WorldWideScience

Sample records for cce faimbe facce

  1. Carcinoma Celular Escamoso (CCE) felino

    OpenAIRE

    Roque Lagarde

    2008-01-01

    INTRODUCCIÓNEl plano nasal blanco del felino es asiento frecuente del Carcinoma Celular Escamoso (CCE). Generalmente se produce a continuación de una dermatitis actínica recidivante estacional.Su incidencia es mayor en las regiones de clima templado y en felinos que tienen por costumbre “asolearse”crónicamente y durante períodos prolongados durante los meses del verano.Las radiaciones solares no ionizantes ultravioletas (UVB) son más intensas y penetrantes a través de las capas superficiales ...

  2. Carcinoma Celular Escamoso (CCE felino

    Directory of Open Access Journals (Sweden)

    Roque Lagarde

    2008-12-01

    Full Text Available INTRODUCCIÓNEl plano nasal blanco del felino es asiento frecuente del Carcinoma Celular Escamoso (CCE. Generalmente se produce a continuación de una dermatitis actínica recidivante estacional.Su incidencia es mayor en las regiones de clima templado y en felinos que tienen por costumbre “asolearse”crónicamente y durante períodos prolongados durante los meses del verano.Las radiaciones solares no ionizantes ultravioletas (UVB son más intensas y penetrantes a través de las capas superficiales de la piel durante los meses del verano y entre las 10 hs. y las 16 hs. (incidencia perpendicular de los rayos por lo que deberán ser evitadas.Siendo la nariz del gato una zona tan visible, llama la atención, que ciertas lesiones iniciales, algunas de regular tamaño (2mm, no sean advertidas por sus dueños y ocasionalmente, tenidas poco en cuenta por algunos profesionales.Posiblemente, el desconocimiento de la gravedad potencial de esta afección sea la causa de este proceder

  3. 48 CFR 301.603-72 - FAC-C and HHS SAC certification requirements.

    Science.gov (United States)

    2010-10-01

    ... available to all acquisition staff who are/will be involved as Contracting Officers or Contract Specialists... retention of certification, including the requirement to earn continuous learning points (CLPs). FAC-C... three sets of requirements: Education, training, and experience, and the requirements are...

  4. Analysis of the pattern of expression of the Fanconi anemia group C (Facc) gene during murine development

    Energy Technology Data Exchange (ETDEWEB)

    Krasnoshtein, F.; Buchwald, M. [Hospital for sick children, Ontario (Canada)

    1994-09-01

    Fanconi anemia (FA) is an autosomal recessive disorder characterized by a variety of congenital and skeletal malformations, progressive pancytopanenia and predisposition to malignancies. FA cells display chromosomal instability and hypersensitivity to DNA-damaging agents. Both the human and the corresponding murine cDNAs have been cloned in our lab. Here we describe the expression of Facc during mouse development, using mRNA in situ hybridization. Our aim is to obtain clues on the possible function of the Facc gene product during development that may help elucidate basic defect(s) in FA. In addition, knowledge of the exact pattern of Facc expression will assist in interpreting the phenotypes of mutant mice, currently being developed. In embryos the gene is diffusely expressed over the entire embryo, with higher hybridization levels in the mesenchyme and in both upper and lower extremities. Specific expression of Facc is seen in the perichondrium and marrow of long bones of hind limbs/hip; long bones of front limbs/shoulder region; developing digits of front and hind paws; and ribs. The signal is also detected in the following regions: cranial/frontal; facial/periorbital and maxillary/mandibular, hair follicles, diaphragm and lung. In addition, generalized Facc expression is seen during these embryonic stages. The pattern of Facc expression is consistent with the known skeletal abnormalities in FA patients, which include radial ray deformities, metacarpal hypoplasia, and abnormalities of lower limbs, ribs, head and face. The signal in the lung is consistent with the lung lobe absence and abnormal pulmonary drainage that have been detected in some FA patients. The sloped forehead and microcephaly in FA patients may have some association with the signal seen in the frontal region of the mouse cranium. Taken together, our results suggest that Facc is directly involved in the development of various embryonic tissues, particularly bone.

  5. The AMPTE CCE Magnetic Field Experiment

    Science.gov (United States)

    Potemra, T. A.; Zanetti, L. J.; Acuna, M. H.

    1985-01-01

    The Magnetic Field Experiment on the Active Magnetosheric Particle Tracer Explorer (AMPTE) Charge Composition Explorer (CCE) spacecraft consists of a triaxial fluxgate-magnetometer system containing sensors mounted on a 2.3-m two-link collapsible boom. It is pointed out that this instrument is similar to those flown on Voyager 1 and 2, and those scheduled to flight on the Giotto and Viking spacecraft. A description is provided of the sensor system and the analog electronics, and some preliminary data are presented.

  6. Evidence for a founder effect for the IVS4 +4 A{r_arrow}T mutation in the Fanconi anemia gene FACC in a Jewish population

    Energy Technology Data Exchange (ETDEWEB)

    Verlander, P.C.; Kaporis, A.G.; Qian, L. [Rockefeller Univ., New York, NY (United States)] [and others

    1994-09-01

    Fanconi anemia (FA) is a genetically heterogeneous autosomal recessive disorder defined by hypersensitivity of cells to DNA cross-linking agents; a gene for complementation group C(FACC) has been cloned. Two common mutations, IVS4 +4 A{r_arrow}T and 322delG, and several rare mutations have recently been reported in affected individuals. We now report the development of amplification refractory mutation system (ARMS) assays for rapid, non-radioactive detection of these known mutations in FACC. Primer pairs specific for variant sequences were designed, with the 3{prime} terminal base of one primer matching the variant base. PCR products are separated by electrophoresis on 2.5% agarose gels; mutations are indicated by the presence of a band of a specific size. These ARMS assays can be multiplexed to allow screening for all known mutations in two PCR reactions. We have used these assays for detection of FACC mutations in affected individuals in the International Fanconi Anemia Registry (IFAR), and for carrier detection FACC families. IVS4 +4 A{r_arrow}T is the only FACC mutation found in Jewish FA patients and their families, of both Ashkenazi and Sephardic ancestry. This mutation was not found in any affected individual of non-Jewish origin. In addition, DNA samples from 1596 healthy Jewish individuals primarily of Ashkenazi ancestry were supplied to us by Dor Yeshorim. These samples, ascertained for carrier screening for Tay Sachs, cystic fibrosis, and other genetic diseases with a high frequency in the religious Jewish community served by this organization, were tested for both IVS4 +4 A{r_arrow}T and 322delG mutations; seventeen IVS4 +4 A{r_arrow}T are of Sephardic Jewish ancestry. We hypothesize that IVS4 +4 A{r_arrow}T is a very old mutation, predating the divergence of the Ashkenazi and Sephardic populations. Haplotype analysis with microsatellite markers is in progress.

  7. The AMPTE/CCE Hot-Plasma Composition Experiment (HPCE)

    Science.gov (United States)

    Shelley, E. G.; Ghielmetti, A.; Hertzberg, E.; Battel, S. J.; Altwegg-Von Burg, K.; Balsiger, H.

    1985-01-01

    The Hot-Plasma Composition Experiment (HPCE) on the AMPTE-CCE spacecraft consists of an energetic ions-mass spectrometer and an electron background-environment monitor (EBEM). The mass spectrometer covers the entire mass per charge range from below 1 to greater than 150 amu/e and the energy per charge range from 0 eV/e (spacecraft potential) to 17 keV/e. The EBEM measures electrons between 50 eV and 25 keV in eight broad energy bands. The ion and electron data are processed into color spectrogram formats for the data pool.

  8. CCE measurements on heavily irradiated micro-strip sensors

    International Nuclear Information System (INIS)

    The paper describes a study of the radiation hardness of micro-strip devices, processed on different silicon substrates, designed to explore the feasibility of a tracker system for the experiments upgrade at the Super-LHC (S-LHC) collider. The radiation tolerance of the devices has been established comparing the Charge Collection Efficiency (CCE) measured on irradiated and not irradiated sensors of the same type. The CCE has been measured with minimum ionizing events and the read-out electronics and data acquisition system are the same designed for the CMS experiment at LHC. The performances of different silicon substrates (MCz, Fz, Epi) and different bulk doping types (p, n) have been investigated. The radiation hardness has been studied up to a fluence of 3.5x1015neqcm-2, value expected at a radial distance of about 9 cm from the interaction point at S-LHC. Preliminary results of radiation hard candidate material are shown. This work is part of the research activities of INFN SMART and RD50 CERN collaborations.

  9. Substorm variations in the magnitude of the magnetic field - AMPTE/CCE observations

    Science.gov (United States)

    Lopez, R. E.; Sibeck, D. G.; Lui, A. T. Y.; Takahashi, K.; Mcentire, R. W.

    1988-01-01

    Using energetic-particle data taken in the near-earth tail by the AMPTE/Charge Composition Explorer (CCE) satellite, 167 ion injection events, that were essentially dispersionless over a 25-285 keV energy range, were identified, and the variations in the total magnetic field strength over the course of these events were examined in order to determine the dependence of the magnetic field strength on dipole latitude. Results indicate that, during periods of substorm activity, the latitudinal position of the current sheet varied significantly within the 32-deg wedge centered on the dipole equator traversed by CCE. Results also suggest that, even in the near-earth magnetotail out to 8.8 R(E) (CCE apogee), the local field measurements are a better guide to the determination of satellite's position relative to the current shield during a substorm, than is the magnetic latitude.

  10. CCE measurements and annealing studies on proton-irradiated p-type MCz silicon diodes

    CERN Document Server

    Hoedlmoser, H; Köhler, M; Nordlund, H

    2007-01-01

    Magnetic Czochralski (MCz) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of p-type MCz Silicon diodes irradiated with protons up to a fluence of has been performed by means of Charge Collection Efficiency (CCE) measurements as well as standard CV/IV characterizations. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. A subsequent annealing study of the irradiated detectors shows an increase in effective doping concentration and a decrease in the leakage current, whereas the CCE remains basically unchanged. Two different series of detectors have been compared differing in the implantation dose of p-spray isolation as well as effective doping concentration (Neff) of the p-type bulk presumably due to a difference in thermal donor (TD) activation during processing. The series with the higher concentration of TDs shows a delayed reverse annealing of Neff after irradia...

  11. CCE plasma wave observations during the storm of September 4, 5, 1984. [Charge Composition Explorer

    Science.gov (United States)

    Scarf, F. L.

    1985-01-01

    Near 0700 on September 4, 1984 a series of interplanetary discontinuities arrived at earth when the AMPTE Charge Composition Explorer (CCE) was near apogee. During the next few hours the spacecraft passed in and out of the magnetosheath. At the magnetopause boundary, the CCE wave instrument detected strong electron plasma oscillations, weaker electromagnetic waves at the electron plasma frequency, and broadband electrostatic waves. During the subsequent perigee passes on September 4 and 5, the wave observations of upper hybrid resonance emissions, continuum radiation, electrostatic noise bands and unusual low latitude auroral kilometic radiation were used to monitor significant variations in the magnetospheric characteristics as the main storm phases developed.

  12. The AMPTE CCE Spacecraft. [Active Magnetospheric Particle Tracer Explorer Charge Composition Explorer

    Science.gov (United States)

    Dassoulas, J.; Peterson, M. R.; Margolies, D. L.

    1985-01-01

    The flight segment of the Active Magnetospheric Particle Tracer Explorers (AMPTE) Program consisted of three separate spacecraft which were launched 'piggyback' into orbit aboard a Delta 3924 launch vehicle, from Cape Canaveral, FL, on August 16, 1984. The three spacecaft are the Charge Composition Explorer (CCE), built for NASA by the Applied Physics Laboratory of the Johns Hopkins University (APL/JHU); the Ion Release Module (IRM), built in the Federal Republic of Germany; and the United Kingdom Subsatellite (UKS), built in the United Kingdom. This paper describes the CCE Spacecraft design, development, and early performance in orbit.

  13. The physical oceanographic environment during the CCE-LTER Years: Changes in climate and concepts

    Science.gov (United States)

    Miller, Arthur J.; Song, Hajoon; Subramanian, Aneesh C.

    2015-02-01

    The California Current System (CCS) has been studied by the California Cooperative Oceanic Fisheries Investigations program for many decades. Since 2004, the Southern California Bight (SCB) and the oceanic region offshore has also been the site for the California Current Ecosystem (CCE) Long-Term Ecological Research (LTER) program, which has established long-term observational time series and executed several Process Cruises to better understand physical-biological variations, fluxes and interactions. Since the inception of the CCE-LTER, many new ideas have emerged about what physical processes are the key controls on CCS dynamics. These new perspectives include obtaining a better understanding of what climate patterns exert influences on CCS physical variations and what physical controls are most important in driving CCE ecological changes. Physical oceanographic and climatological conditions in the CCS varied widely since the inception of the CCE-LTER observational time series, including unusual climate events and persistently anomalous states. Although the CCE-LTER project commenced in 2004 in the midst of normal ocean conditions near the climatological means, over the following decade, El Nino/Southern Oscillation conditions flickered weakly from warm to cold, with the Pacific Decadal Oscillation (PDO) generally tracking that behavior, while the North Pacific Gyre Oscillation (NPGO) evolved to persistent and strong positive conditions after 2007, indicative of enhanced upwelling from 2007 to 2012. Together the combined impact of the negative PDO state (La Nina conditions) and positive NPGO state (increased upwelling conditions) yielded remarkably persistent cool conditions in the CCS from late 2007 to early 2009 and from mid-2010 through 2012. The broad-scale climate variations that occurred over the North Pacific and CCS during this time period are discussed here to provide physical context for the CCE-LTER time series observations and the CCE-LTER Process

  14. Indications for ionospheric participation in the substorm process from AMPTE/CCE observations

    International Nuclear Information System (INIS)

    The authors present and discuss observations with the AMPTE/CCE spacecraft in the near-earth nightside magnetosphere, which show a significant enhancement of ionospheric particle presence (mainly O+) at the beginning of the substorm growth phase. Such an enhancement indicates not only an ionospheric participation in the substorm initiation, but also an active role in the substorm growth phase

  15. Indications for ionospheric participation in the substorm process from AMPTE/CCE observations. [Charge Composition Explorer

    Science.gov (United States)

    Daglis, I. A.; Sarris, E. T.; Kremser, G.

    1990-01-01

    Observations with the AMPTE/CCE spacecraft in the near-earth nightside magnetosphere show a significant enhancement of ionospheric particle presence, mainly O(+), at the beginning of the substorm growth phase. Such an enhancement indicates not only an ionospheric participation in the substorm initiation, but also an active role in the substorm growth phase.

  16. CCE-Westlake High School: A Case Study. Documentation and Technical Assistance in Urban Schools.

    Science.gov (United States)

    Paoli, Lillian

    This study documents the evolution and implementation of a program directed by the Council on Comprehensive Education (CCE) toward the purpose of realizing community control of a comprehensive high school in New York City. The program was one of nine at sites selected by the Documentation and Technical Assistance (DTA) Project as representing…

  17. Spectroscopic Classification of AT SN 2016cce (=PTSS-16dzd) as a Type Ia Supernova

    Science.gov (United States)

    Zhang, Jujia; Zhang, Xiliang; Wang, Xiaofeng; Li, Wenxiong; Yang, Zesheng; Li, Bin; Xu, Zhijian; Zhao, Haibin; Wang, Lifan

    2016-05-01

    We obtained an optical spectrum (range 345-910 nm) of SN 2016cce (=PTSS-16dzd), discovered by the PMO-Tsinghua Supernova Survey (PTSS: http://119.78.210.3/ptss2/ ), on UT Apr.30.7 2016 with the 2.4-m telescope (+YFOSC) at LiJiang Gaomeigu Station of Yunnan Astronomical Observatories (YNAO).

  18. Crystal structure of cce_0566 from Cyanothece 51142, a protein associated with nitrogen fixation in the DUF269 family

    OpenAIRE

    BUCHKO, GARRY W.; Robinson, Howard

    2012-01-01

    The crystal structure for cce_0566 (171 aa, 19.4 kDa), a DUF269 annotated protein from the diazotrophic cyanobacterium Cyanothece sp. ATCC 51142, was determined to 1.60 Å resolution. Cce_0566 is a homodimer with each molecule composed of eight α-helices folded on one side of a three strand anti-parallel β-sheet. Hydrophobic interactions between the side chains of largely conserved residues on the surface of each β-sheet hold the dimer together. The fold observed for cce_0566 may be unique to ...

  19. AMPTE/CCE magnetic field studies of the September 4, 1984 storm

    Science.gov (United States)

    Potemra, T. A.; Zanetti, L. J.; Acuna, M. H.

    1985-01-01

    The AMPTE/CCE (active magnetospheric particle tracer explorer/charge composition explorer) magnetic-field observations acquired during the September 4, 1984 geomagnetic storm are described. The observations are used to determine magnetospheric regions and boundaries and are also used as the primary index of the development, evolution, and distribution of the ring current. The results of an analysis of the observations are presented. It is shown that a magnetic compression observed inside the magnetosphere by CCE and outside by ISEE-2 is interpreted as a sudden impulse. From an estimation of magnetopause normals at each crossing, it is concluded that the magnetic variations that occur are due to a contraction and expansion of the entire magnetosphere. Local magnetic-field depressions are observed during two inbound dusk passes, confirming that the ring current never developed in the dawn sector.

  20. Harmonically structured ULF pulsations observed by the AMPTE CCE magnetic field experiment

    Science.gov (United States)

    Engebretson, M. J.; Zanetti, L. J.; Potemra, T. A.; Acuna, M. H.

    1986-01-01

    Spectrograms of ULF waves in the 0 to 80 mHz frequency range have been prepared from magnetic field data obtained by the elliptically orbiting AMPTE/CCE satellite (with an apogee of approximately 8.8 earth radii). The most prominent feature of these spectrograms (which cover a full 15.6-h orbit) is the presence of harmonically structured, azimuthally polarized pulsations in the outer magnetosphere during daytime hours. The frequencies of these pulsations decrease with increasing radial distance from the earth, indicating that they represent independent resonances of local magnetic flux tubes. The latitudinal structure of these harmonic pulsations, observed as AMPTE/CCE traveled to + or - 16 deg magnetic latitude, is consistent with accepted field line resonance models.

  1. The Medium-energy particle analyzer (MEPA) on the AMPTE CCE spacecraft

    Science.gov (United States)

    Mcentire, R. W.; Keath, E. P.; Fort, D. E.; Lui, A. T. Y.; Krimigis, S. M.

    1985-01-01

    A major objective in the design of the Charge Composition Explorer (CCE) is related to the measurement of small fluxes of ions (lithium and barium) injected in the solar wind and the deep magnetotail. A second important objective is concerned with the comprehensive measurement of the composition and dynamics of the natural-particle population. The medium-energy particle analyzer (MEPA) in the CCE is designed to cover an energy range which is normally covered by electrostatic analyzers. In order to prevent saturation by the large magnetospheric fluxes of low-energy protons, the MEPA sensor was designed to have a low efficiency for protons, but a high efficiency for the rarer heavier nuclei. The considered aims could be achieved by developing a technology, new to space flight, for measuring energetic ion composition. Particle mass is determined on the basis of the measurement of particle time of flight and total energy.

  2. AMPTE CCE observations of Pc 3-4 pulsations at L = 2-6

    Science.gov (United States)

    Takahashi, Kazue; Anderson, Brian J.; Strangeway, Robert J.

    1990-01-01

    Magnetic field data acquired by the AMPTE CCE satellite from L = 2-6 are analyzed. A procedure was specially developed to reduce the artificial modulation and noise in magnetic field measurements, making it possible to detect Pc 3-4 pulsations with amplitudes only 1 nT or less, even for L values less than 3. A survey of 41 CCE passes in L = 2-6 and in the postnoon sector showed that the most commonly observed pulsations in this region were the east-west oscillations of magnetic field with clearly L-dependent frequencies; these are identified as the toroidal mode standing Alfven waves. A relationship was found between the pulsation frequency and plasma density, showing that the pulsation data can be used to estimate the plasma mass density in the inner magnetosphere.

  3. Introduction to CCE-LTER: Responses of the California Current Ecosystem to climate forcing

    Science.gov (United States)

    Goericke, R.; Ohman, M. D.

    2015-02-01

    The California Current Ecosystem Long Term Ecological Research (CCE-LTER) site has been in existence since 2004. One of its primary objectives is to understand the response of the southern California Current ecosystem to climate forcing. The CCE-LTER site cooperates with the California Cooperative Oceanic Fisheries Investigations (CalCOFI) program and complements CalCOFI's work through more extensive observations, process studies, and a modeling program. This special issue is focused on the long-term observations made by the CCE-LTER and CalCOFI programs, describing and understanding long-term changes in the physical, chemical, and biotic environment in the region. The papers in this issue highlight the climatological conditions during recent years and employ modeling to diagnose the principal forcing of meridional currents and eddy transport, both of which affect biotic responses. Changes in source waters in the region, and altered flushing of the Santa Barbara Basin, are considered. Temporal variations in inherent optical properties and in higher trophic levels, including seabirds and marine mammals, are presented. Key methodological developments presented include the incorporation of subsurface phytoplankton and light distributions in order to improve remotely sensed measures of primary production, and the validation of multi-frequency acoustic estimates of mesopelagic fish biomass. Results also highlight significant spatial differences across the CCE-LTER region, including cross-shore trends in microbial assemblages, and glider-resolved frontal features and zones of mixing associated with abrupt topography. Alterations to the spatial structure of the pelagic ecosystem must also be considered when evaluating future climate-related changes.

  4. AMPTE/CCE and SCATHA simultaneous observations of magnetic signatures associated with a substorm onset

    Science.gov (United States)

    Ohtani, S.; Takahashi, K.; Higuchi, T.; Lui, A. T. Y.; Spence, H. E.

    1996-01-01

    Magnetic field signatures associated with a substorm onset event are examined by making use of simultaneous observations from the Active Magnetosphere Particle Tracer Explorer (AMPTE)/Charge Composition Explorer (CCE) and Spacecraft Charging AT High Altitude (SCATHA). The observations of the two satellites are discussed in relation to their differences and the relative positions of the satellites. Despite the small separation between the satellites, AMPTE/CCE observed the start of irregular magnetic field fluctuations a few tens of seconds earlier than SCATHA, indicating that the CCE was within, or closer to, the onset region. It was found that the amplitude of the fluctuations was largest in the north-south component. The results indicate that the magnetic field fluctuations were excited locally and the coherence length was less than a multiple of Larmor radius of thermal protons. It is suggested that the tail current disruption is described as a system of chaotic filamentary electric currents which flow in various directions, but preferentially anti-parallel to the cross-tail current, and that ions play an important role in the triggering of the tail current disruption.

  5. CCE measurements and annealing studies on proton-irradiated p-type MCz silicon diodes

    International Nuclear Information System (INIS)

    Magnetic Czochralski (MCz) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of p-type MCz Silicon diodes irradiated with 24GeV/c protons up to a fluence of 1016pcm-2 has been performed by means of Charge Collection Efficiency (CCE) measurements as well as standard CV/IV characterizations. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. A subsequent annealing study of the irradiated detectors shows an increase in effective doping concentration and a decrease in the leakage current, whereas the CCE remains basically unchanged. Two different series of detectors have been compared differing in the implantation dose of p-spray isolation as well as effective doping concentration (Neff) of the p-type bulk presumably due to a difference in thermal donor (TD) activation during processing. The series with the higher concentration of TDs shows a delayed reverse annealing of Neff after irradiation

  6. AMPTE CCE observations of Pc 3-4 pulsations at L = 2-6

    International Nuclear Information System (INIS)

    Very few spacecraft observations of magnetic Pc 3-4 pulsations at L < 4 have been reported in the past despite the fact that Pc 3-4 pulsations are a common occurrence on the ground at L < 4. In order to fill this observational gap in the magnetosphere, the authors have initiated an analysis of magnetic field data acquired by the AMPTE CCE spacecraft. A procedure has been developed to reduce the artificial modulation and noise in magnetic field measurements, with the resultant data useful for studying magnetic pulsations with amplitude less that 1 nT in the 1,000 nT (L ∼ 3) background and periods longer than 12 s. From a survey of 41 CCE passes in L = 2-6 and in the postnoon sector, they find that the most commonly observed pulsations in this region are the east-west oscillations of magnetic field with clearly L-dependent frequencies. These are identified to be the toroidal mode standing Alfven waves. From a comparison of CCE and GOES 5 magnetic field measurements there is evidence that the resonances can be excited by the same mechanism as those previously found at geostationary orbit or beyond. Abrupt changes is resonance frequency, as a function of L, are not usually seen, supporting previous reports that the mass or number density profile on the dayside does not have a steep plasmapause structure

  7. AMPTE/CCE observations of substorm-associated standing Alfven waves in the midnight sector

    Science.gov (United States)

    Takahashi, K.; Mcentire, R. W.; Potemra, T. A.; Kokubun, S.; Sakurai, T.

    1988-01-01

    Magnetic-field and medium-energy particle data from the AMPTE/CCE spacecraft are used to study substorm-associated ULF pulsations in the midnight sector at a radial distance of 8 to 9 earth radii. The particle data are used to identify ion injections and to detect the electric field of ULF waves. A case study of the events on May 23, 1985 shows that the waves have the properties of a fundamental-mode standing Alfven wave. It is suggested that these observations are evidence of substorm-associated standing Alfven waves in the nightside magnetosphere.

  8. Disruption of the magnetotail current sheet observed by AMPTE/CCE

    Science.gov (United States)

    Takahashi, K.; Zanetti, L. J.; Mcentire, R. W.; Potemra, T. A.; Lopez, R. E.

    1987-01-01

    An unusual large-amplitude (from less than 10 nT to greater than 40 nT) magnetic oscillation characterized by about-13-sec periodicity and southward turnings of the field was observed by AMPTE/CCE on August 28, 1986. The magnetic field was often stronger southward, with some southward components exceeding 20 nT being noted. The level of the high frequency perturbations was also seen to be enhanced. It is suggested that these observations may be due to the formation of an X-type neutral line and its motion near the spacecraft.

  9. Studies of storm-time ring current from the AMPTE/CCE MEPA measurements

    Science.gov (United States)

    Lui, A. T. Y.; Mcentire, R. W.; Krimigis, S. M.

    1987-01-01

    The evolution of the ring current for the September 4-7, 1984 storm is studied with data from the Medium Energy Particle Analyzer on the AMPTE/CCE spacecraft. From an examination of particle pressures and current densities, it is found that the leading and trailing edges of particle injections are associated with depressions and enhancements of westward current densities, respectively. Based on the ion composition measurements which cover the bulk of the ring current population, the contribution of the O(+) ions to the westward ring current density is estimated to be no more than about 25 percent for this magnetic storm.

  10. An eastward propagating compressional Pc 5 wave observed by AMPTE/CCE in the postmidnight sector

    International Nuclear Information System (INIS)

    Data from three instruments, the magnetometer, the charge-energy-mass spectrometer, and the medium-energy particle analyzer onboard the Active Magnetospheric Particle Tracer Explorers/Charge Composition Explorer (CCE) spacecraft have been used to study a compressional Pc 5 wave observed at 1925-2200 UT on day 202 (July 21) of 1986 at a radial distance of ≅ 8 RE in the postmidnight sector near the beginning of minor geomagnetic activity. The wave exhibited harmonically related transverse and compressional magnetic oscillations, modulation of the flux of medium energy protons (E approx-gt 10 keV), and a large azimuthal wave number (m ∼ 65). These properties are similar to those of compressional Pc 5 waves observed previously at geostationary orbit. The unique observations associated with the CCE event are the occurrence in the postmidnight sector, the eastward (or sunward) propagation with respect to the spacecraft, and the left-handed polarization of the perturbed magnetic field. These are opposite to previous geostationary observations. The authors propose that the unique propagation and polarization are propagating westward in the plasma rest frame, appears to propagate eastward to the observer because the electric field drift velocity is larger than the wave phase velocity

  11. The magnetic field of the equatorial magnetotail: AMPTE/CCE observations at R E

    International Nuclear Information System (INIS)

    The Active Magnetospheric Particle Tracer Explorers/Charge Composition Explorer (AMPTE/CCE) magnetic field experiment has provided extensive measurements of the vector field near the equatorial plane in the inner magnetotail. Taillike distortions from the dipole field direction may reach 80 degree near the AMPTE/CCE apogee of 8.8 RE. The Bz (north-south) field component in dipole coordinates was always positive within 0.5 RE of the equatorial current sheet, indicating that neutral lines were never seen inside of 8.8 RE. South of -0.5 RE, Bz values are sometimes southward due to extremely taillike fields and the southward tilt of the tail in dipole coordinates during northern hemisphere winter. Fields are most taillike near midnight and during times of high Kp. At 8.5 RE the equatorial field magnitude depressions are roughly half the dipole field strength of 51 nT. The equatorial crossing points of midnight field lines are computed using the observed field depressions. Mapping auroral boundaries along these distorted field lines indicates that most auroral arcs map to magnetospheric locations beyond 12 RE, but that low latitude arcs may well occur on closed field lines earthward of this distance. Evidence is found confirming that a cross-tail field component in the inner magnetotail is related to the interplanetary sector structure but, contrary to earlier results, the effect is found to be larger during geomagnetically disturbed times

  12. Solar wind carbon, nitrogen and oxygen abundances measured in the Earth's magnetosheath with AMPTE/CCE

    International Nuclear Information System (INIS)

    The solar wind number density ratios of C/sup 6+/+C/sup 5+/ and N/sup 7+/+N/sup 6+/+N/sup 5+/ relative to O/sup 8+/+O/sup 7+/+O/sup 6+/ have been measured for the first time using data from the Charge-Energy-Mass (CHEM) spectrometer on the AMPTE/CCE spacecraft during four solar active periods from Sept. 19 to Nov. 1, 1984 when CCE traversed the subsolar magnetosheath of the compressed magnetosphere. We find the average values of the density ratios of C/O and N/O to be 0.43 +- 0.03 and 0.15 +- 0.06, respectively. These ratios, as well as our average He/sup 2+//O ratio of 43 +- 5 for these same time periods, are in excellent agreement with Solar Energetic Particles (SEP) abundance ratios as well as SEP-derived coronal abundances of these elements. Our solar wind C/O ratio is substantially below the generally accepted photospheric value of 0.60

  13. AMPTE/CCE observations of the plasma composition below 17 keV during the September 4, 1984 magnetic storm

    Science.gov (United States)

    Shelley, E. G.; Klumpar, D. M.; Peterson, W. K.; Ghielmetti, A.; Balsiger, H.; Geiss, J.; Rosenbauer, H.

    1985-01-01

    Observations from the Hot Plasma Composition Experiment on the AMPTE/CCE spacecraft during the magnetic storm of 4-5 September 1984 reveal that significant injection of ions of terrestrial origin accompanied the storm development. The compression of the magnetosphere at storm sudden commencement carried the magnetopause inside the CCE orbit clearly revealing the shocked solar wind plasma. A build up of suprathermal ions is observed near the plasmapause during the storm main phase and recovery phase. Pitch angle distributions in the ring current during the main phase show differences between H(+) and O(+) that suggest mass dependent injection, transport and/or loss processes.

  14. AMPTE/CCE observations of the plasma composition below 17 keV during the September 4, 1984 magnetic storm

    International Nuclear Information System (INIS)

    Observations from the Hot Plasma Composition Experiment on the AMPTE/CCE spacecraft during the magnetic storm of 4-5 September 1984 reveal that significant injection of ions of terrestrial origin accompanied the storm development. The compression of the magnetosphere at storm sudden commencement carried the magnetopause inside the CCE orbit clearly revealing the shocked solar wind plasma. A build up of suprathermal ions is observed near the plasmapause during the storm main phase and recovery phase. Pitch angle distributions in the ring current during the main phase show differences between H(+) and O(+) that suggest mass dependent injection, transport and/or loss processes. 9 references

  15. Validación del Cuestionario de Creencias Centrales de los Trastornos de la Personalidad (CCE-TP en población colombiana

    Directory of Open Access Journals (Sweden)

    Diego Castrillón M.

    2007-06-01

    Full Text Available Se construyó un cuestionario para evaluar creencias centrales asociadas con los trastornos de la personalidad, fundamentadas en el Modelo de la Terapia Cognitiva. Se realizó el análisis estructural y la validez de contenido de la prueba en población universitaria de la ciudad de Medellín, Colombia. La muestra fue representativa y elegida al azar a través de un procedimiento polietápico. Un número de 809 estudiantes universitarios contestaron el cuestionario de creencias centrales de los trastornos de la personalidad (CCE-TP. Se realizó un análisis factorial exploratorio de la prueba, reagrupándose los ítems en 14 factores (F que representan el 61,3% de la varianza. F1: CCE-TP antisocial (8 ítems, a 0,839; F2: CCE-TP esquizotípico/límite (8 ítems, a 0,846; F3: CCE-TP histriónico/patrón seductor (6 ítems, a 0,833; F4: CCE-TP paranoide (6 ítems, a 0,836; F5: CCE-TP por evitación / autopercepción negativa (5 ítems, a 0,755; F6: CCE-TP por dependencia (5 ítems, a 0,797; F7: CCE-TP histriónico/dependencia emocional (4 ítems, a 0,755; F8: CCETP obsesivo-compulsivo/perfeccionista (4 ítems, a 0,808; F9: CCE-TP por evitación/hipersensible (4 ítems, a 0,766; F10: CCE-TP obsesivo-compulsivo/ crítico frente a los demás (3 ítems, a 0,851; F11: CCE-TP narcisista (4 ítems, a 0,717; F12: CCE-TP pasivo-agresivo / temor a ser dominado (3 ítems, a 0,719; F13: CCE-TP pasivo-agresivo/crítico frente a la autoridad (3 ítems, a 0,685, y F14: CCE-TP esquizoide (2 ítems, a 0,774. El alfa de Cronbach de la prueba fue de 0,931.

  16. AMPTE/CCE observations of shell-like He(2+) and O(6+) distributions in the magnetosheath

    Science.gov (United States)

    Fuselier, S. A.; Shelley, E. G.; Klumpar, D. M.

    1988-01-01

    Simultaneous observations of solar wind He(2+) and O(6+) shell-like distributions in the magnetosheath were obtained by the AMPTE CCE on November 1, 1984. It is found that the present distributions are centered on the downstream H(+) bulk velocity and have radii proportional to the mass/charge ratio. The results support an electrostatic cross-shock potential model.

  17. The blue light-dependent phosphorylation of the CCE domain determines the photosensitivity of Arabidopsis CRY2.

    Science.gov (United States)

    Wang, Qin; Barshop, William D; Bian, Mingdi; Vashisht, Ajay A; He, Reqing; Yu, Xuhong; Liu, Bin; Nguyen, Paula; Liu, Xuanming; Zhao, Xiaoying; Wohlschlegel, James A; Lin, Chentao

    2015-04-01

    Arabidopsis cryptochrome 2 (CRY2) is a blue light receptor that mediates light inhibition of hypocotyl elongation and long-day promotion of floral initiation. CRY2 is known to undergo blue light-dependent phosphorylation, which is believed to serve regulatory roles in the function of CRY2. We report here on a biochemical and genetics study of CRY2 phosphorylation. Using mass spectrometry analysis, we identified three serine residues in the CCE domain of CRY2 (S588, S599, and S605) that undergo blue light-dependent phosphorylation in Arabidopsis seedlings. A study of serine-substitution mutations in the CCE domain of CRY2 demonstrates that CRY2 contains two types of phosphorylation in the CCE domain, one in the serine cluster that causes electrophoretic mobility upshift and the other outside the serine cluster that does not seem to cause mobility upshift. We showed that mutations in the serine residues within and outside the serine cluster diminished blue light-dependent CRY2 phosphorylation, degradation, and physiological activities. These results support the hypothesis that blue light-dependent phosphorylation of the CCE domain determines the photosensitivity of Arabidopsis CRY2. PMID:25792146

  18. Studies of electromagnetic ion cyclotron waves using AMPTE/CCE and dynamics explorer

    Science.gov (United States)

    Erlandson, Robert E.

    1994-01-01

    The overall objective of this research is to investigate the generation and propagation of electromagnetic ion cyclotron (EMIC) waves in the frequency range from 0.2 to 5 Hz (Pc 1 frequency band). Data used in this research were acquired by the AMPTE/CCE, DE-1, and DE-2 satellites. One of the primary questions addressed in this research is the role which EMIC waves have on the transfer of energy from the equatorial magnetosphere to the ionosphere. The primary result from this research is that some fraction of EMIC waves, generated in the equatorial magnetosphere, are Landau damped in the ionosphere and are therefore a heat source for ionospheric electrons. This result as well as other results are summarized below.

  19. AMPTE/CCE energetic particle composition measurements during the September 4, 1984 magnetic storm

    International Nuclear Information System (INIS)

    The results of measurements for the magnetic-storm period of September 4-7, 1984 from the medium-energy particle analyzer (MEPA) on the CCE spacecraft are presented. It is shown that within L-shells of about 2.5 to 5 in the dusk sector near the equatorial plane, the enhancement factor in the fluxes for the CNO group is greater than that of helium, which is greater than that of protons. The flux ratios of helium and CNO over all ions at the same total energy show considerable increases in the same L-shell ranges. For the particle population measured by MEPA, a local current-density enhancement of about 0.5 nA/sq m is found over the L range of 3.5 to 6 during the magnetic storm. It is found that the total current density is dominated by the pressure-gradient current of the protons. 9 references

  20. AMPTE/CCE energetic particle composition measurements during the September 4, 1984 magnetic storm

    Science.gov (United States)

    Mcentire, R. W.; Lui, A. T. Y.; Krimigis, S. M.; Keath, E. P.

    1985-01-01

    The results of measurements for the magnetic-storm period of September 4-7, 1984 from the medium-energy particle analyzer (MEPA) on the CCE spacecraft are presented. It is shown that within L-shells of about 2.5 to 5 in the dusk sector near the equatorial plane, the enhancement factor in the fluxes for the CNO group is greater than that of helium, which is greater than that of protons. The flux ratios of helium and CNO over all ions at the same total energy show considerable increases in the same L-shell ranges. For the particle population measured by MEPA, a local current-density enhancement of about 0.5 nA/sq m is found over the L range of 3.5 to 6 during the magnetic storm. It is found that the total current density is dominated by the pressure-gradient current of the protons.

  1. Geomagnetic field-line resonant harmonics measured by the Viking and AMPTE/CCE magnetic field experiments

    Science.gov (United States)

    Zanetti, L. J.; Potemra, T. A.; Erlandson, R. E.; Engebretson, M. J.; Acuna, M. H.

    1987-01-01

    The first simultaneous observations of multiple harmonic, azimuthally polarized, ULF pulsations at two points along a geomagnetic flux tube in space are reported. In March 1986, the elliptically orbiting equatorial AMPTE/CCE satellite was oriented with the apogee near 0830 h MLT, and the orbital plane of the polar-orbiting Viking satellite was at 1000 MLT. The satellites were situated within approximately the same flux tube but with an effective separation of approximately 10 R(e) near L = 8 on the inbound pass of the AMPTE/CCE orbit. Structured harmonic pulsations were observed by the magnetic field experiments on both spacecraft, and they appeared to turn off and on simultaneously at both locations. Both the observations and the relative amplitudes along the magnetic field lines support recent ideas of multiple field-line resonances of Alfven waves.

  2. Variable carbon and oxygen abundances in the solar wind as observed in earth's magnetosheath by AMPTE/CCE

    Science.gov (United States)

    Von Steiger, R.; Christon, S. P.; Gloeckler, G.; Ipavich, F. M.

    1992-01-01

    A comprehensive list is presented of the solar wind oxygen and carbon charge states and abundances measured in all magnetosheath periods during the lifetime of the AMPTE/CCE satellite, 1984-1988. A surprisingly variable C/O ratio is found. The variations seem to be strongly correlated to the source temperature in the corona where the solar wind responsible for the particular flow originated.

  3. Pc1 pulsations observed by AMPTE/CCE in the earth's outer magnetosphere

    Science.gov (United States)

    Anderson, B. J.; Takahashi, K.; Erlandson, R. E.; Zanetti, L. J.

    1990-01-01

    Electromagnetic ion-cyclotron waves in the Pc1-2 frequency range (0.1-5 Hz) have been observed in earth's equatorial magnetosphere over the range L = 3 to 9 by the AMPTE/CCE magnetic-field experiment. Detailed analysis of data from two orbits together with preliminary occurrence statistics from 31 days are reported. One example occurred during disturbed geomagnetic conditions (maximum AE greater than 1000 nT) and exhibited intense Pc1 from L = 5 to the magnetopause (L = about 7.5). The second example occurred during moderate to quiet conditions (average AE = about 300 nT) and displayed Pc1 in two distinct L ranges: low (L = about 4) and high (L greater than 7.5). Statistical results show that Pc1 are about 4 times more common for L greater than 7 than for L less than 6 and occur primarily in the afternoon. The discovery of a statistically dominant outer-magnetospheric source region implies that ring-current interaction with the plasmasphere is not the primary source of Pc1 excitation, but suggests that plasma sheet ions may be a significant energy source for Pc1. This result is consistent with the strong dependence of the linear convective growth rate on magnetic-field strength.

  4. Pc1 pulsations observed by AMPTE/CCE in the Earth's outer magnetosphere

    International Nuclear Information System (INIS)

    Electromagnetic ion cyclotron waves in the Pc1-2 frequency range (0.1-5 Hz) have been observed in Earth's equatorial magnetosphere over the range L=3 to 9 by the AMPTE/CCE magnetic fields experiment. The authors report detailed analysis of data from two orbits together with preliminary occurrences statistics from 31 days. One example occurred during disturbed geomagnetic conditions (maximum AE>1,000 nT) and exhibited intense Pc1 from L=5 to the magnetopause (L∼7.5). The second example occurred during moderate to quiet conditions (average AE∼300 nT) and displayed Pc1 in two distinct L ranges: low (L∼4) and high (L>7.5). Statistical results show that Pc1 are ∼4 times more common for L>7 than for L<6 and occur primarily in the afternoon. The discovery of a statistically dominant outer magnetospheric source region implies that ring current interaction with the plasmasphere is not the primary source of Pc1 excitation but suggests that plasma sheet ions may be a significant energy source for Pc1. This result is consistent with the strong dependence of the linear convective growth rate on magnetic field strength

  5. AMPTE CCE observations of Pi 2 pulsations in the inner magnetosphere

    Science.gov (United States)

    Takahashi, Kazue; Ohtani, Shin-Ichi; Yumoto, Kiyohumi

    1992-01-01

    Magnetic field data acquired with the AMPTE Charge Composition Explorer satellite in the inner magnetosphere (L = 2-5) often show Pi 2 pulsations whose waveforms match Pi 2 pulsations simultaneously observed on the ground at Kakioka (L = 1.2). From a study such events, it is found that the magnetic pulsations in the equatorial magnetosphere are dominated by poloidal-mode oscillations. The relative phase between the compressional component at CCE and the horizontal component at Kakioka is either near zero or near 180 deg, with the 180 lag observed only when the satellite is at L greater than 3. This observation implies that there is a node of a radial standing wave at L greater than 3. It is argued that the nodal structure arises from reflection of MHD fast-mode waves at some inner boundary of the magnetosphere and discuss the relevance of the nodal structure to cavity-mode resonances and oscillations in the inner magnetosphere forced by a source wave external to the inner magnetosphere.

  6. AMPTE CCE observations of Pi 2 pulsations in the inner magnetosphere

    International Nuclear Information System (INIS)

    Magnetic field data acquired with the AMPTE Charge Composition Explorer satellite in the inner magnetosphere (L = 2-5) often show Pi 2 pulsations whose waveforms match Pi 2 pulsations simultaneously observed on the ground at Kakioka (L = 1.2). From a study of 25 such events, the authors find that the magnetic pulsations in the equatorial magnetosphere are dominated by poloidal-mode oscillations. The relative phase between the compressional component at CCE and the horizontal component at Kakioka is either near zero or near 180 degree, with the ∼ 180 degree lag observed only when the satellite is at L > 3. This observation implies that there is a node of a radial standing wave at L > 3. They argue that the nodal structure arises from reflection of MHD fast-mode waves at some inner boundary of the magnetosphere and discuss the relevance of the nodal structure to cavity-mode resonances and oscillations in the inner magnetosphere forced by a source wave external to the inner magnetosphere

  7. Disruption of the magnetotial current sheet observed by AMPTE/CCE

    International Nuclear Information System (INIS)

    The Active Magnetospheric Particle Tracer Explorers/Charge Composition Explorer (AMPTE/CCE), with a small inclination of 4.80 and an apogee of ∼8.8 R/sub E/, is capable of exploring the dynamical behavior of the near-earth magnetotial current sheet during substorms. At ∼1153 UT on day 240 (August 28), 1986, the spacecraft was on the midplane of the magnetotail near midnight (∼23.4 h LT) at a radial distance of ∼8 R/sub E/, when the onset of a substorm took place. The magnetic field data for the ∼3.5-min interval following the onset indicated a variation of the magnetic field that has not been observed by geostationary satellites or by other spacecraft flown in the near-earth tail (rapprox. <20 R/sub E/). The variation was characterized by a large-amplitude (from less than 10 nT to greater than 40 nT) oscillation of the total field with a period of ∼13 s and also by southward turning of the field during most cycles of the oscillation. At times the magnetic field became strongly southward, and in a few measurements the magnitude of the southward component exceeded 20 nT. The level of high-frequency perturbations (period shorter than ∼10 s) was also enhanced during the event. The observations may be due to the formation of an X-type neutral line and its motion near the spacecraft. copyright American Geophysical Union 1987

  8. Particle signatures of magnetic topology at the magnetopause: AMPTE/CCE observations

    Science.gov (United States)

    Fuselier, S. A.; Anderson, B. J.; Onsager, T. G.

    1995-01-01

    Electron distributions at energies above 50 eV have been found to be a sensitive indicator of magnetic topology for magnetopause crossings of the AMPTE/CCE spacecraft. Progressing from the magnetosheath to the magnetosphere two abrupt transitions occur. First, the magnetosheath electron population directed either parallel or antiparallel to the magnetic field is replaced by a streaming, heated magnetosheath electron population. The other half of the distribution is unchanged. The region with unidirectional, heated magnetosheath electrons is identified as the magnetosheath boundary layer (MSBL). Second, the unheated magnetosheath electron population is replaced by a heated population nearly identical to the population encountered in the MSBL, resulting in a symmetric counterstreaming distribution. The region populated by the bidirectional heated magnetosheath electrons is identified as the low-latitude boundary layer (LLBL). The MSBL and LLBL identified by the electron transitions are the same as the regions identified using ion composition measurements. The magnetosheath-MSBL transition reflects a change in magnetic topology from a solar wind field line to one that threads the magnetopause, and the existence of a magnetosheath-MSBL transition implies that the magnetopause is open. When the current layer is easily identified, the MSBL-LLBL transition coincides with the magnetopause current layer, indicating that the magnetosheath electrons are heated in the current layer. Both magnetosheath-MSBL and MSBL-LLBL transitions are observed for low as well as high magnetic shears. Moreover, the transitions are particularly clear for low shear implying that magnetic topology boundaries are sharp even when abrupt changes in the field and other plasma parameters are absent. Furthermore, for low magnetic shear, solar wind ions with low parallel drift speeds make up the majority of the LLBL population indicating that the magnetosheath plasma has convected directly across the

  9. Ring current plasma of the Earth magnetosphere. Model in comparison with the results of the AMPTE/CCE experiment

    International Nuclear Information System (INIS)

    When comparing the model of ion energy density distribution in the range of the ring current with the results of AMPTE/CCE experiment, the existence of the quiet ring current was confirmed, the maximum energy content of plasma and its composition was refined. Considerable content of oxygen ions points to their ionospheric source. Temperatures of ring current ions constitute tens of kiloelectronvolt. Gradient drift in magnetic field of the ions can create the ring current with magnetic momentum of the same direction in the Earth centre as geomagnetic dipole

  10. Reduction and scientific analysis of data from the charge-energy-mass (CHEM) spectrometer on the AMPTE/CCE spacecraft

    Science.gov (United States)

    Gloeckler, G.; Hamilton, D. C.; Ipavich, F. M.

    1987-01-01

    The Charge-Energy-Mass (CHEM) spectrometer instrument on the AMPTE/Charge Composition Explorer (CCE) spacecraft is designed to measure the mass and charge-state abundance of magnetospheric and magnetosheath ions between 0.3 and 315 keV/e, an energy range that includes the bulk of the ring current and the dynamically important portion of the plasma sheet population. Continuing research is being conducted using the AMPTE mission data set, and in particular, that of the CHEM spectrometer which has operated flawlessly since launch and still provides excellent quality data. The requirted routine data processing and reduction, and software develpment continues to be performed. Scientific analysis of composition data in a number of magnetospheric regions including the ring current region, near-earth plasma sheet and subsolar magnetosheath continues to be undertaken. Correlative studies using data from the sister instrument SULEICA, which determines the mass and charge states of ions in the energy range of approximately 10 to 250 keV/e on the IRM, as well as other data from the CCE and IRM spacecraft, particularly in the upstream region and plasma sheet have also been undertaken.

  11. Testing of the NASA Hypersonics Project Combined Cycle Engine Large Scale Inlet Mode Transition Experiment (CCE LlMX)

    Science.gov (United States)

    Saunders, J. D.; Stueber, T. J.; Thomas, S. R.; Suder, K. L.; Weir, L. J.; Sanders, B. W.

    2012-01-01

    Status on an effort to develop Turbine Based Combined Cycle (TBCC) propulsion is described. This propulsion technology can enable reliable and reusable space launch systems. TBCC propulsion offers improved performance and safety over rocket propulsion. The potential to realize aircraft-like operations and reduced maintenance are additional benefits. Among most the critical TBCC enabling technologies are: 1) mode transition from turbine to scramjet propulsion, 2) high Mach turbine engines and 3) TBCC integration. To address these TBCC challenges, the effort is centered on a propulsion mode transition experiment and includes analytical research. The test program, the Combined-Cycle Engine Large Scale Inlet Mode Transition Experiment (CCE LIMX), was conceived to integrate TBCC propulsion with proposed hypersonic vehicles. The goals address: (1) dual inlet operability and performance, (2) mode-transition sequences enabling a switch between turbine and scramjet flow paths, and (3) turbine engine transients during transition. Four test phases are planned from which a database can be used to both validate design and analysis codes and characterize operability and integration issues for TBCC propulsion. In this paper we discuss the research objectives, features of the CCE hardware and test plans, and status of the parametric inlet characterization testing which began in 2011. This effort is sponsored by the NASA Fundamental Aeronautics Hypersonics project

  12. Toroidal wave frequency at L=6-10: AMPTE/CCE Observations and Comparison with Theoretical Model

    Science.gov (United States)

    Takahashi, Kazue; Denton, Richard E.; Gallaher, Dennis

    2003-01-01

    Magnetospheric standing Alfven waves are guided along the ambient magnetic field and their frequency depends on the mass density of the plasma distributed along the field lines. These properties allow us to use Alfen waves to map time-dependent phenomena between space and ground and to estimate the mass density. In this paper we present a statistical study of the spatial variation of the fundamental frequency f(sub T1) of toroidal-mode standing Alfen waves in the L range from 6 to 10, where L indicates the maximum geocentric distance on the field line. The data used for this analysis are energetic particle flux anisotropy (proxy of transverse electric field) and magnetic field measurements from the Active Magnetospheric Particle Tracer Explorers Charge Composition Explorer (CCE) spacecraft. Using CCE data covering 4 years we obtained approximately 5000 20-min intervals containing a clear signature of toroidal waves. The median f(sub T1), is 6-10 mHz at L=7 and decreases to 4-8 mHz at L = . The frequency tends to be lower at noon than at midnight. The observed frequencies are compared with numerically derived frequencies using an empirical mass density model and a magnetic field model. We found a good agreement for 12-24 MLT but a large discrepancy near MLT= 3. This may indicate that the flux tubes at this local time are more heavily loaded than specified in the Gallagher et al. model.

  13. Solar wind carbon, nitrogen and oxygen abundances measured in the earth's magnetosheath with AMPTE/CCE. [Charge Composition Explorer

    Science.gov (United States)

    Gloeckler, G.; Ipavich, F. M.; Hamilton, D. C.; Wilken, B.; Stuedemann, W.

    1986-01-01

    The solar wind number density ratios of C(6+) + C(5+) and N(7+) + N(6+) + N(5+) relative to O(8+) + O(7+) + O(6+) have been measured for the first time using data from the Charge-Energy-Mass Spectrometer on the AMPTE/CCE spacecraft during four solar active periods from Sept. 19 to Nov. 1, 1984 when CCE traversed the subsolar magnetosheath of the compressed magnetosphere. It is found that the average values of the density ratios of C/O and N/O to be 0.43 + or - 0.03 and 0.15 + or - 0.06, respectively. These ratios, as well as the average He(2+)/O ratio of 43 + or - 5 for these same time periods, are in excellent agreement with Solar Energetic Particles (SEP) abundance ratios as well as SEP-derived coronal abundances of these elements. The solar wind C/O ratio is substantially below the generally accepted photospheric value of 0.60.

  14. PENGARUH MODEL COOPERATIVE CLASS EXPERIMENT (CCE TIPE TEAM GAMES TOURNAMENT (TGT PADA KBK DAN HASIL BELAJAR SISWA

    Directory of Open Access Journals (Sweden)

    Fajar Mahda Akhmad Sa’idun

    2015-11-01

    Full Text Available Learning with the conventional method make competency achievement in chemistry subject is still low. This study aimed to determine the effect of Model Cooperative Class Experiment (CCE type Team Games Tournament (TGT on CBC and Learning Outcomes on high school students in the topic of redox reactions. Sample determination was using cluster random sampling technique, class X8 grade students is as the experimental class and X7 class is as control class. The method used in data collection is documentation, in the form of multiple choice test and an essay in the form of open-ended questions and observations. The results showed that analysis of CBC data test achieved fifth subindikator CBC in the experimental class gained an average of 73.75%, which means that students can develop CBC with good criterion, while the control class with an average of 64.68% in the CBC is sufficient criteria. The analysis data obtained rb 0.51 with the contribution of 26.29%. The results of this study concluded that the implementation of Cooperative Learning Model Class Experi ment (CCE Study Team Games Tournament (TGT type have signiffican effect on CBC and student learning outcomes in high school in Semarang on the redox subject with the contribution of 26.29%.

  15. The charge-energy-mass spectrometer for 0.3-300 keV/e ions on the AMPTE CCE

    Science.gov (United States)

    Gloeckler, G.; Ipavich, F. M.; Hamilton, D. C.; Lundgren, R. A.; Studemann, W.; Wilken, B.; Kremser, G.; Hovestadt, D.; Gliem, F.; Rieck, W.

    1985-01-01

    The charge-energy-mass (CHEM) spectrometer on the Charge Composition Explorer (CCE) has the function to measure the energy spectra, pitch-angle distributions, and ionization states of ions in the earth's magnetosphere and magnetosheath in the energy range from 0.3 to 300 keV/charge with a time resolution of less than 1 min. The obtained data will provide essential information on outstanding problems related to ion sources and dynamical processes of space plasmas and of suprathermal ions. A description of the CHEM experiment is given, taking into account the principle of operation, the sensor, the electronics, instrument characteristics, specifications, and requirements. Questions of postlaunch performance are also discussed.

  16. The longitudinal and radial distribution of magnetic reconfigurations in the near-earth magnetotail as observed by AMPTE/CCE

    Science.gov (United States)

    Lopez, R. E.; Lui, A. T. Y.; Sibeck, D. G.; Mcentire, R. W.; Zanetti, L. J.

    1988-01-01

    The longitudinal and radial distribution of 103 substorm dipolarization events in the equatorial nightside magnetosphere from low altitude to about 9 R(E) observed by AMPTE/CCE is examined. The center of the distribution was located near midnight. For Kp of 3- or less, the distribution peak shifted toward the premidnight region, whereas for Kp of 4+ and higher, the distribution peak was inside the postmidnight region. The substorm frequency for the high-Kp case was about four times larger than the low-to-moderate-Kp case. The occurrence frequency of events increased with increasing radial distance, and no events were observed inside of 6.4 R(E). This radial distribution suggests that, on average, the substorm initiation region is greater than about 8 R(E). In addition, the average radial position of the signatures decreased with increasing Kp.

  17. Periodic oscillations of the quasi-parallel bow shock as observed with the AMPTE/CCE spacecraft

    Science.gov (United States)

    Strangeway, R. J.; Zanetti, L. J.

    1991-01-01

    The AMPTE/CCE spacecraft has, on occasion, encountered the earth's bow shock near apogee (about 9 earth radii). During one encounter, on November 1, 1984, the bow shock was observed to pass back and forth over the spacecraft several times in a periodic fashion. The period of the oscillation was about 20 seconds, and an upstream wave with a similar period was observed in the solar wind just prior to the multiple shock crossings. Minimum variance analysis of the shock crossings shows that the magnetic field carried out a single rotation through 360 deg for each pair of shock crossings. This implies that the shock was responding to the rotation of the field in the upstream wave, and it is shown how the plasma displacement associated with the upstream wave can produce the observed oscillations. These data may provide support for the wavelike structure of quasi-parallel shocks predicted in simulations.

  18. Quiet time equatorial mass density distribution derived from AMPTE/CCE and GOES using the magnetoseismology technique

    Science.gov (United States)

    Min, Kyungguk; Bortnik, Jacob; Denton, Richard E.; Takahashi, Kazue; Lee, Jeongwoo; Singer, Howard J.

