Climate Change Education in the Context of Education for Sustainable Development: Rationale and Principles

Science.gov (United States)

Mochizuki, Yoko; Bryan, Audrey

2015-01-01

Although the role of education in addressing the challenges of climate change is increasingly recognized, the education sector remains underutilized as a strategic resource to mitigate and adapt to climate change. Education stakeholders in many countries have yet to develop a coherent framework for climate change education (CCE). This article…

Education for Sustainable Development and Climate Change Education in China: A Status Report

Science.gov (United States)

Han, Qingqing

2015-01-01

Recognizing the significance of education in promoting sustainable development (SD), China has developed a number of policies and initiatives relating to education for sustainable development (ESD) and climate change education (CCE). The article first reviews China's national policies and initiatives with regard to SD, climate change, education,…

Repeat Mapping in the Lower Monterey Submarine Canyon Sheds Light on Morphological Change During Discrete Sediment Density Flow Events

Science.gov (United States)

Anderson, K.; Lundsten, E. M.; Caress, D. W.; Thomas, H. J.; Paull, C. K.; Maier, K. L.; Gales, J. A.; Gwiazda, R.; Talling, P.; Xu, J.; Parsons, D. R.

2017-12-01

The Coordinated Canyon Experiment (CCE), a multi-institutional collaboration effort, was designed to monitor the passage of sediment density flows along the axis of Monterey Canyon, offshore California, between 200 and 1850 m water depth. An array of moorings and sensors were deployed for three 6-month periods from October 2015 to April 2017. Aligned with the CCE deployments, repeat high-resolution multibeam bathymetric surveys of the Monterey Canyon floor were conducted with a mapping AUV (Autonomous Underwater Vehicle). The AUV carried a Reson 7125 multibeam echosounder (vertical precision of 0.15 m and horizontal resolution of 1.0 m). An inertial navigation system combined with a Doppler velocity logger allowed the AUV to fly pre-programmed grids at 3 knots, while maintaining an altitude of 50 m above the seafloor, to obtain a nominal line spacing of 130 m. The floor and lower flanks of the canyon between 200 to 540 m and 1350 to 1880 m water depths were mapped six times during the CCE. These repeat maps are subtracted to create bathymetry difference grids to show morphological change. Coupling the sensor observations with the bathymetric surveys, the CCE successfully documented sediment density flow events as well as the associated changes in seafloor morphology. Between repeat surveys, three sediment density flow events reached the lower canyon, extending to at least 1850 m water depth. On January 15, 2016, a particularly large density flow traveled more than 50 km down Monterey Canyon. Unlike in the upper canyon where this event caused wholesale reorganization of geomorphological features, changes to the lower canyon morphology involved a more moderate re-sculpting of the features. The effect of a sediment density flow of known magnitude and duration on the seafloor morphology has never been documented in a deep-sea setting before.

Evaluation of the effect of a chicken comb extract-containing supplement on cartilage and bone metabolism in athletes.

Science.gov (United States)

Yoshimura, Masafumi; Aoba, Yukihiro; Watari, Taiji; Momomura, Rei; Watanabe, Keita; Tomonaga, Akihito; Matsunaga, Michitaka; Suda, Yoshimasa; Lee, Woo Young; Asai, Katsuhito; Yoshimura, Kaori; Nakagawa, Takashi; Yamamoto, Tetsuro; Yamaguchi, Hideyo; Nagaoka, Isao

2012-10-01

In a previous study, we revealed that a commercially available product of dietary supplement containing a chicken comb extract (CCE), which is rich in hyaluronan, not only relieves joint pain and other symptoms, but also potentially improves the balance of type II collagen degradation/synthesis in patients with knee osteoarthritis. Since soccer is one of the sports most likely to cause knee osteoarthritis (OA), we evaluated the effect of a CCE-containing supplement on cartilage and bone metabolism in athletes. Fourteen and 15 subjects (all midfielders) were randomly assigned to receive the test product (test group) and the dummy placebo containing only vehicle (placebo group), respectively, for 12 weeks. The daily oral intake of the CCE-containing test product clearly decreased the urinary levels of both C-terminal crosslinked telopeptides of cartilage-specific type II collagen (CTX-II) as a type II collagen degradation marker and the N-terminal telopeptides of bone-specific type I collagen (NTx) as a marker of bone resorption at 12 weeks after the initiation of the intervention. By contrast, no significant reduction was detected in the placebo group at any timepoint during the intervention. These observations indicate that the test product is effective in inhibiting, not only cartilage degradation, but also bone remodeling. Thus, the CCE-containing supplement may be useful for the management of joint health in athletes.

Anti-fibrotic effects of Cuscuta chinensis with in vitro hepatic stellate cells and a thioacetamide-induced experimental rat model.

Science.gov (United States)

Kim, Jin Seoub; Koppula, Sushruta; Yum, Mun Jeong; Shin, Gwang Mo; Chae, Yun Jin; Hong, Seok Min; Lee, Jae Dong; Song, MinDong

