier performance for polymer substrates after addition of CVD graphene films. A layer-by-layer transfer method was utilized to enhance the barrier performance of monolayer graphene. Another set of absorption measurements were conducted to demonstrate the barrier performance of graphene and the degradation mechanism of graphene/P3HT over multiple wavelengths from 400 to 800 nm. The absorption spectra for graphene/polymer composite were simulated by solving Fresnel equations. The simulation results were found to be in good agreement with the measured absorption spectra. The P3HT degradation results qualitatively indicate the potential of graphene films as a possible candidate for medium performance barriers.
Production and testing of an s-band resonator with a Nb3Sn surface
International Nuclear Information System (INIS)
Peiniger, M.
1983-01-01
This report describes the preparation of a niobium s-band resonator with Nb3Sn surface using a special vapor phase deposition method. High-frequency superconductivity tests were performed on this resonator. Measurements of transition temperature, penetration depth, energy gap, and temperature dependence of surface conductivity of Nb3Sn, and resonator behaviour at high electrical field strengths are reported. (GSCH)
Rhodnius prolixus supergene families of enzymes potentially associated with insecticide resistance.
Schama, Renata; Pedrini, Nicolás; Juárez, M Patricia; Nelson, David R; Torres, André Q; Valle, Denise; Mesquita, Rafael D
2016-02-01
Chagas disease or American trypanosomiasis, is a potentially life-threatening illness caused by the protozoan parasite, Trypanosoma cruzi. Once known as an endemic health problem of poor rural populations in Latin American countries, it has now spread worldwide. The parasite is transmitted by triatomine bugs, of which Rhodnius prolixus (Hemiptera, Reduviidae, Triatominae) is one of the vectors and a model organism. This species occurs mainly in Central and South American countries where the disease is endemic. Disease prevention focuses on vector control programs that, in general, rely intensely on insecticide use. However, the massive use of chemical insecticides can lead to resistance. One of the major mechanisms is known as metabolic resistance that is associated with an increase in the expression or activity of detoxification genes. Three of the enzyme families that are involved in this process - carboxylesterases (CCE), glutathione s-transferases (GST) and cytochrome P450s (CYP) - are analyzed in the R. prolixus genome. A similar set of detoxification genes to those of the Hemipteran Acyrthosiphon pisum but smaller than in most dipteran species was found in R. prolixus genome. All major CCE classes (43 genes found) are present but the pheromone/hormone processing class had fewer genes than usual. One main expansion was detected on the detoxification/dietary class. The phosphotriesterase family, recently associated with insecticide resistance, was also represented with one gene. One microsomal GST gene was found and the cytosolic GST gene count (14 genes) is extremely low when compared to the other hemipteran species with sequenced genomes. However, this is similar to Apis mellifera, a species known for its deficit in detoxification genes. In R. prolixus 88 CYP genes were found, with representatives in the four clans (CYP2, CYP3, CYP4 and mitochondrial) usually found in insects. R. prolixus seems to have smaller species-specific expansions of CYP genes than
Preliminary Report on Oak Ridge National Laboratory Testing of Drake/ACSS/MA2/E3X
Energy Technology Data Exchange (ETDEWEB)
Irminger, Philip [ORNL; Davis, Cody [General Cable Corporation; Temple, Bill [General Cable Corporation; Baker, Gord [General Cable Corporation; Starke, Michael R [ORNL
2016-01-01
A key to industry acceptance of a new technology is extensive validation in field trials. The Powerline Conductor Accelerated Test facility (PCAT) at Oak Ridge National Laboratory (ORNL) is specifically designed to evaluate the performance and reliability of a new conductor technology under real world conditions. The facility is set up to capture lar