    2013-10-01

    An inversion technique for estimating the properties of the magnetospheric plasma from the harmonic frequencies of the toroidal standing Alfvén waves has been used to derive the global equatorial mass density covering radial distances from 4 to 9 Earth radii (RE), within the local time sector spanning from 0300 to 1900 h. This broad range of L shell extending to the outer magnetosphere allows us to examine the local time and radial dependence of the quiet time equatorial mass density during solar minimum and thereby construct a global distribution of the equatorial mass density. The toroidal Alfvén waves were detected with magnetometers on the Active Magnetospheric Particle Tracer Explorers (AMPTE)/Charge Composition Explorer (CCE) during the nearly 5 year interval from August 1984 to January 1989 and on the Geostationary Operational Environmental Satellites (GOES) (10, 11, and 12) for 2 years from 2007 to 2008, both of which were operating during solar minimum years. The derived equatorial mass density, ρeq, at geosynchronous orbit (GEO) monotonically increases with increasing magnetic local time (MLT) from the nightside toward the dusk sector. At other radial distances, ρeq has the same MLT variation as that of GEO, while the magnitude logarithmically decreases with increasing L value. An investigation of the Dst and Kp dependence shows that the median value of ρeq varies little in the daytime sector during moderately disturbed times, which agrees with previous studies. ρeq calculated from the F10.7 dependent empirical model shows good agreement with that of CCE but overestimates that of GOES probably due to the extreme solar cycle minimum in years 2007-2008.

  19. A statistical study of Pc 3-5 pulsations observed by the AMPTE/CCE magnetic fields experiment. I - Occurrence distributions

    Science.gov (United States)

    Anderson, B. J.; Engebretson, M. J.; Rounds, S. P.; Zanetti, L. J.; Potemra, T. A.

    1990-01-01

    A classification system based on dynamic power spectra of AMPTE/CCE magnetic field data has been developed which allows semiquantitative specification of pulsation activity at all times. Fifteen months of 6.24-s AMPTE/CCE magnetic field data have been analyzed using this scheme to generate a comprehensive data base of all pulsation activity observed from L = 5 to L = 9 at all local times in the frequency range 0-80 mHz. The pulsation divide naturally into five basic categories: toroidal fundamental mode resonances, toroidal harmonic resonances, compressional low-frequency waves, radially polarized waves, and disturbed intervals. Additional distinctions among members of these classes are made to arrive at 14 categories which describe 95 percent of the pulsations observed. Normal spatial distributions in local time and L shell are determined for each category. Magnetic latitude distributions are determined for four coherent categories of activity.

  20. An eastward propagating compressional Pc 5 wave observed by AMPTE/CCE in the postmidnight sector. [Active Magnetospheric Particle Tracer Explorers

    Science.gov (United States)

    Takahashi, K.; Mcentire, R. W.; Zanetti, L. J.; Lopez, R. E.; Kistler, L. M.

    1987-01-01

    This paper presents a detailed analysis of a compressional Pc 5 wave observed in the postmidnight sector on July 21, 1986, using data from the magnetometer, the charge-energy-mass spectrometer, and the medium-energy particle analyzer aboard the AMPTE/Charge Composition Explorer (CCE) spacecraft. The Pc 5 wave exhibited harmonically related transverse and compressional magnetic oscillations, modulation of the flux of medium energy protons, and a large azimuthal wave number, i.e., properties that are similar to those of compressional Pc5 waves observed previously at geostationary orbit. The unique observations recorded by the AMPTE/CCE included the occurrence of the wave in the postmidnight sector, its sunward propagation with respect to the spacecraft, and the left-handed polarization of the perturbed magnetic field. In spite of the morphological uniqueness observed, the excitation of the July 21 event is considered to be due to the same type of instability as operates at geostationary orbit.

  1. Power, thermal, and attitude control design interactions of the CCE/AMPTE spacecraft. [Charge Composition Explorer/Active Magnetospheric Particle Tracer Explorers

    Science.gov (United States)

    Wingate, C. A., Jr.; Allen, W. E.; Smola, J. F.; Ray, J. C.

    1982-01-01

    The power, thermal and attitude control interactions of the CCE spacecraft and the design compromises resulting from these interactions are described. These compromises result from the conflict between the plane change maneuver requirements and the final on station requirements. The resolution of these conflicts to arrive at an acceptable final design, is given and the resulting power, thermal and attitude control systems are described in some detail.

  2. The magnetic field of the equatorial magnetotail - AMPTE/CCE observations at R less than 8.8 earth radii

    Science.gov (United States)

    Fairfield, D. H.; Acuna, M. H.; Zanetti, L. J.; Potemra, T. A.

    1987-01-01

    The MPTE/CCE magnetic field experiment has been used to obtain a quantitative evaluation of the frequency and extent of magnetic field distortion in the near-tail region at less than 8.8 earth radii. The variation of this distortion with Kp, radial distance, longitude, and near-equatorial latitude is reported. It has been found that taillike distortions from the dipole field direction may reach 80 deg near the MPTE/CE apogee of 8.8 earth radii. The Bz field component in dipole coordinates was always positive within 0.5 earth radii of the equatorial current sheet, indicating the neutral lines were never seen inside of 8.8 earth radii. Fields were most taillike near midnight and during times of high Kp. At 8.5 earth radii the equatorial field magnitude depressions were roughly half the dipole field strength of 51 nT. These depressions are larger at lesser distances, reaching -40 nT at 3.4 earth radii for Kp of 2- or less and -80 nT and Kp of 3+ and greater.

  3. The longitudinal and radial distribution of magnetic reconfigurations in the near-earth magnetotail as observed by AMPTE/CCE

    International Nuclear Information System (INIS)

    Magnetic field and energetic particle data from the AMPTE/CCE have been used to identify 103 magnetic reconfiguration events in the near-Earth (R≤8.8RE) nightside equatorial plane. The events involve a dipolarization of the magnetic field and increases in energetic particle fluxes typical of substorms. This study is the first survey of such signatures extended over both local time and radial distance. The events are distributed in magnetic local time (MLT) from 19.9 MLT to 4.7 MLT with the peak of the distribution near midnight. No events were observed inside of 6.4 RE, and the occurrence frequency increased with radial distance. For Kp≤3-, the local time peak of the distribution in near 23 MLT, whereas for Kp≥4+, the distribution center is near 2 MLT. Furthermore, the occurrence frequency of the events when Kp≥4+ is 4 times greater than the occurrency frequency for events when Kp≤3-. The results of this study suggest that (1) substorm reconfiguration of the magnetic field, presumably arising from disruption/diversion of the cross-tail current, seldom reaches inside a radial distance of about 6.4 RE, and (2) the central meridian of the substorm current wedge tends to shift from the premidnight to the postmidnight sectors as the global geomagnetic activity increases

  4. Application of colon capsule endoscopy (CCE to evaluate the whole gastrointestinal tract: a comparative study of single-camera and dual-camera analysis

    Directory of Open Access Journals (Sweden)

    Remes-Troche JM

    2013-09-01

    Full Text Available José María Remes-Troche,1 Victoria Alejandra Jiménez-García,2 Josefa María García-Montes,2 Pedro Hergueta-Delgado,2 Federico Roesch-Dietlen,1 Juan Manuel Herrerías-Gutiérrez2 1Digestive Physiology and Motility Lab, Medical Biological Research Institute, Universidad Veracruzana, Veracruz, México; 2Gastroenterology Service, Virgen Macarena University Hospital, Seville, Spain Background and study aims: Colon capsule endoscopy (CCE was developed for the evaluation of colorectal pathology. In this study, our aim was to assess if a dual-camera analysis using CCE allows better evaluation of the whole gastrointestinal (GI tract compared to a single-camera analysis. Patients and methods: We included 21 patients (12 males, mean age 56.20 years submitted for a CCE examination. After standard colon preparation, the colon capsule endoscope (PillCam Colon™ was swallowed after reinitiation from its “sleep” mode. Four physicians performed the analysis: two reviewed both video streams at the same time (dual-camera analysis; one analyzed images from one side of the device (“camera 1”; and the other reviewed the opposite side (“camera 2”. We compared numbers of findings from different parts of the entire GI tract and level of agreement among reviewers. Results: A complete evaluation of the GI tract was possible in all patients. Dual-camera analysis provided 16% and 5% more findings compared to camera 1 and camera 2 analysis, respectively. Overall agreement was 62.7% (kappa = 0.44, 95% CI: 0.373–0.510. Esophageal (kappa = 0.611 and colorectal (kappa = 0.595 findings had a good level of agreement, while small bowel (kappa = 0.405 showed moderate agreement. Conclusion: The use of dual-camera analysis with CCE for the evaluation of the GI tract is feasible and detects more abnormalities when compared with single-camera analysis. Keywords: capsule endoscopy, colon, gastrointestinal tract, small bowel

  5. First composition measurement of the bulk of the storm-time ring current (1 to 300 keV/e) with AMPTE-CCE

    Science.gov (United States)

    Gloeckler, G.; Ipavich, F. M.; Wilken, B.; Stuedemann, W.; Hovestadt, D.

    1985-01-01

    Measurements of the charge state and elemental compositions as well as differential intensities of ring current ions with energies of 1-315 keV/e, made with the Charge-Energy-Mass Spectrometer on the AMPTE/CCE spacecraft, are reported. An analysis of the data suggests that while the storm-time increases in the number densities of ring current H(+) and He(2+) may be roughly accounted for by the decreased volume of the compressed magnetosphere, the large jumps in the number and energy densities of O(+) require injection of energetic ionospheric ions.

  6. Distribution of ULF energy (f is less than 80 mHz) in the inner magnetosphere - A statistical analysis of AMPTE CCE magnetic field data

    Science.gov (United States)

    Takahashi, Kazue; Anderson, Brian J.

    1992-01-01

    Magnetic field measurements made with the AMPTE CCE spacecraft are used to investigate the distribution of ULF energy in the inner magnetosphere. The data base is employed to examine the spatial distribution of ULF energy. The spatial distribution of wave power and spectral structures are used to identify several pulsation types, including multiharmonic toroidal oscillations; equatorial compressional Pc 3 oscillations; second harmonic poloidal oscillations; and nightside compressional oscillations. The frequencies of the toroidal oscillations are applied to determine the statistical radial profile of the plasma mass density and Alfven velocity. A clear signature of the plasma pause in the profiles of these average parameters is found.

  7. Reduction and scientific analysis of data from the charge-energy-mass (CHEM) spectrometer on the AMPTE/CCE spacecraft. Cumulative Semiannual progress report, August 1984-August 1987

    International Nuclear Information System (INIS)

    The Charge-Energy-Mass (CHEM) spectrometer instrument on the AMPTE/Charge Composition Explorer (CCE) spacecraft is designed to measure the mass and charge-state abundance of magnetospheric and magnetosheath ions between 0.3 and 315 keV/e, an energy range that includes the bulk of the ring current and the dynamically important portion of the plasma sheet population. Continuing research is being conducted using the AMPTE mission data set, and in particular, that of the CHEM spectrometer which has operated flawlessly since launch and still provides excellent quality data. The requirted routine data processing and reduction, and software develpment continues to be performed. Scientific analysis of composition data in a number of magnetospheric regions including the ring current region, near-earth plasma sheet and subsolar magnetosheath continues to be undertaken. Correlative studies using data from the sister instrument SULEICA, which determines the mass and charge states of ions in the energy range of approximately 10 to 250 keV/e on the IRM, as well as other data from the CCE and IRM spacecraft, particularly in the upstream region and plasma sheet have also been undertaken

  8. High field Jc characteristics of in-situ processed V3Ga and CCE processed Nb3cAl wires

    International Nuclear Information System (INIS)

    Critical current densities in in-situ processed V3Ga wires prepared by a CaO crucible melting and CCE (clad-chip extrusion) processed Nb3Al wires were studied up to 22 T in the hybrid magnet (HM-2) at HFLSM, Tohoku University. A Cu-20%V alloy was melted by using an induction furnace and a CaO crucible, and then wire drawn down to the final size of ∼0.3 mm diameter. Samples were heat treated (450-550 deg. C)x(2-6.5 days) for the reaction of V3Ga compound after a Ga plating on the wire surface. The sample heat treated at 550 deg. C for 2 days showed the best Jc values higher than 104 A/cm2 up to 16.2 T. It is expected that higher Jc values at higher field will be attained after the optimization of alloy composition, heat treatment condition and so on. The best sample of Nb3Al wire prepared by the newly developed CCE process showed Jc higher than 104 A/cm2 up to 18.8 T at 4.2 K. (author). 12 refs, 4 figs

  9. Charge state distributions of oxygen and carbon in the energy range 1 to 300 keV/e observed with AMPTE/CCE in the magnetosphere

    International Nuclear Information System (INIS)

    Observations of charge state distributions of oxygen and carbon are presented that were obtained with the charge-energy-mass spectrometer (CHEM) onboard the AMPTE/CCE space-craft. Data were selected for two different local time sectors (apogee at 1300 LT and 0300 LT, respectively), three L-ranges (48), and quiet to moderately disturbed days (Kp< or =4). The charge state distributions reveal the existence of all charge states of oxygen and carbon in the magnetosphere. The relative importance of the different charge states strongly depends on L and much less on local time. The observations confirm that the solar wind and the ionosphere contribute to the oxygen population, whereas carbon only originates from the solar wind. The L-dependence of the charge state distributions can be interpreted in terms of these different ion sources and of charge exchange and diffusion processes that largely influence the distribution of oxygen and carbon in the magnetosphere

  10. Plasma in the ring currents in the earth's magnetosphere. A model and a comparison with the results of the AMPTE/CCE experiment

    International Nuclear Information System (INIS)

    Based on experiments performed in the years 1961-1983, they have constructed a model for the distribution of ion energy density in the region of the ring current. The model is aimed at demonstrating the stationary nature of the way in which the region is filled up with plasma having an energy density commensurate with the energy of the geomagnetic field. Comparing the model with the results of the AMPTE/CCE experiment, they have confirmed the existence of a quiet ring current, and they have improved our knowledge of the maximum energy content of the plasma and its composition. The fact that a significant amount of the ions are oxygen indicates an ionospheric source. Ion temperatures in the ring current amount to tens of kiloelectron-volts. When these ions undergo gradient drift in the magnetic field, they may create a ring current with a magnetic moment in the same direction (at the center of the earth) as the geomagnetic dipole

  11. Internal dosimetry of a chylomicron-like emulsion doubly-labeled with 3H-TG and {sup 14}C-CE in humans

    Energy Technology Data Exchange (ETDEWEB)

    Marcato, Larissa A.; Carvalho, Diego V.S.; Santos, Robinson A.; Hamada, Margarida M.; Mesquita, Carlos H. de [Energy and Nuclear Research Institute (IPEN/CNEN/SP), Sao Paulo, SP (Brazil); Vinagre, Carmen [University of Sao Paulo, SP (Brazil). The Heart Institute of the Medical School Hospital; Maranhao, Raul C. [University of Sao Paulo, SP (Brazil). Faculty of Pharmaceutical Sciences

    2010-07-01

    Full text: This paper describes a research about the calculation of the effective equivalent doses to which participants are exposed when submitted to studies that use artificial lipid emulsions doubly-labeled with radioactive tracers {sup 14}C and {sup 3}H. Several studies have used these emulsions in order to improve the knowledge of the biodistribution parameters of plasma lipoproteins. In the particular case of studies with chylomicron-like emulsion doubly- labeled with radioactive cholesteryl esters ({sup 14}C-CE) and triacylglycerols ({sup 3}H-TG) the dosimetric calculations was estimated indirectly. Initially, the LIA limits suggested by ICRP no 26 for {sup 3}H and {sup 14}C were used, however the LIA parameter is dependent on the chemical form of the labeled product and these parameters have not been scheduled yet for artificial lipoproteins. In particular for the {sup 14}C-CE, the internal dose in humans was estimated from the allometric theory using data from the biodistribution in rats with approximately 0.4 kg. The purpose of this paper is to improve the estimation of the effective equivalent dose in humans in order to contribute to future studies that will utilize artificial lipoproteins. For this study, chylomicron-like emulsion containing radioactive lipids were injected intravenously in bolus into the volunteers and aliquots of blood were collected at predetermined intervals of time. The activity of each aliquot was measured in liquid scintillator using a spectrometer. The plasmatic radioactive decay curves were determined and subsequently the kinetic parameters and effective equivalent doses were calculated using the ANACOMP software. It was proposed a kinetic model consisting of eight compartments for the biodistribution of plasma lipoproteins in humans. (author)

  12. Some aspects of the relation between Pi 1-2 magnetic pulsations observed at L - 1.3-2.1 on the ground and substorm-associated magnetic field variations in the near-earth magnetotail observed by AMPTE CCE

    International Nuclear Information System (INIS)

    The relation between Pi 1-2 pulsations on the ground and substorm-associated magnetic field variations in space has been studied using data obtained on the ground at low-latitude conjugate stations (L = 1.3-2.1) and in the near-Earth magnetotail by the AMPTE CCE spacecraft. The ground-based data were acquired in a campaign period from July 20 to September 16, of 1986, during which the apogee of CCE (8.8 RE) was located between 2330 and 0230 hours magnetic local time. Of 16 clear magnetic field dipolarizations observed at CCE, all had a corresponding Pi 2 pulsation on the ground, with a time lag of +1 to -7 min. For most (13) of these cases, the time lag was equal to or shorter than 2 min. However, the authors also found Pi 2 pulsations that do not accompany a dipolarization at CCE. These results are consistent with previous observations, which showed that Pi 2 pulsations are a global indicator of the expansion phase onset of a substorm, whereas dipolarizations occur in a limited region in the near-Earth magnetotail. One of the 16 events, which occurred on August 28, 1986, is studied in detail because a 13-s Pi 1 pulsation was observed on the ground in addition to an ordinary Pi 2 pulsation. For this event, CCE also observed a ∼ 13-s oscillation at ∼ 8.1 RE in the midplane of the magnetorail near midnight (Takahashi et a., 1987). They suggest that field line resonance driven by a quasi-monochromatic oscillation in the near-Earth tail is the cause of the Pi 1 pulsation observed on the ground. The commonly observed Pi 2 pulsations could be attributed to other wave excitation mechanisms including transient response of the magnetospheric cavity to a substorm-associated impulse

  13. Average spatial distributions of energetic O(+), O(2+), O(6+), and C(6+) ions in the magnetosphere observed by AMPTE CCE

    Science.gov (United States)

    Kremser, G.; Stuedemann, W.; Wilken, B.; Gloeckler, G.; Hamilton, D. C.

    1987-01-01

    Measurements with the charge energy mass spectrometer of the AMPTE CCE spacecraft are used to determine the relative fluxes of these ions near the equatorial plane as a function of the drift shell parameter L, the magnetic activity index Kp, and the local time LT. The O(+) and O(2+) ions have radial profiles with maxima at about L = 5 and diurnal variations with a broad maximum on the dayside. The O(6+) and C(6+) ion fluxes increase with L between L = 5 and L = 7 and level off farther out. The diurnal variations of the relative O(6+) and C(6+) fluxes exhibit a pronounced minimum on the dayside. The observations can be interpreted in terms of ion convection from the tail onto quasi-trapped drift orbits and further radial diffusion onto closed drift shells. The maximum of the O(+) and O(2+) fluxes as well as the minimum of the O(6+) and C(6+) fluxes on the dayside can be explained by drift shell splitting. The inward transport is associated with ion losses, mainly by charge exchange. O(6+) and C(6+) ions are removed already at larger distances than O(+) and O(2+). As a result, the ionosphere contributes most of the oxygen ions in the magnetosphere. Important contributions from the solar wind are encountered in the outer magnetosphere.

  14. Charge state distributions of oxygen and carbon in the energy range 1 to 300 keV/e observed with AMPTE/CCE in the magnetosphere

    Science.gov (United States)

    Kremser, G.; Stuedemann, W.; Wilken, B.; Gloeckler, G.; Hamilton, D. C.

    1985-01-01

    Observations of charge state distributions of oxygen and carbon are presented that were obtained with the charge-energy-mass spectrometer onboard the AMPTE/CCE spacecraft. Data were selected for two different local time sectors (apogee at 1300 LT and 0300 LT, respectively), three L-ranges (4-6, 6-8, and greater than 8), and quiet to moderately disturbed days (Kp less than or equal to 4). The charge state distributions reveal the existence of all charge states of oxygen and carbon in the magnetosphere. The relative importance of the different charge states strongly depends on L and much less on local time. The observations confirm that the solar wind and the ionosphere contribute to the oxygen population, whereas carbon only originates from the solar wind. The L-dependence of the charge state distributions can be interpreted in terms of these different ion sources and of charge exchange and diffusion processes that largely influence the distribution of oxygen and carbon in the magnetosphere.

  15. COMPARATIVE STUDY BETWEEN CONVENTIONAL CLINICAL EXAMINATION (CCE V / S OBJECTIVE STRUCTURED CLINICAL EXAMINATION (OSCE AS AN EVALUATION TOOL FOR MBBS STUDENTS

    Directory of Open Access Journals (Sweden)

    Sreedevi

    2015-05-01

    Full Text Available BACK GROUND: In India, there has been a considerable rethink on the curriculum of medical education, specially, on the teaching and assessment methodology. Subjective assessment is slowly giving way to objective structured assessment. The aim of undergoing clinical ex amination is to assess the students learning skill, knowledge, professionalism and attitude avoiding examiners variability and bias. OSCE has been advocated as it overcomes the flaws of conventional clinical examination. OBJECTIVE: To find out effective, E valuation tool where the assessment is Structured, Competency based, In - depth testing of skills is done, And higher levels of Millers Pyramid is tested. Method: A comparative study was conducted in Tagore Medical College and Hospital among the 9 th Semester students. Scores obtained under both the methods were compared using statistical methods. After undergoing both the examination, feedback was collected to assess the attitude of the students towards both the methods. RESULTS: By quantitative analysis, t he two - tailed P value is 0.000 which is considered to be extremely statistically significant. So, the null hypothesis was rejected. So, there is strong reason to believe that students are able to score better under a better examination methodology. By qualit ative analysis, attitude of the students towards OSCE method was better than CCE method. CONCLUSION: It is proved that Objective structured clinical examination a statistically significant better evaluation tool with comparison to conventional examination and it can be included in the undergraduate assessment method.

  16. Origin, transport, and losses of energetic He(+) and He(2+) ions in the magnetosphere of the Earth - AMPTE/CCE observations

    Science.gov (United States)

    Kremser, G.; Wilken, B.; Gloeckler, G.; Hamilton, D. C.; Ipavich, F. M.; Kistler, L. M.; Tanskanen, P.

    1993-01-01

    Data from the ion charge-energy-mass spectrometer CHEM flown on AMPTE/CCE spacecraft are used to investigate the origin, transport, and losses of energetic He(+) and He(2+) ions in the earth's magnetosphere. The L profiles of the average ion phase space density f were determined as a function of the magnetic momentum. It is shown that the L profiles have an inner part, where f increases with L for both He(+) adn He(2+) and where steady-state conditions are fulfilled. The outer boundary L(lim) of this region is located at a distance that depends on the ion species and the geomagnetic activity level. Steady-state conditions continue outside L(lim) for He(+) ions, while the He(2+) ion distribution outside L(lim) is strongly influenced by ion convection causing a lack of steady-state conditions. It is concluded that solar wind is the origin of the He(2+), while a mixed origin is suggested for the He(+) ions, in which the major contribution is from the solar wind via charge exchange production from the He(2+) ions.

  17. Distribution of ULF energy (f < 80 mHz) in the inner magnetosphere: A statistical analysis of AMPTE CCE magnetic field data

    International Nuclear Information System (INIS)

    The distribution of ULF energy (frequency < 80 mHz) in the inner magnetosphere (L = 2.5-6.5) has been studied using magnetic field measurements made with the Active Magnetospheric Particle Tracers Explorers Charge Composition Explorer (AMPTE CCE) spacecraft during its whole mission of over 4 years. The magnetic field time series was split into consecutive 10-min segments and subjected to fast Fourier transform (FFT), and the spectral data were achieved along with the Kp index and the satellite location. This data base was then used to examine the spatial distribution of ULF energy. Overall, the oscillation energy is localized to the dayside except for compressional oscillations associated with substorms. From the spatial distributions of wave power and spectral structures the authors identify several pulsation types, including multiharmonic toroidal oscillations; equatorial compressional Pc 3 oscillations; second harmonic poloidal oscillations; and nightside compressional oscillations; equatorial compressional Pc 3 oscillations; second harmonic poloidal oscillations; and nightside compressional oscillations. The toroidal oscillations are observable even in the plasmasphere, and using their frequencies they can determine the statistical radial profile of the plasma mass density and Alfven velocity. They find a clear signature of the plasmapause in the profiles of these average parameters. Of particular interest among the other oscillation types are the equatorial compressional Pc 3 oscillations that have an average spectral peak around 30 mHz and are present in the prenoon sector and from L∼3 to ∼5. The oscillations are similar to the compressional Pc3 previously observed at and near geostationary orbit and might represent magnetohydrodynamic waves propagating from the parallel portion of the bow shock

  18. Overlapping contributions of Msh1p and putative recombination proteins Cce1p, Din7p, and Mhr1p in large-scale recombination and genome sorting events in the mitochondrial genome of Saccharomyces cerevisiae

    Energy Technology Data Exchange (ETDEWEB)

    Mookerjee, Shona A. [Department of Biology, University of Rochester, Rochester, NY 14627-0211 (United States); Sia, Elaine A. [Department of Biology, University of Rochester, Rochester, NY 14627-0211 (United States)]. E-mail: esia@mail.rochester.edu

    2006-03-20

    The mechanisms that govern mutation avoidance in the mitochondrial genome, though believed to be numerous, are poorly understood. The identification of individual genes has implicated mismatch repair and several recombination pathways in maintaining the fidelity and structural stability of mitochondrial DNA. However, the majority of genes in these pathways have not been identified and the interactions between different pathways have not been extensively studied. Additionally, the multicopy presence of the mitochondrial genome affects the occurrence and persistence of mutant phenotypes, making mitochondrial DNA transmission and sorting important factors affecting mutation accumulation. We present new evidence that the putative recombination genes CCE1, DIN7, and MHR1 have overlapping function with the mismatch repair homolog MSH1 in point mutation avoidance and suppression of aberrant recombination events. In addition, we demonstrate a novel role for Msh1p in mtDNA transmission, a role not predicted by studies of its nuclear homologs.

  19. Validation of a questionnaire on emotional eating for use in cases of obesity: the Emotional Eater Questionnaire (EEQ Validación de un cuestionario de comedores emocionales para uso en casos de obesidad: Cuestionario de Comedor Emocional (CCE

    Directory of Open Access Journals (Sweden)

    M. Garaulet

    2012-04-01

    étricas de un cuestionario para identificar la ingesta emocional en la obesidad de fácil aplicación en la práctica clínica. Material y métodos: Se ha desarrollado y administrado un cuestionario de diez ítems llamado Cuestionario-de-Comedor-Emocional (CCE a un total de 354 sujetos (Índice de Masa Corporal: 31 ± 5, (Edad: 39 ± 12 años, pertenecientes a un programa de reducción de peso. Se llevó a cabo un análisis de la estructura interna del cuestionario, de la consistencia interna, la fiabilidad testretest y la validez convergente con el Mindful-Eater-Questionnaire (MEQ. Resultados: El análisis de componentes principales del cuestionario encontró tres dimensiones diferentes que explicaban el 60% de la varianza: desinhibición, tipo de alimento y culpa. La consistencia interna mostró que el alfa de Cronbach fue de 0,773 para la subescala "Desinhibición", 0,656 para "Tipo de alimentos" y 0,612 para "culpa". La estabilidad test-retest fue de r = 0,70. Los datos mostraron que el porcentaje de acuerdo entre el CCE y MEQ era del 70% con un índice Kappa de 0,40, P < 0,0001. Conclusión: Hemos presentado un nuevo cuestionario, que clasifica a los individuos en función de la relación entre la ingesta de alimentos y las emociones. Esta información permitirá el diseño de tratamientos personalizados desde el inicio para la obesidad.

  20. Opinion of the Consultative Committee for the EURATOM Research and Training Programme in the Field of Nuclear Energy (Fusion) - CCE-FU - on the European domestic assessment of the ITER-FEAT outline design report. Brussels, 11 July 2000

    International Nuclear Information System (INIS)

    The CCE-FU endorses the findings of the FTC on the European Domestic Assessment of the ITER-FEAT Outline Design Review, and expresses the opinion that: The machine, ITER-FEAT, the design of which is presented in the Outline Design Report and accompanying document (Technical Basis for the ITER-FEAT Outline Design) successfully responds, in broad terms, to the requirements set by the Special Working Group, established by the ITER Council, in response to Task No. 1 and adopted by the Council; The parameters chosen represent convergence towards a coherent design, based upon preserving adequate margins within the cost target against the new objectives and yet retaining flexibility to exploit advances in physics understanding; ITER-FEAT can meet its objectives of extended burn in induction operation with power amplification Q>10 at the reference operating values of Ip=15MA, Paux=40MW, thus providing 400 MW of fusion power. The margins to achieve this objective are in the range of 15-25%. The design also has sufficient flexibility to explore hybrid scenarios with long pulse capability (> 2000 seconds), and scenarios aiming at demonstrating steady state operation with the ratio of fusion power to input power for current drive of at least 5, provided further confinement enhancement can be achieved; Although most of the components of ITER-FEAT are still in a preliminary design state, the new design appears suitable to be developed into the final design stage, the new design appears suitable to be developed into the final design of a machine capable of achieving the objectives set by the ITER Council; The target cost for the realisation of ITER-FEAT was set by the ITER Council at about half of the 1998 ITER cost estimates. The present preliminary analysis provides confidence that this target will be reached. By the end of 2000, the detailed cost estimates will be provided from the detailed design specifications and manufacturing studies in the industries of the three Parties

  1. AMPTE CCE plasma wave measurements during magnetospheric compressions

    Science.gov (United States)

    Strangeway, R. J.; Zanetti, L. J.; Klumpar, D. M.; Scarf, F. L.

    1988-01-01

    This paper summarizes plasma wave observations for the AMPTE Charge Composition Explorer bow-shock crossings of November 1, 1984, and February 8, 1986, and investigates the details of the 1984 interval during which multiple periodic shock crossings were observed. For this case, it is demonstrated that the characteristic features observed in the wave measurements provide unique signatures for the magnetosheath, bow shock, and foreshock. It was found that multiple quasi-periodic bow shock crossings detected near 0900 UT, November 1, 1984, were associated with wavelike motion of the shock surface, rather than with the structure of the shock itself.

  2. Brevi cenni di riflessione sul drafting formale e sul drafting sostanziale. Analisi di due facce della stessa medaglia

    OpenAIRE

    Foschini, Federica

    2013-01-01

    Il drafting normativo ha assunto sempre più importanza e ad oggi riveste un ruolo fondamentale per la produzione legislativa. Breve analisi di alcune problematiche rilevanti, in relazione al dualismo drafting formale e drafting sostanziale, che hanno portato al sopravvento di quest’ultimo sia a livello nazionale che internazionale, in vista di una regolamentazione “sostenibile” da un punto di vista sociale.

  3. Science Excursion As A One Of The Tool For CCE In Science Subject

    OpenAIRE

    Chaudhari, Dr. Priti

    2015-01-01

    The present world is a world of science and technology. Everything and every event happening around us demand some knowledge of simple scientific facts or principles. Learning by doing and learning by living are the two cardinal principles of teaching and same is true in case of teaching science. It is the natural urge in the children to make things, to break things and to handle things but the present curriculum does not provide ample opportunities for the students for self expression, indep...

  4. The effect of construction cost estimating (CCE software on job performance: An improvement plan

    Directory of Open Access Journals (Sweden)

    Mohd Mukelas M.F.

    2014-01-01

    Full Text Available This paper presents a comprehensive statistical research on the effect of construction cost estimating software’s features towards estimating job performance. The objectives of this study are identification of cost estimating software features, analyzing the significant relation of cost estimating software’s features towards job performance, Explore the problem faced during the implementation and lastly propose a plan to improve the cost estimating software usage among contractors in Malaysia. The study statistically reveals four features of cost estimating software that significantly impact towards changes in cost estimating job performance. These features were refined by performing interview to focus group of respondent to observe the actual possible problems during the implementation. Eventually, the proposed improvement plan was validated by the focus group of respondents to enhance the cost estimating software implementation among contractors in Malaysia.

  5. AMPTE/CCE CHEM observations of the energetic ion population at geosynchronous altitudes

    Science.gov (United States)

    Daglis, Ioannis A.; Sarris, Emmanuel T.; Wilken, Berend

    1993-01-01

    The paper presents results of a statistical study of average characteristics of the energetic ion population at geosynchronous altitudes, using energetic-ion (1-300 keV/e) measurements from the CHEM spectrometer aboard the AMPTE Charge Composition Explorer between January 1985 and June 1987. Data were sorted into four MLT groups and two extreme geomagnetic activity levels ('very quiet' for AE less than 30 nT and 'very active' for AE greater than 700 nT). A clear quiet-time dayside feature found in the measurements was a dip in H(+) and He(2+) spectra, at 6.6 keV/e in the prenoon sector and at 3.5 keV/e in the postnoon sector. During active times, the ion fluxes increased (except for He(+)), and the O(+) contribution to the total energy density increased dramatically. The pitch angle distributions were normal during quiet times and isotropic or field-aligned during active times.

  6. The response of energetic particles to nightside magnetic pulsations as seen by AMPTE/CCE

    Science.gov (United States)

    Lopez, R. E.; Engebretson, M. J.; Mcentire, R. W.; Lui, A. T. Y.; Zanetti, L. J.

    1986-01-01

    This paper reports the response of energetic ions during two types of magnetic oscillations: an azimuthal fluctuation and a radial fluctuation, both with periods in the Pc4-Pc5 range. The azimuthal oscillations occur on April 30, 1985 from 0950 to 1210 UT at 8.7 to 7.0 R(E) and from 1.5 to 2.8 MLT. The radial oscillations occur on April 26, 1985 from 1200 to 1400 UT at 8.7 to 7.5 R(E) and from 2.2 to 3.0 MLT. In this case the particles show in phase periodic flux variations in sectors with radial gradients in the flux. These particle fluctuations represent two distinct modulations, each associated with a basic mode of magnetic oscillation in the near-earth magnetotail.

  7. On the solar wind - magnetosphere - ionosphere coupling: AMPTE/CCE particle data and the AE indices

    International Nuclear Information System (INIS)

    We present a statistical study of the substorm particle energization in terms of the energy density of the major magnetospheric ions (H+, O+, He++, He+). The correlation between energy density during substorm expansion phase and the auroral indices (AE, AU, Al) is examined and interpreted. Most distinct result is that the ionospheric origin O+ energy density correlate remarkable well with the AE index, while the solar wind origin He++ energy density does not correlate at all with AE. Mixed origin H+ and He+ ions exhibit an intermediate behavior. Furthermore, the O+ energy density correlates very well with the pre-onset AU index level, while there is no correlation with the pre-onset AL index. The results are interpreted as a result of solar wind. The results are interpreted as a result of solar wind - magnetosphere - ionosphere coupling through the internal magnetospheric dynamo: the ionosphere responds to the increased activity of the internal dynamo (which is due to the high solar wind input) and influences substorm dynamics by feeding the near-Earth magnetotail with energetic ionospheric ions during late growth phase and expansion phase

  8. SWFSC/MMTD/CCE: Tagging and Tracking of Physeter (T-TOP/T-TOP2) 1997

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This research was devoted to studying sperm whale (Physeter macrocephalus) behavior. The principal study area for T-TOP and T-TOP2 was the Pioneer Seamount, 50...

  9. SWFSC/MMTD/CCE: Collaborative Survey of Cetacean Abundance and the Pelagic Ecosystem (CSCAPE) 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The CSCAPE 2005 cruise was a collaboration between the National Marine Fisheries Service (NMFS) and the National Marine Sanctuary (NMS) Program to assess the...

  10. ALiCCE: Atomic Lines Calibration using the Cross-Entropy Algorithm

    CERN Document Server

    Martins, Lucimara; Caproni, Anderson; Vitoriano, Roberto

    2014-01-01

    Atomic line opacities play a crucial role in stellar astrophysics. They strongly modify the radiative transfer in stars, therefore impacting their physical structure. Ultimately, most of our knowledge of stellar population systems (stars, clusters, galaxies, etc.) relies on the accuracy with which we understand and reproduce the stellar spectra. With such a wide impact on Astronomy, it would be ideal to have access to a complete, accurate and precise list of atomic transitions. This, unfortunately, is not the case. Few atomic transitions had their parameters actually measured in the laboratory, and for most of the lines the parameters were calculated with low precision atomic energy levels. Only a small fraction of the lines were calibrated empirically. For the purpose of computing a stellar spectral grid with a complete coverage of spectral types and luminosity classes, this situation is rather limiting. We have implemented an innovative method to perform a robust calibration of atomic line lists used by spe...

  11. Progress in the Modelling of Critical Thresholds and Dynamic Modelling, including Impacts on Vegetation in Europe : CCE Status Report 2010

    NARCIS (Netherlands)

    Slootweg J; Posch M; Hettelingh JP; CMM; mev

    2011-01-01

    Wat weten we over de relatie tussen stikstofdepositie en biodiversiteit? Dit rapport laat zien hoe de huidige kennis het Europese luchtbeleid op dit terrein kan ondersteunen. In Europa staat de biodiversiteit onder druk door onder andere een te hoge stikstofdepositie. De opstellers gaan in op de inv

  12. Magnetic storm of September 4, 1984 - A synthesis of ring current spectra and energy densities measured with AMPTE/CCE

    Science.gov (United States)

    Krimigis, S. M.; Mcentire, R. W.; Potemra, T. A.; Gloeckler, G.; Scarf, F. L.; Shelley, E. G.

    1985-01-01

    Compositional studies of the equatorial distributions of ring current ions during the September 4, 1984 magnetic storm have been made possible by comprehensive energy, charge state, and mass coverage data from the Charge Composition Explorer satellite. An examination of ion spectra at an L value of about 4 on September 5, in the local evening sector, shows that energy density was dominated by protons, with O ions contributing about 27 percent at the peak of about 150 keV, while He ions contributed less than about 2 percent. September 6 ion spectra, taken during the recovery phase of the storm, indicate that ion densities at more than 20 keV had decreased markedly, and that the ring current energy density was primarily provided by protons.

  13. Magnetic storm of September 4, 1984 - a synthesis of ring current spectra and energy densities measured with AMPTE/CCE

    International Nuclear Information System (INIS)

    Compositional studies of the equatorial distributions of ring current ions during the September 4, 1984 magnetic storm have been made possible by comprehensive energy, charge state, and mass coverage data from the Charge Composition Explorer satellite. An examination of ion spectra at an L value of about 4 on September 5, in the local evening sector, shows that energy density was dominated by protons, with O ions contributing about 27 percent at the peak of about 150 keV, while He ions contributed less than about 2 percent. September 6 ion spectra, taken during the recovery phase of the storm, indicate that ion densities at more than 20 keV had decreased markedly, and that the ring current energy density was primarily provided by protons

  14. AMPTE/CCE observations of shell-like He2+ and O6+ distributions in the magnetosheath

    International Nuclear Information System (INIS)

    We present the first simultaneous observations of solar wind He2+ and O6+ shell-like distributions in the magnetosheath. The He2+ and O6+ distributions are centered on the downstream H+ bulk velocity and have radii proportional to mass/charge. These observations are consistent with the electrostatic cross-shock potential model discussed in the text. copyright American Geophysical Union 1988

  15. aP2-Cre-mediated inactivation of acetyl-CoA carboxylase 1 causes growth retardation and reduced lipid accumulation in adipose tissues

    Science.gov (United States)

    Adipose tissue is one of the major sites for fatty acid synthesis and lipid storage. We generated adipose (fat)-specific ACC1 knockout (FACC1KO) mice using the aP2-Cre/loxP system. FACC1KO mice showed prenatal growth retardation; after weaning, however, their weight gain was comparable to that of wi...

  16. 78 FR 25702 - Notice of Availability of a Draft Programmatic Environmental Assessment for Fisheries Research...

    Science.gov (United States)

    2013-05-02

    ... Current Ecosystem (CCE), throughout the Eastern Tropical Pacific (ETP) Ocean, and in the Scotia Sea area... in the CCE; longline surveys for life history studies of sablefish in the CCE and highly migratory species tagging in the CCE and ETP; deep-set buoy surveys for tagging swordfish in the CCE;...

  17. Ion composition of the bulk ring current during a magnetic storm - Observations with the CHEM-instrument on AMPTE-CCE

    Science.gov (United States)

    Stuedemann, W.; Wilken, B.; Kremser, G.; Gloeckler, G.; Ipavich, F. M.

    1986-01-01

    Ion composition measurements in the entire energy range of the ring current population, obtained with the Charge-, Energy-, Mass-spectrometer instrument on the Charge Composition Explorer in September 1984, are reported. From the energy spectra obtained for all major constituents during the main phase of a magnetic storm, the number densities, energy densities, and mean energies are calculated and displayed as radial profiles. The mean energies of He(2+) are found to be about twice that of H(+) and He(+) throughout this storm, and the time profiles for the mean energies of all major ions are seen to bunch together (when normalizing mean energies by the ionic charge), with the largest variations of the energy densities and mean energies occurring for O(+) ions.

  18. Validación del Cuestionario de Creencias Centrales de los Trastornos de la Personalidad (CCE-TP) en población colombiana

    OpenAIRE

    Diego Castrillón M.; Mónica Schnitter C.; Alberto Ferrer B.; Liliana Chaves C.; Nora Helena Londono A; Carlos Alberto Marín C.; Katherine Maestre C.

    2007-01-01

    Se construyó un cuestionario para evaluar creencias centrales asociadas con los trastornos de la personalidad, fundamentadas en el Modelo de la Terapia Cognitiva. Se realizó el análisis estructural y la validez de contenido de la prueba en población universitaria de la ciudad de Medellín, Colombia. La muestra fue representativa y elegida al azar a través de un procedimiento polietápico. Un número de 809 estudiantes universitarios contestaron el cuestionario de creencias centrales de los trast...

  19. Protein (Viridiplantae): 145351138 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:3572 predicted protein Ostreococcus lucimarinus CCE9901 MATRATRATATATPTLRQSMTALVRLVHPDVLAATHPEHARANG...DALAHLQGTLDDARGRGALPGARVRRLRFYVRDDARAEGVRDVGFTLRTTGGDCRNVMRRDLGALFAQVGIEREFEWGEGDWGATRTETEAEDEGARGRGEGETSRSSETPEVAQAYREQTTTNAGGGGTR

  20. Protein (Viridiplantae): 145341964 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 17:1029 predicted protein Ostreococcus lucimarinus CCE9901 MATRDGDGDAATTFTPATLRALVERSNGALCAFACDGVVFDATLGKDFYGVGGPYAALNGRDATRALATMKINVSDADEALGARGLTEEELKTLGEWRAKFESKYPRLGTFERRGEGN ...

  1. Protein (Viridiplantae): 145348312 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available PGAIGDAARVVSSAAMCARGRGRGGAAERLRDAALATCSHESDFAVACFAGSMFAKMAETERRVREAVGTRASAPATVAFALALGMATNAAAAASARALGYGDACWRGAGGLVFALKTYRA... 436017:2775 predicted protein Ostreococcus lucimarinus CCE9901 MFYYLAWRSLEAIARCWRATRDAFGFEPVGAAATLGVVFVERVARRA...RVDYARGYRGRVSFFGFIDVPAETASVAEIVILALMDSSPTALNLYGAGAAVGFMVASFERETMRGLACATRGVKKLLGVALGPSVRVGSRVVLARMRNASLNGNWGIVVETRGDQVTVSLDVDGRNITALRDNLIVV ...

  2. Protein (Viridiplantae): 145353460 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TTTDDGGAGGWFGGGGGWLGGGGGGGFGGDGDDATRGARRAAFALAAATATGAGGAREANATTTTTRRRGDGGRRATKLGDMATSALYGFA... 436017:4186 predicted protein Ostreococcus lucimarinus CCE9901 MRRLATPRVAVAGVGRREDARGNRRDVARARRSETASTTRSETRTTTRDGIEKSSATTRAT...AFYGIKIALKRLFAPFALFWGTTQLLFRMHAVKISPAMLHERLVRPYLPIEYQKSLNDFGVAAMKTKAAKNAMRDGWWDKQERRFWTCAHRLLPACDSAMGERAFVFGVILAGLA ...

  3. Protein (Viridiplantae): 145349678 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:3185 predicted protein Ostreococcus lucimarinus CCE9901 MATRAGDARARATTTTRVRQGVRFGARRAATGRRRAVNEAPLETATR...NQTEHALACREIAAYAPSDADGASAFARTRAKRREMIEAAEGSDAVVPVFGFDESNVVIFVGVKANAGGVDANDWATTFGI...TSAQAIVGAGAFQDASLFEVVKSSKANEVDHRFTHVARVSLGPVGQDEALVSAAEDVIRRACAAIDPSALIAPYACVYNIGKKGTPPGALPAMREIAKKKKENDEMSTQSTRTTADV ...

  4. Protein (Viridiplantae): 145354124 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4321 predicted protein Ostreococcus lucimarinus CCE9901 MSSGEDDEVDLSALATISETCREFRRLHEASDRAMAVIPRWYALCVNDAAVELGEAATAATRA...APSARLDAFLERGFAHESEKARAPEKLTSAIEDVGRCVAFMGDAVTRANEALGEFVEATSGRRPSDDGDARWIADVPVPVMRTAFKWGSEEEYTIEQWLWMAT...SVVEQLERELETRRKILDYVRGGVASARAEELDGCVALWSAQPFVDDRLFAIVCGDSADADAAAAS ...

  5. Protein (Viridiplantae): 145356534 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4933 predicted protein Ostreococcus lucimarinus CCE9901 MATARIARVAPARADARARRARGARASSTAPSTPARATRRRAEA...PRRDERLEVITFDLDDTLWPTTPVVNAANEALIEWCSARLGGRFPRTARVHATMKRIREQRECEAAARGTTAEPMSYAAIRIAGATRAAIECGIPESDAVATVARGYHLAWIPMRNAMA...RELVYPGAAEALRAIRERHPGVAVGSITNGFGSAAGAGLGEFFDFEISAEALIDEHMVHGEMARKPNAYP

  6. Protein (緑色植物): 145352889 [

    Lifescience Database Archive (English)

    Full Text Available 7:304 predicted protein Ostreococcus lucimarinus CCE9901 MLVDLTSPAPARASEGADDDARSARRASAATRRARATREGEEEDDDVVLVEASKTKRRRASLDVVVTGEATRTRA...TNAREVGGARARARAAARAAAVRGTTTTTKAATTANANGNANARGRCAVCLDDYVNATTTRCGHVFCARCVRAAIEHSGTCPTCRKKVTRAQCHRVFL ...

  7. Protein (Viridiplantae): 145352889 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 7:304 predicted protein Ostreococcus lucimarinus CCE9901 MLVDLTSPAPARASEGADDDARSARRASAATRRARATREGEEEDDDVVLVEASKTKRRRASLDVVVTGEATRTRA...TNAREVGGARARARAAARAAAVRGTTTTTKAATTANANGNANARGRCAVCLDDYVNATTTRCGHVFCARCVRAAIEHSGTCPTCRKKVTRAQCHRVFL ...

  8. Protein (Viridiplantae): 145351935 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 6017:3792 predicted protein, partial Ostreococcus lucimarinus CCE9901 QGYPANNTGYPSNSTGYPSSSTGYPSDSTGSGYPSNSTGYPASGYPANSTGYPAKGYPANS...NGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSNGYPANSDG ...

  9. Protein (Viridiplantae): 145347773 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:2613 predicted protein Ostreococcus lucimarinus CCE9901 MKWTASKVFQCVTLFLLASALEIGGCYGFWRAVRLEKNKLWAAFGAASLVAYGGVFLLMPMDAFARIMAAYGGVFIVSSYAFGAAVEGFKLDAGDYVGASIALAGVGVCLFWPRE ...

  10. Dicty_cDB: AFM809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM809 (Link to dictyBase) - G21616 DDB0231736 - - (Link to Original site) ... slug cDNA, clone SSI661. 192 5e-74 2 ( EL371623 ) CCE L13642.b1_C04.ab1 CCE (LMS) endive Cichorium en... 5 ... 2 0.014 1 ( EL354988 ) CCE M11643.b1_F07.ab1 CCE (LMS) endive Cichorium en... 5 ... 2 0.014 1 ( EL349132 ) CCE L5548.b1_H19.ab1 CCE (LMS) endive Cichorium end... 5 ...

  11. Growth of Lactobacillus paracasei ATCC 334 in a cheese model system: a biochemical approach

    OpenAIRE

    Budinich, M.; Diaz-Muniz, I.; Cai, H; Rankin, S. A.; Broadbent, Jeffery R.; Steele, J L

    2011-01-01

    Growth of Lactobacillus paracasei ATCC 334, in a cheese-ripening model system based upon a medium prepared from ripening Cheddar cheese extract (CCE) was evaluated. Lactobacillus paracasei ATCC 334 grows in CCE made from cheese ripened for 2 (2mCCE), 6 (6mCCE), and 8 (8mCCE) mo, to final cell densities of 5.9 × 108, 1.2 × 108, and 2.1 × 107 cfu/mL, respectively. Biochemical analysis and mass balance equations were used to determine substrate consumption patterns and products formed in 2mCCE. ...

  12. Dicty_cDB: VHC275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC275 (Link to dictyBase) - G22313 DDB0233961 Contig-U14773-1 - (Link to O ... complete sequence. 34 0.22 8 EL371567 |EL371567.1 CCE L13585.b1_B13.ab1 CCE (LMS) endive Cichorium endivia ... cDNA clone CCE L13585, mRNA sequence. 48 0.26 1 EL360537 |EL360537 ... .1 CCE M5240.b1_O14.ab1 CCE (LMS) endive Cichorium endivia ... cDNA clone CCE M5240, mRNA sequence. 48 0.26 1 dna update 2007. 4. ...

  13. 2013-2014 California Current Ecosystem (CCE14): Acoustic-Trawl Survey of Coastal Pelagic Fishes (Legs I and II); and Investigations of hake survey methods, life history, and associated ecosystem (Legs III and IV) (SH1405, ME70)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2014 acoustic-trawl method (ATM) project aboard Bell M. Shimada represents a joint effort between the SWFSC and the NWFSC in investigating elements of the...

  14. 2013-2014 California Current Ecosystem (CCE14): Acoustic-Trawl Survey of Coastal Pelagic Fishes (Legs I and II); and Investigations of hake survey methods, life history, and associated ecosystem (Legs III and IV) (SH1405, EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2014 acoustic-trawl method (ATM) project aboard Bell M. Shimada represents a joint effort between the SWFSC and the NWFSC in investigating elements of the...

  15. In situ, navigational, physical and profile data collected by University of California - San Diego; Scripps Institution of Oceanography at OceanSITES site CCE1 from 2008-11-11 to 2012-09-19 (NCEI Accession 0130028)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In situ, navigational, physical and profile oceanographic data were collected, including CONDUCTIVITY, CURRENT DIRECTION, CURRENT SPEED, CURRENT SPEED - EAST/WEST...

  16. In situ, navigational, physical and profile data collected by University of California - San Diego; Scripps Institution of Oceanography at OceanSITES site CCE2 from 2010-01-17 to 2014-04-29 (NCEI Accession 0130029)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In situ, navigational, physical and profile oceanographic data were collected, including CONDUCTIVITY, CURRENT DIRECTION, CURRENT SPEED, CURRENT SPEED - EAST/WEST...

  17. Protein (Viridiplantae): 145350763 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 36017:3474 predicted protein Ostreococcus lucimarinus CCE9901 MFAVEYEAVPRLSGEGMRAGAKIALTDPYVGEDGTIWLERATTELLGGVVERLERARTRAMA...VFEAPNRPGVGEGDRVKAATRAAWEEEANEARALDGARDVEGAAPRVVVTPNAARGVVPDSQVVDILEIGGEDDALAGDARAMGAVASPRRSTR...SSLQASGEPIFSSRERSSVPSSSAPALDDRTMALVQRVNESAVKGLWTYLGCLRAARASLDDKSAMATVHAWITRTGRL...EVQEDARPPLWRVKIQISDPTGAASAYLRNAPLDAFAGTTATAYVAADARERESIEASIRKRLEEFCGRIRLASLKEKIMVVQKLDAQPTGFKPSVVGALRARKAYL ...

  18. Protein (Viridiplantae): 145354891 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4521 predicted protein Ostreococcus lucimarinus CCE9901 MATTWTTARDGAGRGRGAARASTRRALDDARATRGIATRAVRSGGTGEVGEASRA...AVEGSAVETVETVEADLDLGSAAANATTATRAEASADLARGAVSGAWRSDVVPEVAYVVTWCCGNSVAHLTKRFDGLAATTLGLVFAAKTPESACDALTDDLRA...MTWMCAEMPNSQAREVDAMAWFLRETYVGDAPKIFIFAHDDRPFWPSLRAFVEELRTGERDGTVTRVVDARARK...MEKEFSVARDGKAPTDFDGDTFIAYSVAREPLVGTYMYTNAFALLLRTFFDVVKDVEDPASELADAPDRNASERPGWRVSSRYLGERLDWPISAIFAVTRDMAKHRSQ...KFYEALSLLVACDGKLTSAVDFEYFAALEWAHTLERAWLPIVFNPALRERAEGVPECLLDAEARCYEVLDWNAGVRDVVRYDPARHADVPWSFPQGADSRGLSVATEPRDVVDKCGARTWHDHPIAMGGGKNLEI ...

  19. Protein (Viridiplantae): 145356447 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4912 predicted protein Ostreococcus lucimarinus CCE9901 MATTTVARASIAPTVSRAIARRSSRSRPRVARVGARATTTTRETRARTRRPTTTTTRAATTTATATAT...ATRRTTRGTTTTTRATREEDALATAIGATAAALARTRARTGRALTLALVAGAWAQSVNLGGTFALALFRAHEVPIVAAAFALGV...IPYLGLIKLLDFAVAGPVLVNEGKTPREAMARSRELMYGYRVLLMKTTFLCSTVCAALVCGTVGAFVACVPSLPNLMLGAEATTVGEAAAGFINGAAFDRVWVLGTPLERAATFALLVCGLVLSFLFTLGFRELLSLFYEETTARYSPPPPLDASAIDAPNKPSLWRRAQFWRKE ... ...AAWKFACAQYARTCVLRREGEKEGEARSDRRGALAAVNSMGWSVRAAHGELKDARGVLASLCVLDLRRLASVAWNSLITVP

  20. Protein (Viridiplantae): 145343508 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available LAMPAYDASRGLARASTTRRDATRRGGLADVACEGVRAATSWDGEHHVGIAVRGYEFEHQHAFYPGLAMATRATTAAVGRAARLAGARTTRDDARE...17:1275 predicted protein Ostreococcus lucimarinus CCE9901 MPRDGDGATDGRATRAAFGTFLRDASRRRDGGATTTTTRAMMFRRGARTRAVALCVVLATR...RNLGNVLLGAPAIALGFYLTKRFAWSRDARVFVKEEQRFFVGAYFVKLGVMTVIAATYMHVQVATRFLSTSPAMYWGLAHLGRHSKAWRRFIATYHVSYALVGAALFANFYPWT ... ...MFRSNGVLCVVLLLGHAGREMFRLLRDANDETRHRRAARHLKRAMIAIALTVAPHYAFAQFGDMRYCNGAVFDGAERPYCRPKSWRNLYGYVPSGMYSFIQRHYWNLGFMSSYRA...ECAAGAAAVAINAYAFARSVEAMYALSTQLLRDEALAEAAATLYAMNPANVFYGSAYAEAGFAYAQFAAGSLLQENKVLHSGVLFGVAT

  1. Protein (Viridiplantae): 145350768 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 17:3476 predicted protein Ostreococcus lucimarinus CCE9901 MATRANVDDGAREANALRTFLRDAKEAFARDPGACDVSVGNEACDLDSVACAVATARAASAKRGRDDGERETRA...DRVIELIGSCSSLVYRDVVAKAADEGVARDVARLLLGAIVLDTRMLDATTTRAAPVDFAAAESLRDILGWDEDATRAEYESLSRA...VPIVSCAREELKLRPDVVLALANAGVKLGDLTCAEDVAAAATKATPRSVTLVDHNALSARLFPDAWQARVVRVIDHHEDSGMYAERA...RHDQSSFSCAQLLAKDYKQWTMGSLEVGIASFGVRFQDLLARQDASSVNDEIVAFVDARRIDVLFMMSSFEDADADGAFARQIDVTKSSACSIELEAVMRDLGERTPLAPLRLPENDFGVFKSARAQLDVKASRKKVQPILLEILARF ...

  2. Protein (Viridiplantae): 145348646 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available MLAREETERVEKWLRDSAAATRRGEGARGEGSRGRRSDDDGGVKMAMASEEDVEVEEYDYGVEEERAMRSSMATTLVARESMSSLFVPQRSPARSVIHRPIPRRPLSASVEGTEWTTLRAKATR... 436017:2871 predicted protein Ostreococcus lucimarinus CCE9901 MGAVRTMRDGTTRGEGERDAREGTRARGTTTTTTTTTSLDAFDARLARARERA...SGDTRTNVSIVSDEDGRSAFQSLARDNRAGLDGLGDMVARTTISSGVLDDGGLDGG...MSTPPRPHRSPLRPPVARPRNRTLSEDFSSPVRLSSSMELRHSTSSRMTLLESVAHEAEYERARMSEKSYDDSEPR ...