2017-12-01

Cuscuta chinensis Lam. (Convolvulaceae) has been used as a traditional herbal remedy for treating liver and kidney disorders. Anti-fibrotic effects of C. chinensis extract (CCE) in cellular and experimental animal models were investigated. HSC-T6 cell viability, cell cycle and apoptosis were analysed using MTT assay, flow cytometry and Annexin V-FITC/PI staining techniques. Thioacetamide (TAA)-induced fibrosis model was established using Sprague Dawley rats (n = 10). Control, TAA, CCE 10 (TAA with CCE 10 mg/kg), CCE 100 (TAA with CCE 100 mg/kg) and silymarin (TAA with silymarin 50 mg/kg). Fibrosis was induced by TAA (200 mg/kg, i.p.) twice per week for 13 weeks. CCE and silymarin were administered orally two times per week from the 7th to 13th week. Fibrotic related gene expression (α-SMA, Col1α1 and TGF-β1) was measured by RT-PCR. Serum biomarkers, glutathione (GSH) and hydroxyproline were estimated by spectrophotometer using commercial kits. CCE (0.05 and 0.1 mg/mL) and silymarin (0.05 mg/mL) treatment significantly (p < 0.01 and p < 0.001) induced apoptosis (11.56%, 17.52% for CCE; 16.50% for silymarin, respectively) in activated HSC-T6 cells, compared with control group (7.26%). Further, rat primary HSCs showed changes in morphology with CCE 0.1 mg/mL treatment. In in vivo studies, CCE (10 and 100 mg/kg) treatment ameliorated the TAA-induced altered levels of serum biomarkers, fibrotic related gene expression, GSH, hydroxyproline significantly (p < 0.05-0.001) and rescued the histopathological changes. CCE can be developed as a potential agent in the treatment of hepatofibrosis.

Climate Change Education and Education for Sustainable Development in the Republic of Korea: A Status Report

Science.gov (United States)

Sung, Junghee

2015-01-01

The Republic of Korea (ROK) has officially declared its national vision of green growth, and actively develops and implements policies related to education for sustainable development (ESD), green growth education (GGE) and climate change education (CCE). Over the Decade of ESD, the ROK experienced three administrations which have taken different…

Enhanced barrier functions and anti-inflammatory effect of cultured coconut extract on human skin.

Science.gov (United States)

Kim, Soomin; Jang, Ji Eun; Kim, Jihee; Lee, Young In; Lee, Dong Won; Song, Seung Yong; Lee, Ju Hee

2017-08-01

Natural plant oils have been used as a translational alternative to modern medicine. Particularly, virgin coconut oil (VCO) has gained popularity because of its potential benefits in pharmaceutical, nutritional, and cosmetic applications. Cultured coconut extract (CCE) is an alternative end product of VCO, which undergoes a further bacterial fermentation process. This study aimed to investigate the effects of CCE on human skin. We analyzed the expression of skin barrier molecules and collagens after applying CCE on human explanted skin. To evaluate the anti-inflammatory properties of CCE, the expression of inflammatory markers was analyzed after ultraviolet B (UVB) irradiation. The CCE-treated group showed increased expression of cornified cell envelope components, which contribute to protective barrier functions of the stratum corneum. Further, the expression of inflammatory markers was lower in the CCE-treated group after exposure to UVB radiation. These results suggest an anti-inflammatory effect of CCE against UVB irradiation-induced inflammation. Additionally, the CCE-treated group showed increased collagen and hyaluronan synthase-3 expression. In our study, CCE showed a barrier-enhancing effect and anti-inflammatory properties against ex vivo UVB irradiation-induced inflammation. The promising effect of CCE may be attributed to its high levels of polyphenols and fatty acid components. Copyright © 2017 Elsevier Ltd. All rights reserved.

Colon Capsule Endoscopy: Where Are We and Where Are We Going

Directory of Open Access Journals (Sweden)

Yoo Min Han

2016-09-01

Full Text Available Colon capsule endoscopy (CCE is a noninvasive technique for diagnostic imaging of the colon. It does not require air inflation or sedation and allows minimally invasive and painless colonic evaluation. The role of CCE is rapidly evolving; for example, for colorectal screening (colorectal cancer [CRC] in average-risk patients, in patients with an incomplete colonoscopy, in patients refusing a conventional colonoscopy, and in patients with contraindications for conventional colonoscopy. In this paper, we comprehensively review the technical characteristics and procedure of CCE and compare CCE with conventional methods such as conventional colonoscopy or computed tomographic colonography. Future expansion of CCE in the area of CRC screening for the surveillance of polyps and adenomatous lesions and for assessment of inflammatory bowel disease is also discussed.

Use of computer-based clinical examination to assess medical students in surgery.

Science.gov (United States)

El Shallaly, Gamal E H A; Mekki, Abdelrahman M

2012-01-01

To improve the viewing of the video-projected structured clinical examination (ViPSCE), we developed a computerized version; the computer-based clinical examination (CCE). This was used to assess medical students' higher knowledge and problem solving skills in surgery. We present how we did this, test score descriptive statistics, and the students' evaluation of the CCE. A CCE in surgery was administered to assess a class of 43 final year medical students at the end of their surgical clerkship. Like the ViPSCE, the exam was delivered as a slide show, using a PowerPoint computer program. However, instead of projecting it onto a screen, each student used a computer. There were 20 slides containing either still photos or short video clips of clinical situations in surgery. The students answered by hand writing on the exam papers. At the end, they completed evaluation forms. The exam papers were corrected manually. Test score descriptive statistics were calculated and correlated with the students' scores in other exams in surgery. Administration of the CCE was straightforward. The test scores were normally distributed (mean = median = 4.9). They correlated significantly with the total scores obtained by the students in surgery (r = 0.68), and with each of the other exam modalities in surgery, such as the multiple choice and structured essay questions. Acceptability of the CCE to the students was high and they recommended the use of the CCE in other departments. CCE is feasible and popular with students. It inherits the validity and reliability of the ViPSCE with the added advantage of improving the viewing of the slides.

A double blind, placebo-controlled study of the effects of post-retrieval propranolol on reconsolidation of memory for craving and cue reactivity in cocaine dependent humans.