  3. Protein (Viridiplantae): 145349555 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:344 predicted protein Ostreococcus lucimarinus CCE9901 MSRASSRVAPALARRARAATRDARGATTTTRDDDATRRRRRATTEARDDGQRRALDALERFYDGARLGTRA...GRGVYLHGGVGRGKTALADATSEDAREKGGLEVERTHFHAFMARIHRALHESAMKARGEGGGGADDPLWTLGKNMATKTRQHV...LCLDEMEISDVADAMVIERLMRSYFAHGGALVTTSNCAPERLYYGGINRAAFAGFADGLRARCEVVDLDARESVDYRRRARDEDVEDGVIFVGDDDATRERLSRA...DVLYEHRVVLLANLWTSPDDLFDVVDGAVDDSDAFRELAPRERTRIENAFQSTLSVTRDGGSSGRSTTMLAPELEWSATGRVGASLAHVSGVNFTLAASPRAASRLHHMRSSAYFNTSP ... ...WDRFTRDAEGEREVDADVGRLRAKARVGAHARFTFDDICGRRSRAAPSDYVALAERFKVICVEDVPRLPVDASENEARRFINLI

  4. Protein (Viridiplantae): 145353482 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:4191 predicted protein Ostreococcus lucimarinus CCE9901 MATRRRARGARAAKRALACALALVACVTVGARWRSGGEASSTASTSSATTSVDDDAREGAEAAT...AARDDATRSTLKATLLAGAKDEGACTNERDVRGRFATRDFALVREVERRTRARVGFGWARWGDAEMISSARDGSPMRLAVRALMSVSAT...VEGLPFIGHSAFVDASGKGMGGDGAADSVVQRIFEIGDAFDEPPVVIMAAGMAAKTAILSAQDRINSKGWGLIDAGTTLDGYAGVKSRDYNDPRVYCRKSRERARDEHDGVDFWFAKGVCEKFGA ...

  5. Protein (Viridiplantae): 145351503 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:2527 predicted protein Ostreococcus lucimarinus CCE9901 MATATIGRATLEATRARARATATRARGRWDAGRAARARATGRARAT...GVDMLPPLDETTMLKGIDLNRLTDGVHSKEALDMVREHLMAVLGGAGENAYSSQLVRMSKLQAAQVYAASIMFGYFVTRADKRFQLDRMVGTLPMDPMESAMA...GRGDGFGDAETNPAAGLKAPSTPESPRGQQLAYILRTAPEMFDAAVDSQLDGLGEEVEREAKSASEEAKTEQLVLFKRIADVRALERRNGLEDIMYTTIIQKFLSV

  6. Protein (Viridiplantae): 145345647 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:1985 predicted protein Ostreococcus lucimarinus CCE9901 MATARATAGAPARATTARWIATRSRATRATRGTRGRARATPNDGEAHAAYLRDVAATRA...PAELEALARVLDALGCETIAPNARRGIHPLVMPLARTREGGVIGLMVTEDDGEATPVVEVRDGAHATMLAKSARDYVHRAIVEEEAMSDEQTT...TVAAAAGAVGVSLHAHGAFKTSGKEFDVYVTTQIGKFPSSMEGLVRRHLKRNDEQSALITCDLYKATFGDWGAPHVFISDL...YSKLGRDEEARDAARQALQTPWSTIGGRDAITRMIDVAGWSGKTVAEIKEVLESRRGPSAAAFDGPKSEKQLAREEGELLLDQIAAGEIESSTVNQRLAECYMNAGKPALAKFIMCGAGMPAL ...

  7. Protein (Viridiplantae): 145356904 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 7:304 predicted protein Ostreococcus lucimarinus CCE9901 MATRSRGFPRAARPDVVRAAQKDETHAAATAERLHDACARALGPRLSVRWNRALRACGRAAYPALTYLSGRAT...LGEEYCDLASGDARGRKSSARALWTRFVIDAFGEEIARELRGCVVRNHERGVGLGGGETSAATRAMDASARTALALVGRRVERGMG...DETTSHGQAMIDARGGFANAAHLALFYANGEYYDWSCRASGTRRAFTGAYAGEERPSYALLGVFVAFQLAVVTCENVASFA...RGGGSSETSGAPSVGARVLESDGSPAIEAAIVASPRLDVFGNPVDEGASASRKSKSTSPLIAAKCALCLSPRESPTATPCGHVFCWRCIAGWASKKPECPLCRAPTTPQSLVPLSNLA ...

  8. Protein (Viridiplantae): 145349039 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:2992 predicted protein Ostreococcus lucimarinus CCE9901 MATSRRRRARLGALVLACVAALAARARASDVDTECAEARRACARDARRAIDSDARLQKFLATATRDATR...ADGDAALGASRYGGFVADDAPRLAFAELVALGCCLFDGECARDAATRAARRGDDEAAATRDALEIGGALLFRASEHEHWTKMPGIGTLGADARTCAEATGTTR...LFKRLLTSNRFDKVAAERLREVTRAEELWVDPTRGGTPDKAYLMADALIRLASRGATAIAVCVVFYVFRNFTFIGGAWRFARSVFLAVTGISLVTRVFKRVRAFVKWLRWKPPVVDTRQARREEARKSKKRV ... ...CDDALVATYVKAGDAGDELGVLRAGDAMLRRYVAGLATRVQGEGAREECDATRGGDVGDAAGARA

  9. Protein (Viridiplantae): 145355788 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:1518 predicted protein Ostreococcus lucimarinus CCE9901 MRRARRACQRALGAARGARAATTLTSTSVDARASTRARGATRRRRPPTERA...LPRLPPTTLTPRPGDRERYARSLREQFARCAVVREREHGVPRATRLTRDAPGGTTRALERLRRRAGADAYVVGGAVRDWIALGERAKPRDVDLVTSATYEEIEAAMDGRAKVVGRRFRVALVRA...NAGRWIEVASFESEGEGEGEGESEEDATRADAEGAPVTASGETDYDAMLRRRRAERAKREATSTSTTSSRRA...LASASPRRVASEIETLMQNGYSEASFKLLWHSTLMKYAFPVQHEFFKPRLPNKSSLTYDLESLVSPNRDFDGGARVLFDALKAYDGHVSDDISKSSVAQWLAIIVAPVAMHRMATR...SECASALLLLLAHGPVFADAPSGDLKWRHASFESLVDRGERVFALVKTKRRNEWSDANKASPTAEAEVVRASLEVATTTTTR ...

  10. Dicty_cDB: VFM645 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM645 (Link to dictyBase) - G20229 DDB0215888 Contig-U09876-1 - (Link to O ... S) chicory Cichorium in... 60 5e-12 3 ( EL342921 ) CCE L10914.b1_D17.ab1 CCE (LMS) endive Cichorium en... 6 ... 0 5e-12 3 ( EL371213 ) CCE L13227.b1_F19.ab1 CCE (LMS) endive Cichorium en... 6 ...

  11. An unusual case of a patient who lost his native kidneys and renal allograft from cholesterol crystal emboli

    OpenAIRE

    Wasim Ahmed; Abdulkareem Al Garni; Elbadri Abdelgadir; Khamess Obeid Khamees; Mohammed Ali Ahmed Ellouly; Abdul Haleem

    2015-01-01

    Cholesterol crystal emboli (CCE) syndrome involving native kidneys is an underdiagnosed condition. CCE is rare in renal allografts. It may present with acute kidney injury, but usually not acute graft loss. CCE should be considered in patients with a history of atherosclerosis and an invasive arterial procedure who present with acute or chronic renal allograft dysfunction. Therapy for CCE is mainly supportive and carries a high rate of mortality. To the best of our knowledge, this is the firs...

  12. Dicty_cDB: VFJ869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ869 (Link to dictyBase) - G23283 DDB0218741+2 Contig-U15102-1 VFJ869P (L ... slug cDNA, clone SSK426. 452 e-122 1 ( EL367947 ) CCE S4102.b1_K18.ab1 CCE (LMS) endive Cichorium end... 5 ... 0 1e-05 2 ( EL366777 ) CCE S2888.b1_O02.ab1 CCE (LMS) endive Cichorium end... 5 ...

  13. Dicty_cDB: VSD831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSD831 (Link to dictyBase) - G00977 DDB0186435 Contig-U06604-1 VSD831P (Lin ... g leaf Medicago truncat... 42 3e-04 2 ( EL343426 ) CCE L11427.b1_F02.ab1 CCE (LMS) endive Cichorium en... 3 ... 8 4e-04 3 ( EL353306 ) CCE L9939.b1_F14.ab1 CCE (LMS) endive Cichorium end... 3 ...

  14. Experimental Identification and Study of Coloured Conical Emission in Quadratic Nonlinear Media

    Institute of Scientific and Technical Information of China (English)

    YANG Hua; QIAN Lie-Jia; FU Xi-Quan; LUO Hang; YUAN Peng; ZHU He-Yuan

    2007-01-01

    We have explicitly identified coloured conical emission (CCE) and noncollinear optical parametric generation (OPG) by spectrum characterizations. With an experimental setup providing different pump pulse durations,CCE and noncollinear OPG are observed both alternatively and simultaneously. Comparisons between CCE and noncollinear OPG are studied. Accumulation behaviour of modulational instabilities is observed in our two-crystal cascaded configuration, which results in enhancement or depression of the CCE formation.

  15. Protein (Viridiplantae): 145347228 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TPKKHGKETTKIAVVGDTGQTDVTREVLTHVRDALGDSELLIHTGDVSYADGFAPRWDSFGTLSEFLLDGMPMLTVPGNHDVAQNGMDLVSYMARYPSPYTASKSPSQLFWSHEVGQAHIIGLNSYANS...LFDAGVDLVFNGHVHAYERSHPVHDFHVHECGPVHVVVGDGGNYEGPYGNSWMEPQPSYSAFREGSFGAGSLTIHNDTHATWEWRR ... ...36017:2451 predicted protein, partial Ostreococcus lucimarinus CCE9901 YHSPIVHTAKMTGLMAGERYSYALPGSETTRSFRAPK...QTGVYDGADTPQMAWLRKDLATINRQYTPWVVVVFHAPWYNSNRGHFKEAERMRKALEQI

  16. Protein (Viridiplantae): 145356660 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 36017:1074 predicted protein, partial Ostreococcus lucimarinus CCE9901 MSYEEYVKTYGEDLDEIASAYPTPSPVPGEAPNAYPTSSPNAYPTQSPV...PGEAPNAYPTQSPVPGEAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTQSPV...PGKAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTPSPVPGETPNAYPTPSPV...PGETPNAYPTPSPVPGETPNAYPTPSPVPGEAPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPVPG ...

  17. Protein (Viridiplantae): 145356658 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 36017:1074 predicted protein, partial Ostreococcus lucimarinus CCE9901 MTQVPVISSASSEPSSPVPGETPNAYPTQSPVPGETPNAYPTQSPV...PGEAPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPV...PGETPNAYPTSSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGETPNAYPTSSPNAYPTQSPV...PGEAPNAYPTPSPNAYPTQSPVPGEAPNAYPTQSPVPGEAPNAYPTPSPNAYPTQSPAPNAYPTPSPNAYPTQSPVPGEAPNAYPTPSPNAYPTPSPSAYPTPSPE ...

  18. Protein (Viridiplantae): 145356136 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 017:640 predicted protein, partial Ostreococcus lucimarinus CCE9901 MPDWDTGNVTNMGSAFSSKYYFNASIGNWNTSRVTYMGSMFQSAYSFNQDIGNWNTS...QVTNMYSMFQSANSFNQDIGNWNTARVTYMGSMFQYASSFDQDIGGWNTSQVTNMYSMFQYASSFDQDIGNWNTSRVTYMYSMFQGASAFDQDIGGWNTS...RVTNMGSMFQYASSFDQDITNWNTSRVTNMYSMFQYASSFDQDIGNWNTSRVTYMYSMFQGASAFDQDIGGWNTS...RVTNMGSMFQYASSFDQDITNWNTSRVTNMGSIYMFYNAGAFNQPIGSWNTANVTTMRSMFQGASAFNQDIGNWNTTSVTDMYSMFGSATAFNQNITGW ...

  19. Protein (Viridiplantae): 145347410 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available TPICRLLVPRVQVGSLIGKGGTVISAIRASSGATVRVMPANMLPACASQGDELLQITAPSRDADGAERDQKLSMASVKNAL...CEQVNGAEERIICVSSSDDGLAPMLAAQVALFRVYRCIVESAGNEIPLPFRLLVQTSQIGCLIGKGGSIIKQIRNETGATVRVLPSEALPSCANDDELLEIGQWPADACAL...7:295 predicted protein Ostreococcus lucimarinus CCE9901 MDALAIERRATEFLLDDDGSTTSEGGEGEGEGEGGARSGERRHRGEHGSNGEFRDAS...VRYRLLCPTTRIGRVIGKEGRVIKATRAETGARVKVAPTTRGADERVILVASGDDLTVGEDGEGMTTAEVALFRIFDTITGEEGVTAARGGEGEGEGEASGGSTRGAS...APGVSVVNSVQMAISSQHIGSVLGRGGCNISLARQVSGARIKLYPGAAGSRRTADRSVDSDRLLEISGSSEQVASAQDIIQRFIASSGAMLPEFASFTATGKQHEPETAMFVVS ...

  20. Protein (Viridiplantae): 145351486 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ILLSYLRAVLQASESPSPACEIVIFDLIRMCAKLIPTDEDVADDLLDALPVLFTLKPAVADAFFGRIVAEIDSLISNGADKIKTRQSWDTVCKLLMAS...MQTMRVREIAAAKRNQGSSLLRSFSAMISGDDGRDSPLPPPSEAEQSIEELATACATACRVKELFADTKFLELESLTHLMRALIWAAGDPGLVAATADDEDAALFCLDAMFMVTLRNCDRIRAVLP...GKETPLLRELSKQTLSEIVYHVSRRTGEIAAKAKATTGEKGPRLTSPRQAIVIPATPPAVVRGDAGVDSPHATGPGMDVTAHEHTDVAKGPYGLPALIEIFRFATSLI...VLLAILDATSLLRKHAKTEELVDAIPEAIKNVLLVLCASEIVPRDDPLWGKMWGKASAIDSELTPDALGLLKETEESPP ... ...436017:2154 predicted protein Ostreococcus lucimarinus CCE9901 MTRDVDAPPNRSFDPARFATIVKHEARAVVASMRAHQRWSGRSSASSALNAYGLYGAS

  1. Importance and difficulty of correctly diagnosing covered cloacal exstrophy for adequate reconstruction: A case report

    OpenAIRE

    Insu Kawahara; Shigeru Ono; Katsuhisa Baba; Atsuhisa Fukuta; Yuki Tsuji; Yoshiko Usui; Taiju Hyuga; Shina Kawai; Shigeru Nakamura; Hideo Nakai

    2015-01-01

    Covered cloacal exstrophy (CCE) is extremely rare condition. In patients with a single perineal orifice and no pubic bone separation, it is very difficult to suspect and/or diagnose CCE based on external signs alone. We present the case of a 2-month-old girl diagnosed with CCE based on cystography, ileostomy contrast study and cystoscopy.

  2. 78 FR 21115 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for...

    Science.gov (United States)

    2013-04-09

    ... the following methods: Email: nero.efp@noaa.gov . Include in the subject line ``Comments on CCE... Great Republic Drive, Gloucester, MA 01930. Mark the outside of the envelope ``Comments on CCE monkfish... Specialist, 978-281-9177. SUPPLEMENTARY INFORMATION: Cornell Cooperative Extension (CCE) is conducting...

  3. Importance and difficulty of correctly diagnosing covered cloacal exstrophy for adequate reconstruction: A case report

    Directory of Open Access Journals (Sweden)

    Insu Kawahara

    2015-02-01

    Full Text Available Covered cloacal exstrophy (CCE is extremely rare condition. In patients with a single perineal orifice and no pubic bone separation, it is very difficult to suspect and/or diagnose CCE based on external signs alone. We present the case of a 2-month-old girl diagnosed with CCE based on cystography, ileostomy contrast study and cystoscopy.

  4. 78 FR 32375 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for...

    Science.gov (United States)

    2013-05-30

    ... methods: Email: nero.efp@noaa.gov . Include in the subject line ``Comments on CCE Monkfish RSA EFP.'' Mail..., Gloucester, MA 01930. Mark the outside of the envelope ``Comments on CCE monkfish RSA EFP.'' Fax: (978) 281.... SUPPLEMENTARY INFORMATION: The Cornell Cooperative Extension (CCE) was awarded 371 days-at-sea (DAS) under...

  5. On effect of Coulomb correlation energy on characteristics of atomic nuclei

    International Nuclear Information System (INIS)

    Coulomb correlation energy (CCE) of semi-infinite nuclear matter is studied. The CCE contribution to the surface tension is calculated. Mass differences of mirror nuclei in the range A=16 and A=40 are evaluated taking CCE into account. The results agree well with the experiment

  6. 78 FR 21114 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for...

    Science.gov (United States)

    2013-04-09

    ... subject line ``Comments on CCE Winter Flounder EFP.'' Mail: John K. Bullard, Regional Administrator, NMFS... ``Comments on CCE Winter Flounder EFP.'' Fax: (978) 281-9135. FOR FURTHER INFORMATION CONTACT: Jason... Extension (CCE) submitted a complete application for an Exempted Fishing Permit (EFP) on March 13, 2013,...

  7. An unusual case of a patient who lost his native kidneys and renal allograft from cholesterol crystal emboli.

    Science.gov (United States)

    Ahmed, Wasim; Al Garni, Abdulkareem; Abdelgadir, Elbadri; Khamees, Khamess Obeid; Ellouly, Mohammed Ali Ahmed; Haleem, Abdul

    2015-09-01

    Cholesterol crystal emboli (CCE) syndrome involving native kidneys is an underdiagnosed condition. CCE is rare in renal allografts. It may present with acute kidney injury, but usually not acute graft loss. CCE should be considered in patients with a history of atherosclerosis and an invasive arterial procedure who present with acute or chronic renal allograft dysfunction. Therapy for CCE is mainly supportive and carries a high rate of mortality. To the best of our knowledge, this is the first reported case of a patient who lost his native kidneys and renal allograft due to CCE arising from his own vasculature. PMID:26354570

  8. AcEST: DK960740 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0008_D17 420 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_D17. 5' end seq ... NA. clone: TST39A01NGRL0008_D17. 5' end sequence. Acce ssion DK960740 Tissue type prothallia with plantlet ... 8%), Positives = 17/29 (58%) Frame = -1 Query: 150 CCE SPVEAVWPCVSVVVASISRAQSPDAR 64 CCE ... P A PC+S+V +SR SP ... R Sbjct: 36 CCE PPCCAPAPCLSLVCTPVSRVSSPCCR 64 >sp|P60371|KR106_HUMA ... 0%), Positives = 16/26 (61%) Frame = -1 Query: 150 CCE SPVEAVWPCVSVVVASISRAQSP 73 CCE ... P A PC+S+V +SR SP Sb ...

  9. Annealing effects on charge collection efficiency of an electron-irradiated 4H-SiC particle detector

    International Nuclear Information System (INIS)

    Thermal annealing effects on the charge collection efficiency (CCE) of an electron-irradiated 4H silicon carbide Schottky barrier diode (SBD) particle detector have been studied. The CCE of the SBD detector is degraded by 1 MeV electrons with a fluence of 1×1015 cm-2. The degraded CCE recovers with low temperature annealing up to 300°C. However, CCE starts to decrease again by annealing at 350°C. Conventional electrical characterization such as current and capacitance vs voltage measurements, deep level transient spectroscopy used to understand the CCE variation on annealing is discussed. (author)

  10. GROWING ALTERNATIVE SUSTAINABLE BUILDINGS: BIO-COMPOSITE PRODUCTS FROM NATURAL FIBER, BIODEGRADABLE AND RECYCLABLE POLYMER MATERIALS FOR LOAD-BEARING CONSTRUCTION COMPONENTS

    Science.gov (United States)

    The project is an integrative educational and research project that will revolutionize design and construction methods towards more sustainable buildings. The project will develop and test new product design concepts using bio-composite materials in load-bearing and fa&cced...

  11. Effect of concentrator field layout on the EE-1 small community solar power system

    Energy Technology Data Exchange (ETDEWEB)

    Pons, R.L.; Irwin, R.E.

    1981-01-01

    This paper presents an evaluation of the effect of concentrator field layout on the technical/economic performance of a point-focusing distributed receiver (PFDR) solar thermal power plant rated at 1 MW/sub e/. The plant design is based on the EE-1 prototype currently under development by FACC for JPL/DOE. 6 refs.

  12. Dicty_cDB: Contig-U16556-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16556-1 gap included 2197 - - - - 3 6 U16556 0 1 0 1 0 0 0 1 0 0 0 0 0 0 Show Contig-U16 ... ces: 8402 Number of extensions: 106779 Number of succe ssful extensions: 25202 Number of sequences better ... 6-8 kb library from tot... 54 0.024 1 ( EL349521 ) CCE L591.b1_M04.ab1 CCE (LMS) endive Cichorium endi... 5 ... 4 0.024 1 ( EL348221 ) CCE L4357.b1_J09.ab1 CCE (LMS) endive Cichorium end... 5 ... 4 0.024 1 ( EL344642 ) CCE L12553.b1_A20.ab1 CCE (LMS) endive Cichorium en... 5 ...

  13. Dicty_cDB: Contig-U15464-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15464-1 no gap 1471 3 2002553 2001143 MINUS 3 3 U15464 0 2 1 0 0 0 0 0 0 0 0 0 0 0 Show ... nces: 8402 Number of extensions: 30871 Number of succe ssful extensions: 3621 Number of sequences better t ... opus (Silurana) tropicali... 46 3.7 1 ( EL370901 ) CCE S7918.b1_K12.ab1 CCE (LMS) endive Cichorium end... 4 ... 6 3.7 1 ( EL366798 ) CCE S2909.b1_I08.ab1 CCE (LMS) endive Cichorium end... 4 ... 6 3.7 1 ( EL364486 ) CCE M8999.b1_N17.ab1 CCE (LMS) endive Cichorium end... 4 ...

  14. Ileus caused by cholesterol crystal embolization: A case report.

    Science.gov (United States)

    Azuma, Shunjiro; Ikenouchi, Maiko; Akamatsu, Takuji; Seta, Takeshi; Urai, Shunji; Uenoyama, Yoshito; Yamashita, Yukitaka

    2016-03-28

    Cholesterol crystal embolization (CCE) is a rare systemic embolism caused by formation of cholesterol crystals from atherosclerotic plaques. CCE usually occurs during vascular manipulation, such as vascular surgery or endovascular catheter manipulation, or due to anticoagulation or thrombolytic therapy. We report a rare case of intestinal obstruction caused by spontaneous CCE. An 81-year-old man with a history of hypertension was admitted for complaints of abdominal pain, bloating, and anorexia persisting for 4 mo. An abdominal computed tomography revealed intestinal ileus. His symptoms were immediately relieved by an ileus tube insertion, and he was discharged 6 d later. However, these symptoms immediately reappeared and persisted, and partial resection of the small intestine was performed. A histopathological examination indicated that small intestine obstruction was caused by CCE. At the 12-mo follow-up, the patient showed no evidence of CCE recurrence. Thus, in cases of intestinal obstruction, CCE should also be considered. PMID:27022232

  15. Dicty_cDB: VHE666 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE666 (Link to dictyBase) - - - Contig-U16319-1 - (Link to Original site) ... 6268, mRNA sequence. 42 4.0 1 EL355937 |EL355937.1 CCE M12514.b1_C10.ab1 CCE (LMS) endive Cichorium endivia ... cDNA clone CCE M12514, mRNA sequence. 42 4.0 1 AC144995 |AC144995. ...

  16. Non- (quantum) differentiable $C^1$-functions in the spaces with trivial Boyd indices

    OpenAIRE

    Potapov, Denis; Sukochev, Fyodor

    2008-01-01

    If E is a separable symmetric sequence space with trivial Boyd indices and $\\cC^E$ is the corresponding ideal of compact operators, then there exists a $C^1$-function $f_E$, a self-adjoint element $W\\in \\cC^E$ and a densely defined closed symmetric derivation $\\delta$ on $\\cC^E$ such that $W \\in Dom \\delta$, but $f_E(W) \

  17. Dicty_cDB: SLE213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE213 (Link to dictyBase) - G24168 DDB0217029 Contig-U04013-1 SLE213F (Lin ... -Sampling_GS-28-01-01-1... 50 0.001 2 ( EL349336 ) CCE L5739.b1_F20.ab1 CCE (LMS) endive Cichorium end... 4 ... 1_75( CP000581 |pid:none) Ostreococcus lucimarinus CCE 9901 ... 196 7e-49 AK078936_1( AK078936 |pid:none) ...

  18. Dicty_cDB: SSB383 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB383 (Link to dictyBase) - - - Contig-U04549-1 SSB383P (Link to Original ... getative cDNA clone:VS... 333 e-118 2 ( EL369290 ) CCE S5350.b1_L18.ab1 CCE (LMS) endive Cichorium end... 4 ... _128( CP000596 |pid:none) Ostreococcus lucimarinus CCE 9901... 140 2e-48 CP001326_527( CP001326 |pid:none) ...

  19. Unigene BLAST: CBRC-RNOR-03-0388 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-03-0388 gnl|UG|Rn#S14139785 UI-R-CW0s-cce -b-04-0-UI.s1 UI-R-CW0s Rattus norvegicus cDN ... A clone UI-R-CW0s-cce -b-04-0-UI 3', mRNA sequence /clone=UI-R-CW0s-cce -b ...

  20. Accuracy and safety of second-generation PillCam COLON capsule for colorectal polyp detection

    OpenAIRE

    Spada, Cristiano; De Vincentis, Fabio; Cesaro, Paola; Hassan, Cesare; Riccioni, Maria Elena; Minelli Grazioli, Leonardo; Bolivar, Santiago; Zurita, Andrade; Costamagna, Guido

    2012-01-01

    PillCam COLON capsule endoscopy (CCE) (Given Imaging Ltd, Yoqneam, Israel) is one of the most recent diagnostic, endoscopic technologies designed to explore the colon. CCE is a noninvasive, patient-friendly technique that is able to explore the colon without requiring sedation and air insufflation. The first generation of CCE was released onto the market in 2006 and although it generated great enthusiasm, it showed suboptimal accuracy. Recently, a second-generation system (PillCam COLON 2) (C...

  1. Implementing strategies in consumer and community engagement in health care: results of a large-scale, scoping meta-review

    OpenAIRE

    Sarrami-Foroushani, Pooria; Travaglia, Joanne; Debono, Deborah; Braithwaite, Jeffrey

    2014-01-01

    Background There is growing recognition of the importance of the active involvement of consumers and community members in health care. Despite the long history of consumer and community engagement (CCE) research and practice, there is no consensus on the best strategies for CCE. In this paper, we identify various dimensions of CCE-related strategies and offer a practical model to assist policy-makers, practitioners and researchers. Methods We undertook a large-scale, scoping meta-review and s...

  2. Protein (Viridiplantae): 145346810 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available STSAPTLGGRRSAIVGGGAVALEQRAMATRAERRRVVTRAGGVAKAAPGEPKKVFGLTLPEGEGISFAILAAGSLGSALGFAALQEGVFRIPGF...KFSAWMTVLTTFTYFLCGALEMKLTKDSRKGSWKNYGILSVYTYGGMALTNYALSYLNYATRIVFKSAKIIPVMAFSVLIV...6017:996 DMT family transporter: UDP-galactose/UDP-glucose Ostreococcus lucimarinus CCE9901 MISRATTVAIAPNARAQTHARQRRAPSVRA...GKKYNWKEWLSAAILVAGIVLFTLGDVASSPAFAPIGVALIAAALCVDAICANFEEKNFFRCETPSTTQEVLCYASLIGTAYGLVPLIASGGLAPALAFSQANPQVVPMIMA

  3. Protein (Viridiplantae): 145355084 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 17:1506 AAAP family transporter: amino acid Ostreococcus lucimarinus CCE9901 MATTTATRATRGCVAGRATARPTRRGVAIERRARARRGFARVPLDAGRARRDDAT...TIAGRGTREARATRTFASAGDASGENAAIVNTVKAIFGAGGFALPWAFAQGGIALVGTCMAASLVFALEALRMLIKAQDALVGAGASTASEVATYAGLTNAAMGRA...GDAACRVMNVLTCFGITVSYLIFIAETMKVVVPALGVSAFGASPTTASMLALVGPLMIA...LSWLREMSGVAVISAVGTASVAVGMAVTTATALSNPLQLGALPVANFAAFPGFFGTVAFLFFIHFTLFGIKEAMPQPDKFFGAAVKAFTGAAVIAGLFGVAGAAGFGT...GVSSVVVTMLTGPSGIAVQLLLCLNLLSTYPIMAQSALRICENVLEGDKPGSIGAPQALAVRTAFTAGALWTAANVPNFGVVLGYVGGVCCSILSLVLPAMILYLTQKKVKAEIVPLELARIGGVFVTGVTCIVLSIVL ...

  4. Protein (Viridiplantae): 145347182 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 17:748 predicted protein, partial Ostreococcus lucimarinus CCE9901 MATASGRVVAPRARVDGGRATTRVGRRTRGAATRARADADK...EDDSDSAGAVVTSARKASFGPSRKDADAVRRDLLEKSLASAGWDDARMFLAKRASTALGKAACETLEASTTSREARKALDETEAAMAMESKHGVSLEFGGMLTAEVRRGFYKTRQGSPLGGDELAAT...VIPFFDKVLVDIGDDQSLLTSLSTFSGRLTRAQAILEQSTPESLVLMDEVGTGTSPAEGAAIGYALLKALAGIIPGQLGACLTFATTHHGQL...IKLDVIAAKCRYSQALNGVRPEFSVFADDDDGFYEAYEDEDEDEDEDIEEQDDEGFDEAREQTKKPPIEKSSLLLELVGLRQPVLASQAIEAAAERRQAAAEAVESQNSRGSSSTGYKVATR...KALKYEHEEFENAAVEFDEADLRPTYKLLWGVPGRSSALQIATRYKLDADVVHEARELLGEGLVSLDDTISKLETARRDADADIATAIGM ...

  5. Protein (Viridiplantae): 145355665 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 6017:2814 HAAAP family transporter: tyrosine, partial Ostreococcus lucimarinus CCE9901 MTTVPTRATTRATTVSTRARATRAMATTTTTASTARHAATGGRRA...RDGRARLEMTRGGGGVNVNDASTAGRARRRARGGRRTTTTTTNAISDATEPELAATRATIPISSFDEEERAVDEERDEETHTGSLAGVVALIVGSTVGAGVLALPAAT...PSTIPIIFLTLVYHDLIPVMCAFLQGDMKQIRRAILIGSSIPLAMFLLWNTVALAMAGGDITADPLSIISEDLGGSASVLLSLFGVSAIGTSFIGVSLGMSEYLMPFM...ENAVSRVLTFAAFLSVPLFVAEQCPNIFLPVTNFVGAYGMTTLYGVMPPIMAYTMRQERRESRRADPFAPLALRFKTNTLLPGGRLTLSALSLSAVAIALSKVYEDIS ... ...AEAGILPASGALIGVWILLVCDALLLAEVNVGIMRERDEDRLTHGRGHSPVVISLSDMA

  6. Protein (Viridiplantae): 145351089 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 436017:3561 FNT family transporter: formate/nitrite Ostreococcus lucimarinus CCE9901 MMTTTTTTTTLTTLTTATRGTARRATRTVARVARPTFARAT...AVGGASRTRTTRARRGGAVVTRADALAPPAVFDAACAASEKKSAQAPTTTLTLGFAAGALIGLGALLMTCVGGASPALAANNPGLSAFV...AKASLPFVAAFTKGVLCNWLVCLAVWGTMATTSVAGKILAIFWPITMFVALGFEHSVANMFLIPHGMLLGANVSWAQMMTGNIIPVTLGNIVGAAVFVAGVHWLAYGKK ... ...KGAIGLPAGLTMVILTGAELFTGNVFVMLSGALNGVANERQVARSWALSYAGNFAGSVFMAYMAYTAMTAASPAASAAAVGIAT

  7. Dicty_cDB: SLB802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB802 (Link to dictyBase) - G22395 DDB0202133 Contig-U09141-1 SLB802P (Lin ... tropInt1 Xenopus (Silur... 44 5e-04 2 ( EL364507 ) CCE M9020.b1_H23.ab1 CCE (LMS) endive Cichorium end... 4 ... ropOva1 Xenopus (Silura... 44 5e-04 2 ( EL343227 ) CCE L11223.b1_M21.ab1 CCE (LMS) endive Cichorium en... 4 ...

  8. Effects of radiation-induced defects on the charge collection efficiency of a silicon carbide particle detector

    Science.gov (United States)

    Iwamoto, Naoya; Onoda, Shinobu; Makino, Takahiro; Ohshima, Takeshi; Kojima, Kazutoshi; Nozaki, Shinji

    2013-05-01

    Radiation hardness of 6H silicon carbide (SiC) p+n diode particle detectors has been studied. The charge collection efficiency (CCE) of the detectors decreases with the increased fluence of electrons with energies of 0.2 MeV and higher. Defect X2 with an activation energy of 0.5 eV was found in all detectors which showed the decreased CCE. The decreased CCE was restored to the initial value by thermal annealing of defect X2. It is concluded that defect X2 is responsible for the decreased CCE of 6H-SiC p+n diode particle detectors.

  9. Protein (Viridiplantae): 145350438 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 017:640 predicted protein Ostreococcus lucimarinus CCE9901 MDMRFMFATAYAFDSPIRNWDISQVTNTSYMFYSIAASFNVFNQSVENWNTS...QVMDMRGMFGNARYFNKPIGGWNTSQVTDMRNMFVTASSFNQPIGDWDTSQVTDMRYMFATASSFNQPIGDWDTSQVTDMRGMLGSVSFNQPIGNWNTSQVTDMRTMFATASSFNAPIGDWNTS...QVTDMGRMFYAASSFNRSIGDWNTSQVTDMQSMFYASSFDQPIGNWDTSLVTYMNSMFNSAVSFNQSIGGWNTS...RVVSMQSMFANAFSFNQPIGNWNTGRVVSMHSMFDSAVYFNQPIGNWNTGRVVSMNSMFDSAGFFNQPIGNWDTSQVTDMNSMFDSAGSFNQPIGNWNTS...QVTDMNSMFDSAGSFNQPIGDWDTSQVTDMHWMFQGASSFNQPIGDWDTSQVVTSYSFSEMFKDATAWLCSHTHNTSDPMHFQRYYDGPPSFWFESAAGIGAVCLSPPPPTTLPCVYVAAPPLTARSTGTARSSVALSLYTTVIIIYFHA ...

  10. Modelling and mapping of critical thresholds in Europe

    NARCIS (Netherlands)

    Posch M; de Smet PAM; Hettelingh JP; Downing RJ; MNV

    2001-01-01

    This report is the sixth in a bi-annual series prepared by the Coordination Center for Effects (CCE) to document the progress made in calculating and mapping critical loads in Europe. The CCE, as part of the Mapping Programme under the UN/ECE Working Group on Effects (WGE), develops methodologies a

  11. Social and Rational: The Presentation of Nature of Science and the Uptake of Change in Evolution Textbooks

    Science.gov (United States)

    Fuselier, Linda C.; Jackson, J. Kasi; Stoiko, Rachel

    2016-01-01

    The nature of science (NOS) as described by education scholars is a critical component of scientific literacy and includes both rational and social aspects taught best in an explicit and reflective manner. NOS is frequently tied to a critical contextual empiricism (CCE) framework for knowledge production. Central to CCE is that objectivity is…

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-0528 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0528 ref|YP_001803032.1| hypothetical protein cce _1616 [Cyanothece sp. ATCC 51142] ... gb|ACB50966.1| hypothetical protein cce _1616 [Cyanothece sp. ATCC 51142] YP_001803032.1 0. ...

  13. Dicty_cDB: SLC388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC388 (Link to dictyBase) slc388 - - Contig-U10187-1 - (Link to Original s ... RKCRSKNQFYLVQIDLIVRIPMKMHFALNIVGMLHT*hltslkmi i*ln*cce *lrnllkpflf--- Translated Amino Acid sequence (All ... RKCRSKNQFYLVQIDLIVRIPMKMHFALNIVGMLHT*hltslkmi i*ln*cce *lrnllkpflf--- Frame B: pv*t*csleiviih*nmnktiy*ctpp ...

  14. Fostering Social Cohesion and Cultural Sustainability: Character and Citizenship Education in Singapore

    Science.gov (United States)

    Tan, Charlene; Tan, Chee Soon

    2014-01-01

    This article critically discusses the Singapore state's endeavor to balance social cohesion and cultural sustainability through the Character and Citizenship Education (CCE) curriculum. This article points out that underpinning the CCE syllabus are the state ideologies of communitarianism and multiracialism. It is argued that the ideology of…

  15. Developing an International Framework for Education in Democracy. ERIC Digest.

    Science.gov (United States)

    Bahmueller, Charles F.

    Is it possible to develop an international consensus on the meaning of democracy and education for democratic citizenship? A cooperative project administered by the Center for Civic Education (CCE) in Calabasas, California is attempting to answer this question. Since 1996, the CCE has been developing "An International Framework for Education in…

  16. NCBI nr-aa BLAST: CBRC-TTRU-01-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0006 ref|YP_001805937.1| hypothetical protein cce _4523 [Cyanothece sp. ATCC 51142] ... gb|ACB53871.1| hypothetical protein cce _4523 [Cyanothece sp. ATCC 51142] YP_001805937.1 0. ...

  17. Comparing gravitational waveform extrapolation to Cauchy-characteristic extraction in binary black hole simulations

    Science.gov (United States)

    Taylor, Nicholas W.; Boyle, Michael; Reisswig, Christian; Scheel, Mark A.; Chu, Tony; Kidder, Lawrence E.; Szilágyi, Béla

    2013-12-01

    We extract gravitational waveforms from numerical simulations of black hole binaries computed using the Spectral Einstein Code. We compare two extraction methods: direct construction of the Newman-Penrose (NP) scalar Ψ4 at a finite distance from the source and Cauchy-characteristic extraction (CCE). The direct NP approach is simpler than CCE, but NP waveforms can be contaminated by near-zone effects—unless the waves are extracted at several distances from the source and extrapolated to infinity. Even then, the resulting waveforms can in principle be contaminated by gauge effects. In contrast, CCE directly provides, by construction, gauge-invariant waveforms at future null infinity. We verify the gauge invariance of CCE by running the same physical simulation using two different gauge conditions. We find that these two gauge conditions produce the same CCE waveforms but show differences in extrapolated-Ψ4 waveforms. We examine data from several different binary configurations and measure the dominant sources of error in the extrapolated-Ψ4 and CCE waveforms. In some cases, we find that NP waveforms extrapolated to infinity agree with the corresponding CCE waveforms to within the estimated error bars. However, we find that in other cases extrapolated and CCE waveforms disagree, most notably for m=0 “memory” modes.

  18. 76 FR 21579 - Energy Conservation Program: Test Procedures for Walk-In Coolers and Walk-In Freezers

    Science.gov (United States)

    2011-04-15

    ... enforcement (CCE) final rule, published on March 7, 2011. 76 FR 12422, 12444. In brief, some of those comments... responsible for the compliance of the walk-in with the standards. 76 FR 12442-12446. In the CCE final rule... noncompliance on a case-by-case basis. 76 FR 12444. DOE notes that the provisions and clarifications in the...

  19. Dicty_cDB: SFJ891 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFJ891 (Link to dictyBase) - - - Contig-U11012-1 SFJ891Z (Link to Original ... d Bluecrop library Vacc... 46 3e-08 2 ( EL364803 ) CCE M9322.b1_D03.ab1 CCE (LMS) endive Cichorium end... 5 ...

  20. Standardization of enterococci density estimates by EPA qPCR methods and comparison of beach action value exceedances in river waters with culture methods

    Science.gov (United States)

    The U.S.EPA has published recommendations for calibrator cell equivalent (CCE) densities of enterococci in recreational waters determined by a qPCR method in its 2012 Recreational Water Quality Criteria (RWQC). The CCE quantification unit stems from the calibration model used to ...

  1. The Effects of Check, Connect, and Expect on Behavioral and Academic Growth

    Science.gov (United States)

    McDaniel, Sara C.; Houchins, David E.; Robinson, Cecil

    2016-01-01

    "Check, Connect, and Expect" (CCE) is a secondary tier behavioral intervention that provides students with levels of support including a dedicated "coach" for check-in and check-out procedures, and social skills instruction. Elementary students (n = 22) in an alternative education school setting received CCE for 13 weeks…

  2. Down-regulation of tyrosinase, TRP-1, TRP-2 and MITF expressions by citrus press-cakes in murine B16 F10 melanoma

    Institute of Scientific and Technical Information of China (English)

    Sang Suk Kim; Min-Jin Kim; Young Hun Choi; Byung Kuk Kim; Kwang Sik Kim; Kyung Jin Park; Suk Man Park; Nam Ho Lee; Chang-Gu Hyun

    2013-01-01

    Objective: To investigate the suitability of citrus-press cakes, by-products of the juice industry as a source for the whitening agents for cosmetic industry. Methods:Ethylacetate extracts of citrus-press cakes (CCE) were examined for their anti-melanogenic potentials in terms of the inhibition of melanin production and mechanisim of melanogenesis by using Western Blot analysis with tyrosinese, tyrosinase-related protein-1 (TRP-1), TRP2, and microphthalmia-associated transcription factor (MITF) proteins. To apply the topical agents, citrus-press cakes was investigated the safety in human skin cell line. Finally flavonoid analysis of CCE was also determined by HPLC analysis. Results: Results indicated that CCE were shown to down-regulate melanin content in a dose-dependent pattern. The CCE inhibited tyrosinase, TRP-2, and MITF expressions in a dose-dependent manner. To test the applicability of CCE to human skin, we used MTT assay to assess the cytotoxic effects of CCE on human keratinocyte HaCaT cells. The CCE exhibited low cytotoxicity at 50 µg/mL. Characterization of the citrus-press cakes for flavonoid contents using HPLC showed varied quantity of rutin, narirutin, and hesperidin. Conclusions:Considering the anti-melanogenic activity and human safety, CCE is considered as a potential anti-melanogenic agent and may be effective for topical application for treating hyperpigmentation disorders.

  3. "Dem Wod Mo Saf": Materials for Reading Creole English.

    Science.gov (United States)

    Kephart, Ronald

    As part of a study that sought ways to improve the language arts educational experience for Grenadian children, an anthropologist investigated how Carriacou Creole English (CCE) reading materials could be provided and how these children would react to them. CCE is the native language of the inhabitants of Carriacou, a sister island of Grenada. The…

  4. Real Language Meets Real Business

    Science.gov (United States)

    Muirhead, Muirhead; Schechter, Sarah

    2016-01-01

    The Real Business Language Challenge was a collaborative pilot project between Coca-Cola Enterprises (CCE) and Routes into Languages East for Year 9 and 10 pupils. It was based on CCE's award-winning Real Business Challenge, part of its highly acclaimed education programme. The Real Business Language Challenge transformed the project into a…

  5. Industrial collaborators honoured by ALICE

    CERN Multimedia

    Maximilien Brice

    2004-01-01

    Picture 01 : the winners gather after the ALICE Award ceremony (from left to right): Yuri Saveliev, Stanislav Burachas and Sergei Beloglovsky of North Crystals; Maximilian Metzger, CERN's secretary-general; Rang Cai of ATM; Jürgen Schukraft, ALICE spokesperson; Erich Pamminger and Daniel Gattinger of FACC; and Tiejun Wang of ATM. The ALICE collaboration has presented its second round of awards to three companies for their novel and remarkable contributions to major detector systems: Advance Technology and Materials (ATM), Fischer Advanced Composite Components (FACC) and North Crystals. The awards presented to these three leaders in advanced, modern materials were beautifully sculpted from one of the oldest materials used by mankind to manufacture tools - Mexican Obsidian

  6. Comparing Gravitational Waveform Extrapolation to Cauchy-Characteristic Extraction in Binary Black Hole Simulations

    CERN Document Server

    Taylor, Nicholas W; Reisswig, Christian; Scheel, Mark A; Chu, Tony; Kidder, Lawrence E; Szilagyi, Bela

    2013-01-01

    We extract gravitational waveforms from numerical simulations of black hole binaries computed using the Spectral Einstein Code. We compare two extraction methods: direct construction of the Newman-Penrose (NP) scalar $\\Psi_4$ at a finite distance from the source and Cauchy-characteristic extraction (CCE). The direct NP approach is simpler than CCE, but NP waveforms can be contaminated by near-zone effects---unless the waves are extracted at several distances from the source and extrapolated to infinity. Even then, the resulting waveforms can in principle be contaminated by gauge effects. In contrast, CCE directly provides, by construction, gauge-invariant waveforms at future null infinity. We verify the gauge invariance of CCE by running the same physical simulation using two different gauge conditions. We find that these two gauge conditions produce the same CCE waveforms but show differences in extrapolated-$\\Psi_4$ waveforms. We examine data from several different binary configurations and measure the domi...

  7. Low-density lipoprotein apheresis for corticosteroid-resistant skin lesions caused by cholesterol crystal embolism: a case report and review of the literature.

    Science.gov (United States)

    Kobayashi, Hiroki; Abe, Masanori; Murata, Yusuke; Maruyama, Takashi; Furukawa, Tetsuya; Oikawa, Osamu; Okada, Kazuyoshi

    2015-09-01

    Cholesterol crystal embolism (CCE) is an arterio-arterial embolism originating from the breakdown of atherosclerotic plaques in the aortic wall. The embolism affects the skin and kidney particularly, as well as frequently affects the gastrointestinal tract and other organs. Although there are no clearly effective direct therapies for CCE, corticosteroid therapy and combination therapy with low-density lipoprotein apheresis (LDL-A) followed by corticosteroids were recently reported to be effective for renal manifestations in some cases. However, few cases offer suggestions for the treatment of skin lesions caused by CCE. We report here a case of a 58-year-old man diagnosed with CCE with skin manifestations and kidney dysfunction who achieved complete remission after LDL-A. LDL-A may be a useful treatment for CCE, particularly in cases with skin manifestations. PMID:25821197

  8. Experimental demonstration of cryocooler electronics with multiple mechanical cryocooler types

    Science.gov (United States)

    Freeman, J. J.; Murphy, J. B.; Kirkconnell, C. S.

    2012-06-01

    This paper describes a series of experiments during which a particular cryocooler control electronics (CCE) was shown to successfully drive several very different cryocoolers and simulated cryocooler loads, including a space pulse tube cryocooler, long life tactical Stirling coolers, and even a simulated reverse turbo Brayton (RTB) cryocooler compressor. This CCE is an early brassboard version of a low cost, radiation hard cryocooler electronics module being developed primarily for cost-constrained, but nevertheless mission critical military and civilian spaceborne applications. This design is also applicable for tactical applications which seek to support multiple cryocooler types and/or vendors with a given CCE. The CCE provides high efficiency DC-to-AC conversion, automated cool down, and precision temperature control. The results demonstrate convincingly that this CCE design is broadly supportive of a wide range of thermodynamic-mechanical cryocooler units (TMUs) for a subsequently broad range of payloads and missions.

  9. Cerenkov counting as a complement to liquid scintillation counting

    International Nuclear Information System (INIS)

    A commercially available spectrometer was calibrated for liquid scintillation (LS) and Cerenkov counting efficiency (CCE) using National Institute of Standards and Technology traceable solutions. The CCE increased linearly over a 3 order of magnitude range in 40K β activity, and by 42% per MeV as β-energies increased from 0.300 to 3.54 MeV, achieving a maximum value of 80% for 106Ru/106Rh The CCE can be enhanced by 10-15% when a wavelength shifter is used. A comparison of the data showed that the CCE was typically 20-50% less than the LS counting efficiency for β-particles with maximum energies >1 MeV. Applications that utilize sequential CCE and LS counting to quantitate activity concentrations are discussed for samples containing two β-emitting nuclides of differing energies. (Author)

  10. Geografilärares och niondeklassares syn på undervisningen om klimatförändringenClimate change education: Geography teachers’ and ninth-graders’ views

    Directory of Open Access Journals (Sweden)

    Mikaela Hermans

    2014-10-01

    Full Text Available It has been increasingly recognised that education plays a key role in addressing human-induced climate change. The ultimate goal of climate change education (CCE is positive impacts on the climate through both individual and collective actions. The aim of this study is to investigate geography teachers’ and their ninth-graders’ views about CCE. Data was collected using semi-structured interviews with geography teachers (N = 13 and questionnaires for ninth-graders (N = 549 at eleven secondary schools from all parts of Swedish-speaking Finland. The results show that although the students’ attitudes to CCE is positive, it does not supply them with action competence. The geography teachers in this study largely miss the ultimate goal of CCE, pointing at the need for more effort to be made in the process of developing CCE at secondary school.

  11. Atopic cough and fungal allergy

    Science.gov (United States)

    Fujimura, Masaki; Ohkura, Noriyuki; Makimura, Koichi

    2014-01-01

    We have shown that some patients presenting with chronic bronchodilator-resistant non-productive cough have a global atopic tendency and cough hypersensitivity without nonspecific bronchial hyperresponsiveness, abbreviated as atopic cough (AC). The cough can be treated successfully with histamine H1 antagonists and/or glucocorticoids. Eosinophilic tracheobronchitis and cough hypersensitivity are pathological and physiological characteristics of AC. Fungus-associated chronic cough (FACC) is defined as chronic cough associated with basidiomycetous (BM) fungi found in induced sputum, and recognition of FACC has provided the possibility of using antifungal drugs as new treatment strategies. Bjerkandera adusta is a wood decay BM fungus, which has attracted attention because of its potential role in enhancing the severity of cough symptoms in FACC patients by sensitization to this fungus. Before making a diagnosis of “idiopathic cough” in cases of chronic refractory cough, remaining intractable cough-related laryngeal sensations, such as “a sensation of mucus in the throat (SMIT),” which is correlated with fungal colonization, should be evaluated and treated appropriately in each patient. The new findings, i.e., the detection of environmental mushroom spores that should not be present in the human airways in addition to the good clinical response of patients to antifungal drugs, may lead to the development of novel strategies for treatment of chronic cough. PMID:25383202

  12. [Clinical practice using colon capsule endoscopy].

    Science.gov (United States)

    Kakugawa, Yasuo; Matsumoto, Minori; Saito, Yutaka

    2014-01-01

    PillCam COLON capsule endoscopy(CCE) (Given Imaging Ltd., Yoqneam, Israel) is one of the most recent diagnostic technologies designed to explore the colorectum. The first generation of CCE was released onto the market in 2006, and the second generation (PillCam COLON 2 : CCE-2), with increased sensitivity, was released in 2009. The CCE-2 has 2 imagers with a much wider angle of view that has been increased to 172 degrees per imager, allowing nearly 360 degrees coverage of the colon by two. The most unique feature of the CCE-2 is its adaptive frame rate (AFR). This new technology allows the CCE-2 to capture 35 images per second when in motion and 4 images per second when virtually stationary. The per-patient CCE-2 sensitivity for detecting polyps > or = 6 mm has been reported as 84%-91%. These recent advancements in this modality might offer physicians the option to screen for colorectal lesions noninvasively. PMID:24597367

  13. Functional modulation of cerebral gamma-aminobutyric acidA receptor/benzodiazepine receptor/chloride ion channel complex with ethyl beta-carboline-3-carboxylate: Presence of independent binding site for ethyl beta-carboline-3-carboxylate

    Energy Technology Data Exchange (ETDEWEB)

    Taguchi, J.; Kuriyama, K. (Kyoto Prefectural Univ. of Medicine (Japan))

    1990-05-01

    Effect of ethyl beta-carboline-3-carboxylate (beta-CCE) on the function of gamma-aminobutyric acid (GABA)A receptor/benzodiazepine receptor/chloride ion channel complex was studied. Beta-CCE noncompetitively and competitively inhibited (3H)flunitrazepam binding to benzodiazepine receptor, but not (3H)muscimol binding to GABAA receptor as well as t-(3H)butylbicycloorthobenzoate (( 3H) TBOB) binding to chloride ion channel, in particulate fraction of the mouse brain. Ro15-1788 also inhibited competitively (3H) flunitrazepam binding. On the other hand, the binding of beta-(3H)CCE was inhibited noncompetitively and competitively by clonazepam and competitively by Ro15-1788. In agreement with these results, benzodiazepines-stimulated (3H)muscimol binding was antagonized by beta-CCE and Ro15-1788. Gel column chromatography for the solubilized fraction from cerebral particulate fraction by 0.2% sodium deoxycholate (DOC-Na) in the presence of 1 M KCl indicated that beta-(3H)CCE binding site was eluted in the same fraction (molecular weight, 250,000) as the binding sites for (3H)flunitrazepam, (3H)muscimol and (3H)TBOB. GABA-stimulated 36Cl- influx into membrane vesicles prepared from the bovine cerebral cortex was stimulated and attenuated by flunitrazepam and beta-CCE, respectively. These effects of flunitrazepam and beta-CCE on the GABA-stimulated 36Cl- influx were antagonized by Ro15-1788. The present results suggest that the binding site for beta-CCE, which resides on GABAA receptor/benzodiazepine receptor/chloride ion channel complex, may be different from that for benzodiazepine. Possible roles of beta-CCE binding site in the allosteric inhibitions on benzodiazepine binding site as well as on the functional coupling between chloride ion channel and GABAA receptor are also suggested.

  14. Functional modulation of cerebral gamma-aminobutyric acidA receptor/benzodiazepine receptor/chloride ion channel complex with ethyl beta-carboline-3-carboxylate: Presence of independent binding site for ethyl beta-carboline-3-carboxylate

    International Nuclear Information System (INIS)

    Effect of ethyl beta-carboline-3-carboxylate (beta-CCE) on the function of gamma-aminobutyric acid (GABA)A receptor/benzodiazepine receptor/chloride ion channel complex was studied. Beta-CCE noncompetitively and competitively inhibited [3H]flunitrazepam binding to benzodiazepine receptor, but not [3H]muscimol binding to GABAA receptor as well as t-[3H]butylbicycloorthobenzoate [( 3H] TBOB) binding to chloride ion channel, in particulate fraction of the mouse brain. Ro15-1788 also inhibited competitively [3H] flunitrazepam binding. On the other hand, the binding of beta-[3H]CCE was inhibited noncompetitively and competitively by clonazepam and competitively by Ro15-1788. In agreement with these results, benzodiazepines-stimulated [3H]muscimol binding was antagonized by beta-CCE and Ro15-1788. Gel column chromatography for the solubilized fraction from cerebral particulate fraction by 0.2% sodium deoxycholate (DOC-Na) in the presence of 1 M KCl indicated that beta-[3H]CCE binding site was eluted in the same fraction (molecular weight, 250,000) as the binding sites for [3H]flunitrazepam, [3H]muscimol and [3H]TBOB. GABA-stimulated 36Cl- influx into membrane vesicles prepared from the bovine cerebral cortex was stimulated and attenuated by flunitrazepam and beta-CCE, respectively. These effects of flunitrazepam and beta-CCE on the GABA-stimulated 36Cl- influx were antagonized by Ro15-1788. The present results suggest that the binding site for beta-CCE, which resides on GABAA receptor/benzodiazepine receptor/chloride ion channel complex, may be different from that for benzodiazepine. Possible roles of beta-CCE binding site in the allosteric inhibitions on benzodiazepine binding site as well as on the functional coupling between chloride ion channel and GABAA receptor are also suggested

  15. Development of cryogenic tracking detectors for very high luminosity experiments

    CERN Document Server

    Härkönen, J; Anbinderis, T; Bates, R; de Boer, W; Borchi, E; Bruzzi, M; Buttar, C; Chen, W; Cindro, V; Czellar, S; Eremin, V; Furgeri, A; Gaubas, E; Heijne, E; Ilyashenko, I; Kalesinskas, V; Krause, M; Li, Z; Luukka, P; Mandic, I; Menichelli, D; Mikuz, M; Militaru, O; Mueller, S; Niinikoski, T O; O’Shea, V; Parkes, C; Piotrzkowski, K; Pirollo, S; Pusa, P; Räisänen, J; Rouby, X; Tuominen, E; Tuovinen, E; Vaitkus, J; Verbitskaya, E; Väyrynen, S; Zavrtanik, M

    2009-01-01

    Experimental results and simulations of Charge Collection Efficiency (CCE) of Current Injected Detectors (CIDs) are focused. CID is a concept where the current is limited by the space charge. The injected carriers will be trapped by the deep levels. This induces a stable electric field through the entire bulk regardless of the irradiation fluence the detector has been exposed. Our results show that the CCE of CIDs is about two times higher than of regular detectors when irradiated up to 1×1016 cm−2. The higher CCE is achieved already at −50 °C temperatures.

  16. Investigation on the charge collection properties of a 4H-SiC Schottky diode detector

    International Nuclear Information System (INIS)

    We present experimental and theoretical data on the charge collection properties of a 4H-SiC epitaxial Schottky diode exposed to 5.48- and 2.00-MeV alpha particles. Hundred percent Charge Collection Efficiency (CCE) is, in particular, demonstrated for the 2.00-MeV alpha particles at reverse voltages higher than 40 V. By comparing measured CCE values with the outcomes of drift-diffusion simulations, a value of 500 ns is inferred for the hole lifetime within the lowly doped, active layer of virgin samples. The contributions of diffusion and funneling-assisted drift to CCE at low reverse voltages are pointed out

  17. Investigation on the charge collection properties of a 4H-SiC Schottky diode detector

    CERN Document Server

    Verzellesi, G; Nava, F; Canali, C

    2002-01-01

    We present experimental and theoretical data on the charge collection properties of a 4H-SiC epitaxial Schottky diode exposed to 5.48- and 2.00-MeV alpha particles. Hundred percent Charge Collection Efficiency (CCE) is, in particular, demonstrated for the 2.00-MeV alpha particles at reverse voltages higher than 40 V. By comparing measured CCE values with the outcomes of drift-diffusion simulations, a value of 500 ns is inferred for the hole lifetime within the lowly doped, active layer of virgin samples. The contributions of diffusion and funneling-assisted drift to CCE at low reverse voltages are pointed out.

  18. Comprehensive study of the effects of irradiation on charge collection efficiency in silicon detectors

    CERN Document Server

    Borello, L; Dutta, S; Gennai, Simone; Mariani, M; Messineo, A; Segneri, G; Starodumov, Andrei; Teodorescu, L; Tonelli, G; Verdini, P G

    2001-01-01

    The charge collection efficiency (CCE) for heavily irradiated silicon devices has been carefully investigated on a series of microstrip detectors. Large-area sensors designed for the CMS silicon tracker have been irradiated with neutrons and protons up to a very high fluence. Effects on CCE have been studied using a beam of minimum ionizing particles and a fast shaping time electronics similar to what is expected in CMS. The paper shows the performance of the sensors for CCE and signal-to-noise ratio under different operating conditions. (10 refs).

  19. The hypotensive action of Desmodium styracifolium and Clematis chinensis.

    Science.gov (United States)

    Ho, C S; Wong, Y H; Chiu, K W

    1989-01-01

    The cardiovascular pharmacology of aqueous extracts of Desmodium styracifolium (DSE) and Clematis chinensis (CCE) were studied in rats both in vivo and in vitro. DSE produced two successive hypotensive actions: the first one via cholinergic receptor stimulation, while the second one potentiated by blockades of autonomic ganglion and alpha-adrenoceptor. In contrast to DSE, CCE produced only one hypotensive response which was mediated through histaminergic activity. Furthermore, both extracts relaxed isolated methoxamine preconstricted helical tail artery strips. CCE also produced both negative chronotropic and inotropic effects on isolated atria, while DSE was positive chronotropic without apparent effect on the contractile force. PMID:2633620

  20. Study on the bias-dependent effects of proton-induced damage in CdZnTe radiation detectors using ion beam induced charge microscopy.

    Science.gov (United States)

    Gu, Yaxu; Jie, Wanqi; Rong, Caicai; Xu, Lingyan; Xu, Yadong; Lv, Haoyan; Shen, Hao; Du, Guanghua; Guo, Na; Guo, Rongrong; Zha, Gangqiang; Wang, Tao; Xi, Shouzhi

    2016-09-01

    The influence of damage induced by 2MeV protons on CdZnTe radiation detectors is investigated using ion beam induced charge (IBIC) microscopy. Charge collection efficiency (CCE) in irradiated region is found to be degraded above a fluence of 3.3×10(11)p/cm(2) and the energy spectrum is severely deteriorated with increasing fluence. Moreover, CCE maps obtained under the applied biases from 50V to 400V suggests that local radiation damage results in significant degradation of CCE uniformity, especially under low bias, i. e., 50V and 100V. The CCE nonuniformity induced by local radiation damage, however, can be greatly improved by increasing the detector applied bias. This bias-dependent effect of 2MeV proton-induced radiation damage in CdZnTe detectors is attributed to the interaction of electron cloud and radiation-induced displacement defects. PMID:27399802

  1. What would you say about the industry?

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    CCE asked 5 thought leaders to share their insights about the anticipated 2008 and the fruitful 2007. Learn what’s on the minds of the people leading the industry from entirely different market niches.

  2. Binding of [3H]ethyl-β-carboline-3-carboxylate to brain benzodiazepine receptors

    International Nuclear Information System (INIS)

    It is reported that in contrast to the changes in affinity of [3H]benzodiazepines elicited by halide ions, barbiturates, and pyrazolopyridines, the apparent affinity of β-[3H]CCE (ethyl-β-carboline-3-carboxylate) is unaffected by these agents. Furthermore, Scatchard analysis of β-[3H]CCE binding to cerebral cortical and cerebellar membranes revealed a significantly greater number of binding sites than was observed with either [3H]diazepam or [3H]flunitazepam, suggesting that at low concentrations benzodiazepines selectively label a subpopulation of the receptors labelled with β-[3H]CCE. Alternatively, β-[3H]CCE may bind to sites that are distinct from those labelled with [3H]-benzodiazepines. (Auth.)

  3. Low temperature annealing effects on the performance of proton irradiated GaAs detectors

    International Nuclear Information System (INIS)

    Semi-insulating, undoped, Liquid Encapsulated Czochralski (SI-U LEC) GaAs detectors have been irradiated with 24 GeV/c protons at the fluence of 5.6x1013 p/cm2. The detector charge collection efficiency (CCE), for both electrons and holes is remarkably reduced after irradiation while the reverse current increases. The effect of annealing the detectors at temperatures ranging from 220 deg. C to 280 deg. C has been seen to reduce the reverse current and to increase the electron CCE, while the recovery of the hole CCE is negligible in irradiated detectors. Deep electron traps have been followed in their evolution with the heat treatment temperature by P-DLTS and C-V measurements. They recover by increasing the heat treatment temperature and this can explain the restoration observed in electron CCE

  4. Coulomb energy of nuclei

    International Nuclear Information System (INIS)

    The density functional determining the Coulomb energy of nuclei is calculated to the first order in e2. It is shown that the Coulomb energy includes three terms: the Hartree energy; the Fock energy; and the correlation Coulomb energy (CCE), which contributes considerably to the surface energy, the mass difference between mirror nuclei, and the single-particle spectrum. A CCE-based mechanism of a systematic shift of the single-particle spectrum is proposed. A dominant contribution to the CCE is shown to come from the surface region of nuclei. The CCE effect on the calculated proton drip line is examined, and the maximum charge Z of nuclei near this line is found to decrease by 2 or 3 units. The effect of Coulomb interaction on the effective proton mass is analyzed

  5. Coulomb Energy of Nuclei

    CERN Document Server

    Shaginyan, V R

    2001-01-01

    The density functional determining the Coulomb energy of nuclei is calculated to the first order in $e^2$. It is shown that the Coulomb energy includes three terms: the Hartree energy; the Fock energy; and the correlation Coulomb energy (CCE), which contributes considerably to the surface energy, the mass difference between mirror nuclei, and the single-particle spectrum. A CCE-based mechanism of a systematic shift of the single-particle spectrum is proposed. A dominant contribution to the CCE is shown to come from the surface region of nuclei. The CCE effect on the calculated proton drip line is examined, and the maximum charge $Z$ of nuclei near this line is found to decrease by 2 or 3 units. The effect of Coulomb interaction on the effective proton mass is analyzed.

  6. Dicty_cDB: Contig-U05566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U05566-1 no gap 562 2 1380677 1380114 MINUS 1 1 U05566 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show C ... nces: 6905 Number of extensions: 18179 Number of succe ssful extensions: 1235 Number of sequences better t ... LMS) chicory Cichorium in... 36 1.0 2 ( EL371607 ) CCE L13625.b1_B23.ab1 CCE (LMS) endive Cichorium en... 3 ... (LMS) chicory Cichorium i... 36 1.0 2 ( EL343029 ) CCE L11023.b1_M20.ab1 CCE (LMS) endive Cichorium en... 3 ... 629,563 Number of extensions: 45531301 Number of succe ssful extensions: 3550224 Number of sequences bette ...

  7. Charge Collection Efficiency Simulations of Irradiated Silicon Strip Detectors

    CERN Document Server

    Peltola, T

    2014-01-01

    During the scheduled high luminosity upgrade of LHC, the world's largest particle physics accelerator at CERN, the position sensitive silicon detectors installed in the vertex and tracking part of the CMS experiment will face more intense radiation environment than the present system was designed for. Thus, to upgrade the tracker to required performance level, comprehensive measurements and simulations studies have already been carried out. Essential information of the performance of an irradiated silicon detector is obtained by monitoring its charge collection efficiency (CCE). From the evolution of CCE with fluence, it is possible to directly observe the effect of the radiation induced defects to the ability of the detector to collect charge carriers generated by traversing minimum ionizing particles (mip). In this paper the numerically simulated CCE and CCE loss between the strips of irradiated silicon strip detectors are presented. The simulations based on Synopsys Sentaurus TCAD framework were performed ...

  8. Protein (Viridiplantae): 145352847 [

    Lifescience Database Archive (English)

    Full Text Available XP_001420746.1 33090:14889 3041:7128 1035538:6043 13792:6043 70447:3543 242159:4039 436017:4039 ... polypeptide, typically encoded in the chloroplast genome ... Ostreococcus lucimarinus CCE9901 MAVLALNTGLIPLAARA ...

  9. Lateral IBIC characterization of single crystal synthetic diamond detectors

    CERN Document Server

    Giudice, A Lo; Manfredotti, C; Marinelli, M; Milani, E; Picollo, F; Prestopino, G; Re, A; Rigato, V; Verona, C; Verona-Rinati, G; Vittone, E

    2016-01-01

    In order to evaluate the charge collection efficiency (CCE) profile of single-crystal diamond devices based on a p type/intrinsic/metal configuration, a lateral Ion Beam Induced Charge (IBIC) analysis was performed over their cleaved cross sections using a 2 MeV proton microbeam. CCE profiles in the depth direction were extracted from the cross-sectional maps at variable bias voltage. IBIC spectra relevant to the depletion region extending beneath the frontal Schottky electrode show a 100% CCE, with a spectral resolution of about 1.5%. The dependence of the width of the high efficiency region from applied bias voltage allows the constant residual doping concentration of the active region to be evaluated. The region where the electric field is absent shows an exponentially decreasing CCE profile, from which it is possible to estimate the diffusion length of the minority carriers by means of a drift-diffusion model.

  10. Protein (Viridiplantae): 145352492 [

    Lifescience Database Archive (English)

    Full Text Available XP_001420576.1 33090:213 3041:8778 1035538:7795 13792:7795 70447:3450 242159:3940 436017:3940 MI ... P family transporter: water ... channel Ostreococcus lucimarinus CCE9901 MPAREMAVK ...

  11. Diverse mechanisms of antidiabetic effects of the different procyanidin oligomer types of two different cinnamon species on db/db mice.

    Science.gov (United States)

    Chen, Liang; Sun, Peng; Wang, Ting; Chen, Kaixian; Jia, Qi; Wang, Heyao; Li, Yiming

    2012-09-12

    The procyanidin oligomers are thought to be responsible for the antidiabetic activity of cinnamon. To investigate the hypoglycemic effects of different procyanidin oligomer types, the procyanidin oligomer-rich extracts were prepared from two different cinnamon species. Using high-performance liquid chromatography with purified procyanidin oligomers as reference compounds, we found that the Cinnamomum cassia extract (CC-E) and Cinnamomum tamala extract (CT-E) were rich in B- and A-type procyanidin oligomers, respectively. In the experiment, 8-week-old diabetic (db/db) mice were gavaged with CC-E and CT-E (both 200 mg/kg per day) for 4 weeks. Both CC-E and CT-E exhibited antidiabetic effects. Moreover, histopathological studies of the pancreas, liver, and adipose tissue showed that CC-E promoted lipid accumulation in the adipose tissue and liver, whereas CT-E mainly improved the insulin concentration in the blood and pancreas. PMID:22920511

  12. A case of repeated small bowel perforations in a short period in a patient with cholesterol crystal embolism.

    Science.gov (United States)

    Shinozuka, Eriko; Yamada, Takeshi; Kan, Hayato; Matsumoto, Satoshi; Koizumi, Michihiro; Shinji, Seiichi; Arai, Hiroki; Naito, Zenya; Uchida, Eiji

    2016-05-01

    We report a case of jejunal perforation related to cholesterol crystal embolism (CCE) in a woman in her seventies. The jejunum was partially resected;histological examination of the resected tissue revealed that the perforation was caused by CCE. On postoperative day 12, computed tomography (CT) showed free air in the abdomen. We then performed a second operation to alleviate the anastomotic leakage. Subsequently, 26 days after the second surgery, CT again showed free air in the abdomen. A third operation was performed, and multiple perforations of the jejunum were detected. She died of multiple organ failure 43 days after the first surgery. The prognosis of CCE with gastrointestinal perforation is reported to beextremely poor, and there is a high rate of anastomotic leakage. Partial resection of the intestine and ileostomy might be useful for removing the intestinal perforations caused by a CCE. Steroid administration should be continued, however, because discontinuation may worsen the problem. PMID:27151477

  13. CONTINUOUS AND COMPREHENSIVE EVALUATION – A STUDY

    OpenAIRE

    G. S. Murugan

    2015-01-01

    The growing demands of globalization have given rise to a lot of challenges in education especially on the quality of evaluation. Since evaluation is widely acknowledged as a powerful means of improving the quality of education. As emphasized by the Central Board of Secondary Education (CBSE) the implementation of new evaluation practices focusing on CCE was introduced right from primary to secondary level and CCE has been effectively implemented in Kendriya Vidyalayas throughout the country....

  14. Implementation of Joint Replenishment Inventory Model with Quantity Discounts.

    OpenAIRE

    Rajendran, Keerthana

    2013-01-01

    The purpose of this dissertation is to investigate the feasibility of implementing joint replenishment inventory models to help Palmer and Harvey manage their soft drinks inventory levels. The inventory management decisions involving Coca Cola Enterprise (CCE) and their wholesale partner Palmer and Harvey is an interesting case to investigate taking into consideration the two quantity discount models proposed by CCE. Analysis of the available input data is carried out through simulations to d...

  15. Diagnostic Role of Colon Capsule Endoscopy in Patients with Optimal Colon Cleaning.

    Science.gov (United States)

    Akyüz, Ümit; Yılmaz, Yusuf; İnce, Ali Tüzün; Kaya, Bülent; Pata, Cengiz

    2016-01-01

    Background. Colon capsule endoscopy (CCE) is a diagnostic test with relatively rare usage. In this study, we aimed to evaluate both the optimal cleaning regimen for CCE and the diagnostic value of test in the study group. Methods. A total of 62 patients were enrolled in this study. In the first step, 3 different colon preparing regimens were given to 30 patients [Group A: 3 days of liquid diet, sodium phosphate (NaP) (90 mL), and NaP enema; Group B: 3 days of liquid diet, 4 L of polyethylene glycol (PEG), and metoclopramide; Group C: 3 days of liquid diet, 4 L of PEG, NaP (45 mL), and bisacodyl after capsule ingestion] (10 patients in each group). The other consecutive 32 patients were cleaned with the best regimen which was NaP + PEG and CCE was performed. The results of CCE were controlled with colonoscopy in 28 patients. Results. Group C had the highest cleaning score, compared with the other groups (2.2 ± 0.4 versus 2.7 ± 0.4 versus 3.7 ± 0.4, p value = 0.000). The CCE findings were as follows in 28 patients who were also examined with colonoscopy: polyp (range: 5-10 mm) in 6 patients, internal hemorrhoids in 3 patients, angiodysplasia in 1 patient, diverticula in 1 patient, and ulcerative colitis in 1 patient. The sensitivity, specificity, PPV, and NPV of CCE were 100%, 92%, 93%, and 100%, respectively. Conclusions. Low dosage NaP combined with PEG provides optimal bowel preparation for CCE. CCE appears to be a highly sensitive diagnostic modality for detecting colonic pathologies. PMID:27066070

  16. Simulation of signal in irradiated silicon pixel detectors

    CERN Document Server

    Kramberger, G

    2003-01-01

    Induced currents in silicon pixel detectors of different geometries were simulated. The general properties of charge collection in irradiated segmented devices were investigated. A significant difference in charge collection efficiency (CCE) between n**+-n and p **+-n detectors was predicted after irradiation to the LHC fluences. A possible use of silicon detectors for the LHC upgrade was investigated by simulation of thin pixel sensors. The reduced CCE due to charge trapping seems to be the largest obstacle for their use.

  17. On the molecular basis and regulation of cellular capacitative calcium entry: Roles for Trp proteins

    OpenAIRE

    Birnbaumer, Lutz; Zhu, Xi; Jiang, Meisheng; Boulay, Guylain; Peyton, Michael; Vannier, Brigitte; Brown, Darren; Platano, Daniela; Sadeghi, Hamid; Stefani, Enrico; Birnbaumer, Mariel

    1996-01-01

    During the last 2 years, our laboratory has worked on the elucidation of the molecular basis of capacitative calcium entry (CCE) into cells. Specifically, we tested the hypothesis that CCE channels are formed of subunits encoded in genes related to the Drosophila trp gene. The first step in this pursuit was to search for mammalian trp genes. We found not one but six mammalian genes and cloned several of their cDNAs, some in their full length. As assayed in mammalia...

  18. Coulomb Energy of Nuclei

    OpenAIRE

    Shaginyan, V. R.

    2002-01-01

    The density functional determining the Coulomb energy of nuclei is calculated to the first order in $e^2$. It is shown that the Coulomb energy includes three terms: the Hartree energy; the Fock energy; and the correlation Coulomb energy (CCE), which contributes considerably to the surface energy, the mass difference between mirror nuclei, and the single-particle spectrum. A CCE-based mechanism of a systematic shift of the single-particle spectrum is proposed. A dominant contribution to the CC...

  19. Cholesterol crystal embolisation to the alimentary tract.

    OpenAIRE

    Moolenaar, W; Lamers, C B

    1996-01-01

    The features of cholesterol crystal embolisation (CCE) to the alimentary tract were studied by retrospective analysis of the clinical and pathological data of 96 patients (70 men, 26 women, mean age 73.8 (58-95) years) with this diagnosis in the Dutch national pathology information system (Pathologisch Anatomisch Landelijk Geautomatiseerd Archief (PALGA)) from 1973-92. In the 96 patients, 130 CCE sites were found throughout the alimentary tract, mostly in the colon (42.3%). Most patients had ...

  20. Capacitative Ca2+ Entry via Orai1 and Stromal Interacting Molecule 1 (STIM1) Regulates Adenylyl Cyclase Type 8

    OpenAIRE

    Martin, Agnes C. L.; Willoughby, Debbie; Ciruela, Antonio; Ayling, Laura-Jo; Pagano, Mario; Wachten, Sebastian; Tengholm, Anders; Cooper, Dermot M.F.

    2009-01-01

    Capacitative Ca2+ entry (CCE), which occurs through the plasma membrane as a result of Ca2+ store depletion, is mediated by stromal interacting molecule 1 (STIM1), a sensor of intracellular Ca2+ store content, and the pore-forming component Orai1. However, additional factors, such as C-type transient receptor potential (TRPC) channels, may also participate in the CCE apparatus. To explore whether the store-dependent Ca2+ entry reconstituted by coexpression of Orai1 ...

  1. Can silicon operate beyond 10 sup 1 sup 5 neutrons cm sup - sup 2 ?

    CERN Document Server

    Da Vià, C

    2003-01-01

    Factors that control the charge collection efficiency (CCE) in irradiated silicon detectors are discussed. The CCE and especially the related parameter, signal efficiency, are shown to be the limiting factors for operation after high levels of irradiation. Solutions to improving the radiation tolerance of silicon detectors are discussed, such as operational condition, defect engineering and device engineering. Conclusions are drawn as to future research directions.

  2. Effect of neutron irradiation on charge collection efficiency in 4H-SiC Schottky diode

    International Nuclear Information System (INIS)

    The charge collection efficiency (CCE) in 4H-SiC Schottky diode is studied as a function of neutron fluence. The 4H-SiC diode was irradiated with fast neutrons of a critical assembly in Nuclear Physics and Chemistry Institute and CCE for 3.5 MeV alpha particles was then measured as a function of the applied reverse bias. It was found from our experiment that an increase of neutron fluence led to a decrease of CCE. In particular, CCE of the diode was less than 1.3% at zero bias after an irradiation at 8.26×1014 n/cm2. A generalized Hecht's equation was employed to analyze CCE in neutron irradiated 4H-SiC diode. The calculations nicely fit the CCE of 4H-SiC diode irradiated at different neutron fluences. According to the calculated results, the extracted electron μτ product (μτ)e and hole μτ product (μτ)h of the irradiated 4H-SiC diode are found to decrease by increasing the neutron fluence. -- Highlights: • An increase of neutron fluence led to a decrease of CCE in the irradiated 4H-SiC diode. • The experimental CCE of the neutron-irradiated 4H-SiC diode is nicely fitted using a generalized Hecht's equation. • The extracted electron/hole μτ product of the 4H-SiC diode decrease by increasing the neutron fluence

  3. Modelling of crystallizer wear

    OpenAIRE

    J. David; P. Švec; R. Frischer

    2012-01-01

    Purpose: In this paper will be described an analysis of control problems and technical lifetime modeling of continuous casting device crystallizers. A full exploitation of continuous casting equipment (CCE) advantages can only be achieved through a control system that minimizes all undesirable effects on the technological process. Some of the undesirable effects influencing the CCE process effectiveness are the failures and service interruptions. The failures and service interruptions are cau...

  4. Aktivierung muskarinischer Rezeptoren moduliert die Effekte von kapazitativem Ca2+-Einstrom auf Erregbarkeit und Energiemetabolismus in zentralen Nervenzellen

    OpenAIRE

    Taubenberger, Nando

    2013-01-01

    In excitable and non-excitable cells, depletion of intracellular Ca2+-stores results in capacitative Ca2+-entry (CCE) across the cellular membrane. However, the effects of CCE on membrane excitability and mitochondrial functions in central neurons are not well defined. We investigated such cellular downstream effects in pyramidal neurons of rat organotypic hippocampal slice cultures by applying electrophysiological and fluorescence imaging techniques. We report that (1) in p...

  5. Squamous cell carcinoma in vaginal fundus in a Brahman cow

    Directory of Open Access Journals (Sweden)

    A. Pimenta-Oliveira

    2011-06-01

    Full Text Available É descrito o carcinoma de células escamosas (CCE no fundo vaginal de uma vaca. O diagnóstico de CCE moderadamente diferenciado foi confirmado através do exame histopatológico. Os testes imunoistoquímicos com os marcadores p53 e Ki67 realizados em amostras do tumor confirmaram a mutação na p53 e aumento da proliferação celular.

  6. Electrooxidation of 2-propanol and 2-butanol on the Pt–Ni alloy nanoparticles in acidic media

    International Nuclear Information System (INIS)

    Graphical abstract: Schematic representation of 2-propanol electrooxidation on the Pt–Ni alloy. Highlights: ► Electrocatalytic oxidation of 2-propanol and 2-butanol on the Pt–Ni nanoparticles. ► High stability and reproducibility of the Pt–Ni nanoparticles at the CCE. ► Pt–Ni/CCE as a potent electrocatalyst in the oxidation of alcohols in DAFCs. -- Abstract: The platinum–nickel nanoparticles carbon-ceramic modified electrode (Pt–Ni/CCE) was used as a potent electrocatalyst for the electrooxidation of 2-propanol and 2-butanol in a mixture of 0.15 M 2-propanol (or 0.15 M 2-butanol) and 0.1 M H2SO4 solutions. The Pt–Ni/CCE catalyst shows excellent electrocatalytic activity for electrooxidation of these fuels in comparison with platinum nanoparticles of carbon-ceramic modified (Pt/CCE) and smooth Pt electrodes due to the presence of Ni atoms in the alloy which enhances the electrocatalytic activity of Pt toward the oxidation of 2-propanol and 2-butanol and reduces the amount of Pt in the anodic material of direct 2-propanol and 2-butanol fuel cells. Furthermore, the Pt–Ni/CCE catalyst has satisfactory stability and reproducibility for the electrooxidation of 2-propanol and 2-butanol in acidic media when stored in ambient conditions or when used in constant potential applying (chronoamperometry) and continuous potential cycling (cyclic voltammetry) which makes it more attractive for alcohol-based fuel cell applications

  7. DIFFERENT RESPONSES OF CHORIOCAPILLARY ENDOTHELIAL CELLS AND RETINALCAPILLARY ENDOTHELIAL CELLS TO MITOGENIC AND VASOACTIVE FACTORS

    Institute of Scientific and Technical Information of China (English)

    李维业; 刘熙朴; MyronYanoff

    1994-01-01

    The reaponses of choriocapillary endothelial cells(CCE) and retinal capillary ondothelial cells (RCE) in cul-ture,in terms of phosphoinositide (PI) breakdown and cellular mitogenesis,to retinal pigment epithelial cell (RPE)-conditioned medium and vasoactive agents have been compared.RPE-conditioned medium did not induce PI breakdown in either type of cell.However,it stimulated DNA synthesis in CCE but not in RCE.Bradykinin (BDK)acted as both a fast signaling and a slow mitogenic factor on CCE,out BDK did not affect PI turnover or DNA synthesis in RCE.In contrast,thrombin stimulated PI turnover in RCE but not in CCE,though it did not in-duce 3H-thymidine incorporation into either type of cell.These differences in cellular functions between CCE and RCE following stimulation suggest that induction of DNA synthesis and recptor-mediated PI turnover by external factors is determined,at least in part,by the origin of the capillary endothelial cell.Therefore,extrapolation to CCE pathophysiology from experiments using endothelial cells from other capillary origins may not be valid.

  8. Colon Capsule Endoscopy compared to Conventional Colonoscopy under routine screening conditions

    Directory of Open Access Journals (Sweden)

    Beglinger Christoph

    2010-06-01

    Full Text Available Abstract Background Colonoscopy (CSPY for colorectal cancer screening has several limitations. Colon Capsule Endoscopy (PillCam Colon, CCE was compared to CSPY under routine screening conditions. Methods We performed a prospective, single-center pilot study at a University Hospital. Data were obtained from November 2007 until May 2008. Patients underwent CCE on Day 1 and CSPY on Day 2. Outcomes were evaluated regarding sensitivity and specificity of polyp detection rate, with a significance level set at >5 mm. Results 59 individuals were included in this study, the results were evaluable in 56 patients (males 34, females 22; median age 59. CCE was complete in 36 subjects. Polyp detection rate for significant polyps was 11% on CSPY and 27% on CCE. 6/56 (11% patients had polyps on CSPY not detected on CCE (miss rate. Overall sensitivity was 79% (95% confidence interval [CI], 61 to 90, specificity was 54% (95% CI, 35 to 70, positive predictive value (PPV was 63% and negative predictive value (NPV was 71%. Adjusted to significance of findings, sensitivity was 50% (95% CI, 19 to 81, specificity was 76% (95% CI, 63 to 86, PPV was 20% and NPV was 93%. Conclusion In comparison to the gold standard, the sensitivity of CCE for detection of relevant polyps is low, however, the high NPV supports its role as a possible screening tool. Trial Registration NCT00991003.

  9. Critical care ultrasonography in acute respiratory failure.

    Science.gov (United States)

    Vignon, Philippe; Repessé, Xavier; Vieillard-Baron, Antoine; Maury, Eric

    2016-01-01

    Acute respiratory failure (ARF) is a leading indication for performing critical care ultrasonography (CCUS) which, in these patients, combines critical care echocardiography (CCE) and chest ultrasonography. CCE is ideally suited to guide the diagnostic work-up in patients presenting with ARF since it allows the assessment of left ventricular filling pressure and pulmonary artery pressure, and the identification of a potential underlying cardiopathy. In addition, CCE precisely depicts the consequences of pulmonary vascular lesions on right ventricular function and helps in adjusting the ventilator settings in patients sustaining moderate-to-severe acute respiratory distress syndrome. Similarly, CCE helps in identifying patients at high risk of ventilator weaning failure, depicts the mechanisms of weaning pulmonary edema in those patients who fail a spontaneous breathing trial, and guides tailored therapeutic strategy. In all these clinical settings, CCE provides unparalleled information on both the efficacy and tolerance of therapeutic changes. Chest ultrasonography provides further insights into pleural and lung abnormalities associated with ARF, irrespective of its origin. It also allows the assessment of the effects of treatment on lung aeration or pleural effusions. The major limitation of lung ultrasonography is that it is currently based on a qualitative approach in the absence of standardized quantification parameters. CCE combined with chest ultrasonography rapidly provides highly relevant information in patients sustaining ARF. A pragmatic strategy based on the serial use of CCUS for the management of patients presenting with ARF of various origins is detailed in the present manuscript. PMID:27524204

  10. Motor callosal disconnection in early relapsing-remitting multiple sclerosis.

    Science.gov (United States)

    Wahl, Mathias; Hübers, Annemarie; Lauterbach-Soon, Birgit; Hattingen, Elke; Jung, Patrick; Cohen, Leonardo G; Ziemann, Ulf

    2011-06-01

    In relapsing-remitting multiple sclerosis (RRMS) the corpus callosum (CC) is often and early affected by macroscopic lesions when investigated by conventional MRI. We sought to determine to which extent microstructural and effective disconnection of the CC are already present in RRMS patients at the earliest stages of the disease prior to evidence of macroscopic CC lesion. We compared 16 very early RRMS patients (median expanded disability status scale (EDSS), 1.5; range, 0-2.0) to an age-matched group of healthy controls and focused analysis to the motor CC, i.e. that part of the CC relaying interhemispheric motor information. A combined functional magnetic resonance imaging/diffusion tensor imaging fiber-tracking procedure was applied to identify the callosal motor fibers (CMFs) connecting the hand areas of the primary motor cortices of the two hemispheres. Fractional anisotropy (FA) within the motor CC (FA-CC) assessed the CMF microstructural integrity. Bifocal paired transcranial magnetic stimulation (TMS) tested short-interval interhemispheric inhibition (S-IHI), an established measure of CMF effective connectivity. FA-CC and S-IHI were significantly reduced in early RRMS compared to healthy controls. Furthermore, a significant linear correlation between microstructure (FA-CC) and function (S-IHI) in the controls was broken down in the patients. These abnormalities were obtained in the absence of macroscopic CMF lesion in conventional MRI, and whilst motor hand/arm function in the nine-hole-peg test and corticospinal conduction time were normal. Findings suggest that reductions in FA and S-IHI may serve as surrogate markers of motor callosal disconnection at the earliest stages of RRMS prior to development of macroscopic lesion. PMID:21495114

  11. Projeto BEEHOPE 2015

    OpenAIRE

    Pinto, M. Alice; Neves, Cátia; Vilas-Boas, Miguel; Rodrigues, Pedro João; Ventura, Paulo; Garnery, Lionel; Legout, Helene; Douarre, Vincent; Houte, Sylvie; Odoux, Francois; Estonba, Andone; Miguel, Irati; Montes, Iratxe; Mallet, Noel; Grenier, Claude

    2015-01-01

    O projeto BEEHOPE, com o título original “Honeybee conservation centres in western Europe - an innovative strategy using sustainable beekeeping to reduce honeybee decline”, foi um dos 10 aprovados na área da biodiversidade do 5º concurso transnacional (2013-2014) BiodivErsA/FACCE-JPI (http://www.biodiversa.org/766), subordinado ao tema “Promover sinergias e reduzir o compromisso entre o abastecimento de alimentos, biodiversidade e serviços dos ecossistemas”. A diversidade nativa das populaçõe...

  12. Thin slice thickness double-dose contrast-enhanced CT in the detection of brain metastases

    International Nuclear Information System (INIS)

    To compare the usefulness of double-dose contrast-enhanced CT (DDCE-CT) and conventional contrast-enhanced CT(CCE-CT) in the detection of metastatic brain lesions. Sixteen patients with brain metastases were evaluated with both CCE-CT and thin-slice DDCE-CT. For CCE-CT, and initial injection of the 100 ml contrast medium was given, and DDCE-CT with both 10-mm and 5-mm thickness was performed after the addition of an extra 100 ml of contrast medium. The numbers of metastatic lesions detected by CCE-CT and by DDCE-CT were compared, as were the findings of contrast-enhanced MRI (CE-MRI) and thin-slice DDCE-CT in seven patients who underwent both these procedures. Fourteen metastatic brain lesions were detected by CCE-CT, 22 by 10-mm-thickness DDCE-CT than by CCE-CT. Metastatic lesions were detected by 10-mm-thickness DDCE-CT and 5-mm-thickness DDCE-CT detected seven and 18 lesions, respectively. Eleven lesions were detected by thin-slice DDCE-CT and 17 by CE-MRI in the seven patients who underwent both CE-MRI and DDCE-CT. The lesions detected only by CE-MRI were less than 5 mm in diameter and were discovered in the cerebellum or inferior temporal lobe. Thin-slice DDCE-CT was superior to CCE-CT in detecting metastatic brain lesions

  13. Electrochemical behavior of an indenedione derivative electrodeposited on a renewable sol-gel derived carbon ceramic electrode modified with multi-wall carbon nanotubes: Application for electrocatalytic determination of hydrazine

    International Nuclear Information System (INIS)

    A novel modified carbon ceramic electrode (CCE) containing multi-wall carbon nanotubes (MWCNTs) was fabricated by a sol-gel technique. The prepared MWCNT-CCE was modified by the electrodeposition of an indenedione derivative. The indenedione modified MWCNT-CCE (IMWCNT-CCE) shows one pair of peaks with surface confined characteristics. According to the theoretical model of Laviron, estimations were made in different pHs of the surface charge transfer rate constant, ks, and the charge transfer coefficient, α, for electron transfer between the indenedione derivative and MWCNT-CCE. The modified electrode shows a highly catalytic activity toward hydrazine electrooxidation at a wide pH range (5-9). The kinetic parameters such as the electron transfer coefficient, α, the heterogeneous rate constant, k', and the exchange current of hydrazine at the IMWCNT-CCE were calculated as 0.29 ± 0.01, 2.7(±0.3) x 10-3 cm s-1 and 0.17 ± 0.03 μA, respectively. Also, the modified electrode shows an excellent analytical performance for voltammetric determination of hydrazine. Differential pulse voltammetry (DPV) exhibits two linear dynamic ranges, 0.6-8.0 μM and 8.0-100.0 μM, and a lower detection limit of 0.29 μM for hydrazine. Finally, the practical analytical utility is illustrated by differential pulse voltammetric determination of hydrazine in auxiliary cooling water at IMWCNT-CCE and the accuracy of the results is verified in comparison with those obtained from the standard ASTM method

  14. PillCam© Colon Capsule for the study of colonic pathology in clinical practice: Study of agreement with colonoscopy Capsula colónica PillCam© para el estudio de la patología del colon en la práctica clínica

    Directory of Open Access Journals (Sweden)

    J. M. Herrerías-Gutiérrez

    2011-02-01

    Full Text Available Introduction: several studies have pointed out the effectiveness of the PillCam© colon capsule endoscopy (CCE compared with the colonoscopy in the study of the colonic pathology. Aims and methods: the objective of our study was to assess the agreement in the diagnosis of CCE with conventional colonoscopy as well as its sensitivity and specificity, and to describe the findings of the CCE in our clinical practice. Consecutive patients with abdominal symptoms were included in the study. The CCE was performed as previously reported (with PEG and sodium phosphate as laxative agents. The nature and location of the findings, colonic transit time, complications, cleanliness degree and consistency with diagnostic colonoscopy, when performed, were analyzed. Results: a total of 144 subjects (67 women and 77 men; (52.17±16.71 years with the following indications were included: screening of Colorectal cancer (88 patients, control after polipectomy (24, incomplete colonoscopy (7, rectal bleeding (10, anemia (8, diarrhea (7. The CCE exploration was complete in 134/144 cases (93%, with no case of retention. The preparation was good-very good in 88/134 (65,6%, fair in 26/134 (19,4% and poor in 20/134 (15% of the cases. The average colonic transit was of 140.76 min (9-603. Any adverse effect was notified. In 44 cases a colonoscopy was carried out after CCE (results were hidden from another endoscopist. Compared to colonoscopy, the rate of agreement was 75,6%, the sensitivity was 84% and the specificity 62,5%, PPV was 77,7% and NPV was 71,4 %. The colonic findings in 134 CCE were: in 34 cases CCE it did not show lesions, diverticulosis in 63 explorations, polyps in 43, angiodysplasias in 15, Crohn's Disease in 9 and ulcerative colitis in other 8 cases. Conclusions: the CCE is an effective and reliable technique for the detection of lesions in colon, and because of its high agree-ment with the colonoscopy, it could be useful in clinical practice. Further studies

  15. High-resolution mapping of the mobility-lifetime product in CdZnTe using a nuclear microprobe

    International Nuclear Information System (INIS)

    We present frontal ion beam induced charge imaging on a cadmium zinc telluride device using a 2.05 MeV He microbeam. Two sets of voltage-dependent 3 mm x 3 mm scans over the device cathode were acquired at room temperature and 250 K respectively and the corresponding charge collection efficiency (CCE) images extracted. The reduction of CCE due to electron transport with reduced bias voltage can be described using a simplified Hecht equation. This allows us to measure the mobility-lifetime product for electrons (μeτe) and so produce high-resolution μeτe images at 296 and 250 K. At 296 K, CCE values up to 96% were observed for an electric field of 3570 Vcm-1. In general, the CCE values at 250 K are lower than the comparable values at 296 K with μeτe decreasing from 4.7 x 10-4 to 1.2 x 10-4 cm2 V-1, about 1/4 of its original value. Additionally, we observe an increase in CCE at 250 K due to previous irradiation of the material, caused by partial filling of electron traps by the ion beam

  16. The effects of radiation on gallium arsenide radiation detectors

    International Nuclear Information System (INIS)

    Semi-insulating, undoped, liquid encapsulated Czochralski (SI-U LEC) GaAs detectors have been irradiated with 1 MeV neutrons, 24 GeV/c protons, and 300 MeV/c pions. The maximum fluences used were 6 x 1014, 3 x 1014, and 1.8 x 1014 particles/cm2, respectively. For all three types of irradiation, the charge collection efficiencies (cce) of the detector are reduced due to the reduction in the electron and hole mean free paths. Pion and proton irradiations produce a greater reduction in cce than neutron irradiation, with the pions having the greatest effect. The effect of annealing the detectors at room temperature, at 200 C and at 450 C with a flash lamp have been shown to reduce the leakage current and increase the cce of the irradiated detectors. The flash-lamp anneal produced the greatest increase in the cce from 26% to 70% by increasing the mean free path of the electrons. Two indium-doped samples were irradiated with 24 GeV/c protons and demonstrated no improvement over SI-U GaAs with respect to post-irradiation cce. (orig.)

  17. On the standing wave mode of giant pulsations

    International Nuclear Information System (INIS)

    Both odd-mode and even-mode standing were structures have been proposed for giant pulsations. Unless a conclusion is drawn on the field-aligned mode structure, little progress can be made in understanding the excitation mechanism of giant pulsations. In order to determine the standing wave mode, the authors have made a systematic survey of magnetic field data from the AMPTE CCE spacecraft and from ground stations located near the geomagnetic foot point of CCE. They selected time intervals when CCE was close to the magnetic equator and also magnetically close to Syowa and stations in Iceland, and when either transverse or compressional Pc 4 waves were observed at CCE. Magnetograms from the ground stations were then examined to determine if there was a giant pulsation was observed in association with transverse wave events. The CCE magnetic field record for the giant pulsation exhibited a remarkable similarity to a giant pulsation observed from the ATS 6 geostationary satellite near the magnetic equator (Hillebrand et at., 1982). In agreement with Hillebrand et al., they conclude that the compressional nature of the giant pulsation is due to an odd-mode standing wave structure. This conclusion places a strong constraint on the generation mechanism of giant pulsations

  18. Selective antagonization of activated Nrf2 and inhibition of cancer cell proliferation by procyanidins from Cinnamomi Cortex extract.

    Science.gov (United States)

    Ohnuma, Tomokazu; Anzai, Eri; Suzuki, Yohei; Shimoda, Mai; Saito, Shin; Nishiyama, Takahito; Ogura, Kenichiro; Hiratsuka, Akira

    2015-11-01

    Nuclear factor-E2-related factor 2 (Nrf2) is an important transcription factor and plays a central role in inducible expression of many cytoprotective genes. Recent studies have reported that various cancer cells having unrestrained Nrf2 due to its overexpression exhibit increased proliferation and resistance to chemotherapy. Suppression of abnormal Nrf2 activation is needed for a new therapeutic approach against these cancers. Our previous study found that procyanidins prepared from Cinnamomi Cortex extract (CCE) have an ability to suppress Nrf2-regulated enzyme activity and Nrf2 expression in human lung cancer A549 cells. In the present study, we investigated the effect of CCE procyanidins on Nrf2 activity and cell proliferation in several cancer cells, which have normal or constitutively active Nrf2. Interestingly, CCE procyanidin treatment selectively reduced Nrf2 expression and inhibited cell proliferation in cancer cells that overexpress Nrf2, but these phenomena were not seen in cells with low Nrf2 expression. Moreover, transfection assay demonstrated that CCE procyanidins had selective inhibition of activated Nrf2. These results suggest that CCE procyanidins might be an effective cancer therapeutic agent to selectively suppress abnormal Nrf2 activation responsible for enhanced proliferation. PMID:26365032

  19. Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle

    International Nuclear Information System (INIS)

    Sol-gel chemistry is becoming more popular for the synthesis of electrode materials. For example, the sol-gel reaction can be performed in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together via the ceramic binder, which can also promote ion transport. Furthermore, the CCE structure has a high active surface area and is chemical and thermally robust. We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments (cyclic voltammetry, electrochemical impedance spectroscopy) were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. Our initial results have shown that CCE-based electrodes vastly outperform a bare carbon electrode, and thus are highly promising and cost-effective electrode material. Subsequent experiments involved the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements will be presented. (author)

  20. Charge collection efficiency simulations of irradiated silicon strip detectors

    International Nuclear Information System (INIS)

    During the scheduled high luminosity upgrade of LHC, the world's largest particle physics accelerator at CERN, the position sensitive silicon detectors installed in the vertex and tracking part of the CMS experiment will face a more intense radiation environment than the present system was designed for. Thus, to upgrade the tracker to the required performance level, comprehensive measurements and simulation studies have already been carried out. Essential information of the performance of an irradiated silicon detector is obtained by monitoring its charge collection efficiency (CCE). From the evolution of CCE with fluence, it is possible to directly observe the effect of the radiation induced defects on the ability of the detector to collect charge carriers generated by traversing minimum ionizing particles (MIPs). In this paper the numerically simulated CCE and CCE loss between the strips of irradiated silicon strip detectors are presented. The simulations based on the Synopsys Sentaurus TCAD framework were performed before and after irradiation for fluences up to 1.5 × 1015 neqcm−2 for n-on-p sensors. A two level defect model and non-uniform three level defect model were applied for the proton irradiation simulations, and a two level model for neutrons. The results are presented together with the measurements of strip detectors irradiated by different particles and fluences and show considerable agreement for both CCE and its position dependency

  1. Preparation and Electrochemical Characterization of a Carbon Ceramic Electrode Modified with Ferrocenecarboxylic Acid

    Directory of Open Access Journals (Sweden)

    Christiana A. Pessoa

    2011-01-01

    Full Text Available The present paper describes the characterization of a carbon ceramic electrode modified with ferrocenecarboxylic acid (designated as CCE/Fc by electrochemical techniques and its detection ability for dopamine. From cyclic voltammetric experiments, it was observed that the CCE/Fc presented a redox pair at Epa = 405 mV and Epc = 335 mV (DE = 70 mV, related to the ferrocene/ferrocenium process. Studies showed a considerably increase in the redox currents at the same oxidation potential of ferrocene (Epa = 414 mV vs. Ag/AgCl in the presence of dopamine (DA, differently from those observed when using only the unmodified CCE, in which the anodic peak increase was considerably lower. From SWV experiments, it was observed that the AA (ascorbic acid oxidation at CCE/Fc occurred in a different potential than the DA oxidation (with a peak separation of approximately 200 mV. Moreover, CCE/Fc did not respond to different AA concentrations, indicating that it is possible to determine DA without the AA interference with this electrode.

  2. Effects of microalgae chlorella species crude extracts on intestinal adaptation in experimental short bowel syndrome

    Institute of Scientific and Technical Information of China (English)

    Mustafa Kerem; Bulent Salman; Hatice Pasaoglu; Abdulkadir Bedirli; Murat Alper; Hikmet Katircioglu; Tahir Atici; E Ferda Pertoin; Ebru Ofluoglu

    2008-01-01

    AIM: To evaluate the effects of chlorella crude extract (CCE) on intestinal adaptation in rats subjected to short bowel syndrome (SBS).METHODS: Wistar rats weighing 230-260 g were used in the study. After anesthesia a 75% small bowel resection was performed. Rats were randomized and divided into groups. Control group (n = 10): where 5% dextrose was given through a gastrostomy tube, Enteral nutrition (EN) group (n = 10): Isocaloric and isonitrogen EN (Alitraq, Abbott, USA), study group (/7 = 10): CCE was administrated through a gastrostomy tube. Rats were sacrificed on the fifteenth postoperative day and blood and tissue samples were taken. Histopathologic evaluation, intestinal mucosal protein and DNA levels,intestinal proliferation and apoptosis were determined in intestinal tissues, and total protein, albumin and citrulline levels in blood were studied.RESULTS: In rats receiving CCE, villus lengthening,crypt depth, mucosal DNA and protein levels, intestinal proliferation, and serum citrulline, protein and albumin levels were found to be significantly higher than those in control group. Apoptosis in CCE treated rats was significantly reduced when compared to EN group rats.CONCLUSION: CCE has beneficial effects on intestinala daptation in experimental SBS.

  3. The formation of a cold-core eddy in the East Australian Current

    Science.gov (United States)

    Macdonald, H. S.; Roughan, M.; Baird, M. E.; Wilkin, J.

    2016-02-01

    Cold-core eddies (CCEs) frequently form in western boundary currents and can affect continental shelf processes. It is not always clear, however, if baroclinic or barotropic instabilities contribute more to their formation. The Regional Ocean Modelling System (ROMS) is used to investigate the ocean state during the formation of a CCE in the East Australian Current (EAC) during October 2009. The observed eddy initially appeared as a small billow (approx. 50 km in length) that perturbed the landward edge of the EAC. The billow grew into a mesoscale CCE (approx. 100 km in diameter), diverting the EAC around it. A ROMS simulation with a realistic wind field reproduced a similar eddy. This eddy formed from negative vorticity waters found on the continental shelf south of the EAC separation point. A sensitivity analysis is performed whereby the impact of 3 different wind forcing scenarios, upwelling, downwelling, and no winds, are investigated. A CCE formed in all wind scenarios despite the wind induced changes in hydrographic conditions in the continental shelf and slope waters. As such, the source of energy for eddy formation did not come from the interactions of wind with the continental shelf waters. Analysis of strain and energy transformation confirms this by showing that the prevailing source of CCE energy was kinetic energy of the offshore EAC. These results clearly link the formation of the CCE to the swift flowing EAC and barotropic instabilities.

  4. Charge collection characteristics of Frisch collar CdZnTe gamma-ray spectrometers

    International Nuclear Information System (INIS)

    A collimated 198Au source was used to determine the charge collection efficiency (CCE) at several locations along the length of a 3.4x3.4x5.5 mm3 CdZnTe bar detector, both in planar configuration and with Frisch collars of varying length. For each configuration, a 0.50-mm-long region spanning the width of the device was irradiated with 411-keV gamma rays produced by a neutron-activated gold foil. Irradiation began at the cathode and stepped in 0.50-mm steps toward the anode, with a spectrum being collected at each location. By observing the channel location of the full-energy peak in each collected spectrum, an average CCE was determined for each irradiated region. The CCE was found to vary nearly linearly along the length of the device in the planar configuration, starting at a peak value of 89% and dropping to a minimum measured value of 26% near the anode. The addition of a Frisch collar covering the entire length of the crystal greatly altered the CCE profile, which remained near 87% for approximately two-thirds of the length, then sharply dropped near the anode. Results were confirmed by theoretical models. Further CCE mapping was also completed for devices with Frisch collars of various lengths. Those results are reported as well

  5. Effect of Cerium on the Viscosity of Liquid Fe-C Alloy of Eutectic Content

    Institute of Scientific and Technical Information of China (English)

    滕新营; 叶以富; 刘含莲; 王焕荣; 石志强; 耿浩然

    2002-01-01

    The viscosities of liquid Fe-4.30C and Fe-4.30C-Ce alloys were measured by oscillating crucible viscometer. The results show that viscosity of Fe-4.30C alloy changes from 5.50 to 8.30 MPa*s when the liquid is cooled from 1425 ℃ to the melting point. The abnormity of viscosity of Fe-4.30C alloy near the melting point is reasonable due to the formation of graphite. The addition of cerium especially with content higher than 0.21% causes an evidently decrease in viscosity for eutectic alloy resulting from increase of free volume and size decrease of atom cluster in the liquids. It can be concended that the existence of C-Ce compound contributes to the discontinuous of viscosity at 1340~1370 ℃ for the Fe-4.30C-Ce alloy by experinments with differential scanning calorimeter.

  6. Detection properties of LEC SI GaAs radiation detectors with the symmetrical contact configuration

    International Nuclear Information System (INIS)

    I-V characteristics and detection properties (CCE, FWHM) of the semi-insulating GaAs detectors (base length 200 μm) with the Au-Au and W-W Schottky barriers and N+-N+ ohmic contacts, measured at room temperature, are presented for α, β and heavier particles (up to Z≅10). The best results (average values of CCE and FWHM were 87% and 5%, respectively, for 5.48 MeV α particles from 241Am) give detectors with the Au-Au contact configuration. Detectors with the N+ contacts have worse parameters, about 30% for both, the CCE and FWHM, respectively. Nevertheless, such detectors operate at a low bias voltage, under 20 V. (orig.)

  7. Mechanical pretreatment improving hemicelluloses removal from cellulosic fibers during cold caustic extraction.

    Science.gov (United States)

    Li, Jianguo; Liu, Yishan; Duan, Chao; Zhang, Hongjie; Ni, Yonghao

    2015-09-01

    Hemicelluloses removal is a prerequisite for the production of high-quality cellulose (also known as dissolving pulp), and further recovery and utilization of hemicelluloses, which can be considered as a typical Integrated Forest Biorefinery concept. In this paper, a process of combined mechanical refining and cold caustic extraction (CCE), which was applied to a softwood sulfite sample, was investigated. The results showed that the hemicelluloses removal efficiency and selectivity were higher for the combined treatment than that for the CCE alone. The combined treatment can thus decrease the alkali concentration (from 8% to 4%) to achieve a similar hemicelluloses removal. The improved results were due to the fact that the mechanical refining resulted in increases in pore volume and diameter, water retention value (WRV) and specific surface area (SSA), all of which can make positive contributions to the hemicelluloses removal in the subsequent CCE process. PMID:26081626

  8. Cryogenic temperature performance of heavily irradiated silicon detectors

    International Nuclear Information System (INIS)

    The charge collection efficiency (CCE) of silicon detectors, previously irradiated with high neutron fluences, has been measured at 4.2, 77 and 195 K. The CCE recovery measured after 1.2x1014 n/cm2 is 100% at a bias voltage of 50 V. For 2x1015 n/cm2 the most probable signal collected for minimum ionising particles is 13 000 electrons, corresponding to 50% CCE, at a bias voltage of 250 V. Negligible difference has been observed between 77 and 4.2 K operation, while no recovery was measurable at 195 K. The timing of the signal was measured to be better than 5 ns. The samples were irradiated and stored at room temperature and cooled only when operated. Reproducible results were obtained after several weeks and several thermal cycles. (author)

  9. Charge collection efficiency of an irradiated cryogenic double-p silicon detector

    International Nuclear Information System (INIS)

    We present results on the measurement of the charge collection efficiency of a p+/n/p+ silicon detector irradiated to 1x1015 n/cm2, operated in the temperature range between 80 and 200 K. For comparison, measurements obtained with a standard silicon diode (p+/n/n+), irradiated to the same fluence, are also presented. Both detectors show a dramatic increase of the CCE when operated at temperatures around 130 K. The double-p detector shows a higher CCE regardless of the applied bias and temperature, besides being symmetric with respect to the polarity of the bias voltage. At 130 K and 500 V applied bias the double-p detector shows a CCE of 80%, an unprecedented result for a silicon detector irradiated to such a high dose

  10. Response of a SiC Photodiode to Extreme Ultraviolet through Visible Radiation

    International Nuclear Information System (INIS)

    The responsivity of a type 6H-SiC photodiode in the 1.5-400 nm wavelength range was measured using synchrotron radiation. The responsivity was 0.20 A/W at 270 nm and was less than 0.10 A/W in the extreme ultraviolet (EUV) region. The responsivity was calculated using a proven optical model that accounted for the reflection and absorption of the incident radiation and the variation of the charge collection efficiency (CCE) with depth into the device. The CCE was determined from the responsivity measured in the 200-400 nm wavelength range. By use of this CCE and the effective pair creation energy (7.2 eV) determined from x-ray absorption measurements, the EUV responsivity was accurately modeled with no free parameters. The measured visible-light sensitivity, although low compared with that of a silicon photodiode, was surprisingly high for this wide bandgap semiconductor

  11. Flow injection amperometric detection of insulin at cobalt hydroxide nanoparticles modified carbon ceramic electrode.

    Science.gov (United States)

    Habibi, Esmaeil; Omidinia, Eskandar; Heidari, Hassan; Fazli, Maryam

    2016-02-15

    Cobalt hydroxide nanoparticles were prepared onto a carbon ceramic electrode (CHN|CCE) using the cyclic voltammetry (CV) technique. The modified electrode was characterized by X-ray diffraction and scanning electron microscopy. The results showed that CHN with a single-layer structure was uniformly electrodeposited on the surface of CCE. The electrocatalytic activity of the modified electrode toward the oxidation of insulin was studied by CV. CHN|CCE was also used in a homemade flow injection analysis system for insulin determination. The limit of detection (signal/noise [S/N] = 3) and sensitivity were found to be 0.11 nM and 11.8 nA/nM, respectively. Moreover, the sensor was used for detection of insulin in human serum samples. This sensor showed attractive properties such as high stability, reproducibility, and high selectivity. PMID:26686031

  12. Cryogenic temperature performance of heavily irradiated silicon detectors

    CERN Document Server

    Da Vià, C; Casagrande, L; Granata, V; Palmieri, V G

    1999-01-01

    The charge collection efficiency (CCE) of silicon detectors, previously irradiated with high neutron fluences, has been measured at 4.2, 77 and 195 K. The CCE recovery measured after 1.2x10 sup 1 sup 4 n/cm sup 2 is 100% at a bias voltage of 50 V. For 2x10 sup 1 sup 5 n/cm sup 2 the most probable signal collected for minimum ionising particles is 13 000 electrons, corresponding to 50% CCE, at a bias voltage of 250 V. Negligible difference has been observed between 77 and 4.2 K operation, while no recovery was measurable at 195 K. The timing of the signal was measured to be better than 5 ns. The samples were irradiated and stored at room temperature and cooled only when operated. Reproducible results were obtained after several weeks and several thermal cycles. (author)

  13. Optical Fiber Grating based Sensors

    DEFF Research Database (Denmark)

    Michelsen, Susanne

    2003-01-01

    In this thesis differenct optical fiber gratings are used for sensor purposes. If a fiber with a core concentricity error (CCE) is used, a directional dependent bend sensor can be produced. The CCE direction can be determined by means of diffraction. This makes it possible to produce long......-period gratings in a fiber with a CCE direction parallel or perpendicular to the writing direction. The maximal bending sensitivity is independent on the writing direction, but the detailed bending response is different in the two cases. A temperature and strain sensor, based on a long-period grating and two...... sampled gratings, was produced and investigated. It is based on the different temperature and strain response of these gratings. Both a transfer matrix method and an overlap calculation is performed to explain the sensor response. Another type of sensor is based on tuning and modulation of a laser...

  14. Charge collection efficiency of an irradiated cryogenic double-p silicon detector

    Energy Technology Data Exchange (ETDEWEB)

    Borer, K.; Janos, S.; Li, Z.; Dezillie, B.; Da Via, C.; Granata, V.; Casagrande, L. E-mail: luca.casagrande@cern.ch; Boer, R.W.I. de; Lourenco, C.; Niinikoski, T.O.; Palmieri, V.G.; Chapuy, S.; Dimcovski, Z.; Grigoriev, E.; Bell, W.; Devine, S.R.H.; Ruggiero, G.; O' Shea, V.; Smith, K.; Berglund, P.; Boer, W. de; Hauler, F.; Heising, S.; Jungermann, L.; Abreu, M.; Rato, P.; Sousa, P.; Cindro, V.; Mikuz, M.; Zavrtanik, M.; Esposito, A.; Paul, S.; Buontempo, S.; D' Ambrosio, N.; Pagano, S.; Eremin, V.; Verbitskaya, E

    2001-04-21

    We present results on the measurement of the charge collection efficiency of a p{sup +}/n/p{sup +} silicon detector irradiated to 1x10{sup 15} n/cm{sup 2}, operated in the temperature range between 80 and 200 K. For comparison, measurements obtained with a standard silicon diode (p{sup +}/n/n{sup +}), irradiated to the same fluence, are also presented. Both detectors show a dramatic increase of the CCE when operated at temperatures around 130 K. The double-p detector shows a higher CCE regardless of the applied bias and temperature, besides being symmetric with respect to the polarity of the bias voltage. At 130 K and 500 V applied bias the double-p detector shows a CCE of 80%, an unprecedented result for a silicon detector irradiated to such a high dose.

  15. Charge collection efficiency recovery in heavily irradiated silicon detectors operated at cryogenic temperatures

    CERN Document Server

    Da Vià, C; Berglund, P; Borchi, E; Borer, K; Bruzzi, Mara; Buontempo, S; Casagrande, L; Chapuy, S; Cindro, V; Dimcovski, Zlatomir; D'Ambrosio, N; de Boer, Wim; Dezillie, B; Esposito, A P; Granat, V; Grigoriev, E; Heijne, Erik H M; Heising, S; Janos, S; Koivuniemi, J H; Konotov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; Pagano, S; Palmieri, V G; Paul, S; Pirollo, S; Pretzl, Klaus P; Ropotar, I; Ruggiero, G; Salmi, J; Seppä, H; Suni, I; Smith, K; Sonderegger, P; Valtonen, M J; Zavrtanik, M

    1998-01-01

    The charge collection efficiency (CCE) of high resistivity silicon detectors, previously neutron irradiated up to 2*10/sup 15/ n/cm/sup 2/, was measured at different cryogenic temperatures and different bias voltages. In order to $9 study reverse annealing (RA) effects, a few samples were heated to 80 degrees C and kept at room temperature for several months after irradiation. For comparison other samples (NRA) where kept at -10 C after irradiation. The RA and $9 NRA samples, measured at 250 V forward and reverse bias voltage, present a common temperature threshold at 150 K. Below 120 K the CCE is constant and ranges between 55and 65 0.000000or the RA and NRA sample respectively. Similar CCE $9 was measured for a device processed with low resistivity contacts (OHMIC), opening the prospect for a consistent reduction of the cost of large area particle tracking. (7 refs).

  16. Cell Control Engineering

    DEFF Research Database (Denmark)

    Lynggaard, Hans Jørgen Birk; Alting, Leo

    1996-01-01

    The engineering process of creating cell control systems is described, and a Cell Control Engineering (CCE) concept is defined. The purpose is to assist people, representing different disciplines in the organisation, to implement cell controllers by addressing the complexity of having many systems...... in physically and logically different and changing manufacturing environments. The defined CCE concept combines state-of-the-art of commercially available enabling technologies for automation system software development, generic cell control models and guidelines for the complete engineering process....... It facilitates the understanding of the task and structure of cell controllers and uses this knowledge directly in the implementation of the system. By applying generic models CCE facilitates reuse of software components and maintenance of applications. In many enterprises, software makes up an...