Science.gov (United States)

Saladin, Michael E; Gray, Kevin M; McRae-Clark, Aimee L; Larowe, Steven D; Yeatts, Sharon D; Baker, Nathaniel L; Hartwell, Karen J; Brady, Kathleen T

2013-04-01

This study examined the effects of propranolol vs. placebo, administered immediately after a "retrieval" session of cocaine cue exposure (CCE), on craving and physiological responses occurring 24 h later during a subsequent "test" session of CCE. It was hypothesized that compared to placebo-treated cocaine-dependent (CD) individuals, propranolol-treated CD individuals would evidence attenuated craving and physiological reactivity during the test session. Secondarily, it was expected that group differences identified in the test session would be evident at a 1-week follow-up CCE session. Exploratory analyses of treatment effects on cocaine use were also performed at follow-up. CD participants received either 40 mg propranolol or placebo immediately following a "retrieval" CCE session. The next day, participants received a "test" session of CCE that was identical to the "retrieval" session except no medication was administered. Participants underwent a "follow-up" CCE session 1 week later. Craving and other reactivity measures were obtained at multiple time points during the CCE sessions. Propranolol- vs. placebo-treated participants evidenced significantly greater attenuation of craving and cardiovascular reactivity during the test session. Analysis of the follow-up CCE session data did not reveal any group differences. Although there was no evidence of treatment effects on cocaine use during follow-up, this study was insufficiently powered to rigorously evaluate differential cocaine use. This double-blind, placebo-controlled laboratory study provides the first evidence that propranolol administration following CCE may modulate memories for learning processes that subserve cocaine craving/cue reactivity in CD humans. Alternative interpretations of the findings were considered, and implications of the results for treatment were noted.

Ten good reasons why everybody can and should perform cardiac ultrasound in the ICU.

Science.gov (United States)

Charron, Cyril; Repessé, Xavier; Bodson, Laurent; Au, Siu-Ming; Vieillard-Baron, Antoine

2014-01-01

Critical care ultrasonography (CCUS) has been defined as an ultrasound evaluation of the heart, abdomen, pleura and lungs at the bedside by the intensivist, 24/7. Within CCUS, critical care echocardiography (CCE) is used to assess cardiac function and more generally haemodynamics. Experts in haemodynamics have published a 'consensus of 16' regarding an update on haemodynamic monitoring. They reported the ten key properties of an 'ideal' haemodynamic monitoring system, which perfectly match the ten good reasons we describe here for performing CCE in critically ill patients. Even though unfortunately no evidence-based medicine study is available to support this review, especially regarding CCE-related improvement of outcome, many clinical studies have demonstrated that CCE provides measurements of relevant, accurate, reproducible and interpretable variables, is easy to use, readily available, has a rapid response time, causes no harm, and is cost-effective. Whether it is operator-independent is obviously more debatable and is discussed in this review. All these characteristics are arguments for the extensive use of CCE by intensivists. This is why experts in the field have recommended that a basic level of CCE should be included in the training of all intensivists.

Diagnostic Role of Colon Capsule Endoscopy in Patients with Optimal Colon Cleaning

Directory of Open Access Journals (Sweden)

Ümit Akyüz

2016-01-01

Full Text Available Background. Colon capsule endoscopy (CCE is a diagnostic test with relatively rare usage. In this study, we aimed to evaluate both the optimal cleaning regimen for CCE and the diagnostic value of test in the study group. Methods. A total of 62 patients were enrolled in this study. In the first step, 3 different colon preparing regimens were given to 30 patients [Group A: 3 days of liquid diet, sodium phosphate (NaP (90 mL, and NaP enema; Group B: 3 days of liquid diet, 4 L of polyethylene glycol (PEG, and metoclopramide; Group C: 3 days of liquid diet, 4 L of PEG, NaP (45 mL, and bisacodyl after capsule ingestion] (10 patients in each group. The other consecutive 32 patients were cleaned with the best regimen which was NaP + PEG and CCE was performed. The results of CCE were controlled with colonoscopy in 28 patients. Results. Group C had the highest cleaning score, compared with the other groups (2.2±0.4 versus 2.7±0.4 versus 3.7±0.4, p value =0.000. The CCE findings were as follows in 28 patients who were also examined with colonoscopy: polyp (range: 5–10 mm in 6 patients, internal hemorrhoids in 3 patients, angiodysplasia in 1 patient, diverticula in 1 patient, and ulcerative colitis in 1 patient. The sensitivity, specificity, PPV, and NPV of CCE were 100%, 92%, 93%, and 100%, respectively. Conclusions. Low dosage NaP combined with PEG provides optimal bowel preparation for CCE. CCE appears to be a highly sensitive diagnostic modality for detecting colonic pathologies.

Assessment of an electronic learning system for colon capsule endoscopy: a pilot study.

Science.gov (United States)

Watabe, Hirotsugu; Nakamura, Tetsuya; Yamada, Atsuo; Kakugawa, Yasuo; Nouda, Sadaharu; Terano, Akira

2016-06-01

Training for colon capsule endoscopy (CCE) procedures is currently performed as a lecture and hands-on seminar. The aims of this pilot study were to assess the utility of an electronic learning system for CCE (ELCCE) designed for the Japanese Association for Capsule Endoscopy using an objective scoring engine, and to evaluate the efficacy of ELCCE on the acquisition of CCE reading competence. ELCCE is an Internet-based learning system with the following steps: step 1, introduction; step 2, CCE reading competence assessment test (CCAT), which evaluates the competence of CCE reading prior to training; step 3, learning reading theory; step 4, training with guidance; step 5, training without guidance; step 6, final assessment; and step 7, the same as step 2. The CCAT, step 5 and step 6 were scored automatically according to: lesion detection, diagnosis (location, size, shape of lesion), management recommendations, and quality of view. Ten trainee endoscopists were initially recruited (cohort 1), followed by a validating cohort of 11 trainee endoscopists (cohort 2). All but one participant finished ELCCE training within 7 weeks. In step 6, accuracy ranged from 53 to 98 % and was not impacted by step 2 pretest scores. The average CCAT scores significantly increased between step 2 pretest and step 7 in both cohorts, from 42 ± 18 % to 79 ± 15 % in cohort 1 (p = 0.0004), and from 52 ± 15 % to 79 ± 14 % in cohort 2 (p = 0.0003). ELCCE is useful and effective for improving CCE reading competence.