  17. Energetic values and performace of broilers feeding sorghum and soybean meal based diets supplemented with B-glucanase and B-xylanase

    Directory of Open Access Journals (Sweden)

    Evandro de Abreu Fernandes

    2016-04-01

    Full Text Available Grains, brans, and vegetable meals may contain non-starch polysaccharides (NSP, which increases viscosity in the gastrointestinal tract (GIT and interfere with the digestion and absorption of nutrients. This study aimed to evaluate the performance and determine the metabolizable energy of a sorghum-based broiler diet with and without the supplementation of an enzymatic complex. The experiments were conducted in a completely randomized design with 1200 chickens, using sorghum-based feed with and without the addition of 50 g of enzyme-CCE complex (?-glucanase and ?-xylanase, and with two levels of metabolizable energy (ME kg-1: ME; ME + CCE; reduced ME (-50 kcal kg-1; and reduced ME + CCE. The data were subjected to an analysis of variance and the means were compared using a Tukey’s test at the 5% significance level. At 42 and 47 days of age, the living weight of the birds fed with the reduced ME was low, while birds fed with reduced ME + CCE had the same weight as those fed with other energy diets (ME and ME + CCE. Feed conversion was poorest at 47 days of age for the birds on reduced ME diet. In the metabolic test (with fattening diets to determine AME and AMEn, the reduced ME diet had the lowest result, confirming the effect of the addition of enzymes. The addition of CCE to sorghum-based diets provides enough enzymatic activity to increase the metabolizable energy of the diet (50 kcal of AME and influence the growth performance of broilers at the slaughtering age.

  18. Current-carrying element based on second-generation high-temperature superconductor for the magnet system of a fusion neutron source

    International Nuclear Information System (INIS)

    Application of current-carrying elements (CCEs) made of second-generation high-temperature superconductor (2G HTS) in magnet systems of a fusion neutron source (FNS) and other fusion devices will allow their magnetic field and thermodynamic stability to be increased substantially in comparison with those of low-temperature superconductor (LTS) magnets. For a toroidal magnet of the FNS, a design of a helical (partially transposed) CCE made of 2G HTS is under development with forced-flow cooling by helium gas, a current of 20–30 kA, an operating temperature of 10–20 K, and a magnetic field on the winding of 12–15 T (prospectively ∼20 T). Short-sized samples of the helical flexible heavy-current CCE are being fabricated and investigated; a pilot-line unit for production of long-sized CCE pieces is under construction. The applied fabrication technique allows the CCE to be produced which combines a high operating current, thermal and mechanical stability, manufacturability, and low losses in the alternating modes. The possibility of fabricating the CCE with the outer dimensions and values of the operating parameter required for the FNS (and with a significant margin) using already available serial 2G HTS tapes is substantiated. The maximum field of toroidal magnets with CCEs made of 2G HTS will be limited only by mechanical properties of the magnet’s casing and structure, while the thermal stability will be approximately two orders of magnitude higher than that of toroidal magnets with LTS-based CCEs. The helical CCE made of 2G HTS is very promising for fusion and hybrid electric power plants, and its design and technologies of production, as well as the prototype coils made of it for the FNS and other tokamaks, are worth developing now

  19. Current-carrying element based on second-generation high-temperature superconductor for the magnet system of a fusion neutron source

    Science.gov (United States)

    Novikov, M. S.; Ivanov, D. P.; Novikov, S. I.; Shuvaev, S. A.

    2015-12-01

    Application of current-carrying elements (CCEs) made of second-generation high-temperature superconductor (2G HTS) in magnet systems of a fusion neutron source (FNS) and other fusion devices will allow their magnetic field and thermodynamic stability to be increased substantially in comparison with those of low-temperature superconductor (LTS) magnets. For a toroidal magnet of the FNS, a design of a helical (partially transposed) CCE made of 2G HTS is under development with forced-flow cooling by helium gas, a current of 20-30 kA, an operating temperature of 10-20 K, and a magnetic field on the winding of 12-15 T (prospectively ~20 T). Short-sized samples of the helical flexible heavy-current CCE are being fabricated and investigated; a pilot-line unit for production of long-sized CCE pieces is under construction. The applied fabrication technique allows the CCE to be produced which combines a high operating current, thermal and mechanical stability, manufacturability, and low losses in the alternating modes. The possibility of fabricating the CCE with the outer dimensions and values of the operating parameter required for the FNS (and with a significant margin) using already available serial 2G HTS tapes is substantiated. The maximum field of toroidal magnets with CCEs made of 2G HTS will be limited only by mechanical properties of the magnet's casing and structure, while the thermal stability will be approximately two orders of magnitude higher than that of toroidal magnets with LTS-based CCEs. The helical CCE made of 2G HTS is very promising for fusion and hybrid electric power plants, and its design and technologies of production, as well as the prototype coils made of it for the FNS and other tokamaks, are worth developing now.

  20. A multisatellite case study of the expansion of a substorm current wedge in the near-Earth magnetotail

    International Nuclear Information System (INIS)

    This study presents observations made by four spacecraft (AMPTE CCE, AMPTE IRM, GOES 5, and GOES 6) and two ground stations (San Juan and Tucson) during a substorm that occurred at ∼0830 UT on April 19, 1985. The spacecraft were arrayed in a configuration that allows for the examination of the spatial evolution of the substorm current wedge, CCE was located between the GOES spacecraft in longitude, but at a radial distance of 8.0 RE. IRM was located west of the other three spacecraft in the same sector as Tucson, but at a radial distance of 11.6 RE. The relative times at which the signature of the substorm current wedge was first observed at the GOES spacecraft and the ground stations are consistent with a simple longitudinally expanding current wedge. However, the times at which IRM and CCE observed the current wedge are not consistent with a current wedge that expanded only longitudinally, IRM first observed the signature of the current wedge at about the same time the signature was observed by GOES 6 and Tucson, and CCE observed the current wedge only after both GOES satellites and the ground stations had done so. Moreover, both GOES spacecraft observed signatures consistent with entry into the central plasma sheet before CCE and IRM did, even though we estimate that CCE was slightly closer to the neutral sheet than the geosynchronous spacecraft. The sequence of events suggests that during this substorm the disruption of the cross-tail current sheet, the formation of the substorm current wedge, and the expansion of the plasma sheet began in the near-Earth region, and subsequently spread tailward as well as longitudinally

  1. Infection with the oncogenic human papillomavirus type 59 alters protein components of the cornified cell envelope

    International Nuclear Information System (INIS)

    Infection of the genital tract with human papillomaviruses (HPVs) leads to proliferative and dysplastic epithelial lesions. The mechanisms used by the virus to escape the infected keratinocyte are not well understood. Infection of keratinocytes with HPV does not cause lysis, the mechanism used by many viruses to release newly formed virions. For HPV 11, a type associated with a low risk of neoplastic disease, the cornified cell envelope (CCE) of infected keratinocytes is thin and fragile, and transcription of loricrin, the major CCE protein, is reduced. The effects of high-risk HPV infection on components of the CCE have not been previously reported. HPV 59, an oncogenic genital type related to HPV types 18 and 45 was identified in a condylomata acuminata lesion. An extract of this lesion was used to infect human foreskin fragments, which were grown in athymic mice as xenografts. Continued propagation using extracts of xenografts permitted growth of additional HPV 59-infected xenografts. CCEs purified from HPV 59-infected xenografts displayed subtle morphologic abnormalities compared to those derived from uninfected xenografts. HPV 59-infected xenografts revealed dysplastic-appearing cells with mitotic figures. Detection of loricrin, involucrin, and cytokeratin 10 was reduced in HPV 59-infected epithelium, while small proline-rich protein 3 (SPR3) was increased. Reduction in loricrin was most apparent in regions of epithelium containing abundant HPV 59 DNA. Compared to uninfected epithelium, loricrin transcription was decreased in HPV 59-infected epithelium. We conclude that HPV 59 shares with HPV 11 the ability to alter CCE components and to specifically reduce transcription of the loricrin gene. Because loricrin is the major CCE protein, a reduction in this component could alter the physical properties of the CCE, thus facilitating virion release

  2. Current-carrying element based on second-generation high-temperature superconductor for the magnet system of a fusion neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, M. S., E-mail: mihailnovikov@yandex.ru; Ivanov, D. P., E-mail: Ivanov-DP@nrcki.ru, E-mail: denis.ivanov30@mail.ru; Novikov, S. I., E-mail: novikov-si@nrcki.ru; Shuvaev, S. A., E-mail: ser-shuvaev@yandex.ru, E-mail: sergey.shuvaev@phystech.edu [National Research Center Kurchatov Institute (Russian Federation)

    2015-12-15

    Application of current-carrying elements (CCEs) made of second-generation high-temperature superconductor (2G HTS) in magnet systems of a fusion neutron source (FNS) and other fusion devices will allow their magnetic field and thermodynamic stability to be increased substantially in comparison with those of low-temperature superconductor (LTS) magnets. For a toroidal magnet of the FNS, a design of a helical (partially transposed) CCE made of 2G HTS is under development with forced-flow cooling by helium gas, a current of 20–30 kA, an operating temperature of 10–20 K, and a magnetic field on the winding of 12–15 T (prospectively ∼20 T). Short-sized samples of the helical flexible heavy-current CCE are being fabricated and investigated; a pilot-line unit for production of long-sized CCE pieces is under construction. The applied fabrication technique allows the CCE to be produced which combines a high operating current, thermal and mechanical stability, manufacturability, and low losses in the alternating modes. The possibility of fabricating the CCE with the outer dimensions and values of the operating parameter required for the FNS (and with a significant margin) using already available serial 2G HTS tapes is substantiated. The maximum field of toroidal magnets with CCEs made of 2G HTS will be limited only by mechanical properties of the magnet’s casing and structure, while the thermal stability will be approximately two orders of magnitude higher than that of toroidal magnets with LTS-based CCEs. The helical CCE made of 2G HTS is very promising for fusion and hybrid electric power plants, and its design and technologies of production, as well as the prototype coils made of it for the FNS and other tokamaks, are worth developing now.

  3. AcEST: DK950662 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0009_E14 662 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_E14. 5' end seq ... NA. clone: TST38A01NGRL0009_E14. 5' end sequence. Acce ssion DK950662 Tissue type prothallia Developmental ... 1-like protein OS=Ostreococcus lucimarinus (strain CCE 9901) GN=Dfa1 PE=4 SV=1 Length = 638 Score = 258 bi ... Flavoprotein OS=Cyanothece (strain ATCC 51142) GN=cce _3635 PE=4 SV=1 Length = 590 Score = 249 bits (637) ...

  4. Forward-bias operation of Si detectors a way to work in high-radiation environment

    CERN Document Server

    Beattie, L J; Sloan, Terence

    2000-01-01

    Test diodes irradiated by neutrons with fluences up to 10/sup 15/ cm /sup -2/ were successfully operated as particle detectors under forward bias. The charge collection efficiency (CCE) of ~70as reached for minimum ionising particles at relatively low-bias voltages. The more usual reverse bias requires ~10 times larger voltage to give a similar CCE. A decrease in the charge trapping is observed in forward bias operation compared to that under reverse bias. The dark current under forward bias has the usual temperature dependence. This could be used to optimise the operation condition of forward-biased detectors in a real experiment. (23 refs).

  5. Coloured Conical Emission in BBO Crystal Pumped by Second Harmonic Femtosecond Pulses

    International Nuclear Information System (INIS)

    Coloured conical emission (CCE) is investigated experimentally in a β-barium borate crystal excited by intense second harmonic femtosecond pulses. Contrary sequences of green and red conical emission with variable diameters are observed at different incidence angles, which is consistent with the calculation results based on the phase matching condition. As its broad range spectrum, CCE offers an alternative means to produce an ultrafast broadband light source. It is found that the spectrum of green CE shifts toward longer wavelengths as the length of BBO crystal increased

  6. Critical Science Education in a Suburban High School Chemistry Class

    Science.gov (United States)

    Ashby, Patrick

    To improve students' scientific literacy and their general perceptions of chemistry, I enacted critical chemistry education (CCE) in two "regular level" chemistry classes with a group of 25 students in a suburban, private high school as part of this study. CCE combined the efforts of critical science educators (Fusco & Calabrese Barton, 2001; Gilbert 2013) with the performance expectations of the Next Generation Science Standards (NGSS) (NGSS Lead States, 2013a) to critically transform the traditional chemistry curriculum at this setting. Essentially, CCE engages students in the critical exploration of socially situated chemistry content knowledge and requires them to demonstrate this knowledge through the practices of science. The purpose of this study was to gauge these students development of chemistry content knowledge, chemistry interest, and critical scientific literacy (CSL) as they engaged in CCE. CSL was a construct developed for this study that necessarily combined the National Research Center's (2012) definition of scientific literacy with a critical component. As such, CSL entailed demonstrating content knowledge through the practices of science as well as the ability to critically analyze the intersections between science content and socially relevant issues. A mixed methods, critical ethnographic approach framed the collection of data from open-ended questionnaires, focus group interviews, Likert surveys, pre- and post unit tests, and student artifacts. These data revealed three main findings: (1) students began to develop CSL in specific, significant ways working through the activities of CCE, (2) student participants of CCE developed a comparable level of chemistry content understanding to students who participated in a traditional chemistry curriculum, and (3) CCE developed a group of students' perceptions of interest in chemistry. In addition to being able to teach students discipline specific content knowledge, the implications of this study are

  7. Charge collection efficiency of irradiated silicon detectors operated at cryogenic temperatures

    CERN Document Server

    Borer, K; Palmieri, V G; Dezillie, B; Li, Z; Collins, P; Niinikoski, T O; Lourenço, C; Sonderegger, P; Borchi, E; Bruzzi, Mara; Pirollo, S; Granata, V; Pagano, S; Chapuy, S; Dimcovski, Zlatomir; Grigoriev, E; Bell, W; Devine, S R H; O'Shea, V; Smith, K; Berglund, P; de Boer, Wim; Hauler, F; Heising, S; Jungermann, L; Casagrande, L; Cindro, V; Mikuz, M; Zavrtanik, M; Da Vià, C; Esposito, A P; Konorov, I; Paul, S; Schmitt, L; Buontempo, S; D'Ambrosio, N; Ruggiero, G; Eremin, V V; Verbitskaya, E

    2000-01-01

    The charge collection efficiency (CCE) of heavily irradiated silicon diode detectors was investigated at temperatures between 77 and 200 K. The CCE was found to depend on the radiation dose, bias voltage value and history, temperature, and bias current generated by light. The detector irradiated to the highest fluence 2·1015 n/cm2 yields a MIP signal of at least 15000 e- both at 250 V forward bias voltage, and at 250 V reverse bias voltage in the presence of a light-generated current. The "Lazarus effect" was thus shown to extend to fluences at least ten times higher than was previously studied.

  8. Coloured Conical Emission in BBO Crystal Pumped by Second Harmonic Femtosecond Pulses

    Institute of Scientific and Technical Information of China (English)

    BI Jie; LI Yu-Hua; YIN Juan-Juan; LU Pei-Xiang

    2009-01-01

    Coloured conical emission (CCE) is investigated experimentally in a β-barium borate crystal excited by intense second harmonic femtosecond pulses. Contrary sequences of green and red conical emission with variable di-ameters are observed at different incidence angles, which is consistent with the calculation results based on the phase matching condition. As its broad range spectrum, CCE offers an alternative means to produce an ultrafast broadband light source. It is found that the spectrum of green CE shifts toward longer wavelengths as the length of BBO crystal increased.

  9. Associations between the clinical signs of chronic endometritis with ovarian cysts and body condition loss in German Holstein Friesian cows

    OpenAIRE

    Tsousis, Georgios; Sharifi, Reza; Hoedemaker, Martina

    2009-01-01

    The objective of this retrospective field study was to associate the type and smell of discharge, the size of the uterus, the ovarian and treatment status, and the time to diagnosis of animals with chronic clinical endometritis (CCE) with the incidence of ovarian cysts and with a marked loss in body condition in German Holstein Friesian cows. Two hundred and sixty-four cows diagnosed with CCE from day 14 to day 42 postpartum participated in this study. In addition, 100 days milk production an...

  10. A Refined Multiscale Self-Entropy Approach for the Assessment of Cardiac Control Complexity: Application to Long QT Syndrome Type 1 Patients

    OpenAIRE

    Vlasta Bari; Giulia Girardengo; Andrea Marchi; Beatrice De Maria; Paul A Brink; Lia Crotti; Schwartz, Peter J.; Alberto Porta

    2015-01-01

    The study proposes the contemporaneous assessment of conditional entropy (CE) and self-entropy (sE), being the two terms of the Shannon entropy (ShE) decomposition, as a function of the time scale via refined multiscale CE (RMSCE) and sE (RMSsE) with the aim at gaining insight into cardiac control in long QT syndrome type 1 (LQT1) patients featuring the KCNQ1-A341V mutation. CE was estimated via the corrected CE (CCE) and sE as the difference between the ShE and CCE. RMSCE and RMSsE were comp...

  11. Evaluating and quantifying the liming potential of phosphate rocks

    International Nuclear Information System (INIS)

    The liming potential of phosphate rock was evaluated with theoretical calculations and quantified by laboratory titration and soil incubation. Three anions present in the carbonate apatite structure of phosphate rock that can consume protons and cause an increase in pH when dissolved from apatite are PO43-, CO32-, and F-. The pKa for HF is so low that F- has very little effect on increasing pH. The pKa for 2 protons on H2PO4- and H2CO3 are sufficiently high enough to cause an increase in pH with PO43- and CO32- released into solution if the pH range is between 4 and 6. Because of the greater molar quantity of PO43- compared toCO32-, PO43- exerts a greater affect on the liming potential of P rock. For a variety of phosphate rocks with a axes ranging from 9.322 to 9.374 A in the carbonate apatite structure, the theoretical % calcium carbonate equivalence (CCE) ranges from 59.5 to 62%. With the presence of gangue carbonate minerals from 2.5 to 10% on a weight basis in the phosphate rocks, the theoretical %CCE ranges from 59.5 to 63.1%. Use of AOAC method 955.01 for quantifying the %CCE of North Carolina phosphate rock (NCPR) and Idaho phosphate rock (IDPR) resulted in %CCE ranging from 39.9 to 53.7% which were less than the theoretical values. The lower values measured in the AOAC method was presumed to be due to formation of CaHPO4 or CaHPO4·2H2O precipitates which would result in less than 2 protons neutralized per mole of PO43- released from carbonate apatite. The highly concentrated solution formed in the method was considered not indicative of a soil solution and thus determined %CCE values would be suspect. A soil incubation study was conducted to determine a more appropriate %CCE value in a soil environment using Copper Basin, Tennessee soil with a soil pH of 4.2. Agricultural limestone, NCPR, IDPR, and a granulated IDPR were added to 100 g of soil at rates of 0.1, 0.3, 1, 3, and 10 g/kg soil, incubated for 105 days at field moisture capacity, and analyzed for

  12. Calculation and Mapping of Critical Thresholds in Europe: Status Report 1997

    NARCIS (Netherlands)

    Posch M; Hettelingh J-P; Smet PAM de; Downing RJ; MNV

    1997-01-01

    The fourth report on the Coordination Center for Effects (CCE) describes critical threshold methodologies and results which are used for the scientific support of the second nitrogen oxide protocol under the Convention on Long Range Transboundary Air Pollution of the UN-Economic Commission for Europ

  13. Protein (Viridiplantae): 145350462 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available DETRGFGARARARVAVAKTRAREGATRGGTRGDGTRREATRDDDDARTRDAGGADSVKGARGEDARDGRLPTIPRGTYASLATALV...E) family transporter: multidrug efflux Ostreococcus lucimarinus CCE9901 MLARVGVGVGARPRGGGSGTGRATRRAATATRGRANGRTR...XP_001419624.1 33090:1988 3041:64 1035538:2580 13792:2580 70447:1423 242159:3392 436017:3392 MOP(MAT...ALGFPALLNSVNEPVVSLLETVLVARVGTVFLAALAPASALFGLVEEVCFAFSVVVTTAVSSARAEFEDVDAAVPERVKQTVSMSVMA...LTVGQTFIFFYLWKIAHGRGLFSMRSVFKGAESVGAAIARLYRRLEEEHIASEFRWLVLSATARMTTYVIITSCATNLGVISAAVNKTLLDLYILLGLCAEPVFTVGNVLLPRKRRSLVEVLTYRRA

  14. Degradation of the charge collection efficiency of an n-type Fz silicon diode subjected to MeV proton irradiation

    International Nuclear Information System (INIS)

    Highlights: •Study of charge collection efficiency degradation (CCE) in Si diode due to MeV H irradiation. •CCE evaluated by micro-IBIC using 4.5 MeV Li ions to probe the damaged region. •Generation of H-donors, which perturb the electrostatic properties of the diode. -- Abstract: We present the analysis of the charge collection efficiency (CCE) degradation of float zone grown n-type silicon detectors irradiated with 1.3, 2.0 and 3.0 MeV protons. The analysis was carried out by irradiating small regions (50 × 50 μm2) with a proton microbeam at fluences ranging from 1011 to 4·1012 ions/cm2 and probing the effect of irradiation by measuring the 4.5 MeV Li ion induced charge in full depletion conditions. The CCE degradation as function of the proton fluence shows an unexpected deviation from the linear behavior predicted by the Shockley–Read–Hall model of carrier recombination. The build-up of excess hydrogen related donors due to proton irradiations is suggested to be the cause of a significant perturbation of the electrostatic properties of the diode, which drastically change the electron trajectories and hence the induced charge mechanism

  15. Protein (Viridiplantae): 145354966 [

    Lifescience Database Archive (English)

    Full Text Available XP_001421745.1 33090:22288 3041:7101 1035538:6016 13792:6016 70447:4003 242159:4545 436017:4545 ... psbQ , PSII-Q , OEE3, photosystem II polypeptide, oxygen ... 3 Ostreococcus lucimarinus CCE9901 MSVAASTSAFTGKAIAQ KITTSKSVKANTVVKASANKAVSLAAVTAVVLSATPAAFAATGIELTDKRV ... ENQ TGLQ LIYEARDLELDQ KPRSDGPSRFSFQ KLSQ KETAARATESVTRINKDV ... GEYVGKKYWTQ ASNELRRQ VGTLRFDINNLVEIKGADAAQ AKAFYKKLENLDFSIRQ KDQ EA ...

  16. Protein (Viridiplantae): 145343460 [

    Lifescience Database Archive (English)

    Full Text Available XP_001416341.1 33090:7207 3041:702 1035538:1284 13792:1284 70447:246 242159:640 436017:640 Lipop ... rotein Q -related gene Ostreococcus lucimarinus CCE9901 MARM ... MVEAMVVVAIGSRWIGVDAQ VLCAPNNATICTTGAFTGQ HNRDSSSGCNMCSTIKHCLAHDATGASCGTVT ... IGGVTYAIPPISSWDVSNVVSFKGVFADSEYATDQ SFGNIPYRTNQ FNANLGGWTINTASNVQ VTMWDMFRGASSFTGAGIGAWNV ... TKVTDCEGMFDNARSFNEDISSWNTNAINWFTDMFKNAVNFDQ DITGWPHGGTNNVNDMFEGATKWLEKYRRNDWTTLKAGPASAWTGPSPFTS ...

  17. Degradation of the charge collection efficiency of an n-type Fz silicon diode subjected to MeV proton irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Barbero, Nicolò; Forneris, Jacopo [Physics Department, NIS Research Centre and CNISM, University of Torino, Via P. Giuria 1, 10250 Torino (Italy); Grilj, Veljko; Jakšić, Milko [Department for Experimental Physics, Ruđer Bošković Institute, P.O. Box 180, 10002 Zagreb (Croatia); Räisänen, Jyrki [Department of Physics, University of Helsinki, P.O. Box 43, 00014 Helsinki (Finland); Simon, Aliz [International Atomic Energy Agency, Vienna International Centre, P.O. Box 100, 1400 Vienna (Austria); Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Skukan, Natko [Department for Experimental Physics, Ruđer Bošković Institute, P.O. Box 180, 10002 Zagreb (Croatia); Vittone, Ettore, E-mail: ettore.vittone@unito.it [Physics Department, NIS Research Centre and CNISM, University of Torino, Via P. Giuria 1, 10250 Torino (Italy)

    2015-04-01

    Highlights: •Study of charge collection efficiency degradation (CCE) in Si diode due to MeV H irradiation. •CCE evaluated by micro-IBIC using 4.5 MeV Li ions to probe the damaged region. •Generation of H-donors, which perturb the electrostatic properties of the diode. -- Abstract: We present the analysis of the charge collection efficiency (CCE) degradation of float zone grown n-type silicon detectors irradiated with 1.3, 2.0 and 3.0 MeV protons. The analysis was carried out by irradiating small regions (50 × 50 μm{sup 2}) with a proton microbeam at fluences ranging from 10{sup 11} to 4·10{sup 12} ions/cm{sup 2} and probing the effect of irradiation by measuring the 4.5 MeV Li ion induced charge in full depletion conditions. The CCE degradation as function of the proton fluence shows an unexpected deviation from the linear behavior predicted by the Shockley–Read–Hall model of carrier recombination. The build-up of excess hydrogen related donors due to proton irradiations is suggested to be the cause of a significant perturbation of the electrostatic properties of the diode, which drastically change the electron trajectories and hence the induced charge mechanism.

  18. Charge collection studies of proton-irradiated n- and p-type epitaxial silicon detectors

    International Nuclear Information System (INIS)

    Proton-irradiated epitaxial pad diodes of 75, 100 and 150μm thickness and different oxygen concentrations were studied as an option to withstand the extreme radiation environment in the innermost tracking region of the future Super-LHC. With a new TCT setup using red laser light, time-resolved current signals could be measured in 150μm thin diodes. Thus the charge correction method (CCM) could be used to extract the effective trapping times. Similar results compared to previously investigated materials were obtained if the standard model of trapping is assumed, which is based on a constant trapping time at each fluence and neglects detrapping and charge multiplication. Charge collection efficiency (CCE) measured with 5.8 MeV α-particles showed an increase for decreasing thickness, but no dependence on impurity concentration was seen. CCE simulations based on the effective trapping time constants determined with the CCM resulted in systematically lower values than the measurements. This is the case for the CCE of both α-particles, red and infrared laser light. To account for this, possible modifications of the trapping model including voltage- or field-dependent trapping times will be discussed. Moreover, at high fluences and voltages anomalously high CCE>1 was observed, which indicates charge multiplication effects.

  19. Gravitational wave extraction based on Cauchy-characteristic extraction and characteristic evolution

    CERN Document Server

    Babiuc, M; Hawke, I; Zlochower, Y; Babiuc, Maria; Szilagyi, Bela; Hawke, Ian; Zlochower, Yosef

    2005-01-01

    We implement a code to find the gravitational news at future null infinity by using data from a Cauchy code as boundary data for a characteristic code. This technique of Cauchy-characteristic Extraction (CCE) allows for the unambiguous extraction of gravitational waves from numerical simulations.

  20. Combination of mechanical, alkaline and enzymatic treatments to upgrade paper-grade pulp to dissolving pulp with high reactivity.

    Science.gov (United States)

    Duan, Chao; Verma, Saurabh Kumar; Li, Jianguo; Ma, Xiaojuan; Ni, Yonghao

    2016-01-01

    A modified process consisting of an initial mechanical refining (R) followed by a low-alkali (5.5% NaOH) cold caustic extraction (CCE) and finally an endoglucanase (EG) treatment (R-5.5%CCE-EG) was investigated for upgrading paper-grade pulp to dissolving pulp. Results showed that compared to the conventional process (9%CCE-EG), the modified process can decrease the alkali concentration (from 9% to 5.5%) to achieve a similar hemicelluloses removal while simultaneously enhancing the Fock reactivity (from 62.2% to 81.0%). The improved results were due to the fact that the mechanical refining resulted in favorable fiber morphological changes, including increased pore volume/size, water retention value and specific surface area. Consequently, the hemicelluloses removal was enhanced even under the subsequent low-alkali CCE condition. A synergic effect of refining, low alkali concentration and enzymatic activation was responsible for the higher reactivity of resulting dissolving pulp. PMID:26519697

  1. Dicty_cDB: FC-AF03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AF03 (Link to dictyBase) - G24025 DDB0189822 Contig-U15758-1 | Contig-U1 ... cyyyyyyy cyyy--- ---llllllllllllllllllllllfknilwcc*cce **il*g*lcw*n*w*ggcikic* wsc*wsc*ciccillrfrrfsifsllf ...

  2. A characterisation of electronic properties of alkaline texturized polycrystalline silicon solar cells using IBIC

    International Nuclear Information System (INIS)

    In this study, electronic properties of p-type alkaline texturized polycrystalline silicon solar cells were investigated using ion beam induced charge (IBIC) analysis. With this technique, quantitative information on electronic diffusion lengths and average electronic capture cross sections of lattice defects generated by high energy protons were obtained. Angular-resolved IBIC analysis was used to quantify the electronic diffusion lengths. For this purpose, the experimental data were fitted using a simulation based on the Ramo-Shockley-Gunn (RSG) theorem and the assumption of an abrupt pn-junction. In order to determine the average electronic capture cross section of proton-induced lattice defects, the loss of charge collection efficiency (CCE) was plotted vs. the accumulated ion fluence. As will be demonstrated, a simple model based on charge carrier diffusion and Shockley-Read-Hall (SRH) recombination is able to fit the CCE loss well. Furthermore, spatially and energetically highly resolved IBIC-maps of grain boundaries were recorded. A comparison with PIXE-maps shows that there is no correlation observable between CCE variations at grain boundaries and metallic impurities within the PIXE detection limits of a few ppm. On the contrary, there is an evident correlation to the morphology of the sample's surface as was observed by comparing IBIC-maps and SEM-micrographs. These local CCE fluctuations are dominated by the interplay of charge carrier diffusion processes and the sample surface morphology.

  3. A SENSOR AND A METHOD FOR DETERMINING THE DIRECTION AND THE AMPLITUDE OF A BEND

    DEFF Research Database (Denmark)

    2000-01-01

    -period fibre gratings (LPG), in which the intrinsic properties of the fibre and the bend sensitivity of LPG is utilised. In a preferred embodiment, the connection between the Core Concentricity Error (CCE) of the fibre and the LPG in the asymmetric bend behaviour results in coupling resonance between the core...

  4. A Cultivated Form of a Red Seaweed (Chondrus crispus), Suppresses β-Amyloid-Induced Paralysis in Caenorhabditis elegans.

    Science.gov (United States)

    Sangha, Jatinder Singh; Wally, Owen; Banskota, Arjun H; Stefanova, Roumiana; Hafting, Jeff T; Critchley, Alan T; Prithiviraj, Balakrishnan

    2015-10-01

    We report here the protective effects of a methanol extract from a cultivated strain of the red seaweed, Chondrus crispus, against β-amyloid-induced toxicity, in a transgenic Caenorhabditis elegans, expressing human Aβ1-42 gene. The methanol extract of C. crispus (CCE), delayed β-amyloid-induced paralysis, whereas the water extract (CCW) was not effective. The CCE treatment did not affect the transcript abundance of amy1; however, Western blot analysis revealed a significant decrease of Aβ species, as compared to untreated worms. The transcript abundance of stress response genes; sod3, hsp16.2 and skn1 increased in CCE-treated worms. Bioassay guided fractionation of the CCE yielded a fraction enriched in monogalactosyl diacylglycerols (MGDG) that significantly delayed the onset of β-amyloid-induced paralysis. Taken together, these results suggested that the cultivated strain of C. crispus, whilst providing dietary nutritional value, may also have significant protective effects against β-amyloid-induced toxicity in C. elegans, partly through reduced β-amyloid species, up-regulation of stress induced genes and reduced accumulation of reactive oxygen species (ROS). PMID:26492254

  5. Enhanced sensitivity of A549 cells to the cytotoxic action of anticancer drugs via suppression of Nrf2 by procyanidins from Cinnamomi Cortex extract

    International Nuclear Information System (INIS)

    Highlights: → We found a novel inhibitor of Nrf2 known as a chemoresistance factor. → Overexpressed Nrf2 in lung cancer cells was suppressed by Cinnamomi Cortex extract. → Cytotoxic action of anticancer drugs in cells treated with the extract was enhanced. → Procyanidin tetramers and pentamers were active components in suppressing Nrf2. -- Abstract: Nuclear factor-E2-related factor 2 (Nrf2) is an important cytoprotective transcription factor because Nrf2-regulated enzymes play a key role in antioxidant and detoxification processes. Recent studies have reported that lung cancer cells overexpressing Nrf2 exhibit increased resistance to chemotherapy. Suppression of overexpressed Nrf2 is needed for a new therapeutic approach against lung cancers. In the present study, we found that Cinnamomi Cortex extract (CCE) has an ability to suppress Nrf2-regulated enzyme activity and Nrf2 expression in human lung cancer A549 cells with high Nrf2 activity. Moreover, we demonstrated that CCE significantly enhances sensitivity of A549 cells to the cytotoxic action of doxorubicin and etoposide as well as increasing the intracellular accumulation of both drugs. These results suggest that CCE might be an effective concomitant agent to reduce anticancer drug resistance derived from Nrf2 overexpression. Bioactivity-guided fractionation revealed that procyanidin tetramers and pentamers contained in CCE were active components in suppressing Nrf2.

  6. Lateral IBIC characterization of single crystal synthetic diamond detectors

    International Nuclear Information System (INIS)

    In order to evaluate the charge collection efficiency (CCE) profile of single-crystal diamond devices based on a p-type/intrinsic/metal configuration, a lateral Ion Beam Induced Charge (IBIC) analysis was performed over their cleaved cross sections using a 2 MeV proton microbeam. CCE profiles in the depth direction were extracted from the cross-sectional maps at variable bias voltage. IBIC spectra relevant to the depletion region extending beneath the frontal Schottky electrode show a 100% CCE, with a spectral resolution of about 1.5%. The dependence of the width of the high efficiency region from applied bias voltage allows the constant residual doping concentration of the active region to be evaluated. The region where the electric field is absent shows an exponentially decreasing CCE profile, from which it is possible to estimate the diffusion length of the minority carriers by means of a drift-diffusion model. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  7. Exposures in interventional radiology using Monte Carlo simulation coupled with virtual anthropomorphic phantoms.

    Science.gov (United States)

    Santos, William S; Neves, Lucio P; Perini, Ana P; Belinato, Walmir; Caldas, Linda V E; Carvalho, Albérico B; Maia, Ana F

    2015-12-01

    In this work we investigated the way in which conversion coefficients from air kerma-area product for effective doses (CCE) and entrance skin doses (CCESD) in interventional radiology (IR) are affected by variations in the filtration, projection angle of the X-ray beam, lead curtain attached to the surgical table, and suspended shield lead glass in regular conditions of medical practice. Computer simulations were used to model an exposure scenario similar to a real IR room. The patient and the physician were represented by MASH virtual anthropomorphic phantoms, inserted in the MCNPX 2.7.0 radiation transport code. In all cases, the addition of copper filtration also increased the CCE and CCESD values. The highest CCE values were obtained for lateral, cranial and caudal projections. In these projections, the X-ray tube was located above the table, and more scattered radiation reached the middle and upper portions of the physician trunk, where most of the radiosensitive organs are located. Another important result of this study was to show that the physician's protection is 358% higher when the lead curtain and suspended shield lead glasses are used. The values of CCE and CCESD, presented in this study, are an important resource for calculation of effective doses and entrance skin doses in clinical practice. PMID:26160701

  8. Comparative study of transient current induced in SiC p+n and n+p diodes by heavy ion micro beams

    International Nuclear Information System (INIS)

    N+p and p+n diodes were fabricated on p- and n-type 6H-SiC substrates with epitaxial layers, respectively. The charge induced in the diodes by 9 MeV oxygen (O) and nickel (Ni) ions was measured using Transient Ion Beam Induced Current (TIBIC) to clarify the capability of these diodes as particle detectors. As a result of the TIBIC measurements using 9 MeV O, the Charge Collection Efficiency (CCE) of around 83% was obtained for both p+n and n+p diodes. Since the CCE value includes the consumption of incident ion energy in an Al electrode and the n+ (p+) region as well as the decay of charge in the measurement system, the CCE value obtained in this study indicates that SiC n+p as well as p+n diodes are suitable for particle detectors. On the other hand, in the case of 9 MeV Ni ion irradiation, the CCE for both n+p and p+n diodes decreases due to the Auger recombination in dense electron-hole pairs.

  9. Improving charge-collection efficiency of SOI pixel sensors for X-ray astronomy

    Science.gov (United States)

    Matsumura, Hideaki; Tsuru, Takeshi Go; Tanaka, Takaaki; Takeda, Ayaki; Arai, Yasuo; Mori, Koji; Nishioka, Yusuke; Takenaka, Ryota; Kohmura, Takayoshi; Nakashima, Shinya; Hatsui, Takaki; Kohmura, Yoshiki; Takei, Dai; Kameshima, Takashi

    2015-09-01

    We have been developing a new type of active pixel sensor, referred to as "XRPIX" for future X-ray astronomy satellites on the basis of silicon-on-insulator CMOS technology. The problem on our previous device, XRPIX1b, was degradation of the charge-collection efficiency (CCE) at pixel borders. In order to investigate the non-uniformity of the CCE within a pixel, we measured sub-pixel response with X-ray beams whose diameters are 10 μmΦ at SPring-8. We found that the X-ray detection efficiency and CCE degrade in the sensor region under the pixel circuitry placed outside the buried p-wells (BPW). A 2D simulation of the electric fields with the semiconductor device simulator HyDeLEOS shows that the isolated pixel circuitry outside the BPW makes local minimums in the electric potentials at the interface between the sensor and buried oxide layers, where a part of charge is trapped and is not collected to the BPW. Based on this result, we modified the placement of the in-pixel circuitry in the next device, XRPIX2b, for the electric fields to be converged toward the BPW, and confirmed that the CCE at pixel borders is successfully improved.

  10. Challenging the premises of international policy review

    DEFF Research Database (Denmark)

    Feinstein, Noah Weeth; Læssøe, Jeppe; Blum, Nicole;

    2013-01-01

    review symposium that addresses three such questions: (1) How coherent is the concept of ESD across national contexts and what conceptual tensions continue to surround ESD and CCE? (2) Can nation-level analyses tell us anything useful about countries where education is not centrally governed? and (3) In...

  11. Protective role of cactus cladodes extract on sodium dichromate-induced testicular injury and oxidative stress in rats.

    Science.gov (United States)

    Hfaiedh, Mbarka; Brahmi, Dalel; Zourgui, Lazhar

    2014-06-01

    Cactus (Opuntia ficus-indica) is a xerophyte plant that belongs to the Cactaceae family. The present study was designed to investigate the possible protective effects of cactus cladodes extract (CCE) on sodium dichromate-induced testis damage in adult male Wistar rats. For this purpose, CCE at a dose of 100 mg/kg was orally administrated, followed by 10 mg/kg sodium dichromate (intraperitoneal injection). After 40 days of treatment, the rats were sacrificed, and the testes were excised for histological, lipid peroxidation (LPO), and antioxidant enzyme analyses. Sodium dichromate treatment significantly (P<0.01) decreased the body, testis, and accessory sex organ weights, sperm count and motility, and serum testosterone level. In addition, histological analysis revealed pronounced morphological alterations with tubular necrosis and reduction in the number of gametes in the lumen of the seminiferous tubules of sodium dichromate-intoxicated rats. Furthermore, exposure to sodium dichromate significantly (P<0.01) increased LPO level and decreased superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx) activities in testis. Interestingly, pretreatment with CCE significantly (P<0.01) restored the serum testosterone level, sperm count, and motility to the levels of the control group. Moreover, CCE administration was capable of reducing the elevated level of LPO and significantly (P<0.01) increased SOD, CAT, and GPx activities in testis. Cactus cladodes supplementation minimized oxidative damage and reversed the impairment of spermatogenesis and testosterone production induced by sodium dichromate in the rat testis. PMID:24752970

  12. Dicty_cDB: Contig-U07986-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4932.b2_H10.ab1 CHU(LMS) puzzle sunflower Hel... 58 5e-04 1 ( EL474789 ) CHUL2734.b1_K11.ab1 CHU(LMS) puzz...le sunflower Hel... 58 5e-04 1 ( EL360649 ) CCEM5342.b1_L16.ab1 CCE(LMS) endive Cic

  13. Characteristics of rainfall triggering of debris flows in the Chenyulan watershed, Taiwan

    Directory of Open Access Journals (Sweden)

    J. C. Chen

    2013-04-01

    Full Text Available This paper reports the variation in rainfall characteristics associated with debris flows in the Chenyulan watershed, central Taiwan, between 1963 and 2009. The maximum hourly rainfall Im, the maximum 24 h rainfall Rd, and the rainfall index RI (defined as the product RdIm were analysed for each rainfall event that triggered a debris flow within the watershed. The corresponding number of debris flows initiated by each rainfall event (N was also investigated via image analysis and/or field investigation. The relationship between N and RI was analysed. Higher RI of a rainfall event would trigger a larger number of debris flows. This paper also discusses the effects of the Chi-Chi earthquake (CCE on this relationship and on debris flow initiation. The results showed that the critical RI for debris flow initiation had significant variations and was significantly lower in the years immediately following the CCE of 1999, but appeared to revert to the pre-earthquake condition about five years later. Under the same extreme rainfall event of RI = 365 cm2 h−1, the value of N in the CCE-affected period could be six times larger than that in the non-CCE-affected periods.

  14. Marketing Continuing Education: A Study of Price Strategies. Occasional Papers in Continuing Education, No. 11.

    Science.gov (United States)

    Lamoureux, Marvin E.

    The objective of the study conducted at the Centre for Continuing Education (CCE) at the University of British Columbia was to determine that threshold pricing not only existed for continuing education courses, but also was applicable to an administrative decision-making structure. The first part of the three-part investigation analyzed consumer…

  15. EST Table: BP117204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117204 brS-2112 10/09/28 low homology 10/08/28 55 %/197 aa FBpp0272568|Dpse\\GA22549-PA 10/08/2 ... 50 %/209 aa C02F4.2c#CE40348#WBGene00006527#locus:tax - 6#status:Partially_confirmed#UniProt:Q0G819#prote ...

  16. Education for Sustainable Development and Climate Change Education in China: A Status Report

    Science.gov (United States)

    Han, Qingqing

    2015-01-01

    Recognizing the significance of education in promoting sustainable development (SD), China has developed a number of policies and initiatives relating to education for sustainable development (ESD) and climate change education (CCE). The article first reviews China's national policies and initiatives with regard to SD, climate change, education,…

  17. Improving the Quality of Teaching and Learning through Leadership for Learning: Changing Scenarios in Basic Schools of Ghana

    Science.gov (United States)

    Malakolunthu, Suseela; McBeath, John; Swaffield, Sue

    2014-01-01

    This article emerged as a case study from a fact-finding mission of a joint programme between the Centre for Commonwealth Education (CCE) in Cambridge University and the Institute for Educational Planning and Administration (IEPA) in University of Cape Coast, Ghana, to embed innovative approaches to teaching and learning in the basic schools of…

  18. Climate Change Education in the Context of Education for Sustainable Development: Rationale and Principles

    Science.gov (United States)

    Mochizuki, Yoko; Bryan, Audrey

    2015-01-01

    Although the role of education in addressing the challenges of climate change is increasingly recognized, the education sector remains underutilized as a strategic resource to mitigate and adapt to climate change. Education stakeholders in many countries have yet to develop a coherent framework for climate change education (CCE). This article…

  19. Climate Change Education and Education for Sustainable Development in the Republic of Korea: A Status Report

    Science.gov (United States)

    Sung, Junghee

    2015-01-01

    The Republic of Korea (ROK) has officially declared its national vision of green growth, and actively develops and implements policies related to education for sustainable development (ESD), green growth education (GGE) and climate change education (CCE). Over the Decade of ESD, the ROK experienced three administrations which have taken different…

  20. Balancing the Tensions and Meeting the Conceptual Challenges of Education for Sustainable Development and Climate Change

    Science.gov (United States)

    Blum, Nicole; Nazir, Joanne; Breiting, Soren; Goh, Kim Chuan; Pedretti, Erminia

    2013-01-01

    This paper addresses one of the key challenges for work on education, sustainable development and climate change: the overall conceptualisation of central ideas such as Environmental Education (EE), Education for Sustainable Development (ESD) and Climate Change Education (CCE). What do these concepts mean in diverse contexts and amongst diverse…

  1. A Cultivated Form of a Red Seaweed (Chondrus crispus, Suppresses β-Amyloid-Induced Paralysis in Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Jatinder Singh Sangha

    2015-10-01

    Full Text Available We report here the protective effects of a methanol extract from a cultivated strain of the red seaweed, Chondrus crispus, against β-amyloid-induced toxicity, in a transgenic Caenorhabditis elegans, expressing human Aβ1-42 gene. The methanol extract of C. crispus (CCE, delayed β-amyloid-induced paralysis, whereas the water extract (CCW was not effective. The CCE treatment did not affect the transcript abundance of amy1; however, Western blot analysis revealed a significant decrease of Aβ species, as compared to untreated worms. The transcript abundance of stress response genes; sod3, hsp16.2 and skn1 increased in CCE-treated worms. Bioassay guided fractionation of the CCE yielded a fraction enriched in monogalactosyl diacylglycerols (MGDG that significantly delayed the onset of β-amyloid-induced paralysis. Taken together, these results suggested that the cultivated strain of C. crispus, whilst providing dietary nutritional value, may also have significant protective effects against β-amyloid-induced toxicity in C. elegans, partly through reduced β-amyloid species, up-regulation of stress induced genes and reduced accumulation of reactive oxygen species (ROS.

  2. EST Table: FY018575 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY018575 rbmov22l19 11/11/04 59 %/243 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, cytoplasmi ... 50 %/185 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  3. EST Table: FY015172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY015172 rbmov13f11 11/11/04 99 %/298 aa ref|NP_001040121.1| endothelial-monocyte activating pol ... 57 %/165 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  4. EST Table: DY231371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DY231371 EST02122 10/09/28 98 %/130 aa ref|NP_001040121.1| endothelial-monocyte activating polyp ... 58 %/130 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  5. EST Table: NM_001046656 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available NM_001046656 LOC692809 11/12/09 10/09/29 80 %/293 aa ref|NP_001040121.1| endothelial-monocyte ac ... 58 %/160 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  6. EST Table: FS869548 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS869548 E_FL_fner_40B05_R_0 10/09/28 88 %/238 aa ref|NP_001040121.1| endothelial-monocyte activ ... 58 %/160 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  7. EST Table: FS851222 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS851222 E_FL_fner_40B05_F_0 10/09/28 75 %/241 aa ref|NP_001040121.1| endothelial-monocyte activ ... 64 %/107 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  8. EST Table: FS853917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS853917 E_FL_fner_47L09_F_0 10/09/28 75 %/241 aa ref|NP_001040121.1| endothelial-monocyte activ ... 64 %/107 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  9. EST Table: CK522955 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK522955 rswea0_008628.y1 10/09/29 97 %/128 aa ref|NP_001040121.1| endothelial-monocyte activati ... 62 %/129 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  10. EST Table: FY011607 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY011607 rbmov3h24 11/11/04 61 %/202 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, cytoplasmic ... 55 %/150 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  11. EST Table: FS910600 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS910600 E_FL_fufe_20L12_F_0 10/09/28 78 %/287 aa ref|NP_001040121.1| endothelial-monocyte activ ... 59 %/149 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  12. EST Table: FY018488 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY018488 rbmov22h21 11/11/04 97 %/265 aa ref|NP_001040121.1| endothelial-monocyte activating pol ... 57 %/166 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  13. EST Table: FS918507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918507 E_FL_fufe_44J10_F_0 10/09/28 79 %/296 aa ref|NP_001040121.1| endothelial-monocyte activ ... 57 %/160 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  14. The Glutathione-S-Transferase, Cytochrome P450 and Carboxyl/Cholinesterase Gene Superfamilies in Predatory Mite Metaseiulus occidentalis

    Science.gov (United States)

    Hoy, Marjorie A.

    2016-01-01

    Pesticide-resistant populations of the predatory mite Metaseiulus (= Typhlodromus or Galendromus) occidentalis (Arthropoda: Chelicerata: Acari: Phytoseiidae) have been used in the biological control of pest mites such as phytophagous Tetranychus urticae. However, the pesticide resistance mechanisms in M. occidentalis remain largely unknown. In other arthropods, members of the glutathione-S-transferase (GST), cytochrome P450 (CYP) and carboxyl/cholinesterase (CCE) gene superfamilies are involved in the diverse biological pathways such as the metabolism of xenobiotics (e.g. pesticides) in addition to hormonal and chemosensory processes. In the current study, we report the identification and initial characterization of 123 genes in the GST, CYP and CCE superfamilies in the recently sequenced M. occidentalis genome. The gene count represents a reduction of 35% compared to T. urticae. The distribution of genes in the GST and CCE superfamilies in M. occidentalis differs significantly from those of insects and resembles that of T. urticae. Specifically, we report the presence of the Mu class GSTs, and the J’ and J” clade CCEs that, within the Arthropoda, appear unique to Acari. Interestingly, the majority of CCEs in the J’ and J” clades contain a catalytic triad, suggesting that they are catalytically active. They likely represent two Acari-specific CCE clades that may participate in detoxification of xenobiotics. The current study of genes in these superfamilies provides preliminary insights into the potential molecular components that may be involved in pesticide metabolism as well as hormonal/chemosensory processes in the agriculturally important M. occidentalis. PMID:27467523

  15. 77 FR 15788 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-03-16

    ... made available for use by the homeless in accordance with applicable law, subject to screening for... to the CCE Central Dispatch Authority Minnesota FAA Outer Marker 9935 Newton Ave. Minneapolis MN..., Acting Deputy Assistant Commissioner, General Services Administration, Office of Property Disposal,...

  16. Validation and Verification of the Field Programmable Gate Array Based Charge Collection Efficiency Measurement System

    International Nuclear Information System (INIS)

    Based on field programmable gate array (FPGA), we propose a QA/ QC test procedures to validate and verify the operation and the data obtained from newly developed charge collection efficiency (CCE) measurement system. The QA/ QC test procedures were able to detected by a normal test run whilst the operation of the amplifier; counter; and timer were validated and verified. (author)

  17. Enhanced sensitivity of A549 cells to the cytotoxic action of anticancer drugs via suppression of Nrf2 by procyanidins from Cinnamomi Cortex extract

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuma, Tomokazu; Matsumoto, Takashi; Itoi, Ayano; Kawana, Ayako; Nishiyama, Takahito; Ogura, Kenichiro [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan); Hiratsuka, Akira, E-mail: hiratuka@toyaku.ac.jp [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan)

    2011-10-07

    Highlights: {yields} We found a novel inhibitor of Nrf2 known as a chemoresistance factor. {yields} Overexpressed Nrf2 in lung cancer cells was suppressed by Cinnamomi Cortex extract. {yields} Cytotoxic action of anticancer drugs in cells treated with the extract was enhanced. {yields} Procyanidin tetramers and pentamers were active components in suppressing Nrf2. -- Abstract: Nuclear factor-E2-related factor 2 (Nrf2) is an important cytoprotective transcription factor because Nrf2-regulated enzymes play a key role in antioxidant and detoxification processes. Recent studies have reported that lung cancer cells overexpressing Nrf2 exhibit increased resistance to chemotherapy. Suppression of overexpressed Nrf2 is needed for a new therapeutic approach against lung cancers. In the present study, we found that Cinnamomi Cortex extract (CCE) has an ability to suppress Nrf2-regulated enzyme activity and Nrf2 expression in human lung cancer A549 cells with high Nrf2 activity. Moreover, we demonstrated that CCE significantly enhances sensitivity of A549 cells to the cytotoxic action of doxorubicin and etoposide as well as increasing the intracellular accumulation of both drugs. These results suggest that CCE might be an effective concomitant agent to reduce anticancer drug resistance derived from Nrf2 overexpression. Bioactivity-guided fractionation revealed that procyanidin tetramers and pentamers contained in CCE were active components in suppressing Nrf2.

  18. Nuove applicazioni della geometria descrittiva: le PQ mesh nell’architettura contemporanea

    Directory of Open Access Journals (Sweden)

    Leonardo Baglioni

    2012-06-01

    Full Text Available I modellatori informatici oggi a disposizione di tutti i progettisti, hanno portato ad un profondo cambiamento dell’intero processo del fare architettura. Tra i nuovi temi delle applicazioni di Geometria descrittiva, va sicuramente annoverato il passaggio della approssimazione delle superfici continue in superfici discrete. Ogni superficie continua può essere discretizzata in una superficie poliedrica composta da facce piane. L’attenzione dei progettisti si sta dirigendo verso le superfici piane quadrilatere (PQ mesh, che permettono la generazione di mesh parallele. Lo studio delle PQ mesh applicate all’architettura sembra essere una naturale evoluzione del grande tema dei poliedri, argomento ampiamente radicato nella storia della matematica e che trova nel computer una linfa vitale che alimenta, oggi più che mai, l’intera area della Geometria descrittiva.

  19. Nutrient uplift in a cyclonic eddy increases diversity, primary productivity and iron demand of microbial communities relative to a western boundary current.

    Science.gov (United States)

    Doblin, Martina A; Petrou, Katherina; Sinutok, Sutinee; Seymour, Justin R; Messer, Lauren F; Brown, Mark V; Norman, Louiza; Everett, Jason D; McInnes, Allison S; Ralph, Peter J; Thompson, Peter A; Hassler, Christel S

    2016-01-01

    The intensification of western boundary currents in the global ocean will potentially influence meso-scale eddy generation, and redistribute microbes and their associated ecological and biogeochemical functions. To understand eddy-induced changes in microbial community composition as well as how they control growth, we targeted the East Australian Current (EAC) region to sample microbes in a cyclonic (cold-core) eddy (CCE) and the adjacent EAC. Phototrophic and diazotrophic microbes were more diverse (2-10 times greater Shannon index) in the CCE relative to the EAC, and the cell size distribution in the CCE was dominated (67%) by larger micro-plankton [Formula: see text], as opposed to pico- and nano-sized cells in the EAC. Nutrient addition experiments determined that nitrogen was the principal nutrient limiting growth in the EAC, while iron was a secondary limiting nutrient in the CCE. Among the diazotrophic community, heterotrophic NifH gene sequences dominated in the EAC and were attributable to members of the gamma-, beta-, and delta-proteobacteria, while the CCE contained both phototrophic and heterotrophic diazotrophs, including Trichodesmium, UCYN-A and gamma-proteobacteria. Daily sampling of incubation bottles following nutrient amendment captured a cascade of effects at the cellular, population and community level, indicating taxon-specific differences in the speed of response of microbes to nutrient supply. Nitrogen addition to the CCE community increased picoeukaryote chlorophyll a quotas within 24 h, suggesting that nutrient uplift by eddies causes a 'greening' effect as well as an increase in phytoplankton biomass. After three days in both the EAC and CCE, diatoms increased in abundance with macronutrient (N, P, Si) and iron amendment, whereas haptophytes and phototrophic dinoflagellates declined. Our results indicate that cyclonic eddies increase delivery of nitrogen to the upper ocean to potentially mitigate the negative consequences of increased

  20. Chemopreventive effect of cactus Opuntia ficus indica on oxidative stress and genotoxicity of aflatoxin B1

    Directory of Open Access Journals (Sweden)

    Ben Mansour Hédi

    2011-10-01

    Full Text Available Abstract Background Aflatoxin B1 (AFB1 is potent hepatotoxic and hepatocarcinogenic agent. In aflatoxicosis, oxidative stress is a common mechanism contributing to initiation and progression of hepatic damage. The aim of this work was to evaluate the hepatoprotective effect of cactus cladode extract (CCE on aflatoxin B1-induced liver damage in mice by measuring malondialdehyde (MDA level, the protein carbonyls generation and the heat shock proteins Hsp 70 and Hsp 27 expressions in liver. We also looked for an eventual protective effect against AFB1-induced genotoxicity as determined by chromosome aberrations test, SOS Chromotest and DNA fragmentation assay. We further evaluated the modulation of p53, bax and bcl2 protein expressions in liver. Methods Adult, healthy balbC (20-25 g male mice were pre-treated by intraperitonial administration of CCE (50 mg/Kg.b.w for 2 weeks. Control animals were treated 3 days a week for 4 weeks by intraperitonial administration of 250 μg/Kg.b.w AFB1. Animals treated by AFB1 and CCE were divided into two groups: the first group was administrated CCE 2 hours before each treatment with AFB1 3 days a week for 4 weeks. The second group was administrated without pre-treatment with CCE but this extract was administrated 24 hours after each treatment with AFB1 3 days a week for 4 weeks. Results Our results clearly showed that AFB1 induced significant alterations in oxidative stress markers. In addition, it has a genotoxic potential and it increased the expression of pro apoptotic proteins p53 and bax and decreased the expression of bcl2. The treatment of CCE before or after treatment with AFB1, showed (i a total reduction of AFB1 induced oxidative damage markers, (ii an anti-genotoxic effect resulting in an efficient prevention of chromosomal aberrations and DNA fragmentation compared to the group treated with AFB1 alone (iii restriction of the effect of AFB1 by differential modulation of the expression of p53 which

  1. Micro-tidal Disruption Events by Stellar Compact Objects and the Production of Ultra-long GRBs

    Science.gov (United States)

    Perets, Hagai B.; Li, Zhuo; Lombardi, James C., Jr.; Milcarek, Stephen R., Jr.

    2016-06-01

    We explore full/partial tidal disruption events (TDEs) of stars/planets by stellar compact objects (black holes (BHs) or neutron stars (NSs)), which we term micro-TDEs. Disruption of a star/planet with mass M ⋆ may lead to the formation of a debris disk around the BH/NS. Efficient accretion of a fraction ({f}{acc}=0.1 of the debris may then give rise to bright, energetic, long (103–104 s), X-ray/gamma-ray flares, with total energies of up to ({f}{acc}/0.1)× {10}52 ({M}\\star /0.6 {M}ȯ ) erg, possibly resembling ultra-long gamma-ray bursts (GRBs)/X-ray flashes (XRFs). The energy of such flares depends on the poorly constrained accretion processes. Significantly fainter flares might be produced if most of the disk mass is blown away through strong outflows. We suggest three dynamical origins for such disruptions. In the first, a star/planet is tidally disrupted following a close random encounter with a BH/NS in a dense cluster. We estimate the BH (NS) micro-TDE rates from this scenario to be a few × {10}-6 (a few × {10}-7) {{{yr}}}-1 per Milky Way galaxy. Another scenario involves the interaction of wide companions due to perturbations by stars in the field, likely producing comparable but lower rates. Finally, a third scenario involves a BH/NS that gains a natal velocity kick at birth, leading to a close encounter with a binary companion and the tidal disruption of that companion. Such events could be associated with a supernova, or even with a preceding GRB/XRF event, and would likely occur hours to days after the prompt explosion; the rates of such events could be larger than those obtained from the other scenarios, depending on the preceding complex binary stellar evolution.

  2. Modelling the Central Constant Emission X-ray component of η Carinae

    Science.gov (United States)

    Russell, Christopher M. P.; Corcoran, Michael F.; Hamaguchi, Kenji; Madura, Thomas I.; Owocki, Stanley P.; Hillier, D. John

    2016-05-01

    The X-ray emission of η Carinae shows multiple features at various spatial and temporal scales. The central constant emission (CCE) component is centred on the binary and arises from spatial scales much smaller than the bipolar Homunculus nebula, but likely larger than the central wind-wind collision region between the stars as it does not vary over the ˜2-3 month X-ray minimum when it can be observed. Using large-scale 3D smoothed particle hydrodynamics (SPH) simulations, we model both the colliding-wind region between the stars, and the region where the secondary wind collides with primary wind ejected from the previous periastron passage. The simulations extend out to one hundred semimajor axes and make two limiting assumptions (strong coupling and no coupling) about the influence of the primary radiation field on the secondary wind. We perform 3D radiative transfer calculations on the SPH output to synthesize the X-ray emission, with the aim of reproducing the CCE spectrum. For the preferred primary mass-loss rate dot{M}_A≈ 8.5× 10^{-4} M_{⊙} yr-1, the model spectra well reproduce the observation as the strong- and no-coupling spectra bound the CCE observation for longitude of periastron ω ≈ 252°, and bound/converge on the observation for ω ≈ 90°. This suggests that η Carinae has moderate coupling between the primary radiation and secondary wind, that both the region between the stars and the comoving collision on the backside of the secondary generate the CCE, and that the CCE cannot place constraints on the binary's line of sight. We also discuss comparisons with common X-ray fitting parameters.

  3. Low-Density Lipoprotein Apheresis Ameliorates Renal Prognosis of Cholesterol Crystal Embolism.

    Science.gov (United States)

    Ishiyama, Katsuya; Sato, Toshinobu; Taguma, Yoshio

    2015-08-01

    Drugs such as corticosteroids and statins have been used to treat cholesterol crystal embolism (CCE), but the prognosis remains poor. This study evaluated the efficacy of low-density lipoprotein apheresis (LDL-A) in patients with CCE. Patients with CCE who showed renal deterioration after vascular interventions were studied retrospectively. Information on demographic variables, clinical measurements, and medication use was collected. The outcomes were incidence of maintenance dialysis and mortality at 24 weeks. A total of 49 patients with CCE were included, among whom 37 (76%) were diagnosed pathologically and the remainder were diagnosed clinically. The median estimated GFR at baseline and at diagnosis were 40.5 and 13.4 mL/min per 1.73 m(2) , respectively. Corticosteroids were used in 42 patients (86%), statins in 30 patients (61%), and angiotensin-converting enzyme inhibitors and angiotensin receptor blockers in 29 patients (59%). LDL-A was performed in 25 patients (LDL-A group), and not in 24 patients (control group). Smoking (100% vs. 72%, P = 0.02), white blood cell count (8900/mm(3) vs. 7000/mm(3) ) and corticosteroid use (96% vs. 75%) were higher in the LDL-A group compared with the control group, but there were no differences in other demographic and clinical parameters between the groups. Patients in the LDL-A group had a lower incidence of maintenance dialysis (2/25 (8%) vs. 8/24 (33%), P CCE patients after vascular interventions. PMID:26386224

  4. New insights into phosphorus management in agriculture--A crop rotation approach.

    Science.gov (United States)

    Łukowiak, Remigiusz; Grzebisz, Witold; Sassenrath, Gretchen F

    2016-01-15

    This manuscript presents research results examining phosphorus (P) management in a soil–plant system for three variables: i) internal resources of soil available phosphorus, ii) cropping sequence, and iii) external input of phosphorus (manure, fertilizers). The research was conducted in long-term cropping sequences with oilseed rape (10 rotations) and maize (six rotations) over three consecutive growing seasons (2004/2005, 2005/2006, and 2006/2007) in a production farm on soils originated from Albic Luvisols in Poland. The soil available phosphorus pool, measured as calcium chloride extractable P (CCE-P), constituted 28% to 67% of the total phosphorus input (PTI) to the soil–plant system in the spring. Oilseed rape and maize dominant cropping sequences showed a significant potential to utilize the CCE-P pool within the soil profile. Cropping sequences containing oilseed rape significantly affected the CCE-P pool, and in turn contributed to the P(TI). The P(TI) uptake use efficiency was 50% on average. Therefore, the CCE-P pool should be taken into account as an important component of a sound and reliable phosphorus balance. The instability of the yield prediction, based on the P(TI), was mainly due to an imbalanced management of both farmyard manure and phosphorus fertilizer. Oilseed rape plants provide a significant positive impact on the CCE-P pool after harvest, improving the productive stability of the entire cropping sequence. This phenomenon was documented by the P(TI) increase during wheat cultivation following oilseed rape. The Unit Phosphorus Uptake index also showed a higher stability in oilseed rape cropping systems compared to rotations based on maize. Cropping sequences are a primary factor impacting phosphorus management. Judicious implementation of crop rotations can improve soil P resources, efficiency of crop P use, and crop yield and yield stability. Use of cropping sequences can reduce the need for external P sources such as farmyard manure

  5. The effect of charge collection recovery in silicon p-n junction detectors irradiated by different particles

    International Nuclear Information System (INIS)

    The recovery of the charge collection efficiency (CCE) at low temperatures, the so-called 'Lazarus effect', was studied in Si detectors irradiated by fast reactor neutrons, by protons of medium and high energy, by pions and by gamma-rays. The experimental results show that the Lazarus effect is observed: (a) after all types of irradiation; (b) before and after space charge sign inversion; (c) only in detectors that are biased at voltages resulting in partial depletion at room temperature. The experimental temperature dependence of the CCE for proton-irradiated detectors shows non-monotonic behaviour with a maximum at a temperature defined as the CCE recovery temperature. The model of the effect for proton-irradiated detectors agrees well with that developed earlier for detectors irradiated by neutrons. The same midgap acceptor-type and donor-type levels are responsible for the Lazarus effect in detectors irradiated by neutrons and by protons. A new, abnormal 'zigzag'-shaped temperature dependence of the CCE was observed for detectors irradiated by all particles (neutrons, protons and pions) and by an ultra-high dose of γ-rays, when operating at low bias voltages. This effect is explained in the framework of the double-peak electric field distribution model for heavily irradiated detectors. The redistribution of the space charge region depth between the depleted regions adjacent to p+ and n+ contacts is responsible for the 'zigzag'- shaped curves. It is shown that the CCE recovery temperature increases with reverse bias in all detectors, regardless of the type of radiation

  6. The effect of charge collection recovery in silicon p-n junction detectors irradiated by different particles

    Energy Technology Data Exchange (ETDEWEB)

    Verbitskaya, E. E-mail: elena.verbitskaya@pop.ioffe.rssi.ru; Abreu, M.; Anbinderis, P.; Anbinderis, T.; D' Ambrosio, N.; Boer, W. de; Borchi, E.; Borer, K.; Bruzzi, M.; Buontempo, S.; Casagrande, L.; Chen, W.; Cindro, V.; Dezillie, B.; Dierlamm, A.; Eremin, V.; Gaubas, E.; Gorbatenko, V.; Granata, V.; Grigoriev, E.; Grohmann, S.; Hauler, F.; Heijne, E.; Heising, S.; Hempel, O.; Herzog, R.; Haerkoenen, J.; Ilyashenko, I.; Janos, S.; Jungermann, L.; Kalesinskas, V.; Kapturauskas, J.; Laiho, R.; Li, Z.; Mandic, I.; De Masi, Rita; Menichelli, D.; Mikuz, M.; Militaru, O.; Niinikoski, T.O.; O' Shea, V.; Pagano, S.; Palmieri, V.G.; Paul, S.; Perea Solano, B.; Piotrzkowski, K.; Pirollo, S.; Pretzl, K.; Rato Mendes, P.; Ruggiero, G.; Smith, K.; Sonderegger, P.; Sousa, P.; Tuominen, E.; Vaitkus, J.; Da Via, C.; Wobst, E.; Zavrtanik, M

    2003-11-21

    The recovery of the charge collection efficiency (CCE) at low temperatures, the so-called 'Lazarus effect', was studied in Si detectors irradiated by fast reactor neutrons, by protons of medium and high energy, by pions and by gamma-rays. The experimental results show that the Lazarus effect is observed: (a) after all types of irradiation; (b) before and after space charge sign inversion; (c) only in detectors that are biased at voltages resulting in partial depletion at room temperature. The experimental temperature dependence of the CCE for proton-irradiated detectors shows non-monotonic behaviour with a maximum at a temperature defined as the CCE recovery temperature. The model of the effect for proton-irradiated detectors agrees well with that developed earlier for detectors irradiated by neutrons. The same midgap acceptor-type and donor-type levels are responsible for the Lazarus effect in detectors irradiated by neutrons and by protons. A new, abnormal 'zigzag'-shaped temperature dependence of the CCE was observed for detectors irradiated by all particles (neutrons, protons and pions) and by an ultra-high dose of {gamma}-rays, when operating at low bias voltages. This effect is explained in the framework of the double-peak electric field distribution model for heavily irradiated detectors. The redistribution of the space charge region depth between the depleted regions adjacent to p{sup +} and n{sup +} contacts is responsible for the 'zigzag'- shaped curves. It is shown that the CCE recovery temperature increases with reverse bias in all detectors, regardless of the type of radiation.

  7. Avanços na abordagem do carcinoma precoce de esôfago

    Directory of Open Access Journals (Sweden)

    Vitor Arantes

    2012-12-01

    Full Text Available Nos países ocidentais, o carcinoma de células escamosas de esôfago (CCE geralmente é detectado em estágio avançado, quando as possibilidades de cura são remotas e o prognóstico reservado. Entretanto, nos anos recentes, ocorreu uma série de avanços na abordagem do CCE de esôfago, tais como a identificação dos grupos de risco para o surgimento desta neoplasia; o uso da endoscopia de alta resolução e cromoendoscopia com lugol favorecendo o diagnóstico do CCE em estágios iniciais; e o desenvolvimento de técnicas endoscópicas de ressecção tumoral endoluminal em monobloco denominada dissecção endoscópica de submucosa. Este progresso tem possibilitado a aplicação do tratamento endoscópico minimamente invasivo com potencial curativo em pacientes selecionados com CCE superficial de esôfago. O presente artigo de revisão, elaborado por um grupo multicêntrico internacional, tem como objetivo primário contribuir para o entendimento dos principais avanços recentes ocorridos no manejo do CCE precoce de esôfago. Como objetivo secundário, pretende propiciar uma revisão detalhada e minuciosa da estratégia técnica de DES desenvolvida pelos experts japoneses, de forma a colaborar para a difusão deste conceito e a incorporação destas tecnologias na Medicina Brasileira e Latino-americana.

  8. Interagency Collaboration in Support of Climate Change Education

    Science.gov (United States)

    Schoedinger, S. E.; Chambers, L. H.; Karsten, J. L.; McDougall, C.; Campbell, D.

    2011-12-01

    NASA, NOAA and NSF support climate change education (CCE) through their grant programs. As the agencies' investment in CCE has grown, coordination among the agencies has become increasingly important. Although the political landscape and budgets continue to change, the agencies are committed to continued coordination and collaboration. To date, this has taken the form of jointly hosted principal investigator (PI) meetings, the largest of which was held last February (see Eos Vol. 92, No. 24, 14 June 2011). The joint goals are: (1) increased collaboration among grantees and across programs; (2) building capacity among grantees in areas of mutual interest; (3) identification of gaps in investments to date; and (4) identification of opportunities for coordination of evaluation efforts. NOAA's primary funding opportunity for CCE projects is its Environmental Literacy Grant (ELG) Program. Although not exclusively focused on climate, there has been increased emphasis on this area since 2009. Through ELG, NOAA encourages the use of NOAA assets (data, facilities, educational resources, and people) in grantees' work. Thirty awards with a primary focus on CCE have been awarded to institutions of higher education, informal science education, and non-profit organizations involved in K-12 and informal/non-formal education. We anticipate this funding opportunity will continue to support the improvement of climate literacy among various audiences of learners in the future. NASA supported efforts in CCE in an ad hoc way for years. It became a focus area in 2008 with the launch of the NASA Global Climate Change Education (GCCE) Project. This project funded 57 awards in 2008-2010, the vast majority of them in teacher professional development, or use of data, models, or simulations. Beginning in FY11, NASA moved the project into the Minority University Research and Education Program. Fourteen awards were made to minority higher education institutions, non-profit organizations, and

  9. Performance degradation of Si pin photodiodes, used as particle detectors, under 2 MeV proton irradiation

    International Nuclear Information System (INIS)

    Complete text of publication follows. Nowadays high quality Si pin photodiodes are cheap and reliable alternatives to nuclear semiconductor detectors for a wide range of application, especially for charged particle detection. Normal silicon with low oxygen content, however, is known as having low radiation tolerance. Therefore, the performance degradation of Hamamatsu S-5821 diodes has been investigated as a function of fluence for a series of ions. Selected areas of a photodiode were irradiated with various fluences of 2 MeV protons in the range of 1 x 109 - 5 x 1011 ion/cm2 without applying any bias. In order to investigate the impact of the irradiation on the particle detection response of the diode the radiation induced changes were measured with IBIC mapping using also 2 MeV protons in a wide range of reverse bias, from 0 to 100 V in logarithmic steps. The major influence of the irradiation is the decrease of the charge collection efficiency (CCE), i.e. the shift of the spectral peak position towards lower energies, and the increase of the dispersion of CCE, i.e. the widening of the spectral peaks, in other words the increase of the FWHM values, Δ. Since within the irradiated regions these quantities show strong position dependence due to boundary effect, the evaluation of the experimental data was restricted to the central homogenous parts. Quantitative empirical relationships above 10 V bias for the radiation induced contributions to the CCE and FWHM have been deduced as follows [1]: δ(CCE)rad = (-3.3 ± 0.5) x 10-13 Φ[cm-2]/U[V] Δrad[keV ] = (4 ± 1.5) x 10-5 √Φ[cm-2]/U[V] These contributions add linearly to irradiation free CCE, and quadratically to FWHM values, respectively. Since the effect of the irradiation - both on CCE and FWHM - is inversely proportional to the applied bias voltage, it can be significantly reduced by applying the possible highest bias without breakdown or increase of electrical noises due to increased leakage current. In this

  10. Evidence for plasma effect on charge collection efficiency in proton irradiated GaAs detectors

    CERN Document Server

    Nava, F; Canali, C; Vittone, E; Polesello, P; Biggeri, U; Leroy, C

    1999-01-01

    The radiation damage in 100 mu m thick Schottky diodes made on semi-insulating undoped GaAs materials, were studied using alpha-, beta-, proton- and gamma-spectroscopy as well as I-V measurements. The results have been analysed within the framework of the Hecht model to investigate the influence of the plasma produced by short-range strongly ionising particles on the detector performance after 24 GeV proton irradiation. It has been found that with the mean free drift lengths for electrons and holes determined from alpha-spectra in overdepleted detectors, the charge collection efficiency for beta-particles, cce subbeta, is well predicted in the unirradiated detectors, while in the most irradiated ones, the cce subbeta is underestimated by more than 40%. The observed disagreement can be explained by assuming that the charge carrier recombination in the plasma region of such detectors, becomes significant.

  11. IBIC characterization of an ion-beam-micromachined multi-electrode diamond detector

    CERN Document Server

    Forneris, J; Jaksic, M; Giudice, A Lo; Olivero, P; Picollo, F; Skukan, N; Verona, C; Verona-Rinati, G; Vittone, E

    2016-01-01

    Deep Ion Beam Lithography (DIBL) has been used for the direct writing of buried graphitic regions in monocrystalline diamond with micrometric resolution. Aiming at the development and the characterization of a fully ion-beam-micromachined solid state ionization chamber, a device with interdigitated electrodes was fabricated by using a 1.8 MeV He+ ion microbeam scanning on a homoepitaxial, grown by chemical vapour deposition (CVD). In order to evaluate the ionizing-radiation-detection performance of the device, charge collection efficiency (CCE) maps were extracted from Ion Beam Induced Charge (IBIC) measurements carried out by probing different arrangements of buried microelectrodes. The analysis of the CCE maps allowed for an exhaustive evaluation of the detector features, in particular the individuation of the different role played by electrons and holes in the formation of the induced charge pulses. Finally, a comparison of the performances of the detector with buried graphitic electrodes with those releva...

  12. Charge collection efficiency mapping of interdigitated 4H-SiC detectors

    CERN Document Server

    Vittone, E; Pastuovic, Z; Olivero, P; Jaksic, M

    2016-01-01

    The Ion Beam Induced Charge Collection (IBIC) technique was used to map the charge collection efficiency (CCE) of a 4H-SiC photodetector with coplanar interdigitated Schottky barrier electrodes and a common ohmic contact on the back side. IBIC maps were obtained using focused proton beams with energies of 0.9 MeV and 1.5 MeV, at different bias voltages and different sensitive electrode configurations (charge collection at the top Schottky or at the back Ohmic contact). These different experimental conditions have been modeled using a two dimensional finite element code to solve the adjoint carrier continuity equations and the results obtained have been compared with experimental results. The excellent consistency between the simulated and experimental CCE maps allows an exhaustive interpretation of the charge collection mechanisms occurring in pixellated or strip detectors.

  13. Economic Growth and Landscape Change

    Science.gov (United States)

    Prato, Tony; Fagre, Dan

    2007-01-01

    Prato and Fagre offer the first systematic, multi-disciplinary assessment of the challenges involved in managing the Crown of the Continent Ecosystem (CCE), an area of the Rocky Mountains that includes northwestern Montana, southwestern Alberta, and southeastern British Columbia. The spectacular landscapes, extensive recreational options, and broad employment opportunities of the CCE have made it one of the fastest growing regions in the United States and Canada, and have lead to a shift in its economic base from extractive resource industries to service-oriented recreation and tourism industries. In the process, however, the amenities and attributes that draw people to this “New West” are under threat. Pastoral scenes are disappearing as agricultural lands and other open spaces are converted to residential uses, biodiversity is endangered by the fragmentation of fish and wildlife habitats, and many areas are experiencing a decline in air and water quality.

  14. Tracheal relaxant effect of column chromatographic elutes of chloroform fraction of Adhatoda schimperiana leaves in guinea-pigs

    Directory of Open Access Journals (Sweden)

    Zelalem Petros

    2009-01-01

    Full Text Available Adhatoda schimperiana has been used in Ethiopian traditional medicine as a remedy for bronchial asthma. In the present study, tracheal relaxant effect of column chromatographic elutes (CCEs of the chloroform fraction of the leaves of the plant was investigated on guinea-pigs. The intermediate polar CCE of the chloroform fraction showed tracheal relaxant effect as observed by a right-ward shift of the dose-response curve. The maximum response to histamine in presence of the intermediate polar CCE was significantly lower than that of the chloroform fraction (p< 0.05. These results suggest that bioactivity-guided fractionation could show improved tracheal relaxant activity, and the alkaloid-rich fraction of the crude extract might be responsible for the claimed anti-asthmatic effect of the plant.

  15. Superior radiation tolerance of thin epitaxial silicon detectors

    CERN Document Server

    Kramberger, G; Fretwurst, E; Honniger, F; Lindström, G; Pintilie, I; Röder, R; Schramm, A; Stahl, J

    2003-01-01

    For the LHC upgrade (fluences up to 10**1**6 p/cm**2) epi-Si devices are shown to be a viable solution. No type inversion was measured up to 1.3 multiplied by 10**1**524 GeV/c protons/cm**2 and the charge collection efficiency (CCE) remained close to 100%. For reactor neutrons CCE was measured to be 60% at 8 multiplied by 10**1**5 n/cm **2. Annealing measurements have shown that only moderate cooling during beam off periods would be necessary. As a tentative explanation for the superior quality of these devices, we assume that radiation-induced donor generation leads to compensation effects of deep acceptors. In the future, we will extend the experiments to fluences up to 10**1**6 p/cm**2 and use also different variants of the epi-Si material and device geometry.

  16. Enhancing hemicelluloses removal from a softwood sulfite pulp.

    Science.gov (United States)

    Li, Jianguo; Zhang, Hongjie; Duan, Chao; Liu, Yishan; Ni, Yonghao

    2015-09-01

    Hemicelluloses removal is highly desirable in many biomass processes, including the pretreatment steps of the bioconversion for ethanol production, production of high-quality dissolving pulps. In this study, a sequential treatment consisting of pulp fractionation, followed by caustic treatment to remove hemicelluloses from a softwood sulfite pulp, was investigated. The long-fiber fraction obtained after pulp fractionation, had a lower hemicelluloses content and smaller specific surface area, but larger pore diameter than the short-fiber fraction. The fiber fractions were subsequently treated in a cold caustic extraction (CCE) or hot caustic extraction (HCE). Results showed that hemicelluloses removal in the long-fiber fraction was more pronounced than the short-fiber fraction in both CCE and HCE processes. Other parameters, such as hemicelluloses removal selectivity, yield were studied. The underlying explanations were given. PMID:26004557

  17. ENSEÑANZA COMO PUENTE ENTRE CONOCIMIENTOS CIENTÍFICOS ESCOLARES Y CONOCIMIENTOS ECOLÓGICOS TRADICIONALES

    Directory of Open Access Journals (Sweden)

    Adela Molina Andrade

    2013-12-01

    Full Text Available Se enriquece la idea de enseñanza como puente entre Conocimientos Ecológicos Tradicionales (CET y Conocimientos Científicos Escolares (CCE y se retoman otras investigaciones. Amplía la conceptualización de las perspectivas encontradas: asimilacionista (centrada en los CCE, moral y humanista (dirigida al reconocimiento del otro, plural epistémica y ontológica (enfocada en las epistemes alternas y el sujeto y contextual (orientada al sentido, la interpretación, los aspectos socioculturales, los CET. Se concluye que los puentes son de doble vía y tienen una mayor complejidad que la planteada por los profesores. Mayores conocimientos al respecto permiten deconstruir la perspectiva asimilacionista y orientar procesos de enseñanza que tengan en cuenta los demás puentes.

  18. DISSOLVING PULP PRODUCTION FROM BAMBOO

    Directory of Open Access Journals (Sweden)

    Larisse Aparecida Ribas Batalha,

    2011-12-01

    Full Text Available Commercial bamboo chips were evaluated as raw material for dissolving pulp production. The chips were auto-hydrolyzed (AH and subsequently cooked by the NaOH/AQ process and bleached to full brightness with the O-CCE-D-(EP-D-P sequence. The term CCE designates a cold caustic extraction stage. The bamboo chip chemistry (22.4% lignin, 19.5% xylans, 49.3% cellulose, 16.8% total extractives, and 1.5% ash was apparently unfavorable; however high quality dissolving pulp was produced using the aforementioned technologies, even when compared to results obtained with traditional eucalypt commercial wood chips. The pulp showed high brightness (92.4 % ISO and α-cellulose content (94.9%. Its contents of hemicelluloses, extractives and ash were within acceptable levels for a dissolving pulp aimed at viscose rayon production. Thus, the bamboo chip furnish investigated can be regarded as a viable raw material for dissolving pulp production.

  19. Carbon ceramic electrodes: preparation parameters, properties and application as electrochemical sensors

    Directory of Open Access Journals (Sweden)

    Christiana Andrade Pessoa

    2009-03-01

    Full Text Available The electrodes based on carbon ceramic (CCE preparation has been improved during last decades, increasing the potential for application of electrodes and electrochemical sensors. The interest on these materials are principally related to their features such as renewable surface, high thermal stability and mechanical strength. This review sets out some of the key aspects related to CCEs, such as the preparation parameters, which directly influence in their electrochemical properties, besides some applications such as electrochemical sensors. Among the preparation factors stand out the precursor characteristic, carbon material type, precursor proportion, catalyst and carbon material. The CCE modification with electron mediator species can broaden the application as electrochemical sensors as increasing the selectivity and sensitivity.

  20. Quantum Zeno effect in a nitrogen-vacancy center embedded in a spin bath

    CERN Document Server

    Yang, Zhi-Sheng; Zhang, Mei; Ai, Qing; Deng, Fu-Guo

    2016-01-01

    We study the longitudinal relaxation of a nitrogen-vacancy (NV) center surrounded by a $^{13}$C nuclear spin bath in diamond. By means of cluster-correlation expansion (CCE), we numerically demonstrate the decay process of electronic state induced by cross relaxation at low temperature. It is shown that the CCE method is not only capable of describing pure-dephasing effect at large-detuning regime, but it can also simulate the quantum dynamics of populations in the nearly resonant regime. We present a proposal to slow down the decay of NV center via implementing quantum Zeno effect (QZE). The numerical result shows that QZE can effectively inhibit the decay of NV center.

  1. Specific binding of 125I-rErythropoietin to Friend polycythemia virus-transformed erythroleukemia cells purified by centrifugal elutriation

    International Nuclear Information System (INIS)

    We have used countercurrent centrifugal elutriation (CCE) to determine the distribution of cells with respect to cell volume and buoyant density for an erythroleukemia cell line (JG6) transformed by the polycythemia strain of Friend virus (FV-P), and to determine the effect of inducing the cells to differentiate with dimethylsulfoxide (DMSO) on this distribution. CCE made it possible to obtain suspensions of modal JG6 populations virtually free of dead cells and uniform with respect to volume and buoyant density. These modal populations were assayed for specific binding of erythropoietin (Epo). Between 500 and 550 Epo receptors per cell were detected. These belonged to a single class having a dissociation constant of 0.36 nM. DMSO induction of differentiation of the JG6 cells had no effect on the number of Epo receptors expressed

  2. Charge collection efficiency of irradiated silicon detector operated at cryogenic temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Borer, K.; Janos, S.; Palmieri, V.G. E-mail: vittorio.palmieri@cern.ch; Dezillie, B.; Li, Z.; Collins, P.; Niinikoski, T.O. E-mail: tapio.niinikoski@cern.ch; Lourenco, C.; Sonderegger, P.; Borchi, E.; Bruzzi, M.; Pirollo, S.; Granata, V.; Pagano, S.; Chapuy, S.; Dimcovski, Z.; Grigoriev, E.; Bell, W.; Devine, S.R.H.; O' Shea, V.; Smith, K.; Berglund, P.; Boer, W. de; Hauler, F.; Heising, S.; Jungermann, L.; Casagrande, L.; Cindro, V.; Mikuz, M.; Zavartanik, M.; Via, C. da; Esposito, A.; Konorov, I.; Paul, S.; Schmitt, L.; Buontempo, S.; D' Ambrosio, N.; Ruggiero, G.; Eremin, V.; Verbitskaya, E

    2000-01-21

    The charge collection efficiency (CCE) of heavily irradiated silicon diode detectors was investigated at temperatures between 77 and 200 K. The CCE was found to depend on the radiation dose, bias voltage value and history, temperature, and bias current generated by light. The detector irradiated to the highest fluence 2x10{sup 15} n/cm{sup 2} yields a MIP signal of at least 15000 e{sup -} both at 250 V forward bias voltage, and at 250 V reverse bias voltage in the presence of a light-generated current. The 'Lazarus effect' was thus shown to extend to fluences at least ten times higher than was previously studied.

  3. Silicon detectors irradiated 'in situ' at cryogenic temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Ruggiero, G. E-mail: gennaro.ruggiero@cern.ch; Abreu, M.; Bell, W.; Berglund, P.; Boer, W. de; Borer, K.; Buontempo, S.; Casagrande, L.; Chapuy, S.; Cindro, V.; Collins, P.; D' Ambrosio, N.; Da Via, C.; Devine, S.R.H.; Dezillie, B.; Dimcovski, Z.; Eremin, V.; Esposito, A.; Granata, V.; Grigoriev, E.; Grohmann, S.; Hauler, F.; Heijne, E.; Heising, S.; Janos, S.; Jungermann, L.; Konorov, I.; Li, Z.; Lourenco, C.; Mikuz, M.; Niinikoski, T.O.; O' Shea, V.; Pagano, S.; Palmieri, V.G.; Paul, S.; Pretzl, K.; Mendes, P.Rato; Smith, K.; Sonderegger, P.; Sousa, P.; Verbitskaya, E.; Watts, S.; Zavrtanik, M

    2002-01-11

    Though several studies have proved the radiation tolerance of silicon detectors at cryogenic temperatures, following room temperature irradiation, no previous investigation has studied the behaviour of detectors irradiated 'in situ' at low temperatures. In this work, effects of irradiation of 450 GeV protons at 83 K will be presented, showing that after a dose of 1.2x10{sup 15} p cm{sup -2} a charge collection efficiency (CCE) of 55% is reached at 200 V before the annealing. The same results were found at the end of the irradiation, after the sample has spent more then one year at room temperature. This shows that the CCE recovery by low temperature operation is not affected by the temperature of irradiation and by the reverse annealing.

  4. Irradiated silicon detectors operated at cryogenic temperatures the Lazarus effect

    CERN Document Server

    Granata, V; Berglund, P; de Boer, Wim; Borchi, E; Borer, K; Bruzzi, Mara; Buontempo, S; Casagrande, L; Cindro, V; Chapuy, S; D'Ambrosio, N; Da Vià, C; Devine, S R H; Dezillie, B; Dimcovski, Zlatomir; Eremin, V V; Esposito, A P; Gambardella, U; Grigoriev, E; Heijne, Erik H M; Heising, S; Janos, S; Jungermann, L; Konorov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; O'Shea, V; Pagano, S; Palmieri, V G; Paul, S; Pirollo, S; Pretzl, Klaus P; Ruggiero, G; Sarnelli, E; Smith, K; Sonderegger, P; Valtonen, M J; Verbitskaya, E; Watts, S; Zavrtanik, M

    2000-01-01

    An increasing interest in the behaviour of silicon detectors at cryogenic temperatures has been awakened by the discovery of the so- called Lazarus effect, namely the recovery of charge collection efficiency (CCE) by means of cryogenic cooling. We measured the CCEs of three single diodes previously irradiated with different neutron fluences. The current-voltage characteristics were measured at 300 and 77 K, showing that the low-temperature operation considerably decreases the steady-state current. This is also the case when a forward voltage bias is applied, which then becomes a suitable option. At 77 K, in the case of samples irradiated with 5*10/sup 14/ neutrons cm/sup -2/ the CCE is completely recovered. A third sample irradiated with 2*10/sup 15/ neutrons cm/sup -2/ shows a 60CE at 250 V forward bias. (8 refs).

  5. Radiation hard position-sensitive cryogenic silicon detectors the Lazarus effect

    CERN Document Server

    Palmieri, V G; Bell, W H; Berglund, P; de Boer, Wim; Borchi, E; Borer, K; Bruzzi, Mara; Buontempo, S; Casagrande, L; Chapuy, S; Cindro, V; D'Ambrosio, N; Via, D; Devine, S R H; Dezillie, B; Dimcovski, Zlatomir; Eremin, V V; Esposito, A P; Granata, V; Grigoriev, E; Hauler, F; Heijne, Erik H M; Heising, S; Janos, S; Jungermann, L; Konorov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; O'Shea, V; Pagano, S; Paul, S; Pirollo, S; Pretzl, Klaus P; Rato-Mendes, P; Ruggiero, G; Smith, K; Sonderegger, P; Sousa, P; Verbitskaya, E; Watts, S; Zavrtanik, M

    2000-01-01

    The discovery of the so-called Lazarus effect, namely the recovery of the charge collection efficiency (CCE) of irradiated silicon detectors by means of cryogenic cooling has entailed an increasing interest in the behavior of silicon detectors at cryogenic temperatures. We have measured the CCE of a silicon p-i-n diode detector previously irradiated with an equivalent fluence of 1*10/sup 15/ n/cm/sup 2/ neutrons of 1 MeV energy. The charge collection efficiency has been measured at 77 K, showing that the low- temperature operation considerably decreases the bias current. This is also the case when forward voltage bias is applied, which then becomes a suitable option. In this condition, the sample shows a charge collection efficiency in excess of 65% at 250 V corresponding to a most probable signal for a minimum ionizing particle of 21000e /sup /. (6 refs).

  6. Silicon detectors irradiated "in situ" at cryogenic temperatures

    CERN Document Server

    Ruggiero, G; Bell, W; Berglund, P; de Boer, Wim; Borer, K; Buontempo, S; Casagrande, L; Chapuy, S; Cindro, V; Collins, P; D'Ambrosio, N; Da Vià, C; Devine, S R H; Dezillie, B; Dimcovski, Zlatomir; Eremin, V V; Esposito, A P; Granata, V; Grigoriev, E; Grohmann, S; Hauler, F; Heijne, Erik H M; Heising, S; Janos, S; Jungermann, L; Konorov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; O'Shea, V; Pagano, S; Palmieri, V G; Paul, S; Pretzl, Klaus P; Rato-Mendes, P; Smith, K; Sonderegger, P; Sousa, P; Verbitskaya, E; Watts, S; Zavrtanik, M

    2002-01-01

    Though several studies have proved the radiation tolerance of silicon detectors at cryogenic temperatures, following room temperature irradiation, no previous investigation has studied the behaviour of detectors irradiated "in situ" at low temperatures. In this work, effects of irradiation of 450 GeV protons at 83 K will be presented, showing that after a dose of 1.2 * 10/sup 15/ p cm/sup -2/ a charge collection efficiency (CCE) of 55% is reached at 200 V before the annealing. The same results were found at the end of the irradiation, after the sample has spent more then one year at room temperature. This shows that the CCE recovery by low temperature operation is not affected by the temperature of irradiation and by the reverse annealing. (8 refs).

  7. Reliability evaluation of wireless sensor networks using an enhanced OBDD algorithm

    Institute of Scientific and Technical Information of China (English)

    XIAO Yu-feng; CHEN Shan-zhi; LI Xin; LI Yu-hong

    2009-01-01

    An enhanced ordered binary decision diagram (EOBDD) algorithm is proposed to evaluate the reliability of wireless sensor networks (WSNs), based on the considerations of the common cause failure (CCF) and a large number of nodes in WSNs. The EOBDD algorithm analyzes the common cause event (CCE) and the network structure when CCE takes place according to the stochastic graph and the CCF model of WSNs. After constructing the ordered binary decision diagram (OBDD) of the original network with node expansion, it uses a set of OBDD variables (SOV) to guide reliability computations along this OBDD. The two steps about OBDD can decrease the cost of OBDD constructions and storage. Furthermore, the efficient OBDD structure and Hash tables can greatly decrease redundant computations of isomorphs. The experiment results show that the EOBDD can be used to evaluate the reliability of WSN efficiently.

  8. Amperometric determination of L-tyrosine by an enzymeless sensor based on a carbon ceramic electrode modified with copper oxide nanoparticles

    International Nuclear Information System (INIS)

    We report on the electrochemical formation of copper oxide nanoparticles (CuO-NPs) at a carbon ceramic electrode (CCE) as a highly-porous substrate. A copper film was deposited on the surface of the CCE and derivatized in situ to give CuO-NPs by potential cycling between -0.8 and 0.35 V in strongly alkaline solution. The electrode was characterized by scanning electron microscopy and cyclic voltammetry. The CuO-NPs exhibited excellent electrocatalytic activity toward the oxidation of L-tyrosine (L-Tyr) in responding linearly in the 2 to 1,350 μM concentration range, an associated detection limit (S/N = 3) of 160 nM, and a sensitivity of 0.61 A M-1 cm-2. (author)

  9. Characterization of semiconductor and frontier materials by nuclear microprobe technology

    International Nuclear Information System (INIS)

    The nuclear microprobe technology is used to characterize the properties of semiconductor and other frontier materials at the stages of their synthesis, modification, integration and application. On the basis of the beam current being used, the analytical nuclear microprobe techniques being used in this project can be divided into two categories: high beam current (PIXE, RBS, PEB) or low beam current (IBIC, STIM) techniques. The material properties measured are the thickness and composition of a composite surface on a SiC ceramic, the sputtering-induced surface segregation and depth profile change in a Ag-Cu binary alloy, the irradiation effects on the CCE of CVD diamond, the CCE profile at a polycrystalline CVD diamond film and a GaAs diode at different voltage biases and finally, the characterization of individual sample on an integrated material chip. (author)

  10. Electrochemical oxidation and nanomolar detection of acetaminophen at a carbon-ceramic electrode modified by carbon nanotubes: A comparison between multi walled and single walled carbon nanotubes

    International Nuclear Information System (INIS)

    Carbon-ceramic electrodes (CCE) modified with carbon nanotubes were prepared, and the electrochemical behavior towards acetaminophen (ACOP) was investigated using both a bare CCE and electrodes modified with either single walled carbon nanotubes (SWCNT) or multi walled carbon nanotubes (MWCNT) in an effort to understand which of them is the better choice in terms of electrocatalyzing the oxidation of ACOP, and thus for sensing it. The SWCNT are found to be the better material in significantly enhancing the oxidation peak current and improving the reversibility of the oxidation. Under optimal conditions, linearity between the oxidation peak current and the concentration of ACOP is obtained for the concentration range from 40 nM to 85 μM, with a detection limit of 25 nM. Finally, ACOP was successfully determined with the SWCNT modified electrode in pharmaceutical samples. (author)

  11. ATTITUDE OF TEACHERS OF BURDWAN TOWN TOWARDS CONTINUOUS COMPREHENSIVE EVALUATION AT SECONDARY LEVEL

    OpenAIRE

    Basudeb Roy Chaudhury; Shampa Mondal

    2014-01-01

    The present study compare the attitude of teachers of government aided high school in Burdwan Town towards Continuous Comprehensive Evaluation(CCE) on the basis of gender. A sample of 68 teachers who teaches in various government aided high school in Burdwan Town were selected randomly. The sample was administered an attitude scale. The result reveled that there was no significant difference between the groups of teachers towards Continuous Comprehensive Evaluation.

  12. ATTITUDE OF TEACHERS OF BURDWAN TOWN TOWARDS CONTINUOUS COMPREHENSIVE EVALUATION AT SECONDARY LEVEL

    Directory of Open Access Journals (Sweden)

    Basudeb Roy Chaudhury

    2014-04-01

    Full Text Available The present study compare the attitude of teachers of government aided high school in Burdwan Town towards Continuous Comprehensive Evaluation(CCE on the basis of gender. A sample of 68 teachers who teaches in various government aided high school in Burdwan Town were selected randomly. The sample was administered an attitude scale. The result reveled that there was no significant difference between the groups of teachers towards Continuous Comprehensive Evaluation.

  13. AN IMPACT OF CO-SCHOLASTIC DOMAIN ON SCHOLASTIC DOMAINS AMONG SENIOR SECONDARY STUDENTS

    OpenAIRE

    PRASHANT THOTE; Mathew, L.; D.P.S RATHOURE

    2013-01-01

    Central Board Of Secondary Education (CBSE) had been emphasizing education of students at secondary level, that is, grades IX and X, by developing their ten core Life Skills called self-awareness; empathy; critical thinking; creative thinking; decision making; problem solving; ef ective communication; interpersonalrelationship; coping with stress and coping with emotion along with linking it to its scheme of comprehensive and continuous evaluation (CCE) in the formative evaluation format. The...

  14. Cost overruns and cost estimation in the North Sea

    OpenAIRE

    Emhjellen, Magne; Emhjellen, Kjetil; Osmundsen, Petter

    2001-01-01

    Recently, a Norwegian government report on the cost overruns of projects in the North Sea was presented (NOU 1999:11). It concluded that there was a 25% increase in development costs from project sanction (POD, Plan for Operation and Development) to last CCE (Capital Cost Estimate) for the 11 oil field projects investigated. Many reasons like unclear project assumptions in early phase, optimistic interpolation of previous project assumptions, too optimistic estimates, and underestimation of u...

  15. Dicty_cDB: SSC874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i ATCC... 37 1.6 CP000102_1066( CP000102 |pid:none) Methanosphaera stadtmanae DSM...592 |pid:none) Ostreococcus lucimarinus CCE9901 ... 37 2.0 CP000678_411( CP000678 |pid:none) Methanobrevibac...lilql**slphssiieqplvvqfk*mvhylnsm*ksii qylmvimqpilvvlfslkrvnyistvvns*imkrllvhqfiv*iqi*tlvi*hltiipih qyqlqmvlvvvlvkfvpfkvi...wvlhlkmvtnqvvq*f*ikvvg*ilqsinhhllimvqvklvvvlq*lmvlviv vvvlvqlivl*l*liqvlliqpqqqqqqy*iiiikinqmklkkn*qqlvv*ffqiqqh** qlmivdfliivvim...vlvifgqvi***iih*lkvvivhqhsfsiq*vvwvqvhhcs*yqiq hlqmqsvv*gllflvliqlqpfnnvplvim

  16. AcEST: BP915450 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_F10 516 Adiantum capillus-veneris mRNA. clone: YMU001_000071_F10. BP915450 CL1053C ... capillus-veneris mRNA. clone: YMU001_000071_F10. Acce ssion BP915450 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5217 PE=4 SV=1 Length = 278 Score = 36.6 bits (83) ...

  17. AcEST: DK957567 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0028_L10 595 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0028_L10. 5' end seq ... NA. clone: TST39A01NGRL0028_L10. 5' end sequence. Acce ssion DK957567 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3875 PE=4 SV=1 Length = 257 Score = 84.7 bits (208 ...

  18. AcEST: DK961937 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0011_I07 634 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_I07. 5' end seq ... NA. clone: TST39A01NGRL0011_I07. 5' end sequence. Acce ssion DK961937 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0229 PE=4 SV=1 Length = 122 Score = 40.0 bits (92) ...

  19. AcEST: BP912733 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_C05 633 Adiantum capillus-veneris mRNA. clone: YMU001_000022_C05. BP912733 - Show ... capillus-veneris mRNA. clone: YMU001_000022_C05. Acce ssion BP912733 Tissue type prothallium Developmenta ... FCSIAHHLGCLAQG---LAYRLIFFNTSSTSCSWLIATSSFGAVLADLLPLCCE ... 370 VHF LGC+AQG L RL TSS + + F D P+CCE ... Sbjct: 231 ... FVRWVPSLGCVAQGGEDLTVRLWDVRTSSDGMKAIDLSLGFTMACIDYHPICCE ... 286 ...

  20. AcEST: BP920431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A04 293 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A04. BP920431 CL2921C ... capillus-veneris mRNA. clone: YMU001_000137_A04. Acce ssion BP920431 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _2211 PE=4 SV=1 Length = 234 Score = 32.7 bits (73) ...

  1. AcEST: DK960878 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0008_J15 652 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_J15. 5' end seq ... NA. clone: TST39A01NGRL0008_J15. 5' end sequence. Acce ssion DK960878 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0073 PE=4 SV=1 Length = 149 Score = 93.6 bits (231 ...

  2. AcEST: DK948104 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_G23 665 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_G23. 5' end seq ... NA. clone: TST38A01NGRL0002_G23. 5' end sequence. Acce ssion DK948104 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _2721 PE=4 SV=1 Length = 109 Score = 121 bits (303) ...

  3. AcEST: DK951065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0010_G09 487 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_G09. 5' end seq ... NA. clone: TST38A01NGRL0010_G09. 5' end sequence. Acce ssion DK951065 Tissue type prothallia Developmental ... Flavoprotein OS=Cyanothece (strain ATCC 51142) GN=cce _3635 PE=4 SV=1 Length = 590 Score = 79.0 bits (193 ...

  4. AcEST: DK954228 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_O05 575 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_O05. 5' end seq ... NA. clone: TST39A01NGRL0019_O05. 5' end sequence. Acce ssion DK954228 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0129 PE=4 SV=1 Length = 350 Score = 209 bits (533) ...

  5. AcEST: BP919442 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_B07 468 Adiantum capillus-veneris mRNA. clone: YMU001_000125_B07. BP919442 - Show ... capillus-veneris mRNA. clone: YMU001_000125_B07. Acce ssion BP919442 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5053 PE=4 SV=1 Length = 273 Score = 35.0 bits (79) ...

  6. AcEST: DK962911 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C01 661 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C01. 5' end seq ... NA. clone: TST39A01NGRL0015_C01. 5' end sequence. Acce ssion DK962911 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _4342 PE=4 SV=1 Length = 512 Score = 135 bits (341) ...

  7. AcEST: DK947579 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0016_F19 508 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_F19. 5' end seq ... NA. clone: YMU02A01NGRL0016_F19. 5' end sequence. Acce ssion DK947579 Tissue type young leaves Development ... ining protein OS=Cyanothece (strain ATCC 51142) GN=cce _2739 PE=4 SV=1 Length = 94 Score = 136 bits (343), ...

  8. AcEST: BP919225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_F06 379 Adiantum capillus-veneris mRNA. clone: YMU001_000122_F06. BP919225 CL2262C ... capillus-veneris mRNA. clone: YMU001_000122_F06. Acce ssion BP919225 Tissue type prothallium Developmenta ... Flavoprotein OS=Cyanothece (strain ATCC 51142) GN=cce _3835 PE=4 SV=1 Length = 575 Score = 80.1 bits (196 ...

  9. AcEST: BP912073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G04 498 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G04. BP912073 CL1947C ... capillus-veneris mRNA. clone: YMU001_000012_G04. Acce ssion BP912073 Tissue type prothallium Developmenta ... ining protein OS=Cyanothece (strain ATCC 51142) GN=cce _2739 PE=4 SV=1 Length = 94 Score = 139 bits (349), ...

  10. AcEST: DK955251 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_J13 617 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_J13. 5' end seq ... NA. clone: TST39A01NGRL0022_J13. 5' end sequence. Acce ssion DK955251 Tissue type prothallia with plantlet ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _4508 PE=4 SV=1 Length = 335 Score = 38.9 bits (89) ...

  11. AcEST: DK948299 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_P06 667 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_P06. 5' end seq ... NA. clone: TST38A01NGRL0002_P06. 5' end sequence. Acce ssion DK948299 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0915 PE=4 SV=1 Length = 114 Score = 71.6 bits (174 ...

  12. AcEST: DK950588 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0009_B08 592 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_B08. 5' end seq ... NA. clone: TST38A01NGRL0009_B08. 5' end sequence. Acce ssion DK950588 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3875 PE=4 SV=1 Length = 257 Score = 87.0 bits (214 ...

  13. AcEST: DK949549 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_E13 684 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_E13. 5' end seq ... NA. clone: TST38A01NGRL0006_E13. 5' end sequence. Acce ssion DK949549 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0915 PE=4 SV=1 Length = 114 Score = 71.6 bits (174 ...

  14. AcEST: BP916870 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_A05 427 Adiantum capillus-veneris mRNA. clone: YMU001_000093_A05. BP916870 CL1798C ... capillus-veneris mRNA. clone: YMU001_000093_A05. Acce ssion BP916870 Tissue type prothallium Developmenta ... YAA5 Protease OS=Cyanothece (strain ATCC 51142) GN=cce _3195 PE=4 SV=1 Length = 517 Score = 33.1 bits (74) ...

  15. AcEST: BP915556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A06 466 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A06. BP915556 CL403Co ... capillus-veneris mRNA. clone: YMU001_000073_A06. Acce ssion BP915556 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _2722 PE=4 SV=1 Length = 179 Score = 35.0 bits (79) ...

  16. AcEST: BP921577 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_F10 408 Adiantum capillus-veneris mRNA. clone: YMU001_000151_F10. BP921577 - Show ... capillus-veneris mRNA. clone: YMU001_000151_F10. Acce ssion BP921577 Tissue type prothallium Developmenta ... -like protein OS=Cyanothece (strain ATCC 51142) GN=cce _2464 PE=4 SV=1 Length = 555 Score = 34.3 bits (77) ...

  17. AcEST: DK953388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0017_K06 269 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_K06. 5' end seq ... NA. clone: TST39A01NGRL0017_K06. 5' end sequence. Acce ssion DK953388 Tissue type prothallia with plantlet ... 0%) Frame = +2 Query: 71 NRWRMIDGLFTKHVGKPHAVPRPHGICCE A 160 ++WR + LF KH+ +PRP CCE + Sbjct: 231 HKWRFDENLF ... CKHIADIIKIPRPPKQCCE S 260 ...

  18. AcEST: DK950756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0009_I13 665 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_I13. 5' end seq ... NA. clone: TST38A01NGRL0009_I13. 5' end sequence. Acce ssion DK950756 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0915 PE=4 SV=1 Length = 114 Score = 71.6 bits (174 ...

  19. AcEST: BP915857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000078_B12 469 Adiantum capillus-veneris mRNA. clone: YMU001_000078_B12. BP915857 - Show ... capillus-veneris mRNA. clone: YMU001_000078_B12. Acce ssion BP915857 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3872 PE=4 SV=1 Length = 629 Score = 35.0 bits (79) ...

  20. AcEST: BP912608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H03 451 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H03. BP912608 - Show ... capillus-veneris mRNA. clone: YMU001_000020_H03. Acce ssion BP912608 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3238 PE=4 SV=1 Length = 273 Score = 32.7 bits (73) ...

  1. AcEST: BP917922 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_D04 507 Adiantum capillus-veneris mRNA. clone: YMU001_000107_D04. BP917922 - Show ... capillus-veneris mRNA. clone: YMU001_000107_D04. Acce ssion BP917922 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5102 PE=4 SV=1 Length = 273 Score = 28.9 bits (63) ...

  2. AcEST: DK952700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0014_M24 638 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_M24. 5' end seq ... NA. clone: TST38A01NGRL0014_M24. 5' end sequence. Acce ssion DK952700 Tissue type prothallia Developmental ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3875 PE=4 SV=1 Length = 257 Score = 94.0 bits (232 ...

  3. Binary Black Hole Waveform Extraction at Null Infinity

    CERN Document Server

    Babiuc, M C; Zlochower, Y

    2011-01-01

    In this work, we present a work in progress towards an efficient and economical computational module which interfaces between Cauchy and characteristic evolution codes. Our goal is to provide a standardized waveform extraction tool for the numerical relativity community which will allow CCE to be readily applied to a generic Cauchy code. The tool provides a means of unambiguous comparison between the waveforms generated by evolution codes based upon different formulations of the Einstein equations and different numerical approximation.

  4. AcEST: BP920193 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_B07 515 Adiantum capillus-veneris mRNA. clone: YMU001_000134_B07. BP920193 CL2940C ... capillus-veneris mRNA. clone: YMU001_000134_B07. Acce ssion BP920193 Tissue type prothallium Developmenta ... ease factor 2 OS=Cyanothece (strain ATCC 51142) GN=cce _4187 PE=4 SV=1 Length = 358 Score = 239 bits (609) ...

  5. AcEST: BP919484 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_F03 338 Adiantum capillus-veneris mRNA. clone: YMU001_000125_F03. BP919484 CL2736C ... capillus-veneris mRNA. clone: YMU001_000125_F03. Acce ssion BP919484 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0870 PE=4 SV=1 Length = 421 Score = 33.1 bits (74) ...

  6. Observation and modeling of compressional Pi 3 magnetic pulsations

    Science.gov (United States)

    Matsuoka, Hitoshi; Takahashi, K.; Yumoto, K.; Anderson, B. J.; Sibeck, D. G.

    1995-01-01

    Compressional magnetic pulsations with irregular waveforms and periods longer than 150 s (here termed Pi 3) have been studied by using data from Active Magnetospheric Particle Tracer Explorers Charge Composition Explorer (AMPTE/CCE) and GOES 5 and 6 in the dayside magnetosphere and compared with signatures on the ground at low latitudes by using data from Kakioka station (L = 1.25). On the ground, the pulsations appear in the horizontal component. A study of 17 such concurrent events during a 2-month period in 1986 reveals the following pulsation characteristics. (1) The peak-to-peak amplitudes in space (delta B(sub T)) and on the ground (delta H) are comparable and are in the range of 0.5-7 nT. (2) On the ground the pulsations can be seen at all local times, even at midnight, while at geostationary orbit they are observed only on the dayside with a clear amplitude maximum at noon. (3) The pulsations on the ground lag those observed by CCE near local noon, and the lag increases as the local time separation between CCE and the ground station increases. The time lag is 1-2 min longer when the ground station is on the nightside than when it is on the dayside. (4) The time lag between pulsations observed at geostationary orbit and near noon by CCE varies systematically with local time and is about 2 min per 6 hours of local time separation. These observations indicate that some nightside pulsations in the Pi 3 band have dayside origins. The position dependence of the pulsation amplitude can be explained well by changes in the magnetopause current, which are in turn presumably caused by changes in the solar wind dynamic pressure. The time lags observed in space are consistent with signal propagation in the MHD fast mode, but the variation in space-ground time lags with ground station local time must be attributed to another mechanism.

  7. Sustaining Rocky Mountain landscapes: Science, policy and management for the Crown of the Continent ecosystem

    Science.gov (United States)

    2007-01-01

    Prato and Fagre offer the first systematic, multi-disciplinary assessment of the challenges involved in managing the Crown of the Continent Ecosystem ( CCE), an area of the Rocky Mountains that includes northwestern Montana, southwestern Alberta, and southeastern British Columbia. The spectacular landscapes, extensive recreational options, and broad employment opportunities of the CCE have made it one of the fastest growing regions in the United States and Canada, and have lead to a shift in its economic base from extractive resource industries to service-oriented recreation and tourism industries. In the process, however, the amenities and attributes that draw people to this “New West” are under threat. Pastoral scenes are disappearing as agricultural lands and other open spaces are converted to residential uses, biodiversity is endangered by the fragmentation of fish and wildlife habitats, and many areas are experiencing a decline in air and water quality. Sustaining Rocky Mountain Landscapes provides a scientific basis for communities to develop policies for managing the growth and economic transformation of the CCE without sacrificing the quality of life and environment for which the land is renowned. This forthcoming edited volume focuses on five aspects of sustaining mountain landscapes in the CCE and similar regions in the Rocky Mountains. The five aspects are: 1) how social, economic, demo graphic and environmental forces are transforming ecosystem structure and function, 2) trends in use and conditions for human and environmental resources, 3) activating science, policy and education to enhance sustainable landscape management, 4) challenges to sustainable management of public and private lands, and 5) future prospects for achieving sustainable landscapes.

  8. A Two-Stage Estimator for Heterogeneous Panel Models with Common Factors

    OpenAIRE

    Carolina Castagnetti; Eduardo Rossi; Lorenzo Trapani

    2014-01-01

    This paper considers estimation in a stationary heterogeneous panel model where common unknown factors are present. A two-stage estimator is proposed. This estimator is based on the CCE estimator (Pesaran, 2006) in the first stage and on a similar approach to the Interactive Effect estimator (Bai, 2009) in the second stage. The asymptotic properties of this estimator are provided alongside of the comparative finite-sample properties of a range of estimators by means of Monte Carlo experiments.

  9. Benzodiazepine-induced intestinal motor disturbances in rats: mediation by omega 2 (BZ2) sites on capsaicin-sensitive afferent neurones.

    OpenAIRE

    Bonnafous, C; Scatton, B; BUÉNO, L.

    1994-01-01

    1. The central and peripheral effects of the omega (benzodiazepine) site ligands, clonazepam, alpidem, zolpidem, triazolam, flumazenil, ethyl beta carboline-3-carboxylate (beta-CCE) and N-methyl beta carboline-3-carboxylate (beta-CCM) on intestinal myoelectrical activity were evaluated in conscious rats, chronically fitted with Nichrome electrodes implanted on the duodenum and jejunum. The localization of the omega (benzodiazepine) receptors involved in these effects was evaluated by use of s...

  10. Caracterização de colágenos tipos I e III no estroma do carcinoma de células escamosas cutâneo em cães

    Directory of Open Access Journals (Sweden)

    S.A.O. Bedoya

    2016-02-01

    Full Text Available O carcinoma de células escamosas (CCE é uma neoplasia epitelial maligna que acomete cães e diversas outras espécies, incluindo a humana. O CCE afeta vários sítios anatômicos e pode desenvolver metástase. O objetivo deste estudo foi a caracterização das fibras de colágenos tipos I e III no estroma do CCE cutâneo de cães. Para este trabalho, utilizaram-se 44 amostras de pele incluídas em parafina e que tiveram prévio diagnóstico de CCE. As amostras foram processadas histologicamente e coradas com hematoxilina/eosina para confirmação do diagnóstico e classificação do grau de diferenciação tumoral e com a coloração histoquímica de picrosirius para observação dos colágenos tipos I e III. O colágeno tipo III mostrou maior expressão nos CCEs cutâneos bem diferenciados. O papel do colágeno do tipo III nas neoplasias não está bem esclarecido, e outros fatores além do grau de diferenciação celular podem estar envolvidos em sua expressão e determinar sua importância na biologia tumoral.