Phytochemical, antioxidant and protective effect of cactus cladodes extract against lithium-induced liver injury in rats.

Science.gov (United States)

Ben Saad, Anouar; Dalel, Brahmi; Rjeibi, Ilhem; Smida, Amani; Ncib, Sana; Zouari, Nacim; Zourgui, Lazhar

2017-12-01

Opuntia ficus-indica (L.) Mill. (Castaceae) (cactus) is used in Tunisian medicine for the treatment of various diseases. This study determines phytochemical composition of cactus cladode extract (CCE). It also investigates antioxidant activity and hepatoprotective potential of CCE against lithium carbonate (Li 2 CO 3 )-induced liver injury in rats. Twenty-four Wistar male rats were divided into four groups of six each: a control group given distilled water (0.5 mL/100 g b.w.; i.p.), a group injected with Li 2 CO 3 (25 mg/kg b.w.; i.p.; corresponding to 30% of the LD 50 ) twice daily for 30 days, a group receiving only CCE at 100 mg/kg of b.w. for 60 days and then injected with distilled water during the last 30 days of CCE treatment, and a group receiving CCE and then injected with Li 2 CO 3 during the last 30 days of CCE treatment. The bioactive components containing the CCE were identified using chemical assays. Treatment with Li 2 CO 3 caused a significant change of some haematological parameters including red blood cells (RBC), white blood cells (WBC), haemoglobin content (Hb), haematocrit (Ht) and mean corpuscular volume (VCM) compared to the control group. Moreover, significant increases in the levels of glucose, cholesterol, triglycerides and of aspartate aminotransferase (AST), alanine aminotransferase (ALT), alkaline phosphatase (ALP) and lactate dehydrogenase (LDH) activities were observed in the blood of Li 2 CO 3 -treated rats. Furthermore, exposure to Li 2 CO 3 significantly increased the LPO level and decreased superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx) activities in the hepatic tissues. CCE possesses a significant hepatoprotective effect.

Climate Change Education on Public Health Consequences and Impacts to the Human System - An Interdisciplinary Approach to Promoting Climate Literacy

Science.gov (United States)

Matiella Novak, M.; Paxton, L. J.

2012-12-01

In this talk we will discuss our approach to translating an abstract, difficult to internalize idea ("climate change") into knowledge that speaks to people directly in terms of their own lives. Recent research suggests that communicating climate change in the context of public health impacts, and even national security risks, is a more effective method of reaching communities that are currently disengaged or nonresponsive to climate change science than the approaches currently being used. Understanding that these new perspectives might reach a broader audience, the Global Assimilation of Information for Action (GAIA) project has proposed implementing a suite of education activities that focus on the public health consequences that will arise and/or becoming exacerbated by climate change. Reaching the disparate communities that must be brought together to create a workable approach is challenging. GAIA has developed a novel framework for sharing information and developing communities of interest that cross boundaries in what is otherwise a highly disciplinary approach to climate change studies. Members of the GAIA community include climate change, environmental and public health experts, as well as relevant stakeholders, policy makers and decision makers. By leveraging the existing expertise within the GAIA community, an opportunity exists to present climate change education (CCE) in a way that emphasizes how climate change will affect public health, and utilizes an approach that has been shown to engage a broader and more diverse audience. Focusing CCE on public health effects is a new and potentially transformative method since it makes the results more tangible and less "random". When CCE is focused on what will happen to the Earth's climate and associated meteorological hazards one might be tempted to view this as something that can be coped with thus enabling the individualist entrepreneur point of view. Weather disasters always seem to happen to someone else

Downscaling Climate Projections to a Mountainous Landscape: A Climate Impact Assessment for the U.S. Northern Rockies Crown of the Continent Ecosystem

Science.gov (United States)

Oyler, J.; Anderson, R.; Running, S. W.

2010-12-01

In topographically complex landscapes, there is often a mismatch in scale between global climate model projections and more local climate-forcing factors and related ecological/hydrological processes. To overcome this limitation, the objective of this study was to downscale climate projections to the rugged Crown of the Continent Ecosystem (CCE) within the U.S. Northern Rockies and assess future impacts on water balances, vegetation dynamics, and carbon fluxes. A 40-year (1970-2009) spatial historical climate dataset (800m resolution, daily timestep) was generated for the CCE and modified for terrain influences. Regional climate projections were downscaled by applying them to the fine-scale historical dataset using a modified delta downscaling method and stochastic weather generator. The downscaled projections were used to drive the Biome-BGC ecosystem model. Overall CCE impacts included decreases in April 1 snow water equivalent, less days with snow on the ground, increased vegetation water stress, and increased growing degree days. The relaxing of temperature constraints increased annual net primary productivity (NPP) throughout most of the CCE landscape. However, an increase in water stress seems to have limited the growth in NPP and, in some areas, NPP actually decreased. Thus, CCE vegetation productivity trends under increasing temperatures will likely be determined by local changes in hydrologic function. Given the greater uncertainty in precipitation projections, future work should concentrate on determining thresholds in water constraints that greatly modify the magnitude and direction of carbon accumulation within the CCE under a warming climate.

Effect of Swarna Jibanti (Coelogyne cristata Lindley) in alleviation of chronic fatigue syndrome in aged Wistar rats.