  11. Consumer Preference for Palm Oil in Urban Togo, Africa

    OpenAIRE

    Evans, Nicole T.; Chan, Catherine; Yanagida, John; Miura, Tomoaki

    2015-01-01

    The local palm oil market of Togo has been facing competitive imports. Examining consumer preferences for domestic versus imported palm oil will aid local farmers with a more marketable product. A conjoint choice experiment (CCE) was designed to discover consumer preferences. Three-hundred surveys were conducted over two weeks in Sokodé, Togo in June 2014. Latent class analysis results showed three distinctive classes of consumers. Class 1 (69%) consumers purchase palm oil once a week and hav...

  12. Gravitational wave extraction based on Cauchy-characteristic extraction and characteristic evolution

    OpenAIRE

    Babiuc, M.; Szilagyi, B; Hawke, I.; Zlochower, Y.

    2005-01-01

    We implement a code to find the gravitational news at future null infinity by using data from a Cauchy code as boundary data for a characteristic code. This technique of Cauchy-characteristic extraction (CCE) allows for the unambiguous extraction of gravitational waves from numerical simulations. We first test the technique on non-radiative spacetimes: Minkowski spacetime, perturbations of Minkowski spacetime and static black hole spacetimes in various gauges. We show the convergence and limi...

  13. Dicty_cDB: AFI685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI685 (Link to dictyBase) - - - Contig-U13863-1 AFI685P (Link to Original ... thaliana chromosome 2... 75 2e-22 G84651( G84651 )biotin ... holocarboxylase synthetase [imported] - Ara... 75 ... rinus CCE9901... 76 7e-20 ( P50747 ) RecName: Full=Biotin --protein ligase; EC=6.3.4... 76 2e-19 BC153857_1( ...

  14. Dicty_cDB: SFJ133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFJ133 (Link to dictyBase) - - - Contig-U13863-1 SFJ133P (Link to Original ... thaliana chromosome 2... 131 3e-29 G84651( G84651 )biotin ... holocarboxylase synthetase [imported] - Ara... 129 ... inus CCE9901... 124 4e-27 ( P50747 ) RecName: Full=Biotin --protein ligase; EC=6.3.4... 122 2e-26 AK168925_1( ...

  15. Dicty_cDB: SFD294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD294 (Link to dictyBase) - - - Contig-U13863-1 SFD294E (Link to Original ... s lucimarinus CCE9901... 167 9e-40 G84651( G84651 )biotin ... holocarboxylase synthetase [imported] - Ara... 166 ... 1e-39 ( P50747 ) RecName: Full=Biotin --protein ligase; EC=6.3.4... 159 2e-37 AP005804_18 ...

  16. Dicty_cDB: SFF405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF405 (Link to dictyBase) - - - Contig-U13863-1 SFF405Z (Link to Original ... thaliana chromosome 2... 87 4e-24 G84651( G84651 )biotin ... holocarboxylase synthetase [imported] - Ara... 85 ... rinus CCE9901... 85 3e-23 ( P50747 ) RecName: Full=Biotin --protein ligase; EC=6.3.4... 68 4e-22 (Q920N2) Rec ...

  17. EST Table: FS782422 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS782422 E_FL_fcaL_40N16_R_0 11/12/09 GO hit GO:0000049(tRNA binding) 10/09/28 61 %/221 aa ref|X ... 55 %/150 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  18. EST Table: FS785669 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS785669 E_FL_fcaL_51K18_R_0 10/09/28 86 %/232 aa ref|NP_001040121.1| endothelial-monocyte activ ... 59 %/149 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  19. EST Table: FS931757 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS931757 E_FL_fwgP_32C24_F_0 10/09/28 79 %/287 aa ref|NP_001040121.1| endothelial-monocyte activ ... 59 %/149 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  20. EST Table: FS872233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS872233 E_FL_fner_47L09_R_0 11/12/09 GO hit GO:0000049(tRNA binding) 10/09/28 80 %/295 aa ref|N ... 58 %/160 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  1. EST Table: FY753701 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY753701 E_FL_famL_10J05_R_0 11/11/04 59 %/247 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, c ... 50 %/185 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  2. EST Table: FS758152 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS758152 E_FL_fcaL_07G12_F_0 10/09/28 78 %/231 aa ref|NP_001040121.1| endothelial-monocyte activ ... 63 %/110 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  3. EST Table: BY933841 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY933841 E_EL_vg4M_06J18_R_0 10/09/28 65 %/132 aa ref|XP_001602505.1| PREDICTED: similar to GA18 ... 54 %/112 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  4. EST Table: FS775247 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS775247 E_FL_fcaL_07G12_R_0 10/09/28 85 %/270 aa ref|NP_001040121.1| endothelial-monocyte activ ... 40 %/256 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  5. EST Table: FS780691 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS780691 E_FL_fcaL_35A10_R_0 10/09/28 87 %/232 aa ref|NP_001040121.1| endothelial-monocyte activ ... 59 %/149 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  6. EST Table: FS769274 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS769274 E_FL_fcaL_51K18_F_0 10/09/28 77 %/260 aa ref|NP_001040121.1| endothelial-monocyte activ ... 62 %/132 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  7. EST Table: FY754033 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY754033 E_FL_famL_11K19_R_0 11/11/04 62 %/195 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, c ... 55 %/150 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  8. EST Table: FS737136 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS737136 E_FL_bmmt_07P05_R_0 10/09/28 59 %/250 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, c ... 50 %/185 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  9. EST Table: FS744437 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS744437 E_FL_bmmt_28H10_R_0 10/09/28 62 %/211 aa ref|XP_002432437.1| tyrosyl-tRNA synthetase, c ... 50 %/185 aa F58B3.5c#CE44546#WBGene00003415#locus:mars - 1#status:Confirmed#UniProt:D3YT56#protein_id:CBK1 ...

  10. An adaptive extention to high gain observer with application to wastewater monitoring

    Czech Academy of Sciences Publication Activity Database

    Čelikovský, Sergej; Torres-Munoz, J.; Rodríguez-Mata, A.; Dominguez-Bocanegra, A.R.

    Mexico-City: IEEE, 2015, s. 200-205. ISBN 978-1-4673-7837-6. [International Conference on Electrical Engineering, Computing Science and Automatic Control 2015 (CCE 2015) /12./. Mexico-City (MX), 28.10.2015-30.10.2015] R&D Projects: GA ČR GA13-20433S Institutional support: RVO:67985556 Keywords : Biosystems * observer design * uncertain model Subject RIV: BC - Control Systems Theory

  11. Chromogenic and fluorogenic crown ether compounds for the selective extraction and determination of Hg(II)

    Energy Technology Data Exchange (ETDEWEB)

    Vaidya, B.; Zak, J.; Bastiaans, G.J.; Porter, M.D. [Ames Lab., IA (United States)]|[Iowa State Univ., Ames, IA (United States); Hallman, J.L.; Nabulsi, N.A.R.; Utterback, M.D.; Strzelbicka, B.; Bartsch, R.A. [Texas Tech Univ., Lubbock, TX (United States)

    1995-11-15

    Two novel crown ether compounds, N,N`-bis(2-hydroxy-5-nitrobenzyl)-4, 13-diazadibenzo-18-crown-6 (CCE) and N, N`-bis(7-hydroxy-4-methylcoumarin-8-methylene)-4, 13-diazadibenzo-18-crown-6 (FCE), have been synthesized as potential reagents for the selective extraction and determination of heavy metal ions. Characterizations of the acid-base reactivity and the heavy metal ion extraction capabilities are reported. Both CCE and FCE undergo four-step ionization processes with associated tautomeric transformations and form stable complexes with divalent metal cations that can be extracted into 1,2-dichloroethane. Extraction constants for Ba(II), Ca(II), Cd(II), Cu(II), Hg(II), Pb(II), and Sr(II) have been determined for both reagents. For CCE, the extraction order is Hg(II) > Pb(II) > Cu(II) > Cd(II) > Ca(II) > Sr(II) > Ba(II), whereas the order for FCE is Hg(II) > Cu(II) > Pb(II) > Cd(II) > Ca(II) > Sr(II) > Ba(II). The selectivity of CCE for Hg(II) over the next-best-extracted cation, Pb(II), is nearly 2 x 10{sup 7} and that of FCE for Hg(II) over next-best-extracted cation, Cu(II), is nearly 5 x 10{sup 6}. Potential applications to chemical analysis, based on the unprecedented selectivity of both reagents for Hg(II), are briefly examined. 54 refs., 7 figs., 3 tabs.

  12. Dicty_cDB: Contig-U05795-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -10 BC120142_1( BC120142 |pid:none) Bos taurus chromatin accessibility... 67 3e-10 DQ311296_1( DQ311296 |pid... 65 1e-09 CP000600_167( CP000600 |pid:none) Ostreococcus lucimarinus CCE9901... 65 1e-09 (Q9NRG0) RecName: Full=Chromatin accessibili...ty complex protein 1... 65 1e-09 AM449922_3( AM449922 |pid:none) Vitis vinifera con

  13. Nonlinear high-gain observers with integral action: Application to bioreactors

    Czech Academy of Sciences Publication Activity Database

    Rodríguez-Mata, A.; Torres-Munoz, J.; Domínguez, A.R.; Hernandez-Villagran, D.; Čelikovský, Sergej

    Merida City: IEEE, 2011, s. 1-6. ISBN 978-1-4577-1011-7. [The 8th International Conference on Electrical Engineering, Computing Science and Automatic Control 2011 (CCE 2011). Merida City (MX), 26.10.2011-28.10.2011] Institutional research plan: CEZ:AV0Z10750506 Keywords : High-gain observers * integral action * microalgae Subject RIV: BC - Control Systems Theory http://www.ieee.org/conferences_events/conferences/conferencedetails/index.html?Conf_ID=19270

  14. The Struggle for “Thick” or Transformative Citizenship and Democracy in Australia: What Future Teachers Believe and Why it is Important

    OpenAIRE

    Zyngier, David

    2013-01-01

    This paper analyses pre-service education student perceptions and perspectives related to education for democracy in Australia. Using a critical-pedagogical framework to analyse data from an on-line survey, the paper presents both quantitative and qualitative responses to contrast understandings of democracy. The paper begins by outlining the concepts of thick and thin democracy, and revisiting the (parlous) state of civics and citizenship education (CCE) in Australia. Overall, pre-serv...

  15. Componentes de vulnerabilidad cognitiva en el trastorno de ansiedad generalizada

    OpenAIRE

    Nora H. Londoño

    2010-01-01

    The components of cognitive vulnerability to generalized anxiety disorder (GAD) were identified. We performed a comparative analysis between the cognitive profile of patients diagnosed with GAD (69 adults) and a control group with no diagnosis (69 adults). They were completed the MINI International Neuropsyquiatric Interview, the Young Schemes Questionnaire -YSQ-, the Core Beliefs Questionnaire for Personality Disorders -CCE-TP-, the Inventory of Automatic Thoughts -IPA-, and the Coping Strat...

  16. Coarse Competitive Equilibrium and Extreme Prices

    OpenAIRE

    Faruk Gul; Wolfgang Pesendorfer; Tomasz Strzalecki

    2014-01-01

    We introduce a notion of coarse competitive equilibrium (CCE), to study agents' inability to tailor their consumption to the state of the economy. Our notion is motivated by limited cognitive ability (in particular attention, memory, and complexity) and it maintains the complete market structure of competitive equilibrium. Compared to standard competitive equilibrium, our concept yields riskier allocations and more extreme prices. We provide a tractable model that is suitable for general equi...

  17. Monte Carlo analysis of a lateral IBIC experiment on a 4H-SiC Schottky diode

    Science.gov (United States)

    Olivero, P.; Forneris, J.; Gamarra, P.; Jakšić, M.; Giudice, A. Lo; Manfredotti, C.; Pastuović, Ž.; Skukan, N.; Vittone, E.

    2011-10-01

    The transport properties of a 4H-SiC Schottky diode have been investigated by the ion beam induced charge (IBIC) technique in lateral geometry through the analysis of the charge collection efficiency (CCE) profile at a fixed applied reverse bias voltage. The cross section of the sample orthogonal to the electrodes was irradiated by a rarefied 4 MeV proton microbeam and the charge pulses have been recorded as function of incident proton position with a spatial resolution of 2 μm. The CCE profile shows a broad plateau with CCE values close to 100% occurring at the depletion layer, whereas in the neutral region, the exponentially decreasing profile indicates the dominant role played by the diffusion transport mechanism. Mapping of charge pulses was accomplished by a novel computational approach, which consists in mapping the Gunn's weighting potential by solving the electrostatic problem by finite element method and hence evaluating the induced charge at the sensing electrode by a Monte Carlo method. The combination of these two computational methods enabled an exhaustive interpretation of the experimental profiles and allowed an accurate evaluation both of the electrical characteristics of the active region (e.g. electric field profiles) and of basic transport parameters (i.e. diffusion length and minority carrier lifetime).

  18. THE JOURNEY OF EVALUATION SYSTEM FROM ANCIENT GURUKUL TO MODERN EDUCATION SYSTEM

    Directory of Open Access Journals (Sweden)

    POOJA SINGHAL

    2012-11-01

    Full Text Available Education aims at making children capable of becoming responsible, productive and useful members of society. Knowledge, skills and attitudes are built through learning experiences and opportunities created for learners in schools. The education system in vogue in a country reflects the ethos, aspirations and expectations of a particular society. As aspirations and expectations of each generation vary with time, constant review of curriculum and evaluation system becomes an essential exercise. Evaluation is very important component of the education system. Reforms in the examination system are often recommended, sometimes discussed and rarely implemented. Introduction of Continuous and Comprehensive Evaluation (CCE is one of such reforms which have undergone a painful journey. The need for introducing CCE in schools in an effective and systematic manner has been felt for a long time. The present paper discusses the journey of evaluation system from our Ancient Gurukul system in form of oral examination to the implementation of Continuous and Comprehensive Evaluation of Modern Education System in Indian Perspective. The paper reflects the rationale behind replacing our traditional examination system with the concept of Continuous and Comprehensive Evaluation (CCE and its relevance in school education over the traditional examination system. Further this paper also highlight several problems associated with the execution of Continuous and Comprehensive Evaluation and suggests few remedial measures for its smooth execution.

  19. Activity report 1996

    International Nuclear Information System (INIS)

    The Canadian Committee on Electrotechnologies is an organization established to facilitate the exchange of information on the applications of electricity in industry, emphasizing international communications links and technology transfer. This report of activities during 1996 gives a summary account of workshop sessions and technical visits made in conjunction with the 13. International Congress of the International Union of for Electricity Applications (UIE) held in 1996, in Birmingham, England. The UIE is the CCE parent organization. Also reviewed were matters discussed at the UIE General Assembly such as discussions on the new Marketing Plan for 1996-2000 and the four year-work program of the various study committees. These committees will study water treatment, air conditioning and ventilation, cooling processes, separation processes and power quality. A list of publications available from the Committee and a description of the newly established Internet web site were provided. Included were a summary of CCE sponsored conferences at Canadian universities held in 1996 and a review of CCE's strategic plan and business plan for 1997

  20. Electrical characteristics and charge collection efficiency of silicon detectors irradiated with very high neutron and proton fluences

    International Nuclear Information System (INIS)

    Measurements performed on high resistivity silicon detectors irradiated with proton and neutron fluences, up to 3.5 x 1014 p/cm2 and 4.0 x 1015 n/cm2 respectively, are presented. The current-voltage (IV) and capacitance-voltage (CV) characteristics, as well as the charge collection efficiency (CCE) of the devices have been measured to carry out a complete detector performance analysis after irradiation. The IV, CV and CCE analyses show that the irradiated devices depart from the ideal p+n junction modelisation when the fluence (f) is of the order of 1014-1015 cm-2. In this fluence range, it is impossible to fully deplete the irradiated device; the CV characteristics show evidence of full depletion voltages up to 103-104 Volts; the IV and CCE(V) curves are found to be linear in this fluence range; reverse currents up to a few mA are measured. A well visible, although low, charge collection signal has been observed at 7 C after exposure to the extreme irradiation fluence of 4.0 x 1015 n/cm2. This is probably due to a very narrow active region inside the semiconductor bulk, and corresponding approximately, to a 75% inefficiency in the detector performance. (orig.)

  1. Radiation tolerance of epitaxial silicon carbide detectors for electrons and γ-rays

    International Nuclear Information System (INIS)

    Particles detectors were made using semiconductor epitaxial 4H-SiC as the detection medium. The investigated detectors are formed by Schottky contact (Au) on the epitaxial layer and an ohmic contact on the backside of 4H-SiC substrates with different micropipe densities from CREE. For radiation hardness studies, the detectors have been irradiated with electrons (8.2 MeV) and γ-rays (60Co source) at fluences and doses ranging from 0 to 9.48x1014 e/cm2 and 40 Mrad, respectively. We present experimental data on the charge collection properties by using 4.14 MeV α-particles impinging on the Schottky contact. Hundred percent Charge Collection Efficiency, CCE, is demonstrated for reverse voltages higher than the one needed to have a depletion region equal to the α-particle projected range, even after the irradiation at the highest dose. By comparing measured CCE values with the outcomes of drift-diffusion simulations, values are inferred for the hole lifetime, τp, within the neutral region of the charge carrier generation layer. τp was found to decrease with increasing radiation levels, ranging from 300 ns in non-irradiated detectors to 3 ns in the most irradiated ones. The diffusion contribution of the minority charge carriers to CCE is pointed out

  2. Evaluation of the diffusion length in silicon diodes by means of the lateral IBIC technique

    International Nuclear Information System (INIS)

    The transport properties of silicon p+-n-n+ diodes with a junction depth of about 47 μm have been investigated by means of the lateral IBIC technique. Cross section of the samples have been irradiated by a low intensity 5 MeV proton microbeam and the charge pulses have been recorded as a function of incident proton position. The charge collection efficiency (cce) profiles show broad plateaux with values close to 100%. The region where the electric field is absent shows exponentially decreasing cce profiles. The estimate of the decay rate allows the diffusion length of the minority carriers in the bulk of the device to be measured. The analytical method presented in this paper takes into account the dependence of the signal rise time on the incident proton position. The entire cce profile is in full agreement with the IBIC theory based on the extended Ramo's theorem, which provides a very effective tool for quantitative estimates of transport parameters in semiconductor devices

  3. Identification of carboxylesterase genes and their expression profiles in the Colorado potato beetle Leptinotarsa decemlineata treated with fipronil and cyhalothrin.

    Science.gov (United States)

    Lü, Feng-Gong; Fu, Kai-Yun; Li, Qian; Guo, Wen-Chao; Ahmat, Tursun; Li, Guo-Qing

    2015-07-01

    Based on the Leptinotarsa decemlineata transcriptome dataset and the GenBank sequences, 70 novel carboxylesterases and 2 acetylcholinesterases were found. The 72 members belong to a multifunctional carboxylesterase/cholinesterase superfamily (CCE). A phylogenetic tree including the 72 LdCCEs and the CCEs from Tribolium castaneum, Drosophila melanogaster and Apis mellifera revealed that all CCEs fell into three main phylogenetic groups: dietary/detoxification, hormone/semiochemical processing, and neurodevelopmental classes. Numbers of L. decemlineata CCEs in the three classes were 52, 12 and 8, respectively. The dietary/detoxification class includes two clades: coleopteran xenobiotic metabolizing and α-esterase type CCEs. CCEs in the two clades have independently expanded in L. decemlineata. The hormone/semiochemical processing class has three clades: integument CCEs, β- and pheromone CCEs and juvenile hormone CCEs. Integument CCEs in L. decemlineata have also expanded. The neurodevelopmental CCEs are implicated the most ancient class, containing acetylcholinesterase, neuroligin, neurotactin, glutactin, gliotactin and others. Among the 70 novel CCE genes, KM220566, KM220530, KM220576, KM220527 and KM220541 were fipronil-inducible, and KM220578, KM220566, KM220542, KM220564, KM220561, KM220554, KM220527, KM220538 and KM220541 were cyhalothrin-inducible. They were the candidates involving in insecticide detoxification. Moreover, our results also provided a platform to understand the functions and evolution of L. decemlineata CCE genes. PMID:26071812

  4. Renewable-surface sol-gel derived carbon ceramic-modified electrode fabricated by a newly synthesized polypyridil and phosphine Ru (II) complex and its application as an amperometric sensor for hydrazine

    International Nuclear Information System (INIS)

    A chemically modified carbon ceramic composite electrode (CCE) containing Dichloro{(8, 9-dimethyl-dipyridio [2,3-a;2',3'-c] phenazine-κ2-N,N') bis(triphenylphosphine-κ-P)}ruthenium (II) complex which synthesized newly was constructed by the sol-gel technique. Electrochemical behavior and stability of modified CCE were investigated by cyclic voltammetry. The electrocatalytic activity of CCE was investigated and showed a good effect for oxidation of hydrazine in phosphate buffer solution (PBS). A linear concentration range of 6 μM to 1.2 mM of hydrazine with an experimental detection limit of 1 μM of hydrazine was obtained. The diffusion coefficient of hydrazine and its catalytic rate constant for electrocatalytic reaction along with the apparent electron transfer rate constant (ks) and transfer coefficient (α) were also determined. The modified carbon ceramic electrode doped with this new Ru-complex showed good reproducibility, short response time (t 3 month) and especially good surface renewability by simple mechanical polishing. The results showed that this electrode could be used as an electrochemical sensor for determination of hydrazine in real water samples used in Fars Power Plant Station, including its heat recovery steam generator (HRSG) water (at different operational condition), cooling system and clean waste water

  5. Carbon ceramic electrodes obtained by basic catalysis of sol–gel process

    International Nuclear Information System (INIS)

    Highlights: • The CCE prepared by basic catalysis of sol–gel process are more porous. • The synthesized electrodes showed higher sensitivity. • The preparation conditions of CCE were obtained with factorial design. - Abstract: The preparation and characterization of carbon ceramic electrodes (CCEs) produced by the sol–gel method was reported. Different parameters for the manufacture of CCE were studied. Some factors such as the preparation method, type of precursor and catalyst, directly influence the conductive properties, mechanical and morphological characteristics of CCEs, and these are reflected in their electrochemical response. Such factors were evaluated using a 24 (two factors and four levels) factorial design analyzing the anodic peak currents (Ipa) and the variation of peak potential (ΔEp) responses of the respective cyclic voltammograms in presence of potassium ferrocyanide. Analyzing the set of results obtained from cyclic voltammetry, a higher reversibility was observed for the electrodes prepared by basic catalysis using methyltrimethoxysilicate, MTMS, as Si precursor. It is suggested that the obtained material presents a porous morphological structure, providing higher reversibility and better definition of voltammetric peaks. These electrodes were characterized by scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XDR)

  6. Dynamics of medium motion affecting voltage growth rate in direct current exploding breakers

    International Nuclear Information System (INIS)

    The effect of medium motion dynamics on the rate of voltage growth in the switch-off arc on a mockup of the commutator is studied. The commutator mockup comprise cylindrical constant-radius current-carrying foil element (CCE); constant-height, variable-radius, disk charge of explosive; thin dielectric knife located in the middle of the channel; and massive dielectric rings limiting the medium scattering in the axial direction. Water and paraffin are used as a medium inside and outside the CCE. Investigations have been conducted with the following circuit parameters: capacitance equals 2.8x10-3 F, inductance equals 3x10-4 H, load resistance equals 1.11 Ohm, commutation current equals 10 kA. It is shown that at the current density per unit length of the CCE circumference of the order of 100 A/mm the arcing medium pressure of the switch-off arc does not produce an essential effect on the voltage growth on the arc. A direct relationship between the arcing medium motion rate and the voltage growth rate on the arc is found which permits to control the steepness of the voltage pulse front for solving the problems of pulse supply for different kind of systems

  7. Magnetospheric particle injection and the upstream ion event of September 5, 1984

    International Nuclear Information System (INIS)

    Energetic particle data from the AMPTE Charge Composition Explorer (CCE) spacecraft in the outer dayside magnetosphere are examined during the period of an upstream ion event observed by AMPTE Ion Release Module (IRM) spacecraft on September 5, 1984 [Moebius et al., this issue]. The CCE data reveal the following: (a) an ion enhancement was observed at --0040 UT in near coincidence with a substorm onset at --0035 UT, approximately 15 minutes prior to the onset of the event upstream of the shock; (b) ions of both solar wind (He++, Fe-group) and ionospheric (O+) origin over a broad energy range (--20 keV to >1350 keV) were injected at substorm onset; (c) the time evolution of the H+, He++, and O+ pitch angle distributions markedly differed, with O+ exhibiting mostly enhancements at off-900 angles for the first hour after injection; (d) an enhancement in the Fe-group ions inside the magnetosphere at L--6.4 occurred simultaneously with the appearance of an O+ burst upstream of the shock. The CCE observations, taken together with the simultaneously observed IRM ion event, suggest that a plausible explanation for the appearence of upstream ions is leakage from the magnetosphere into the upstream region, rather than the alternate explanation which requires in-situ acceleration of solar wind ions via the Fermi mechanism

  8. Riverbed methanotrophy sustained by high carbon conversion efficiency.

    Science.gov (United States)

    Trimmer, Mark; Shelley, Felicity C; Purdy, Kevin J; Maanoja, Susanna T; Chronopoulou, Panagiota-Myrsini; Grey, Jonathan; Jonathan, Grey

    2015-10-01

    Our understanding of the role of freshwaters in the global carbon cycle is being revised, but there is still a lack of data, especially for the cycling of methane, in rivers and streams. Unravelling the role of methanotrophy is key to determining the fate of methane in rivers. Here we focus on the carbon conversion efficiency (CCE) of methanotrophy, that is, how much organic carbon is produced per mole of CH4 oxidised, and how this is influenced by variation in methanotroph communities. First, we show that the CCE of riverbed methanotrophs is consistently high (~50%) across a wide range of methane concentrations (~10-7000 nM) and despite a 10-fold span in the rate of methane oxidation. Then, we show that this high conversion efficiency is largely conserved (50%± confidence interval 44-56%) across pronounced variation in the key functional gene (70 operational taxonomic units (OTUs)), particulate methane monooxygenase (pmoA), and marked shifts in the abundance of Type I and Type II methanotrophs in eight replicate chalk streams. These data may suggest a degree of functional redundancy within the variable methanotroph community inhabiting these streams and that some of the variation in pmoA may reflect a suite of enzymes of different methane affinities which enables such a large range of methane concentrations to be oxidised. The latter, coupled to their high CCE, enables the methanotrophs to sustain net production throughout the year, regardless of the marked temporal and spatial changes that occur in methane. PMID:26057842

  9. Charge collection efficiency degradation induced by MeV ions in semiconductor devices: Model and experiment

    Science.gov (United States)

    Vittone, E.; Pastuovic, Z.; Breese, M. B. H.; Garcia Lopez, J.; Jaksic, M.; Raisanen, J.; Siegele, R.; Simon, A.; Vizkelethy, G.

    2016-04-01

    This paper investigates both theoretically and experimentally the charge collection efficiency (CCE) degradation in silicon diodes induced by energetic ions. Ion Beam Induced Charge (IBIC) measurements carried out on n- and p-type silicon diodes which were previously irradiated with MeV He ions show evidence that the CCE degradation does not only depend on the mass, energy and fluence of the damaging ion, but also depends on the ion probe species and on the polarization state of the device. A general one-dimensional model is derived, which accounts for the ion-induced defect distribution, the ionization profile of the probing ion and the charge induction mechanism. Using the ionizing and non-ionizing energy loss profiles resulting from simulations based on the binary collision approximation and on the electrostatic/transport parameters of the diode under study as input, the model is able to accurately reproduce the experimental CCE degradation curves without introducing any phenomenological additional term or formula. Although limited to low level of damage, the model is quite general, including the displacement damage approach as a special case and can be applied to any semiconductor device. It provides a method to measure the capture coefficients of the radiation induced recombination centres. They can be considered indexes, which can contribute to assessing the relative radiation hardness of semiconductor materials.

  10. Monte Carlo analysis of a lateral IBIC experiment on a 4H-SiC Schottky diode

    CERN Document Server

    Olivero, P; Gamarra, P; Jaksic, M; Giudice, A Lo; Manfredotti, C; Pastuovic, Z; Skukan, N; Vittone, E

    2016-01-01

    The transport properties of a 4H-SiC Schottky diode have been investigated by the Ion Beam Induced Charge (IBIC) technique in lateral geometry through the analysis of the charge collection efficiency (CCE) profile at a fixed applied reverse bias voltage. The cross section of the sample orthogonal to the electrodes was irradiated by a rarefied 4 MeV proton microbeam and the charge pulses have been recorded as function of incident proton position with a spatial resolution of 2 um. The CCE profile shows a broad plateau with CCE values close to 100% occurring at the depletion layer, whereas in the neutral region, the exponentially decreasing profile indicates the dominant role played by the diffusion transport mechanism. Mapping of charge pulses was accomplished by a novel computational approach, which consists in mapping the Gunn's weighting potential by solving the electrostatic problem by finite element method and hence evaluating the induced charge at the sensing electrode by a Monte Carlo method. The combina...

  11. Renewable-surface sol-gel derived carbon ceramic-modified electrode fabricated by a newly synthesized polypyridil and phosphine Ru (II) complex and its application as an amperometric sensor for hydrazine

    Energy Technology Data Exchange (ETDEWEB)

    Abbaspour, Abdolkarim [Department of Chemistry, College of Sciences, Shiraz University, Shiraz, Fars 7145685464 (Iran, Islamic Republic of)], E-mail: abbaspour@chem.susc.ac.ir; Shamsipur, Mojtaba [Department of Chemistry, College of Sciences, Razi University, Kermanshah (Iran, Islamic Republic of); Siroueinejad, Arash [Department of Chemistry, College of Sciences, Shiraz University, Shiraz, Fars 7145685464 (Iran, Islamic Republic of); Kia, Reza; Raithby, Paul R. [Department of Chemistry, University of Bath, Claverton Down, Bath BA2 7AY (United Kingdom)

    2009-04-01

    A chemically modified carbon ceramic composite electrode (CCE) containing Dichloro{l_brace}(8, 9-dimethyl-dipyridio [2,3-a;2',3'-c] phenazine-{kappa}{sup 2}-N,N') bis(triphenylphosphine-{kappa}-P){r_brace}ruthenium (II) complex which synthesized newly was constructed by the sol-gel technique. Electrochemical behavior and stability of modified CCE were investigated by cyclic voltammetry. The electrocatalytic activity of CCE was investigated and showed a good effect for oxidation of hydrazine in phosphate buffer solution (PBS). A linear concentration range of 6 {mu}M to 1.2 mM of hydrazine with an experimental detection limit of 1 {mu}M of hydrazine was obtained. The diffusion coefficient of hydrazine and its catalytic rate constant for electrocatalytic reaction along with the apparent electron transfer rate constant (k{sub s}) and transfer coefficient ({alpha}) were also determined. The modified carbon ceramic electrode doped with this new Ru-complex showed good reproducibility, short response time (t < 2 s), remarkable long-term stability (>3 month) and especially good surface renewability by simple mechanical polishing. The results showed that this electrode could be used as an electrochemical sensor for determination of hydrazine in real water samples used in Fars Power Plant Station, including its heat recovery steam generator (HRSG) water (at different operational condition), cooling system and clean waste water.

  12. Improving Charge-Collection Efficiency of Kyoto's SOI Pixel Sensors

    CERN Document Server

    Matsumura, Hideaki; Tanaka, Takaaki; Takeda, Ayaki; Ito, Makoto; Ohmura, Syunichi; Arai, Yasuo; Mori, Koji; Nishioka, Yusuke; Takenaka, Ryota; Kohmura, Takayoshi

    2015-01-01

    We have been developing X-ray SOIPIXs for next-generation satellites for X-ray astronomy. Their high time resolution ($\\sim10~\\mu$s) and event-trigger-output function enable us to read out without pile-ups and to use anti-coincidence systems. Their performance in imaging spectroscopy is comparable to that in the CCDs. A problem in our previous model was degradation of charge-collection efficiency (CCE) at pixel borders. We measured the response in the sub-pixel scale, using finely collimated X-ray beams at $10~\\mu$m\\Phi$ at SPring-8, and investigated the non-uniformity of the CCE within a pixel. We found that the X-ray detection efficiency and CCE degrade in the sensor region under the pixel circuitry placed outside the buried p-wells (BPW). A 2D simulation of the electric fields shows that the isolated pixel-circuitry outside the BPW creates local minimums in the electric potentials at the interface between the sensor and buried oxide layers. Thus, a part of signal charge is trapped there and is not collecte...

  13. A 3-dimensional interdigitated electrode geometry for the enhancement of charge collection efficiency in diamond detectors

    CERN Document Server

    Forneris, J; Olivero, P; Picollo, F; Re, A; Marinelli, M; Pompili, F; Verona, C; Rinati, G Verona; Benetti, M; Cannata, D; Di Pietrantonio, F

    2016-01-01

    In this work, a single crystal CVD diamond film with a novel three-dimensional (3D) interdigitated electrode geometry has been fabricated with the Reactive Ion Etching (RIE) technique in order to increase the charge collection efficiency (CCE) with respect to that obtained by standard superficial electrodes. The geometrical arrangement of the electric field lines due to the 3D patterning of the electrodes results in a shorter travel path for the excess charge carriers, thus contributing to a more efficient charge collection mech-anism. The CCE of the device was mapped by means of the Ion Beam Induced Charge (IBIC) technique. A 1 MeV proton micro-beam was raster scanned over the active area of the diamond detector under different bias voltage conditions, enabling to probe the charge transport properties of the detector up to a depth of 8 {\\mu}m below the sample surface. The experimental results, supported by the numerical simulations, show a significant improvement in the 3D-detector performance (i.e. CCE, ene...

  14. Characterization of 150 $\\mu$m thick epitaxial silicon detectors from different producers after proton irradiation

    CERN Document Server

    Hoedlmoser, H; Haerkoenen, J; Kronberger, M; Trummer, J; Rodeghiero, P

    2007-01-01

    Epitaxial (EPI) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of 150 mm thick EPI silicon diodes irradiated with 24GeV=c protons up to a fluence of 3 1015 p=cm2 has been performed by means of Charge Collection Efficiency (CCE) measurements, investigations with the Transient Current Technique (TCT) and standard CV=IV characterizations. The aim of the work was to investigate the impact of radiation damage as well as the influence of the wafer processing on the material performance by comparing diodes from different manufacturers. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. While the generation of leakage current due to irradiation is similar in all investigated series of detectors, a difference in the effective doping concentration can be observed after irradiation. In the CCE measurements an anomalous drop in performance was found even for diodes exposed to ...

  15. Cholesterol crystal embolization diagnosed on bladder transurethral resection.

    Science.gov (United States)

    Chatelain, Denis; Cordonnier, Carole; Brevet, Marie; Petit, Jacques; Sevestre, Henri

    2005-08-01

    Cholesterol crystal embolization (CCE) is a severe systemic disorder caused by vascular migration of cholesterol crystals originating from ulcerative atherosclerotic plaques located in large arteries. We report 2 cases of CCE diagnosed on bladder transurethral resection in 2 men aged 94 and 72 years. Both patients had atherosclerosis disease. One patient had been treated by heparin 1 month before for pulmonary embolism and the other had had a coronary angiography and bypass graft surgery 5 months before for silent myocardial infarction. One patient presented with hematuria and the other with acute renal failure. Cystoscopy showed multiple papillary tumors of the bladder wall. Bladder transurethral resections showed transitional cell carcinoma with cholesterol crystals occluding the lumen of small arterioles in the submucosa. Eight cases of CCE in the bladder wall have been reported in the literature in 3 women and 5 men aged 56 to 79 years. Cholesterol crystal embolization is often discovered in the bladder wall on necropsy specimens. Only 2 cases have been fortuitously discovered on bladder transurethral resection performed for transitional cell carcinoma. Cholesterol crystal embolization in the bladder wall is often a marker of severe disease although the evolution is quite favorable in our patients, still alive 1 and 2 years after diagnosis. PMID:16084459

  16. Multi-input Fuzzy Logic Controller for Brushless dc Motor Drives

    Directory of Open Access Journals (Sweden)

    Y. H. Bharathi

    2008-01-01

    Full Text Available The brushless dc motors are used in various applications such as defence, industries,robotics, etc. In these applications, the motor should be precisely controlled to give the desiredperformance. The proposed controller systems consist of multi-input fuzzy (two-and three-inputlogic controller (FLC and multi-input integrated fuzzy logic controller (IFLC for the speed controlof brushless dc servomotor drive. The input for the controllers are error e(k, change in error[first derivative of error ce(k] and change of change in error [second derivative of error cce(k]with a single-output. The error cce(k is substantial at the overshoots/undershoots and is thereforeessential for accurate speed control of brushless dc motor. The error cce(k has been introducedfor the first time in the literature as one of the input in the FLC and IFLC design. The IFLC isdesigned using FLC and proportional derivation integral (PID controllers. The controller systemshave been studied systematically for the transient and steady-state conditions. The three-inputIFLC is found to be superior, more robust, faster, flexible, and is insensitive to the parametervariations as compared with the FLC (with two-and three-input and conventional two-inputIFLC

  17. Defense-Related Calcium Signaling Mutants Uncovered via a Quantitative High-Throughput Screen in Arabidopsis thaliana

    Institute of Scientific and Technical Information of China (English)

    Stefanie Ranf; Julia Grimmer; Yvonne P(o)schl; Pascal Pecher; Delphine Chinchilla; Dierk Scheel; Justin Lee

    2012-01-01

    Calcium acts as a second messenger for signaling to a variety of stimuli including MAMPs (Microbe-Associated Molecular Patterns),such as flg22 and elf18 that are derived from bacterial flagellin and elongation factor Tu,respectively.Here,Arabidopsis thaliana mutants with changed calcium elevation (cce) in response to fig22 treatment were isolated and characterized.Besides novel mutant alleles of the flg22 receptor,FLS2 (Flagellin-Sensitive 2),and the receptor-associated kinase,BAK1 (Brassinosteroid receptor 1-Associated Kinase 1),the new cce mutants can be categorized into two main groups—those with a reduced or an enhanced calcium elevation.Moreover,cce mutants from both groups show differential phenotypes to different sets of MAMPs.Thus,these mutants will facilitate the discovery of novel components in early MAMP signaling and bridge the gaps in current knowledge of calcium signaling during plant-microbe interactions.Last but not least,the screening method is optimized for speed (covering 384 plants in 3 or 10 h) and can be adapted to genetically dissect any other stimuli that induce a change in calcium levels.

  18. Cardiology in the young : where we have been. Where we are. Where we are going.

    Science.gov (United States)

    Jacobs, Jeffrey P

    2014-12-01

    , Jeffrey P. Jacobs, MD, FACS, FACC, FCCP, became Editor-in-Chief of Cardiology in the Young . Jeffrey P. Jacobs, MD, FACS, FACC, FCCP is Director of the Andrews/Daicoff Cardiovascular Program at Johns Hopkins All Children's Heart Institute and Professor of Cardiac Surgery in the Division of Cardiac Surgery of the Department of Surgery at Johns Hopkins University. He is also Surgical Director of the Heart Transplantation Program and Director of the Extracorporeal Life Support Program at Johns Hopkins All Children's Heart Institute. Dr Jacobs has been a cardiothoracic surgeon at All Children's Hospital since 1998. PMID:25647374

  19. ACC/AHA 2006年非心脏手术围手术期心血管评估指南更新:关于围手术期β-受体阻滞剂使用的专题更新——美国心脏病学会/美国心脏协会医疗指南工作组报告(非心脏手术围手术期心血管评估2002指南更新编写委员会)

    Institute of Scientific and Technical Information of China (English)

    Lee A.Fleisher; Judy R.Kersten; Barbara Riegel; John F.Robb; 李恒; 阎哲; Joshua A.Beckman; Kenneth A.Brown; Hugh Calkins; Elliott L.Chaikof; Kirsten E.Fleischmann; William K.Freeman; James B.Froehlich; Edward K.Kasper

    2008-01-01

    美国心脏病学会/美国心脏协会(ACC/AHA)医疗指南工作组尽力避免因编写委员会成员与企业的关系或个人利益而导致的任何实际的、可能的,或者是已发现的利益冲突.编写委员会的所有成员以及本文件的同行评议人必须对可能被视为是实际上或是潜在的利益冲突进行声明.工作组对以上声明进行审查.在每次会议上,这些声明必须口头汇报给编写委员会的每位成员;当发生变动时,编写委员会对声明进行更新并再次核查.编写委员会成员和企业的关系见附表1,同行评议人与企业的关系见附表2.本指南旨在确定在大多数情形下满足大部分患者需求的方案.指南反映了对当前可获得的科学文献进行系统分析后专家们达成的共识,其目的在于提高医疗质量.如果将指南用于管理/投资决策,其终极目标应是医疗质量得到提高并服务于患者.关于具体患者的医疗问题,必须由医疗人员和患者根据具体情况共同做出最终决定.Sidney C.Smith,Jr.,MD,FACC,FAHA ACC/AHA医疗指南工作组主席 Elliot M.Antman,MD,FACC,FAHA ACC/AHA医疗指南工作组前任主席

  20. Evidencias moleculares de variantes somaclonales de caña de azúcar. Somaclones resistentes a la mancha de ojo

    Directory of Open Access Journals (Sweden)

    Ingrid Hernández

    2005-01-01

    Full Text Available Las técnicas de cultivo de tejidos vegetales, en las que se incluye la variación somaclonal, han sido extendidas y actualmente, se utilizan como fuente alternativa para la producción de variabilidad útil para el mejoramiento vegetal. La mancha de ojo es una enfermedad de la caña de azú- car causada por el hongo patógeno Drechslera sacchari S. que ocasiona da- ños de interés a este cultivo, con pérdidas económicas de importancia en las áreas afectadas. Los marcadores del polimorfismo de ADN (marcadores moleculares se han convertido en herramientas valiosas para los estudios genéticos en plantas. En el presente trabajo, se estudió la estabilidad molecular mediante RFLP y AFLP de plantas de caña de azúcar resistentes a la mancha de ojo obtenidas previamente a partir de una variedad muy susceptible, C 87-51, utilizada en la variación somaclonal y la selección in vitro. Los análisis moleculares realizados permitieron comprobar que luego de 20 años de obtenidos, los tres somaclones de caña de azúcar resistentes a la mancha de ojo, CCe 83-1, CCe 83-2 y CCe 83-4, continúan mostrando patrones de ADN diferentes a la variedad que les dio origen. Los resultados permitieron detectar además, combinaciones de enzimas de restricción-sondas y de cebadores, que resultan de utilidad para iniciar las trabajos de mapeo genético en progenies resultantes de cruces entre somaclones y la variedad donadora. Se reportan adicionalmente, marcadores moleculares de grupos de diversidad e individuales para la identificación rápida y precisa de la variedad C 87-51 y los somaclones CCe 83-1 y CCe 83-4.

  1. Preparation and electrocatalytic oxidation properties of a nickel pentacyanonitrosylferrate modified carbon composite electrode by two-step sol-gel technique: improvement of the catalytic activity

    International Nuclear Information System (INIS)

    The sol-gel technique was used to construct nickel pentacyanonitrosylferrate (NiPCNF) modified composite ceramic carbon electrodes (CCEs). This involves two steps: forming a CCE containing Ni powder and then immersing the electrode into a sodium pentacyanonitrosyl-ferrate solution (electroless deposition). The cyclic voltammograms of the resulting surface modified CCE under optimum conditions show a well-defined redox couple due to the [NiIIFeIII/II(CN)5NO]0/-1 system. The electrochemical properties and stability of the modified electrode were investigated by cyclic voltammetry. The apparent electron transfer rate constant (ks) and transfer coefficient (α) were determined by cyclic voltammetry being about 1.1 s-1 and 0.55, respectively. Sulfite has been chosen as a model to elucidate the electrocatalytic ability of NiPCNF-modified CCE prepared by one- or two-step sol-gel technique. The modified electrode showed excellent electrocatalytic activity toward the SO32- electro oxidation in pH range 3-9 in comparison with CCE modified by homogeneous mixture of graphite powder, Ni(NO3)2 and Na2[Fe(CN)5NO] (one-step sol-gel technique). Sulfite was determined amperometrically at the surface of this modified electrode in pH 7. Under the optimized conditions the calibration curve is linear in the concentration range 2 μM to 2.0 mM. The detection limit (signal-to-noise is 3) and sensitivity are 0.5 μM and 13.5 nA/μM. The modified carbon ceramic electrode containing nickel pentacyanonitrosylferrate shows good repeatability, short response time, t (90%) 2[Fe(CN)5NO] solution. The advantages of the SO32- amperometrically detector based on the nickel pentacyanonitrosylferrate-doped CCE is high sensitivity, inherent stability at wide pH range, excellent catalytic activity and less expense and simplicity of preparation. This sensor can be used as amperometric detector in chromatographic instruments

  2. Suppressor Screen and Phenotype Analyses Revealed an Emerging Role of the Monofunctional Peroxisomal Enoyl-CoA Hydratase 2 in Compensated Cell Enlargement.

    Science.gov (United States)

    Katano, Mana; Takahashi, Kazuki; Hirano, Tomonari; Kazama, Yusuke; Abe, Tomoko; Tsukaya, Hirokazu; Ferjani, Ali

    2016-01-01

    Efficient use of seed nutrient reserves is crucial for germination and establishment of plant seedlings. Mobilizing seed oil reserves in Arabidopsis involves β-oxidation, the glyoxylate cycle, and gluconeogenesis, which provide essential energy and the carbon skeletons needed to sustain seedling growth until photoautotrophy is acquired. We demonstrated that H(+)-PPase activity is required for gluconeogenesis. Lack of H(+)-PPase in fugu5 mutants increases cytosolic pyrophosphate (PPi) levels, which partially reduces sucrose synthesis de novo and inhibits cell division. In contrast, post-mitotic cell expansion in cotyledons was unusually enhanced, a phenotype called compensation. Therefore, it appears that PPi inhibits several cellular functions, including cell cycling, to trigger compensated cell enlargement (CCE). Here, we mutagenized fugu5-1 seeds with (12)C(6+) heavy-ion irradiation and screened mutations that restrain CCE to gain insight into the genetic pathway(s) involved in CCE. We isolated A#3-1, in which cell size was severely reduced, but cell number remained similar to that of original fugu5-1. Moreover, cell number decreased in A#3-1 single mutant (A#3-1sm), similar to that of fugu5-1, but cell size was almost equal to that of the wild type. Surprisingly, A#3-1 mutation did not affect CCE in other compensation exhibiting mutant backgrounds, such as an3-4 and fugu2-1/fas1-6. Subsequent map-based cloning combined with genome sequencing and HRM curve analysis identified enoyl-CoA hydratase 2 (ECH2) as the causal gene of A#3-1. The above phenotypes were consistently observed in the ech2-1 allele and supplying sucrose restored the morphological and cellular phenotypes in fugu5-1, ech2-1, A#3-1sm, fugu5-1 ech2-1, and A#3-1; fugu5-1. Taken together, these results suggest that defects in either H(+)-PPase or ECH2 compromise cell proliferation due to defects in mobilizing seed storage lipids. In contrast, ECH2 alone likely promotes CCE during the post

  3. Suppressor screen and phenotype analyses revealed an emerging role of the Monofunctional peroxisomal enoyl-CoA hydratase 2 in compensated cell enlargement

    Directory of Open Access Journals (Sweden)

    Mana eKatano

    2016-02-01

    Full Text Available Efficient use of seed nutrient reserves is crucial for germination and establishment of plant seedlings. Mobilizing seed oil reserves in Arabidopsis involves β-oxidation, the glyoxylate cycle, and gluconeogenesis, which provide essential energy and the carbon skeletons needed to sustain seedling growth until photoautotrophy is acquired. We demonstrated that H+-PPase activity is required for gluconeogenesis. Lack of H+-PPase in fugu5 mutants increases cytosolic pyrophosphate (PPi levels, which partially reduces sucrose synthesis de novo and inhibits cell division. In contrast, post-mitotic cell expansion in cotyledons was unusually enhanced, a phenotype called compensation. Therefore, it appears that PPi inhibits several cellular functions, including cell cycling, to trigger compensated cell enlargement (CCE. Here, we mutagenized fugu5-1 seeds with 12C6+ heavy-ion irradiation and screened mutations that restrain CCE to gain insight into the genetic pathway(s involved in CCE. We isolated A#3-1, in which cell size was severely reduced, but cell number remained similar to that of original fugu5-1. Moreover, cell number decreased in A#3-1 single mutant (A#3-1sm, similar to that of fugu5-1, but cell size was almost equal to that of the wild type. Surprisingly, A#3-1 mutation did not affect CCE in other compensation exhibiting mutant backgrounds, such as an3-4 and fugu2-1/fas1-6. Subsequent map-based cloning combined with genome sequencing and HRM curve analysis identified enoyl-CoA hydratase 2 (ECH2 as the causal gene of A#3-1. The above phenotypes were consistently observed in the ech2-1 allele and supplying sucrose restored the morphological and cellular phenotypes in fugu5-1, ech2-1, A#3-1sm, fugu5-1 ech2-1 and A#3-1;fugu5-1. Taken together, these results suggest that defects in either H+-PPase or ECH2 compromise cell proliferation due to defects in mobilizing stored lipids. In contrast, ECH2 alone likely promotes CCE during the post-mitotic cell

  4. Using High-Resolution Models to Predict the Effects of Climate Change on Aquatic Ecosystems in the Crown of the Continent

    Science.gov (United States)

    Jones, L.; Muhlfeld, C.; Marshall, L. A.

    2013-12-01

    Climate trends and projections have prompted interest in assessing the thermal sensitivity of aquatic species. How species will adapt and respond to these changes is uncertain, however, climatic and hydrologic changes may shift species habitat distributions and physiological functions both spatially and temporally. This is particularly true for salmonids (e.g., trout, char, and salmon), which are cold-water species strongly influenced by changes in temperature, flow, and physical habitat conditions. Therefore, understanding how habitats are likely to change and how species may respond to changes in climatic conditions is critical for developing conservation and management strategies. The purpose of this study is to develop a high-resolution stream temperature model for the Crown of the Continent Ecosystem (CCE) to simulate potential climate change impacts on thermal regimes throughout the riverscape. A spatially explicit statistical regression model is coupled with high-resolution climate data such as air temperature, precipitation, solar radiation, baseflow and surface runoff. This empirically based model is used to predict daily stream temperatures under historic, current and forecasted climate conditions. The model is parameterized with empirical stream temperature data, which has been gathered from agencies across the region. The current database of empirical stream temperature data consists of over 800 sites throughout the CCE, which provide time series data to the model application. The biological integration and application of this model is on bull trout (Salvelinus confluentus) populations within the CCE. The model will be used to assess species vulnerabilities caused by spatial and temporal changes in stream temperature and hydrology. By evaluating the magnitude, timing and duration of climatic changes on the riverscape, we can more accurately assess potential vulnerabilities of critical life history traits, such as growth potential, spawning migrations

  5. Nitric oxide inhibits capacitative Ca2+ entry by suppression of mitochondrial Ca2+ handling

    Science.gov (United States)

    Thyagarajan, Baskaran; Malli, Roland; Schmidt, Kurt; Graier, Wolfgang F; Groschner, Klaus

    2002-01-01

    Nitric oxide (NO) is a key modulator of cellular Ca2+ signalling and a determinant of mitochondrial function. Here, we demonstrate that NO governs capacitative Ca2+ entry (CCE) into HEK293 cells by impairment of mitochondrial Ca2+ handling. Authentic NO as well as the NO donors 1-[2-(carboxylato)pyrrolidin-1-yl]diazem-1-ium-1,2-diolate (ProliNO) and 2-(N,N-diethylamino)-diazenolate-2-oxide (DEANO) suppressed CCE activated by thapsigargin (TG)-induced store depletion. Threshold concentrations for inhibition of CCE by ProliNO and DEANO were 0.3 and 1 μM, respectively. NO-induced inhibition of CCE was not mimicked by peroxynitrite (100 μM), the peroxynitrite donor 3-morpholino-sydnonimine (SIN-1, 100 μM) or 8-bromoguanosine 3′,5′-cyclic monophosphate (8-BrcGMP, 1 mM). In addition, the guanylyl cyclase inhibitor 1H-[1,2,4] oxadiazole[4,3-a] quinoxalin-1-one (ODQ, 30 μM) failed to antagonize the inhibitory action of NO on CCE. DEANO (1–10 μM) suppressed mitochondrial respiration as evident from inhibition of cellular oxygen consumption. Experiments using fluorescent dyes to monitor mitochondrial membrane potential and mitochondrial Ca2+ levels, respectively, indicated that DEANO (10 μM) depolarized mitochondria and suppressed mitochondrial Ca2+ sequestration. The inhibitory effect of DEANO on Ca2+ uptake into mitochondria was confirmed by recording mitochondrial Ca2+ during agonist stimulation in HEK293 cells expressing ratiometric-pericam in mitochondria. DEANO (10 μM) failed to inhibit Ba2+ entry into TG-stimulated cells when extracellular Ca2+ was buffered below 1 μM, while clear inhibition of Ba2+ entry into store depleted cells was observed when extracellular Ca2+ levels were above 10 μM. Moreover, buffering of intracellular Ca2+ by use of N,N′-[1,2-ethanediylbis(oxy-2,1-phenylene)] bis [N-[25-[(acetyloxy) methoxy]-2-oxoethyl

  6. Protective effect of cactus cladode extract against cisplatin induced oxidative stress, genotoxicity and apoptosis in balb/c mice: combination with phytochemical composition

    Directory of Open Access Journals (Sweden)

    Brahmi Dalel

    2012-07-01

    Full Text Available Abstract Background Cis-Platinum (II (cis-diammine dichloroplatinum; CDDP is a potent antitumor compound widely used for the treatment of many malignancies. An important side-effect of CDDP is nephrotoxicity. The cytotoxic action of this drug is often thought to induce oxidative stress and be associated with its ability to bind DNA to form CDDP–DNA adducts and apoptosis in kidney cells. In this study, the protective effect of cactus cladode extract (CCE against CDDP-induced oxidative stress and genotoxicity were investigated in mice. We also looked for levels of malondialdehyde (MDA, catalase activity, superoxide dismutase (SOD activity, chromosome aberrations (CA test, SOS Chromotest, expressions of p53, bax and bcl2 in kidney and we also analyzed several parameters of renal function markers toxicity such as serum biochemical analysis. Methods Adult, healthy balb/c (20–25 g male mice aged of 4–5 weeks were pre-treated by intraperitonial administration of CCE (50 mg/Kg.b.w for 2 weeks. Control animals were treated 3 days a week for 4 weeks by intraperitonial administration of 100 μg/Kg.b.w CDDP. Animals which treated by CDDP and CCE were divided into two groups: the first group was administrated CCE 2 hours before each treatment with CDDP 3 days a week for 4 weeks. The second group was administrated without pre-treatment with CCE but this extract was administrated 24 hours after each treatment with CDDP 3 days a week for 4 weeks. Results Our results showed that CDDP induced significant alterations in all tested oxidative stress markers. In addition it induced CA in bone morrow cells, increased the expression of pro-apoptotic proteins p53 and bax and decreased the expression of anti-apoptotic protein bcl2 in kidney. On the other hand, CDDP significantly increased the levels of urea and creatinine and decreased the levels of albumin and total protein.The treatment of CCE before or after treatment with CDDP showed

  7. Evaluation of Liver Fibrosis Using Texture Analysis on Combined-Contrast-Enhanced Magnetic Resonance Images at 3.0T

    Directory of Open Access Journals (Sweden)

    Takeshi Yokoo

    2015-01-01

    Full Text Available Purpose. To noninvasively assess liver fibrosis using combined-contrast-enhanced (CCE magnetic resonance imaging (MRI and texture analysis. Materials and Methods. In this IRB-approved, HIPAA-compliant prospective study, 46 adults with newly diagnosed HCV infection and recent liver biopsy underwent CCE liver MRI following intravenous administration of superparamagnetic iron oxides (ferumoxides and gadolinium DTPA (gadopentetate dimeglumine. The image texture of the liver was quantified in regions-of-interest by calculating 165 texture features. Liver biopsy specimens were stained with Masson trichrome and assessed qualitatively (METAVIR fibrosis score and quantitatively (% collagen stained area. Using L1 regularization path algorithm, two texture-based multivariate linear models were constructed, one for quantitative and the other for quantitative histology prediction. The prediction performance of each model was assessed using receiver operating characteristics (ROC and correlation analyses. Results. The texture-based predicted fibrosis score significantly correlated with qualitative (r=0.698, P<0.001 and quantitative (r=0.757, P<0.001 histology. The prediction model for qualitative histology had 0.814–0.976 areas under the curve (AUC, 0.659–1.000 sensitivity, 0.778–0.930 specificity, and 0.674–0.935 accuracy, depending on the binary classification threshold. The prediction model for quantitative histology had 0.742–0.950 AUC, 0.688–1.000 sensitivity, 0.679–0.857 specificity, and 0.696–0.848 accuracy, depending on the binary classification threshold. Conclusion. CCE MRI and texture analysis may permit noninvasive assessment of liver fibrosis.

  8. Gravitational wave extraction in simulations of rotating stellar core collapse

    International Nuclear Information System (INIS)

    We perform simulations of general relativistic rotating stellar core collapse and compute the gravitational waves (GWs) emitted in the core-bounce phase of three representative models via multiple techniques. The simplest technique, the quadrupole formula (QF), estimates the GW content in the spacetime from the mass-quadrupole tensor only. It is strictly valid only in the weak-field and slow-motion approximation. For the first time, we apply GW extraction methods in core collapse that are fully curvature based and valid for strongly radiating and highly relativistic sources. These techniques are not restricted to weak-field and slow-motion assumptions. We employ three extraction methods computing (i) the Newman-Penrose (NP) scalar Ψ4, (ii) Regge-Wheeler-Zerilli-Moncrief master functions, and (iii) Cauchy-characteristic extraction (CCE) allowing for the extraction of GWs at future null infinity, where the spacetime is asymptotically flat and the GW content is unambiguously defined. The latter technique is the only one not suffering from residual gauge and finite-radius effects. All curvature-based methods suffer from strong nonlinear drifts. We employ the fixed-frequency integration technique as a high-pass waveform filter. Using the CCE results as a benchmark, we find that finite-radius NP extraction yields results that agree nearly perfectly in phase, but differ in amplitude by ∼1%-7% at core bounce, depending on the model. Regge-Wheeler-Zerilli-Moncrief waveforms, while, in general, agreeing in phase, contain spurious high-frequency noise of comparable amplitudes to those of the relatively weak GWs emitted in core collapse. We also find remarkably good agreement of the waveforms obtained from the QF with those obtained from CCE. The results from QF agree very well in phase and systematically underpredict peak amplitudes by ∼5%-11%, which is comparable to the NP results and is certainly within the uncertainties associated with core collapse physics.