Science.gov (United States)

Mitra, Achintya; Sur, Tapas Kumar; Upadhyay, Sachhidananda; Bhattacharyya, Dipankar; Hazra, Jayram

2017-11-01

Swarna Jibanti scientifically known as Coelogyne cristata Lindley (Orchidaceae), an orchid mentioned in Ayurvedic medicine is used to promote healthy life span. The present work was planned to study the efficacy of hydro-alcoholic extract of pseudobulbs of C.cristata (CCE) to assess its role on chronic fatigue syndrome (CFS) induced behavioural and biochemical changes in aged Wistar rats compared to Panax ginseng (PG), a prototype anti-stress agent. CFS was induced by forced swimming for consecutive 21 days for fixed duration (15 min sessions). The criteria of CFS due to fatigue were counted using locomotor activity, depression and anxiety through automated photactometer, immobility time and plus maze activity respectively. Acute toxicity study of CCE (upto 2 g/kg, Limit test) was also performed. For CFS, animals were divided into five groups, naive control, control, CCE treated (25 mg/kg b.w., 250 mg/kg b.w.) and standard PG treated (100 mg/kg b.w.) groups. All drugs were given orally for consecutive 21 days along with CFS. After assessing behavioural parameters, all animals were sacrificed at day 21 and in vivo antioxidant potential of CCE was determined by lipid peroxides, nitrite, catalase (CAT) and superoxide dismutase (SOD) in brain tissue. CCE was found to be non-toxic. CCE treated aged rats significantly improved (p < 0.001) the spontaneous locomotor movement with respect to control rats, while, decreased the mobility period or depression score. In CFS, CCE also enhanced the time spent (p < 0.001) in open arms while reducing the time spent in closed arm as compared to CFS control, indicating lowering anxiety score. Moreover, marked diminution in lipid peroxidation, nitrite and SOD level was exhibited after CCE treatment and significantly enhanced catalase level significantly (p < 0.01) with respect to CFS control. PG also showed similar actions. The results confirmed the potential therapeutic actions of CCE against experimentally induced CFS in

Presenilin-mediated modulation of capacitative calcium entry.

Science.gov (United States)

Yoo, A S; Cheng, I; Chung, S; Grenfell, T Z; Lee, H; Pack-Chung, E; Handler, M; Shen, J; Xia, W; Tesco, G; Saunders, A J; Ding, K; Frosch, M P; Tanzi, R E; Kim, T W

2000-09-01

We studied a novel function of the presenilins (PS1 and PS2) in governing capacitative calcium entry (CCE), a refilling mechanism for depleted intracellular calcium stores. Abrogation of functional PS1, by either knocking out PS1 or expressing inactive PS1, markedly potentiated CCE, suggesting a role for PS1 in the modulation of CCE. In contrast, familial Alzheimer's disease (FAD)-linked mutant PS1 or PS2 significantly attenuated CCE and store depletion-activated currents. While inhibition of CCE selectively increased the amyloidogenic amyloid beta peptide (Abeta42), increased accumulation of the peptide had no effect on CCE. Thus, reduced CCE is most likely an early cellular event leading to increased Abeta42 generation associated with FAD mutant presenilins. Our data indicate that the CCE pathway is a novel therapeutic target for Alzheimer's disease.

Root cause analysis underscores the importance of understanding, addressing, and communicating cold chain equipment failures to improve equipment performance.

Science.gov (United States)

Lennon, Pat; Atuhaire, Brian; Yavari, Shahrzad; Sampath, Vidya; Mvundura, Mercy; Ramanathan, Nithya; Robertson, Joanie

2017-04-19

Vaccine cold chain equipment (CCE) in developing countries is often exposed to harsh environmental conditions, such as extreme temperatures and humidity, and is subject to many additional challenges, including intermittent power supply, insufficient maintenance capacity, and a scarcity of replacement parts. Together, these challenges lead to high failure rates for refrigerators, potentially damaging vaccines and adversely affecting immunization coverage. Providing a sustainable solution for improving CCE performance requires an understanding of the root causes of failure. Project teams conducted small-scale studies to determine the root causes of CCE failure in selected locations in Uganda and Mozambique. The evaluations covered 59 failed refrigerators and freezers in Uganda and 27 refrigerators in Mozambique. In Uganda, the vast majority of failures were due to a cooling unit fault in one widely used refrigerator model. In Mozambique, 11 of the 27 problems were attributable to solar refrigerators with batteries that were unable to hold a charge, and another eight problems were associated with a need to adjust thermostat settings. The studies showed that tracking and evaluation of equipment performance and failure can yield important, actionable information for a range of stakeholders, including local CCE technicians, the ministry of health, equipment manufacturers, and international partners such as the United Nations Children's Fund, World Health Organization, and Gavi, the Vaccine Alliance. Collaborative efforts to systematically collect and communicate data on CCE performance and causes of failure will help to improve the efficiency and reach of immunization programs in low- and middle-income countries. Copyright © 2016 The Author(s). Published by Elsevier Ltd.. All rights reserved.

Chemopreventive effect of cactus Opuntia ficus indica on oxidative stress and genotoxicity of aflatoxin B1

Directory of Open Access Journals (Sweden)

Ben Mansour Hédi

2011-10-01

Full Text Available Abstract Background Aflatoxin B1 (AFB1 is potent hepatotoxic and hepatocarcinogenic agent. In aflatoxicosis, oxidative stress is a common mechanism contributing to initiation and progression of hepatic damage. The aim of this work was to evaluate the hepatoprotective effect of cactus cladode extract (CCE on aflatoxin B1-induced liver damage in mice by measuring malondialdehyde (MDA level, the protein carbonyls generation and the heat shock proteins Hsp 70 and Hsp 27 expressions in liver. We also looked for an eventual protective effect against AFB1-induced genotoxicity as determined by chromosome aberrations test, SOS Chromotest and DNA fragmentation assay. We further evaluated the modulation of p53, bax and bcl2 protein expressions in liver. Methods Adult, healthy balbC (20-25 g male mice were pre-treated by intraperitonial administration of CCE (50 mg/Kg.b.w for 2 weeks. Control animals were treated 3 days a week for 4 weeks by intraperitonial administration of 250 μg/Kg.b.w AFB1. Animals treated by AFB1 and CCE were divided into two groups: the first group was administrated CCE 2 hours before each treatment with AFB1 3 days a week for 4 weeks. The second group was administrated without pre-treatment with CCE but this extract was administrated 24 hours after each treatment with AFB1 3 days a week for 4 weeks. Results Our results clearly showed that AFB1 induced significant alterations in oxidative stress markers. In addition, it has a genotoxic potential and it increased the expression of pro apoptotic proteins p53 and bax and decreased the expression of bcl2. The treatment of CCE before or after treatment with AFB1, showed (i a total reduction of AFB1 induced oxidative damage markers, (ii an anti-genotoxic effect resulting in an efficient prevention of chromosomal aberrations and DNA fragmentation compared to the group treated with AFB1 alone (iii restriction of the effect of AFB1 by differential modulation of the expression of p53 which

A Comparative Evaluation of the Thesaurus of Engineering and Scientific Terms and the DDC Retrieval and Indexing Terminology.

Science.gov (United States)

1977-11-01

classificaLion schemes such as UDC, the Dewey Decimal Classification, Ranganathon’sColon Classifica- S tion, the Bliss Bibliographic Classification...UNLIMITED!IBIR-4J1 * : . C)" A COMPARATIVE EVALUATION OF THE THESAURUS OF, SAENGINEERING AND SCIENTIFIC TERMS AND THE DDC RETRIEVAL AND INDEXING...f cce7,i on For TER1 AND THE DDC RETRIEVAL AND A--" o " INDEXING TERMINOLOGY NTIS - * ByD , 2 _jDitr" : i :/ _ _ . _Av: "jl r " 1 t v Codes

Cell Control Engineering

DEFF Research Database (Denmark)

Lynggaard, Hans Jørgen Birk; Alting, Leo

1996-01-01

The engineering process of creating cell control systems is described, and a Cell Control Engineering (CCE) concept is defined. The purpose is to assist people, representing different disciplines in the organisation, to implement cell controllers by addressing the complexity of having many systems...... in physically and logically different and changing manufacturing environments. The defined CCE concept combines state-of-the-art of commercially available enabling technologies for automation system software development, generic cell control models and guidelines for the complete engineering process...

Nutrient uplift in a cyclonic eddy increases diversity, primary productivity and iron demand of microbial communities relative to a western boundary current

Directory of Open Access Journals (Sweden)

Martina A. Doblin

2016-04-01

Full Text Available The intensification of western boundary currents in the global ocean will potentially influence meso-scale eddy generation, and redistribute microbes and their associated ecological and biogeochemical functions. To understand eddy-induced changes in microbial community composition as well as how they control growth, we targeted the East Australian Current (EAC region to sample microbes in a cyclonic (cold-core eddy (CCE and the adjacent EAC. Phototrophic and diazotrophic microbes were more diverse (2–10 times greater Shannon index in the CCE relative to the EAC, and the cell size distribution in the CCE was dominated (67% by larger micro-plankton $(\\geq 20\\lrm{\\mu }\\mathrm{m}$ ≥ 20 μ m , as opposed to pico- and nano-sized cells in the EAC. Nutrient addition experiments determined that nitrogen was the principal nutrient limiting growth in the EAC, while iron was a secondary limiting nutrient in the CCE. Among the diazotrophic community, heterotrophic NifH gene sequences dominated in the EAC and were attributable to members of the gamma-, beta-, and delta-proteobacteria, while the CCE contained both phototrophic and heterotrophic diazotrophs, including Trichodesmium, UCYN-A and gamma-proteobacteria. Daily sampling of incubation bottles following nutrient amendment captured a cascade of effects at the cellular, population and community level, indicating taxon-specific differences in the speed of response of microbes to nutrient supply. Nitrogen addition to the CCE community increased picoeukaryote chlorophyll a quotas within 24 h, suggesting that nutrient uplift by eddies causes a ‘greening’ effect as well as an increase in phytoplankton biomass. After three days in both the EAC and CCE, diatoms increased in abundance with macronutrient (N, P, Si and iron amendment, whereas haptophytes and phototrophic dinoflagellates declined. Our results indicate that cyclonic eddies increase delivery of nitrogen to the upper ocean to potentially

Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival

Science.gov (United States)

Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.

2017-01-01

Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastesspp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.

Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival

Science.gov (United States)

Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.

2017-10-01

Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastes spp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.

The formation of a cold-core eddy in the East Australian Current

Science.gov (United States)

Macdonald, H. S.; Roughan, M.; Baird, M. E.; Wilkin, J.