  9. Charge collection and charge sharing in heavily irradiated n-side read-out silicon microstrip detectors

    International Nuclear Information System (INIS)

    Hadron radiation damage of n-bulk silicon detectors leads to a change in the effective space charge from positive to negative. This effect is called type inversion. Type inversion occurs after exposure to a fluence of a few 1013 proton cm-2 and is characterized by migration of the diode junction to the n+ implanted side (n-side) of the detector. After inversion the charge collection efficiency (CCE) of segmented detectors at low voltage is higher when the n-side, rather than the p-side, is read out. A p-side read out (p-in-n) and an n-side read out (n-in-n) strip detector with identical strip geometry and a wafer thickness of 200 μm were simultaneously and inhomogenously irradiated to a maximum fluence of 7x1014 proton cm-2 with 24 GeV c-1 protons. A comparison of the CCE at very high irradiation doses is shown with these two read out geometries. The inhomogeneous irradiation induces an inhomogenous distribution of the effective space charge with a transverse component of the electric field that could in principle affect the resolution properties of the microstrip detector. The inter-strip charge sharing properties, as a function of dose, for the n-in-n detector have been measured. No systematic distortion of the reconstructed cluster position was detected within the limits of the measurement accuracy. The detectors were manufactured using oxygen enriched silicon substrates to limit the degradation of the full depletion voltage under charged hadron irradiation. The measured CCE confirms that the use of oxygenated n-in-n detectors is viable up to fluences of 7x1014 proton cm-2

  10. Preparations for colon capsule endoscopy: prospective and randomized comparative study between two preparations for colon capsule endoscopy: PEG 2 liters + ascorbic acid versus PEG 4 liters

    Directory of Open Access Journals (Sweden)

    Federico Argüelles-Arias

    2014-05-01

    Full Text Available Introduction: PillCam© colon capsule endoscopy (CCE enables the study of colonic diseases in a safe and non-invasive way, although there are aspects that need to be improved. Current methods of bowel preparation lead to discordant rates of adequate cleansing and CCE excretion. Aims: To compare the efficacy of colon cleansing using two different regimes (2L PEG plus ascorbic acid versus 4L PEG alone for PillCam Colon (C2 capsule endoscopy. Methods: Fifty eight patients included in this prospective study and randomized to: Group A, PEG plus ascorbic acid regimen (n = 28, 12 F/16 M or group B, PEG alone regimen (n = 30, 14 F/16 M. The degree of cleansing was categorized into "excellent-good" or "fair-poor", according to Leighton's recently published preparation scale. CCE excretion rate and colon cleansing were assessed. Patients underwent to PillCam colon of second generation (C2. Results: Cleansing was considered to be excellent-good in 78 % of cases in group A and in 64 % of cases in group B, with no significant difference between the groups (p = 0.252. Nevertheless, when the grade of cleansing was analyzed in segments, a significant difference was found in the cecum and transverse colon. No differences were observed in the bubble effect between preparations. The excretion rate was 93 % in group A versus 70 % in group B (p = 0.043. Conclusions: These results suggest that a 2L PEG plus ascorbic acid regimen is at least as effective as a 4L PEG regimen. This regimen may be considered an effective alternative which would improve compliance because a smaller volume is required.

  11. Investigation of Ni/4H-SiC diodes as radiation detectors with low doped n-type 4H-SiC epilayers

    International Nuclear Information System (INIS)

    The development of SiC minimum ionising particle (MIP) detectors imposes severe constrains in the electronic quality and the thickness of the material due to the relatively high value of the energy required to produce an electron-hole pair in this material by MIP against the value for Si. In this work, particle detectors were made using semiconductor epitaxial undoped n-type 4H-SiC as the detection medium. The thickness of the epilayer is on the order of 40 μm and the detectors are realised by the formation of a nickel silicide on the silicon surface of the epitaxial layer (Schottky contact) and of the ohmic contact on the back side of 4H-SiC substrate. The low doping concentration ( congruent with 6x1013 cm-3) of the epilayer allows the detector to be totally depleted at relatively low reverse voltages ( congruent with 100 V). We present experimental data on the charge collection properties by using 5.486 MeV α-particles impinging on the Schottky contact. A 100% charge collection efficiency (CCE) is demonstrated for reverse voltages higher than the one needed to have a depletion region equal to the α-particle extrapolated range in SiC. The diffusion contribution of the minority change carriers to CCE is pointed out. By comparing measured CCE values to the outcomes of drift-diffusion simulation, values are inferred for the hole lifetime within the neutral region of the charge carrier generation layer

  12. Mouse Model of Cat Allergic Rhinitis and Intranasal Liposome-Adjuvanted Refined Fel d 1 Vaccine.

    Science.gov (United States)

    Tasaniyananda, Natt; Chaisri, Urai; Tungtrongchitr, Anchalee; Chaicumpa, Wanpen; Sookrung, Nitat

    2016-01-01

    Cats (Felis domesticus) are rich source of airborne allergens that prevailed in the environment and sensitized a number of people to allergy. In this study, a mouse model of allergic rhinitis caused by the cat allergens was developed for the first time and the model was used for testing therapeutic efficacy of a novel intranasal liposome-entrapped vaccines made of native Fel d 1 (major cat allergen) in comparison with the vaccine made of crude cat hair extract (cCE). BALB/c mice were sensitized with cCE mixed with alum intraperitoneally and intranasally. The allergic mice were treated with eight doses of either liposome (L)-entrapped native Fel d 1 (L-nFD1), L-cCE), or placebo on every alternate day. Vaccine efficacy evaluation was performed one day after provoking the treated mice with aerosolic cCE. All allergenized mice developed histological features of allergic rhinitis with rises of serum specific-IgE and Th2 cytokine gene expression. Serum IgE and intranasal mucus production of allergic mice reduced significantly after vaccination in comparison with the placebo mice. The vaccines also caused a shift of the Th2 response (reduction of Th2 cytokine expressions) towards the non-pathogenic responses: Th1 (down-regulation of the Th1 suppressive cytokine gene, IL-35) and Treg (up-regulation of IL-10 and TGF-β). In conclusions, a mouse model of allergic rhinitis to cat allergens was successfully developed. The intranasal, liposome-adjuvanted vaccines, especially the refined single allergen formulation, assuaged the allergic manifestations in the modeled mice. The prototype vaccine is worthwhile testing further for clinical use in the pet allergic patients. PMID:26954254

  13. Multi-satellite observations of magnetic fields in space plasmas

    International Nuclear Information System (INIS)

    The most common method of detecting electric currents in space has been by virtue of the magnetic perturbations they produce. A satellite can pass through a field-aligned ''Birkeland'' current and measure the in-situ magnetic perturbations. Satellite-borne magnetic field experiments may also be used to observe characteristics of resonant oscillations of the Earth's magnetic field at ULF frequencies. Examples of such measurements with magnetic field experiments on the Viking, AMPTE/CCE, and DMSP-F7 satellites will be presented. The Viking satellite, launched in February, 1986, is Sweden's first satellite and is in a polar orbit with 3.1 R/sub e/ apogee. AMPTE/CCE was launched in August, 1984, with satellites from West Germany and the United Kingdom, for the purpose of creating artificial comets in space. It is in an equatorial orbit with a 8.8 R/sub e/ apogee. The Defense Meteorological Satellite Program (DMSP)-F7 satellite was launched in October, 1983 into an 800 km circular sun-synchronous orbit in the 0830-2030 magnetic local time plane. Viking and AMPTE/CCE observed harmonic ULF pulsations when they were near the same flux tube, but separated by about 10 R/sub e/. These unique observations are used to investigate the characteristics and sources of multiple field line resonances of Alfven waves. On another occasion, Viking and DMSP-F7 observed similar magnetic perturbations at widely separated locations. The authors interpret these perturbations as due to a complicated system of large-scale stable Birkeland currents in the morning sector. This multi-satellite data set is in the early stages of exploration, but already confirms the usefulness of coordinated multi-position observations of magnetic fields in space

  14. Multipoint observations of a small substorm

    International Nuclear Information System (INIS)

    In this paper the authors present multipoint observations of a small substorm which occurred just after 0110 UT on April 25, 1985. The observations were made by spacecraft (AMPTE CCE, AMPTE IRM, DMSP F6, and DMSP F7), ground auroral stations (EISCAT magnetometer cross, Syowa, Narssarssuaq, Great Whale River, and Fort Churchill), and mid-latitude stations (Furstenfeldbruck, Toledo, and Argentine Island). These data provide them with a broad range of observations, including the latitudinal extent of the polar cap, visual identification of substorm aurorae and the magnetic perturbations produced directly beneath them, in situ magnetic field and energetic particle observations of the disruption of the cross-tail current sheet, and observations concerning the spatial expansion of the current disruption region from two radially aligned spacecraft. The DMSP data indicate that the event took place during a period when the polar cap was relatively contracted, yet the disruption of the current sheet was observed by CCE at 8.56 RE. They have been able to infer a considerable amount of detail concerning the structure and westward expansion of the auroral features associated with the event, and they show that those auroral surges were located more than 10 degree equatorward of the boundary between open and closed field lines. Moreover, they present evidence that the current sheet disruption observed by CCE in the neutral sheet was located on field lines which mapped to the westward traveling surge observed directly overhead of the ground station at Syowa. Furthermore, the observations strongly imply that disruption of the cross-tail current began in the near-Earth region and that it had a component of expansion which was radially antisunward

  15. Multisatellite and ground-based observations of transient ULF waves

    International Nuclear Information System (INIS)

    A unique alignment of the Active Magnetospheric Particle Tracer Explorers (AMPTE) CCE and Viking satellites with respect to the EISCAT Magnetometer Cross has provided an opportunity to study transient ULF pulsations associated with variations in solar wind plasma density observed by the IMP 8 satellite. These observations were acquired during a relatively quiet period on April 24, 1986, during the Polar Region and Outer Magnetosphere International Study (PROMIS) period. An isolated 4-mHz (4-min period) pulsation was detected on the ground which was associated with transverse magnetic field oscillations observed by Viking at a ∼ 2-RE altitude above the auroral zone and by CCE at ∼ 8-RE in the equatorial plane on nearly the same flux tube. CCE detected a compressional oscillation in the magnetic field with twice the period (∼ 10 min) of the transverse waves, and with a waveform nearly identical to an isolated oscillation in the solar wind plasma density measured by IMP 8. The authors conclude that the isolated 10-min oscillation in solar wind plasma density produced magnetic field compression oscillations inside the magnetosphere at the same frequency which also enhanced resonant oscillations at approximately twice the frequency that were already present. The ground magnetic field variations are due to ionospheric Hall currents driven by the electric field of the standing Alfven waves. The time delay between surface and satellite data acquired at different local times supports the conclusion that the periodic solar wind density variation excites a tailward traveling large-scale magnetosphere wave train which excites local field line resonant oscillations. They conclude that these transient magnetic field variations are not associated with magnetic field reconnection or flux transfer events

  16. Analysis of uniformity of as prepared and irradiated S.I. GaAs radiation detectors

    International Nuclear Information System (INIS)

    SI (semi-insulating) LEC (Liquid Encapsulated Czochralsky) GaAs (gallium arsenide) Schottky barrier detectors have been irradiated with high energy protons (24 GeV/c, fluence up to 16.45 x 1013 p/cm2). The detectors have been characterized in terms of I/V curves, charge collection efficiency (cce) for incident 5.48 MeV α-, 2 MeV proton and minimum ionizing β-particles and of cce maps by microprobe technique IBIC (Ion Beam Induced Charge). At the highest fluence a significant degradation of the electron and hole collection efficiencies and a remarkable improvement of the Full Width Half Maximum (FWHM) energy resolution have been measured with α- and proton particles. Furthermore, the reduction in the cce is greater than the one measured with β-particles and the energy resolution worsens with increasing the applied bias, Va, above the voltage Vd necessary to extend the electric field al the way to the ohmic contact. On the contrary, in the unirradiated detectors the charge collection efficiencies with α-, β- and proton particles are quite similar and the energy resolution improves with increasing Va > Vd. IBIC spectra and IBIC space maps obtained by scanning a focused (8 microm2) 2 MeV proton microbeam on front (Schottky) and back (ohmic) contacts, support the observed electric field dependence of the energy resolution both in unirradiated and most irradiated detectors. The results obtained let them explain the effect of the electric field strength and the plasma on the collection of the charge carriers and the FWHM energy resolution

  17. Cytotoxicity of proparacaine to human corneal endothelial cells in vitro.

    Science.gov (United States)

    Wen, Qian; Fan, Tingjun; Bai, Suran; Sui, Yunlong

    2015-08-01

    Proparacaine is a widely used topical anesthetic in ophthalmic optometry and surgery, and has been reported to have cytotoxic effects on rabbit corneal endothelial cells after prolonged and repeated usage. Since rabbit is an exceptive mammal whose corneal endothelial cells still maintaining proliferation abilities even in adulthood, whether proparacaine has cytotoxic effects on human corneal endothelial (HCE) cells need to be further verified. Our objectives in the present study were to investigate the cytotoxicity to HCE cells of proparacaine and its underlying mechanisms in vitro and verify the cytotoxicity using cat corneal endothelial (CCE) cells in an in vivo model of cat corneas. Cytotoxic evaluation results indicated that a dose- and time-dependent toxic response of HCE cells to proparacaine over 0.03125% was rated based on morphology and viability, and a toxic response of CCE cells to 0.5% (clinical applied dosage) proparacaine was also rated based on cell density and histology. Importantly, treatment with proparacaine resulted in significant elevation of plasma membrane permeability, cell cycle arrest at S phase, fragmentation of genomic DNA, formation of apoptotic bodies, and externalization of phosphatidylserine (PS) of HCE cells. Moreover, proparacaine demonstrated disrupting effects on mitochondrial transmembrane potential (MTP) of HCE cells and activating effects on caspase-3, -8 and -9. This study demonstrates that proparacaine has notable cytotoxicity to both HCE cells in vitro and CCE cells in vivo, and its dose- and time-dependent cytotoxicity to HCE cells is achieved by inducing apoptosis via a mitochondrion-mediated caspase-dependent pathway. These findings provide new insights into the cytotoxicity and apoptosis-inducing effect of local anesthetics which should be used with great caution in the eye clinic. PMID:26165639

  18. Government control or low carbon lifestyle? – Analysis and application of a novel selective-constrained energy-saving and emission-reduction dynamic evolution system

    International Nuclear Information System (INIS)

    This paper explores a novel selective-constrained energy-saving and emission-reduction (ESER) dynamic evolution system, analyzing the impact of cost of conserved energy (CCE), government control, low carbon lifestyle and investment in new technology of ESER on energy intensity and economic growth. Based on artificial neural network, the quantitative coefficients of the actual system are identified. Taking the real situation in China for instance, an empirical study is undertaken by adjusting the parameters of the actual system. The dynamic evolution behavior of energy intensity and economic growth in reality are observed, with the results in perfect agreement with actual situation. The research shows that the introduction of CCE into ESER system will have certain restrictive effect on energy intensity in the earlier period. However, with the further development of the actual system, carbon emissions could be better controlled and energy intensity would decline. In the long run, the impacts of CCE on economic growth are positive. Government control and low carbon lifestyle play a decisive role in controlling ESER system and declining energy intensity. But the influence of government control on economic growth should be considered at the same time and the controlling effect of low carbon lifestyle on energy intensity should be strengthened gradually, while the investment in new technology of ESER can be neglected. Two different cases of ESER are proposed after a comprehensive analysis. The relations between variables and constraint conditions in the ESER system are harmonized remarkably. A better solution to carry out ESER is put forward at last, with numerical simulations being carried out to demonstrate the results. - Highlights: • Use of nonlinear dynamical method to model the selective-constrained ESER system. • Monotonic evolution curves of energy intensity and economic growth are obtained. • Detailed analysis of the game between government control and low

  19. Low-cost monitoring of Campylobacter in poultry houses by air sampling and quantitative PCR.

    Science.gov (United States)

    Søndergaard, M S R; Josefsen, M H; Löfström, C; Christensen, L S; Wieczorek, K; Osek, J; Hoorfar, J

    2014-02-01

    The present study describes the evaluation of a method for the quantification of Campylobacter by air sampling in poultry houses. Sampling was carried out in conventional chicken houses in Poland, in addition to a preliminary sampling in Denmark. Each measurement consisted of three air samples, two standard boot swab fecal samples, and one airborne particle count. Sampling was conducted over an 8-week period in three flocks, assessing the presence and levels of Campylobacter in boot swabs and air samples using quantitative real-time PCR. The detection limit for air sampling was approximately 100 Campylobacter cell equivalents (CCE)/m3. Airborne particle counts were used to analyze the size distribution of airborne particles (0.3 to 10 μm) in the chicken houses in relation to the level of airborne Campylobacter. No correlation was found. Using air sampling, Campylobacter was detected in the flocks right away, while boot swab samples were positive after 2 weeks. All samples collected were positive for Campylobacter from week 2 through the rest of the rearing period for both sampling techniques, although levels 1- to 2-log CCE higher were found with air sampling. At week 8, the levels were approximately 10(4) and 10(5) CCE per sample for boot swabs and air, respectively. In conclusion, using air samples combined with quantitative real-time PCR, Campylobacter contamination could be detected earlier than by boot swabs and was found to be a more convenient technique for monitoring and/or to obtain enumeration data useful for quantitative risk assessment of Campylobacter. PMID:24490929

  20. Characterisation of vertical gradient freeze semi-insulating InP for use as a nuclear radiation detector

    International Nuclear Information System (INIS)

    The performance of a nuclear radiation detector fabricated from Vertical Gradient Freeze (VGF) semi-insulating Fe-doped InP was investigated. Pulse height spectra were acquired when the detector was irradiated with alpha particles from 241Am, as a function of temperature and detector bias voltage. The spectroscopic performance of the detector was limited at room temperature due to the presence of a high leakage current. At a bias of -150 V, a room temperature leakage current density of 2.4x10-6 A/mm2 was observed which reduced to 7.1x10-8 A/mm2 at a temperature of -21 degree sign C. By biasing the irradiated detector contact at either a negative or positive potential, the charge collection efficiency (CCE) was measured separately for pulses produced predominantly by electron transport and for pulses produced predominantly by hole transport, respectively. At -21 degree sign C a maximum CCE of 72% was obtained for the electron signal and 44% for the hole signal. As a function of bias the CCE of the electrons remained constant in the temperature range -21 degree sign C to +19 degree sign C, whilst that of the holes exhibited a significant variation. By comparison with the Hecht relationship estimates of the carrier mobility-lifetime (μτ) products are deduced, which are similar for both holes and electrons and in the range 5x10-7-8x10-7 cm2/V. A reduction in μτ is observed at lower temperature for holes, whereas the value for electrons remains constant over the temperature range studied

  1. Identification of carboxylesterase genes implicated in temephos resistance in the dengue vector Aedes aegypti.

    Directory of Open Access Journals (Sweden)

    Rodolphe Poupardin

    2014-03-01

    Full Text Available BACKGROUND: Thailand is currently experiencing one of its worst dengue outbreaks in decades. As in most countries where this disease is endemic, dengue control in Thailand is largely reliant on the use of insecticides targeting both immature and adult stages of the Aedes mosquito, with the organophosphate insecticide, temephos, being the insecticide of choice for attacking the mosquito larvae. Resistance to temephos was first detected in Aedes aegypti larvae in Thailand approximately 25 years ago but the mechanism responsible for this resistance has not been determined. PRINCIPAL FINDINGS: Bioassays on Ae. aegypti larvae from Thailand detected temephos resistance ratios ranging from 3.5 fold in Chiang Mai to nearly 10 fold in Nakhon Sawan (NS province. Synergist and biochemical assays suggested a role for increased carboxylesterase (CCE activities in conferring temephos resistance in the NS population and microarray analysis revealed that the CCE gene, CCEae3a, was upregulated more than 60 fold in the NS population compared to the susceptible population. Upregulation of CCEae3a was shown to be partially due to gene duplication. Another CCE gene, CCEae6a, was also highly regulated in both comparisons. Sequencing and in silico structure prediction of CCEae3a showed that several amino acid polymorphisms in the NS population may also play a role in the increased resistance phenotype. SIGNIFICANCE: Carboxylesterases have previously been implicated in conferring temephos resistance in Ae aegypti but the specific member(s of this family responsible for this phenotype have not been identified. The identification of a strong candidate is an important step in the development of new molecular diagnostic tools for management of temephos resistant populations and thus improved control of dengue.

  2. Calcium-sensing receptor activation contributed to apoptosis stimulates TRPC6 channel in rat neonatal ventricular myocytes

    International Nuclear Information System (INIS)

    Capacitative calcium entry (CCE) refers to the influx of calcium through plasma membrane channels activated on depletion of endoplasmic sarcoplasmic/reticulum (ER/SR) Ca2+ stores, which is performed mainly by the transient receptor potential (TRP) channels. TRP channels are expressed in cardiomyocytes. Calcium-sensing receptor (CaR) is also expressed in rat cardiac tissue and plays an important role in mediating cardiomyocyte apoptosis. However, there are no data regarding the link between CaR and TRP channels in rat heart. In this study, in rat neonatal myocytes, by Ca2+ imaging, we found that the depletion of ER/SR Ca2+ stores by thapsigargin (TG) elicited a transient rise in cytoplasmic Ca2+ ([Ca2+]i), followed by sustained increase depending on extracellular Ca2+. But, TRP channels inhibitor (SKF96365), not L-type channels or the Na+/Ca2+ exchanger inhibitors, inhibited [Ca2+]i relatively high. Then, we found that the stimulation of CaR with its activator gadolinium chloride (GdCl3) or by an increased extracellular Ca2+([Ca2+]o) increased the concentration of intracelluar Ca2+, whereas, the sustained elevation of [Ca2+]i was reduced in the presence of SKF96365. Similarly, the duration of [Ca2+]i increase was also shortened in the absence of extracellular Ca2+. Western blot analysis showed that GdCl3 increased the expression of TRPC6, which was reversed by SKF96365. Additionally, SKF96365 reduced cardiomyocyte apoptosis induced by GdCl3. Our results suggested that CCE exhibited in rat neonatal myocytes and CaR activation induced Ca2+-permeable cationic channels TRPCs to gate the CCE, for which TRPC6 was one of the most likely candidates. TRPC6 channel was functionally coupled with CaR to enhance the cardiomyocyte apoptosis.

  3. Temporal and spatial patterns of microbial community biomass and composition in the Southern California Current Ecosystem

    Science.gov (United States)

    Taylor, Andrew G.; Landry, Michael R.; Selph, Karen E.; Wokuluk, John J.

    2015-02-01

    As part of the California Current Ecosystem Long Term Ecological Research (CCE-LTER) Program, samples for epifluorescence microscopy and flow cytometry (FCM) were collected at ten 'cardinal' stations on the California Cooperative Oceanic Fisheries Investigations (CalCOFI) grid during 25 quarterly cruises from 2004 to 2010 to investigate the biomass, composition and size-structure of microbial communities within the southern CCE. Based on our results, we divided the region into offshore, and inshore northern and southern zones. Mixed-layer phytoplankton communities in the offshore had lower biomass (16±2 μg C L-1; all errors represent the 95% confidence interval), smaller size-class cells and biomass was more stable over seasonal cycles. Offshore phytoplankton biomass peaked during the winter months. Mixed-layer phytoplankton communities in the northern and southern inshore zones had higher biomass (78±22 and 32±9 μg C L-1, respectively), larger size-class cells and stronger seasonal biomass patterns. Inshore communities were often dominated by micro-size (20-200 μm) diatoms; however, autotrophic dinoflagellates dominated during late 2005 to early 2006, corresponding to a year of delayed upwelling in the northern CCE. Biomass trends in mid and deep euphotic zone samples were similar to those seen in the mixed-layer, but with declining biomass with depth, especially for larger size classes in the inshore regions. Mixed-layer ratios of autotrophic carbon to chlorophyll a (AC:Chl a) had a mean value of 51.5±5.3. Variability of nitracline depth, bin-averaged AC:Chl a in the mixed-layer ranged from 40 to 80 and from 22 to 35 for the deep euphotic zone, both with significant positive relationships to nitracline depth. Total living microbial carbon, including auto- and heterotrophs, consistently comprised about half of particulate organic carbon (POC).

  4. Combined Cycle Engine Large-Scale Inlet for Mode Transition Experiments: System Identification Rack Hardware Design

    Science.gov (United States)

    Thomas, Randy; Stueber, Thomas J.

    2013-01-01

    The System Identification (SysID) Rack is a real-time hardware-in-the-loop data acquisition (DAQ) and control instrument rack that was designed and built to support inlet testing in the NASA Glenn Research Center 10- by 10-Foot Supersonic Wind Tunnel. This instrument rack is used to support experiments on the Combined-Cycle Engine Large-Scale Inlet for Mode Transition Experiment (CCE? LIMX). The CCE?LIMX is a testbed for an integrated dual flow-path inlet configuration with the two flow paths in an over-and-under arrangement such that the high-speed flow path is located below the lowspeed flow path. The CCE?LIMX includes multiple actuators that are designed to redirect airflow from one flow path to the other; this action is referred to as "inlet mode transition." Multiple phases of experiments have been planned to support research that investigates inlet mode transition: inlet characterization (Phase-1) and system identification (Phase-2). The SysID Rack hardware design met the following requirements to support Phase-1 and Phase-2 experiments: safely and effectively move multiple actuators individually or synchronously; sample and save effector control and position sensor feedback signals; automate control of actuator positioning based on a mode transition schedule; sample and save pressure sensor signals; and perform DAQ and control processes operating at 2.5 KHz. This document describes the hardware components used to build the SysID Rack including their function, specifications, and system interface. Furthermore, provided in this document are a SysID Rack effectors signal list (signal flow); system identification experiment setup; illustrations indicating a typical SysID Rack experiment; and a SysID Rack performance overview for Phase-1 and Phase-2 experiments. The SysID Rack described in this document was a useful tool to meet the project objectives.

  5. K-nearest-neighbor conditional entropy approach for the assessment of the short-term complexity of cardiovascular control

    International Nuclear Information System (INIS)

    Complexity analysis of short-term cardiovascular control is traditionally performed using entropy-based approaches including corrective terms or strategies to cope with the loss of reliability of conditional distributions with pattern length. This study proposes a new approach aiming at the estimation of conditional entropy (CE) from short data segments (about 250 samples) based on the k-nearest-neighbor technique. The main advantages are: (i) the control of the loss of reliability of the conditional distributions with the pattern length without introducing a priori information; (ii) the assessment of complexity indexes without fixing the pattern length to an arbitrary low value. The approach, referred to as k-nearest-neighbor conditional entropy (KNNCE), was contrasted with corrected approximate entropy (CApEn), sample entropy (SampEn) and corrected CE (CCE), being the most frequently exploited approaches for entropy-based complexity analysis of short cardiovascular series. Complexity indexes were evaluated during the selective pharmacological blockade of the vagal and/or sympathetic branches of the autonomic nervous system. We found that KNNCE was more powerful than CCE in detecting the decrease of complexity of heart period variability imposed by double autonomic blockade. In addition, KNNCE provides indexes indistinguishable from those derived from CApEn and SampEn. Since this result was obtained without using strategies to correct the CE estimate and without fixing the embedding dimension to an arbitrary low value, KNNCE is potentially more valuable than CCE, CApEn and SampEn when the number of past samples most useful to reduce the uncertainty of future behaviors is high and/or variable among conditions and/or groups. (paper)

  6. Covered Clause Elimination

    CERN Document Server

    Heule, Marijn; Biere, Armin

    2010-01-01

    Generalizing the novel clause elimination procedures developed in [M. Heule, M. J\\"arvisalo, and A. Biere. Clause elimination procedures for CNF formulas. In Proc. LPAR-17, volume 6397 of LNCS, pages 357-371. Springer, 2010.], we introduce explicit (CCE), hidden (HCCE), and asymmetric (ACCE) variants of a procedure that eliminates covered clauses from CNF formulas. We show that these procedures are more effective in reducing CNF formulas than the respective variants of blocked clause elimination, and may hence be interesting as new preprocessing/simplification techniques for SAT solving.

  7. Dicty_cDB: SHA589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Oryza sativa (japonica cultivar-group) genomic DNA, chromosome 2, PAC clone:P0437H03. 40 3.6 3 AF506028 |AF506028.1 Poncirus trif...212( CR954204 |pid:none) Ostreococcus tauri strain OTTH05... 89 1e-16 CP000584_198( CP000584 |pid:none) Ostreococcus lucimari...nus CCE9901... 88 2e-16 AY098895_1( AY098895 |pid:none) Citrus hybrid cultivar starch phos....CTGTTATCTCTGGTGGTGATAAAACCAACAACNCTTTAAAACCAAAACAAACTACAAA sequence update 2002.10.25 Translated Amino Acid sequence illffs...NDINAXSIERLSPLTFVKQTXAXPLSVISGGDKTNNXLKP KQTT Translated Amino Acid sequence (All Frames) Frame A: illffssin

  8. GaN-based PIN alpha particle detectors

    Energy Technology Data Exchange (ETDEWEB)

    Wang Guo [Peking University, Shenzhen Graduate School, Guangdong Shenzhen 518055 (China); Peking University, Beijing, 100871 (China); Fu Kai; Yao Changsheng [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Science, Jiangsu Suzhou 215123 (China); Su Dan; Zhang Guoguang [China Institute of Atomic Energy, Beijing 102413 (China); Wang Jinyan [Peking University, Beijing, 100871 (China); Lu Min, E-mail: mlu2006@sinano.ac.cn [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Science, Jiangsu Suzhou 215123 (China)

    2012-01-21

    GaN-based PIN alpha particle detectors are studied in this article. The electrical properties of detectors have been investigated, such as current-voltage (I-V) and capacitance-voltage (C-V). The reverse current of all detectors is in nA range applied at 30 V, which is suitable for detector operation. The charge collection efficiency (CCE) is measured to be approximately 80% but the energy resolution is calculated to be about 40% mostly because the intrinsic layer is not sufficiently thick enough.

  9. CAPACIDAD COMBINATORIA PARA RENDIMIENTO DE GRANO Y CARACTERES DE CALIDAD MALTERA EN CEBADA (Hordeum vulgare L. Combining ability for grain yield and malting quality traits in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Rudy Rivas P.

    2002-07-01

    Full Text Available Se cruzaron seis genotipos de cebada de ciclo de desarrollo primaveral en un arreglo dialelo, con el fin de estudiar sus capacidades combinatorias para rendimiento de grano y doce caracteres de calidad maltera. El comportamiento de los híbridos F1 fue analizado utilizando el Modelo I, método 2 de Griffing. El análisis de capacidad combinatoria general (CCG, de capacidad combinatoria específica (CCE y la relación CCG/CCE, demostraron que ocho de los trece caracteres estudiados mostraron expresión asociada a efectos génicos de tipo aditivo, que fueron: peso de grano, extracto de malta, viscosidad, friabilidad, proteína de la malta, proteína soluble, índice de Kolbach y amino nitrógeno libre (FAN: free amino nitrogen. Por otra parte en la expresión de los caracteres calibre de grano, diferencia del extracto, e índice de Hartong fueron importantes tanto los efectos aditivos como los no aditivos, siendo los primeros de mayor magnitud. Solo el rendimiento de grano y el poder diastásico mostraron predominio de acción génica de tipo no aditivo (dominancia y sobredominancia, aunque los efectos aditivos también estuvieron presentes.Six spring barley (Hordeum vulgare L. genotypes were crossed in a diallel system to study combining ability for grain yield and twelve malting quality traits. The F1 hybrids behavior was analyzed using Griffing’s Model I, method 2. The analysis for general combining ability (CCG, specific combining ability (CCE and the relationship CCG/CCE showed that expression of eight out of the thirteen traits were associated with genes which were additive in their effects: grain weight, malt extract, viscosity, friability, malt protein, soluble protein, Kolbach index and free amino nitrogen (FAN. On the other hand, the expression of grain plumpness, extract difference and the Hartong index showed both additive and non-additive genetic control, the former being of greater magnitude. Only grain yield and diastatic power

  10. El carácter como predictor de trastornos de la personalidad en adictos: la tipología caracterial de Cloninger y su abordaje psicosocial

    OpenAIRE

    Eduardo J. Pedrero Pérez; Álvaro Olivar Arroyo; Carmen Puerta García

    2007-01-01

    El presente estudio aborda las relaciones de las dimensiones caracteriales del modelo de Cloninger con los trastornos de la personalidad. Se obtiene una muestra de sujetos (N=565) que inician tratamiento por conductas adictivas en un centro ambulatorio (CAD 4 San Blas, Instituto de Adicciones, Madrid Salud), y cumplimentan el TCI-R, el MCMI-II, el VIP y el CCE-R. Según los criterios de Cloninger y, mediante análisis discriminante, son clasificados en los diferentes tipos caracteriales. Se com...

  11. Ciclo de convesrión de efectivo en las grandes empresas de comercio al detal en Colombia (1998-2002)

    OpenAIRE

    Néstor Moreno Meza

    2004-01-01

    El presente artículo estudia las magnitudes y las implicaciones financieras del ciclo de conversión de efectivo (CCE), concepto desarrollado por Richards y Laughlin (1980) para integrar tres indicadores fundamentales del capital de trabajo y de la gestión del circulante en la empresa comercial, como son los días de inventario, los días de cartera y los días de crédito de proveedores. Estimado a partir de los estados financieros de una muestra de cinco grandes ...

  12. Initial signatures of magnetic field and energetic particle fluxes at tail reconfiguration - Explosive growth phase

    Science.gov (United States)

    Ohtani, S.; Takahashi, K.; Zanetti, L. J.; Potemra, T. A.; McEntire, R. W.; Iijima, T.

    1992-12-01

    The initial signatures of tail field reconfiguration observed in the near-earth magnetotail are examined using data obtained by the AMPTE/CCE magnetometer and the Medium Energy Particle Analyzer. It is found that the tail reconfiguration events could be classified as belonging to two types, Type I and Type II. In Type I events, a current disruption is immersed in a hot plasma region expanding from inward (earthward/equatorward) of the spacecraft; consequently, the spacecraft is immersed in a hot plasma region expanding from inward. The Type II reconfiguration event is characterized by a distinctive interval (explosive growth phase) just prior to the local commencement of tail phase.

  13. ESTRUTURA ORGANIZACIONAL E GESTÃO DO CONHECIMENTO [doi: 10.5329/RECADM.20050402002

    OpenAIRE

    Edoardo Perrotti; Eduardo Pinheiro Gondim de Vasconcellos

    2005-01-01

    Resumo Determinar quais os efeitos dos critérios de departamentalização em estruturas organizacionais na geração e disseminação do conhecimento é o objetivo principal proposto nesta pesquisa. Para isto há necessidade de entender como o conhecimento e as informações circulam dentro das organizações, quais tipos de conhecimento são estes, quais processos são utilizados para dissemina&cce...

  14. Dicty_cDB: Contig-U03494-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MSMg01-107J22.... 40 1.3 2 ( CP000102 ) Methanosphaera stadtmanae DSM 3091, compl...st* tsdfrkntii*tkytitrr*iiintll*n*nirncngfkft**sicnsnyiykkilfke* ynaiwseigdvimfihcm*nrg*sfryrll**yy*sitiryyk... subunit;... 36 0.58 CP000582_275( CP000582 |pid:none) Ostreococcus lucimarinus CCE9901... 36 0.58 ( P29056 ) RecName: Full=Tran...CHO_OF395xh17r1.ab1 CHO_OF Nicotiana tabacum geno... 46 1.4 1 ( AQ057774 ) CIT-HS...taurus genomic clon... 46 1.4 1 ( EB592928 ) AGENCOURT_51786805 D. ananassae EST Drosophila an

  15. Dicty_cDB: Contig-U15581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 442 ) ISB1-85H2_Sp6.1 ISB1 Xenopus (Silurana) tropicali... 32 3.7 4 ( DU219176 ) 1098553709230 CHORI-243 Ovi...osoma brucei chromosome 5 c... 46 0.006 AC003673_4( AC003673 |pid:none) Arabidopsis thaliana... 40 0.44 CP000591_109( CP000591 |pid:none) Ostreococcus lucimarinus CCE9901... 40 0.58 CP001334_98( CP001334 |pid:none) Micromona...tqapvaksphsitwipiv*pvap*rilkrvskftcsmdhvitlnc*cmlvsql kpismilihsnyic*kvimkfvmikfissknvv...lemvsl*t*ikiqpqmnshsn*fhsiv smpsvnkklvqshhhkylvniiiimainsnlnhwlsklslkrmkrkliqiwfkhskvnll liqpl*krmnkn*krihlq

  16. Dicty_cDB: Contig-U09598-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lksldr*wshiqqlnskrhqtippkil*tlqhitvfhiwlxsv qp--- ---xx*xilviml*mdwvqqrvimkmqmmvkls*vqr*siqkqri*nwnirdwilipl...WO2007089584. 48 0.46 1 ( Z49154 ) Human DNA sequence from clone LA04NC01-1C2 on chrom... 48 0.46 1 ( AL390059 ) Human... ( AL161492 ) Arabidopsis thaliana DNA chromosome 4, contig fra... 44 7.2 1 ( AF069300 ) Arabidopsis thaliana...ys full-length cDNA clone ZM... 54 6e-06 AE017343_104( AE017343 |pid:none) Cryptococcus neoformans var. n...eo... 52 1e-05 CP000595_142( CP000595 |pid:none) Ostreococcus lucimarinus CCE9901

  17. Dicty_cDB: VFC892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vhvhkqqd**qqyleqqds lvdi*yny*hvqvfk*lyhtdvkmkvfvisrcwan*vksfqfvsileianqlkeqfhtqt lssiwlvvimklvishstismfmq...hqvqvvkfmnlqvmkylhgmnf*i*llmvqlnt vn*ifqfqmis*nsslniy*kdslviqislkiksiiiiki*plllvh*l*ki*mlqlpqf kkrlirlsrmyrpgkffnaianpqnk*ei Tran...ete genome, strain:MW2, section 3/10. 36 0.24 9 AQ143038 |AQ143038.1 HS_3064_A1_A03_MR CIT Approved Human Ge... trichocarpa clone WS01210_... 126 4e-47 CP000590_186( CP000590 |pid:none) Ostreococcus lucimarinus CCE9901...... 122 4e-47 AK317648_1( AK317648 |pid:none) Arabidopsis thaliana AT2G20360 mRN..

  18. Dicty_cDB: FC-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vpsilvhl*iskslsklwvvysl*viklvlssivplrfgmikm vlsslknisknwrnisfklkvtlveky*ivlkn*kslvimslklffifilkn*kkvkiqi iqn...mplete sequence. 44 0.010 8 AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 44 0.011 4 AL132715 |AL132715.3 Human... chromosome 14 DNA sequence *** IN PROGRESS *** BAC R-368E9 of library RPCI-11 from chromosome..._16( AC079829 |pid:none) Arabidopsis thaliana chromosome 1... 100 1e-19 AF480496_13( AF480496 |pid:none) Ory... sativa Japonica Group cDNA c... 100 1e-19 CP000594_315( CP000594 |pid:none) Ostreococcus lucimarinus CCE990

  19. Dicty_cDB: SSH696 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qkitmepsytqinqfq p*fqlnlk*il*likllvimmkkd*--- ---slvflivvslkllnvmlmvihlltlkplsftq...nordered pieces. 44 0.95 3 AB028606 |AB028606.1 Arabidopsis thaliana genomic DNA,... chromosome 5, BAC clone:F16F17. 44 1.8 1 AL353683 |AL353683.7 Human DNA sequence from clone RP11-450P11 on ...p 5018074-5200947 strain AX4, complete sequence. 38 2.5 4 AL133415 |AL133415.13 Human...57 CP000582_324( CP000582 |pid:none) Ostreococcus lucimarinus CCE9901... 36 0.74 AK168925_1( AK168925 |pid:n

  20. Dicty_cDB: VFE785 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klvlssivplrfgmik mvlsslknisknwrnisfklkvtlveky*ivlkn*kslvimslklffifilkn*kkvkiq iiqn*nqiiqiqkf*ki Frame B: QSI... 38 0.25 6 AL132715 |AL132715.3 Human chromosome 14 DNA sequence *** IN PROGRESS *** BAC R-368E9 of library ...RPCI-11 from chromosome 14 of Homo sapiens (Human). 38 0.34 6 AC115577 |AC115577....594 |pid:none) Ostreococcus lucimarinus CCE9901... 61 4e-08 AF480496_13( AF480496 |pid:none) Oryza sativa cl...7 AC016662_15( AC016662 |pid:none) Arabidopsis thaliana chromosome 1... 57 6e-07

  1. Dicty_cDB: FC-AX18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itfsfyyk qlidfqlnsn*mryq*cfil*lmhislvimlqlhqfyvviglhlvvviivpf*rllvqf* sfvlwlislls...112644 |AC112644.3 Homo sapiens 3 BAC RP11-10O22 (Roswell Park Cancer Institute Human... BAC Library) complete sequence. 32 0.14 9 AC104640 |AC104640.3 Homo sapiens 3 BAC RP11-809F4 (Roswell Park Can...e) Medicago truncatula clone mth2-14... 238 2e-61 AK221780_1( AK221780 |pid:none) Arabidopsis thaliana mRNA ...4_455( CP000584 |pid:none) Ostreococcus lucimarinus CCE9901... 201 4e-50 BT052563_1( BT052563 |pid:none) Med

  2. GaN-based PIN alpha particle detectors

    International Nuclear Information System (INIS)

    GaN-based PIN alpha particle detectors are studied in this article. The electrical properties of detectors have been investigated, such as current-voltage (I-V) and capacitance-voltage (C-V). The reverse current of all detectors is in nA range applied at 30 V, which is suitable for detector operation. The charge collection efficiency (CCE) is measured to be approximately 80% but the energy resolution is calculated to be about 40% mostly because the intrinsic layer is not sufficiently thick enough.

  3. The Cryogenic Transient Current Technique (C-TCT) measurement setup of CERN RD39 Collaboration

    CERN Document Server

    Härkönen, J; Verbitskaya, E; Czellar, S; Pusa, P; Li, Z; Niinikoski, T O

    2007-01-01

    The CERN RD39 Collaboration has constructed a Transient Current Technique (TCT) measurement setup, which is capable to operate below liquid nitrogen temperatures. By analyzing the current transients, it is possible to extract the full depletion voltage, effective trapping time, electric field distribution and the sign of the space charge in the silicon bulk. Our results show that the effective space charge and trapping can be manipulated by charge injection and temperature. This might allow significantly higher Charge Collection Efficiency (CCE) compared to the detectors operating under normal reverse bias and at temperatures from 0 to .

  4. Transcriptomic and phylogenetic analysis of Culex pipiens quinquefasciatus for three detoxification gene families

    Directory of Open Access Journals (Sweden)

    Yan Liangzhen

    2012-11-01

    Full Text Available Abstract Background The genomes of three major mosquito vectors of human diseases, Anopheles gambiae, Aedes aegypti, and Culex pipiens quinquefasciatus, have been previously sequenced. C. p. quinquefasciatus has the largest number of predicted protein-coding genes, which partially results from the expansion of three detoxification gene families: cytochrome P450 monooxygenases (P450, glutathione S-transferases (GST, and carboxyl/cholinesterases (CCE. However, unlike An. gambiae and Ae. aegypti, which have large amounts of gene expression data, C. p. quinquefasciatus has limited transcriptomic resources. Knowledge of complete gene expression information is very important for the exploration of the functions of genes involved in specific biological processes. In the present study, the three detoxification gene families of C. p. quinquefasciatus were analyzed for phylogenetic classification and compared with those of three other dipteran insects. Gene expression during various developmental stages and the differential expression responsible for parathion resistance were profiled using the digital gene expression (DGE technique. Results A total of 302 detoxification genes were found in C. p. quinquefasciatus, including 71 CCE, 196 P450, and 35 cytosolic GST genes. Compared with three other dipteran species, gene expansion in Culex mainly occurred in the CCE and P450 families, where the genes of α-esterases, juvenile hormone esterases, and CYP325 of the CYP4 subfamily showed the most pronounced expansion on the genome. For the five DGE libraries, 3.5-3.8 million raw tags were generated and mapped to 13314 reference genes. Among 302 detoxification genes, 225 (75% were detected for expression in at least one DGE library. One fourth of the CCE and P450 genes were detected uniquely in one stage, indicating potential developmentally regulated expression. A total of 1511 genes showed different expression levels between a parathion-resistant and a

  5. Freestanding single crystal chemical vapor deposited diamond films produced using a lift-off method: Response to α-particles from 241Am and crystallinity

    International Nuclear Information System (INIS)

    Thick (∼100 μm) undoped diamond films were grown homoepitaxially on single crystal (SC) diamond substrates by microwave plasma chemical vapor deposition (CVD). To form a freestanding SC diamond film (plate), the substrate was pre-ion-implanted with high-energy ion beams before the film growth, and after the thick-film deposition, the substrate was eliminated using a lift-off method, resulting in fabrication of a SC CVD diamond plate. Two samples were prepared; sample 1 was grown on a (0 0 1) oriented, nitrogen doped CVD SC diamond at ∼900 °C with the input microwave power of 1.7 kW, while sample 2 was grown on a (0 0 1) oriented, high-pressure high-temperature synthesized type-Ib SC diamond at ∼900 °C with the input microwave power of 1.25 kW. The formed SC plates have high optical transparencies, indicating no remarkable optical absorptions seen in the wavelength from ultraviolet to near infrared. The photoluminescence (PL) spectra of both samples show strong free exciton FE peaks, while in sample 2 relatively strong optical emissions corresponding to nitrogen related centers were observed in the visible region. After the metal electrodes were formed on both faces of the SC diamond plate to fabricate a sandwich-type diamond particle detector, the energy spectra of 5.486 MeV α-particles from 241Am were measured. The charge collection efficiencies (CCEs) of sample 1 were CCE = 98% for a hole transport and CCE = 89% for an electron transport, respectively, while CCEs of sample 2 were CCE = 80% for a hole transport and CCE = 78% for an electron transport, respectively. These results indicate that both holes and electrons in sample 2 were trapped much more than those in sample 1. Possible candidates of carrier capture centers are nitrogen and/or nitrogen-vacancy centers observed in PL, nonradiative defect (complex) centers, extended defects such as threading dislocations observed in micrographs taken with polarizers. The different growth conditions most

  6. Signals in non-irradiated and irradiated single sided silicon detectors

    CERN Document Server

    Kramberger, G; Mikuz, M

    2000-01-01

    A simulation of signals in silicon microstrip detectors ($p^+-n-n^+$) has been written. Electron-hole pairs are created by electrons from $^{90}$Sr beta source with Landau fluctuations considered. Simulated induced currents calculated according to Ramo's theoremare integrated and shaped. For irradiated sensors, trapping is included in the drift simulation. Using many Monte Carlo generated events, detector's charge collection efficiencyis calculated as a function of shaping time, applied voltage, and temperature. Results are compared with CCE measurements of unirradiated and irradiated strip detectors using 25ns shaping (SCT 32A) readout chip.

  7. Otimizaçâo das condições de preparação de eletrodos à base de carbono cerâmico utilizando-se planejamento fatorial Optimization of electrodes conditions preparation based carbon ceramic using factorial design

    Directory of Open Access Journals (Sweden)

    Tatiane Skeika

    2010-01-01

    Full Text Available Different parameters of carbon ceramic electrodes (CCE preparation, such as type of precursor, carbon material, catalyst amount, among others, significantly influence the morphological properties and consequently their electrochemical responses. This paper describes a 2³ factorial design (2 factors and 3 levels with central point replicates, which the factors analyzed were catalyst amount (HCl 12 mol L-1, graphite/precursor ratio, and precursor type (TEOS - tetraethoxysilane and MTMOS - methyltrimetoxysilane. The design resulted in a significant third order interaction for peak current values (Ipa and a second order interaction for potential difference (ΔE, between thefactors studied, which could not be observed when using an univariated study.

  8. AcEST: BP913394 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_G05 379 Adiantum capillus-veneris mRNA. clone: YMU001_000029_G05. BP913394 - Show ... capillus-veneris mRNA. clone: YMU001_000029_G05. Acce ssion BP913394 Tissue type prothallium Developmenta ... %) Frame = -2 Query: 123 RKFKVGCERICFQI-LLSVKSMFTSECCE V 37 +K K GCE + + L+++K FTS CCE + Sbjct: 104 KKHKAGC ... EHMVLMVVLMTIKDRFTSYCCE M 133 >tr|A9I6H8|A9I6H8_BORPD Probable aldehyde deh ...

  9. Spectral Characteristic Evolution: A New Algorithm for Gravitational Wave Propagation

    CERN Document Server

    Handmer, Casey J

    2014-01-01

    We present a spectral algorithm for solving the full nonlinear vacuum Einstein field equations in the Bondi framework. Developed within the Spectral Einstein Code (SpEC), we demonstrate spectral characteristic evolution as a technical precursor to Cauchy Characteristic Extraction (CCE), a rigorous method for obtaining gauge-invariant gravitational waveforms from existing and future astrophysical simulations. We demonstrate the new algorithm's stability, convergence, and agreement with existing evolution methods. We explain how an innovative spectral approach enables a two orders of magnitude improvement in computational efficiency.

  10. AcEST: BP920317 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_F06 423 Adiantum capillus-veneris mRNA. clone: YMU001_000135_F06. BP920317 - Show ... capillus-veneris mRNA. clone: YMU001_000135_F06. Acce ssion BP920317 Tissue type prothallium Developmenta ... SRVEGTYL-PPCCVVSCTPPSC----CQLHHAQASCCRPSYCGQSCCRPVCCCE P 172 Query: 351 T 353 T Sbjct: 173 T 173 >sp|Q921D ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3506 PE=4 SV=1 Length = 275 Score = 33.9 bits (76) ...

  11. AcEST: DK956010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_J23 487 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_J23. 5' end seq ... NA. clone: TST39A01NGRL0024_J23. 5' end sequence. Acce ssion DK956010 Tissue type prothallia with plantlet ... 27 (62%), Gaps = 3/27 (11%) Frame = +2 Query: 188 SCCE MCRGCKKKGRRH---CFWQTPNE 259 +CCE ... C+GC +GR + WQTP E ... Sbjct: 100 ACCE RCKGCTHEGRTYNSSFKWQTPAE 126 >sp|Q0AET9|HIS2_NITEC P ... e = +2 Query: 89 QSLEAAQGSFLSHSHVTHILQSLHSLKLSSGCRSCCE MCRGCKKKGRRHCFWQTPNEWQR 268 Q++EA + + +HS++ +L S L ...

  12. Recent developments of CERN RD39 cryogenic tracking detectors collaboration CERN RD39 Collaboration

    CERN Document Server

    Rouby, X

    2007-01-01

    CERN RD39 Collaboration is working on radiation hard cryogenic silicon detectors, for environments such as at the Super-LHC. A promising technique for the operation of low temperature detectors and diodes is the current injection of pre-irradiated samples (CID). A new setup, based on the Cryogenic Transient Current Technique (C-TCT), has been built to characterize Si samples (CCE). In addition, we report here some preliminary measurements for the evaluation of laser and plasma-cut sensors developed for edgeless detectors, for which the sensitive area should extend to a few μm from the physical border.

  13. AcEST: DK962916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  14. AcEST: DK955705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  15. Pilot power optimization for AF relaying using maximum likelihood channel estimation

    KAUST Repository

    Wang, Kezhi

    2014-09-01

    Bit error rates (BERs) for amplify-and-forward (AF) relaying systems with two different pilot-symbol-aided channel estimation methods, disintegrated channel estimation (DCE) and cascaded channel estimation (CCE), are derived in Rayleigh fading channels. Based on these BERs, the pilot powers at the source and at the relay are optimized when their total transmitting powers are fixed. Numerical results show that the optimized system has a better performance than other conventional nonoptimized allocation systems. They also show that the optimal pilot power in variable gain is nearly the same as that in fixed gain for similar system settings. andcopy; 2014 IEEE.

  16. Riverbed methanotrophy sustained by high carbon conversion efficiency

    OpenAIRE

    Trimmer, Mark; Shelley, Felicity C; Kevin J Purdy; Maanoja, Susanna T; Chronopoulou, Panagiota-Myrsini; Grey, Jonathan

    2015-01-01

    Our understanding of the role of freshwaters in the global carbon cycle is being revised, but there is still a lack of data, especially for the cycling of methane, in rivers and streams. Unravelling the role of methanotrophy is key to determining the fate of methane in rivers. Here we focus on the carbon conversion efficiency (CCE) of methanotrophy, that is, how much organic carbon is produced per mole of CH4 oxidised, and how this is influenced by variation in methanotroph communities. First...

  17. Carcinoma de células escamosas da cavidade oral em pacientes jovens e sua crescente incidência: revisão de literatura Squamous cell carcinoma of the oral cavity in young patients and its increasing incidence: literature review

    Directory of Open Access Journals (Sweden)

    Beatriz R. M. Venturi

    2004-10-01

    Full Text Available A proposta deste estudo é rever o carcinoma de células escamosas oral na população jovem. A literatura mostra um comportamento diferente neste tipo de doença, que parece ser mais agressivo. Existe uma forte relação entre alguns hábitos (tabaco e consumo de álcool e o desenvolvimento do carcinoma de células escamosas (CCE oral, mas nestes casos os pacientes normalmente não relatam hábitos considerados de risco. Existe um pequeno número de relatos de casos de CCE oral em pacientes com menos de 40 anos de idade, então é difícil de provar o aumento da incidência do CCE da cavidade oral como dito na literatura. Outros estudos são necessários para entendermos melhor esta entidade. A identificação das características desta população jovem se faz necessária, pois pode refletir problemas no controle do câncer e pode possibilitar o desenvolvimento de um programa de prevenção primária para o CCE oral em pacientes jovens.The purpose of this study was to review the squamous cell carcinoma of the oral cavity in young population. The literature shows a different behavior in this type of disease; it seems to be more aggressive. There is a close relationship between some habits (tobacco and alcohol consumption and the development of squamous cell carcinoma of the oral cavity, but in this case the patients normally relate no risk factors. There is a little number of case report of squamous cell carcinoma of the oral cavity in patients under 40 years old, so it's difficult to prove the increasing of the squamous cell carcinoma of the oral cavity as said in the literature. Further studies are necessary to know better this entity. The identification of the characteristics of this young population is necessary, because it might reflect problems in cancer control and can enable the development of a primary prevention program for squamous cell carcinoma of the oral cavity in young patients.

  18. Dicty_cDB: Contig-U14708-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA FLJ90737 fis, cl... 95 3e-18 BT081175_1( BT081175 |pid:none) Caligus clemensi clone ccl...e) Zea mays clone 1542082 transmembra... 68 3e-10 EF148792_1( EF148792 |pid:none) Populus trichoc...0990_1( BT080990 |pid:none) Caligus clemensi clone ccle-evs-50... 64 4e-09 AB172136_1( AB172136 |pid:none) M...e) Ostreococcus lucimarinus CCE9901... 52 1e-05 AC009176_13( AC009176 |pid:none) Arabidopsis thal...f Sequences: 6905 Number of extensions: 10288 Number of successful extensions: 10

  19. The phylogeny graphs of doubly partial orders

    CERN Document Server

    Park, Boram

    2011-01-01

    The competition graph of a doubly partial order is known to be an interval graph. The CCE graph and the niche graph of a doubly partial order are also known to be interval graphs if the graphs do not contain a cycle of length four and three as an induced subgraph, respectively. Phylogeny graphs are variant of competition graphs. The phylogeny graph $P(D)$ of a digraph $D$ is the (simple undirected) graph defined by $V(P(D)):=V(D)$ and $E(P(D)):=\\{xy \\mid N^+_D(x) \\cap N^+_D(y) \

  20. Identification of subpopulations in mesenchymal stem cell-like cultures from human umbilical cord

    Directory of Open Access Journals (Sweden)

    Majore Ingrida

    2009-03-01

    Full Text Available Abstract Background A variety of cell types can be identified in the adherent fraction of bone marrow mononuclear cells including more primitive and embryonic-like stem cells, mesenchymal stem cells (MSC, lineage-committed progenitors as well as mature cells such as osteoblasts and fibroblasts. Different methods are described for the isolation of single bone marrow stem cell subpopulations – beginning from ordinary size sieving, long term cultivation under specific conditions to FACS-based approaches. Besides bone marrow-derived subpopulations, also other tissues including human umbilical cord (UC have been recently suggested to provide a potential source for MSC. Although of clinical importance, these UC-derived MSC populations remain to be characterized. It was thus the aim of the present study to identify possible subpopulations in cultures of MSC-like cells obtained from UC. We used counterflow centrifugal elutriation (CCE as a novel strategy to successfully address this question. Results UC-derived primary cells were separated by CCE and revealed differentially-sized populations in the fractions. Thus, a subpopulation with an average diameter of about 11 μm and a small flat cell body was compared to a large sized subpopulation of about 19 μm average diameter. Flow cytometric analysis revealed the expression of certain MSC stem cell markers including CD44, CD73, CD90 and CD105, respectively, although these markers were expressed at higher levels in the small-sized population. Moreover, this small-sized subpopulation exhibited a higher proliferative capacity as compared to the total UC-derived primary cultures and the large-sized cells and demonstrated a reduced amount of aging cells. Conclusion Using the CCE technique, we were the first to demonstrate a subpopulation of small-sized UC-derived primary cells carrying MSC-like characteristics according to the presence of various mesenchymal stem cell markers. This is also supported by the