2016-02-01

Cold-core eddies (CCEs) frequently form in western boundary currents and can affect continental shelf processes. It is not always clear, however, if baroclinic or barotropic instabilities contribute more to their formation. The Regional Ocean Modelling System (ROMS) is used to investigate the ocean state during the formation of a CCE in the East Australian Current (EAC) during October 2009. The observed eddy initially appeared as a small billow (approx. 50 km in length) that perturbed the landward edge of the EAC. The billow grew into a mesoscale CCE (approx. 100 km in diameter), diverting the EAC around it. A ROMS simulation with a realistic wind field reproduced a similar eddy. This eddy formed from negative vorticity waters found on the continental shelf south of the EAC separation point. A sensitivity analysis is performed whereby the impact of 3 different wind forcing scenarios, upwelling, downwelling, and no winds, are investigated. A CCE formed in all wind scenarios despite the wind induced changes in hydrographic conditions in the continental shelf and slope waters. As such, the source of energy for eddy formation did not come from the interactions of wind with the continental shelf waters. Analysis of strain and energy transformation confirms this by showing that the prevailing source of CCE energy was kinetic energy of the offshore EAC. These results clearly link the formation of the CCE to the swift flowing EAC and barotropic instabilities.

Transrectal rigid-hybrid NOTES cholecystectomy can be performed without peritoneal contamination: a controlled porcine survival study.

Science.gov (United States)

Müller, Philip C; Senft, Jonas D; Gath, Philip; Steinemann, Daniel C; Nickel, Felix; Billeter, Adrian T; Müller-Stich, Beat P; Linke, Georg R

2018-01-01

The risk of infectious complications due to peritoneal contamination is a major concern and inhibits the widespread use of transrectal NOTES. A standardized rectal washout with a reversible colon occlusion device in situ has previously shown potential in reducing peritoneal contamination. The aim of this study was to compare the peritoneal contamination rate and inflammatory reaction for transrectal cholecystectomy after ideal rectal preparation (trCCE) and standard laparoscopic cholecystectomy (lapCCE) in a porcine survival experiment. Twenty pigs were randomized to trCCE (n = 10) or lapCCE (n = 10). Before trCCE, rectal washout was performed with saline solution. A colon occlusion device was then inserted and a second washout with povidone-iodine was performed. The perioperative course and the inflammatory reaction (leukocytes, C-reactive protein) were compared. At necropsy, 14 days after surgery the abdominal cavity was screened for infectious complications and peritoneal swabs were obtained for comparison of peritoneal contamination. Peritoneal contamination was lower after trCCE than after lapCCE (0/10 vs. 6/10; p = 0.003). No infectious complications were found at necropsy in either group and postoperative complications did not differ (p = 1.0). Immediately after the procedure, leukocytes were higher after lapCCE (17.0 ± 2.7 vs. 14.6 ± 2.3; p = 0.047). Leukocytes and C-reactive protein showed no difference in the further postoperative course. Intraoperative complications and total operation time (trCCE 114 ± 32 vs. 111 ± 27 min; p = 0.921) did not differ, but wound closure took longer for trCCE (31.5 ± 19 vs. 13 ± 5 min; p = 0.002). After standardized rectal washout with a colon occlusion device in situ, trCCE was associated without peritoneal contamination and without access-related infectious complications. Based on the findings of this study, a randomized controlled clinical study comparing clinical outcomes of trCCE with

Stakeholder approach for evaluating organizational change projects.

Science.gov (United States)

Peltokorpi, Antti; Alho, Antti; Kujala, Jaakko; Aitamurto, Johanna; Parvinen, Petri

2008-01-01

This paper aims to create a model for evaluating organizational change initiatives from a stakeholder resistance viewpoint. The paper presents a model to evaluate change projects and their expected benefits. Factors affecting the challenge to implement change were defined based on stakeholder theory literature. The authors test the model's practical validity for screening change initiatives to improve operating room productivity. Change initiatives can be evaluated using six factors: the effect of the planned intervention on stakeholders' actions and position; stakeholders' capability to influence the project's implementation; motivation to participate; capability to change; change complexity; and management capability. The presented model's generalizability should be explored by filtering presented factors through a larger number of historical cases operating in different healthcare contexts. The link between stakeholders, the change challenge and the outcomes of change projects needs to be empirically tested. The proposed model can be used to prioritize change projects, manage stakeholder resistance and establish a better organizational and professional competence for managing healthcare organization change projects. New insights into existing stakeholder-related understanding of change project successes are provided.

FG7142, yohimbine, and βCCE produce anxiogenic-like effects in the elevated plus-maze but do not affect brainstem activated hippocampal theta.

Science.gov (United States)

Yeung, Michelle; Lu, Lily; Hughes, Adam M; Treit, Dallas; Dickson, Clayton T

2013-12-01

The neurobiological underpinnings of anxiety are of paramount importance to selective and efficacious pharmaceutical intervention. Hippocampal theta frequency in urethane anaesthetized rats is suppressed by all known (and some previously unknown) anti-anxiety (anxiolytic) drugs. Although these findings support the predictive validity of this assay, its construct validity (i.e., whether theta frequency actually indexes anxiety per se) has not been a subject of systematic investigation. We reasoned that if anxiolytic drugs suppress hippocampal theta frequency, then drugs that increase anxiety (i.e., anxiogenic agents) should increase theta frequency, thus providing evidence of construct validity. We used three proven anxiogenic drugs--two benzodiazepine receptor inverse agonists, N-methyl-β-carboline-3-carboxamide (FG7142) and β-carboline-3-carboxylate ethyl ester (βCCE), and one α2 noradrenergic receptor antagonist, 17α-hydroxy-yohimban-16α-carboxylic acid methyl ester (yohimbine) as pharmacological probes to assess the construct validity of the theta model. Although all three anxiogenic drugs significantly increased behavioural measures of anxiety in the elevated plus-maze, none of the three increased the frequency of hippocampal theta oscillations in the neurophysiological model. As a positive control, we demonstrated that diazepam, a proven anxiolytic drug, decreased the frequency of hippocampal theta, as in all other studies using this model. Given this discrepancy between the significant effects of anxiogenic drugs in the behavioural model and the null effects of these drugs in the neurophysiological model, we conclude that the construct validity of the hippocampal theta model of anxiety is questionable. Copyright © 2013 Elsevier Ltd. All rights reserved.

Neutron detection performance of silicon carbide and diamond detectors with incomplete charge collection properties

Energy Technology Data Exchange (ETDEWEB)

Hodgson, M., E-mail: michael.hodgson@becq.co.uk [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Lohstroh, A.; Sellin, P. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Thomas, D. [NPL, Teddington TW11 0LW (United Kingdom)

2017-03-01

The benefits of neutron detection and spectroscopy with carbon based, wide band gap, semiconductor detectors have previously been discussed within the literature. However, at the time of writing there are still limitations with these detectors related to availability, cost, size and perceived quality. This study demonstrates that lower quality materials—indicated by lower charge collection efficiency (CCE), poor resolution and polarisation effect—available at wafer scale and lower cost, can fulfil requirements for fast neutron detection and spectroscopy for fluxes over several orders of magnitude, where only coarse energy discrimination is required. In this study, a single crystal diamond detector (D-SC, with 100% CCE), a polycrystalline diamond (D-PC, with ≈4% CCE) and semi-insulating silicon carbide (SiC-SI, with ≈35% CCE) have been compared for alpha and fast neutron performance. All detectors demonstrated alpha induced polarisation effects in the form of a change of both energy peak position and count rate with irradiation time. Despite these operational issues the ability to detect fast neutrons and distinguish neutron energies was observed. This performance was demonstrated over a wide dynamic range (500–40,000 neutrons/s), with neutron induced polarisation being demonstrated in D-PC and SiC-SI at high fluxes.

Measurement and assessment of carrying capacity of the environment in Ningbo, China.

Science.gov (United States)

Liu, R Z; Borthwick, Alistair G L

2011-08-01

Carrying Capacity of the Environment (CCE) provides a useful measure of the sustainable development of a region. Approaches that use integrated assessment instead of measurement can lead to misinterpretation of sustainable development because of confusion between Environmental Stress (ES) indexes and CCE indexes, and the selection of over-simple linear plus models. The present paper proposes a comprehensive measurement system for CCE which comprises models of natural resources capacity, environmental assimilative capacity, ecosystem services capacity, and society supporting capacity. The corresponding measurable indexes are designed to assess CCE using a carrying capacity surplus ratio model and a vector of surplus ratio of carrying capacity model. The former aims at direct comparison of ES and CCE based on the values of basic indexes, and the latter uses a Euclidean vector to assess CCE states. The measurement and assessment approaches are applicable to Strategic Environmental Assessment (SEA) and environmental planning and management. A case study is presented for Ningbo, China, whereby all the basic indexes of ECC are measured and the CCE states assessed for 2005 and 2010. Copyright © 2011 Elsevier Ltd. All rights reserved.

Characterization of 150 $\\mu$m thick epitaxial silicon detectors from different producers after proton irradiation

CERN Document Server

Hoedlmoser, H; Haerkoenen, J; Kronberger, M; Trummer, J; Rodeghiero, P

2007-01-01

Epitaxial (EPI) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of 150 mm thick EPI silicon diodes irradiated with 24GeV=c protons up to a fluence of 3 1015 p=cm2 has been performed by means of Charge Collection Efficiency (CCE) measurements, investigations with the Transient Current Technique (TCT) and standard CV=IV characterizations. The aim of the work was to investigate the impact of radiation damage as well as the influence of the wafer processing on the material performance by comparing diodes from different manufacturers. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. While the generation of leakage current due to irradiation is similar in all investigated series of detectors, a difference in the effective doping concentration can be observed after irradiation. In the CCE measurements an anomalous drop in performance was found even for diodes exposed to ...

Consumer behavior changing: methods of evaluation

Directory of Open Access Journals (Sweden)

Elīna Gaile-Sarkane

2013-11-01

Full Text Available The article is devoted to methods of analyses of consumer buying behavior as well as to evaluation of most important factors what influences consumer behavior. This research aims at investigations about the changes in consumer behavior caused by globalization and development of information technologies; it helps to understand the specific factors what should be taken into account in evaluation of consumer behavior. The authors employ well-established quantitative and qualitative methods of research: grouping, analysis, synthesis, expert method, statistic method, etc. Research findings disclosed that there is possibility to introduce new methods for evaluation of changing consumer behavior.

Functional modulation of cerebral gamma-aminobutyric acidA receptor/benzodiazepine receptor/chloride ion channel complex with ethyl beta-carboline-3-carboxylate: Presence of independent binding site for ethyl beta-carboline-3-carboxylate

Energy Technology Data Exchange (ETDEWEB)

Taguchi, J.; Kuriyama, K. (Kyoto Prefectural Univ. of Medicine (Japan))

1990-05-01

Effect of ethyl beta-carboline-3-carboxylate (beta-CCE) on the function of gamma-aminobutyric acid (GABA)A receptor/benzodiazepine receptor/chloride ion channel complex was studied. Beta-CCE noncompetitively and competitively inhibited (3H)flunitrazepam binding to benzodiazepine receptor, but not (3H)muscimol binding to GABAA receptor as well as t-(3H)butylbicycloorthobenzoate (( 3H) TBOB) binding to chloride ion channel, in particulate fraction of the mouse brain. Ro15-1788 also inhibited competitively (3H) flunitrazepam binding. On the other hand, the binding of beta-(3H)CCE was inhibited noncompetitively and competitively by clonazepam and competitively by Ro15-1788. In agreement with these results, benzodiazepines-stimulated (3H)muscimol binding was antagonized by beta-CCE and Ro15-1788. Gel column chromatography for the solubilized fraction from cerebral particulate fraction by 0.2% sodium deoxycholate (DOC-Na) in the presence of 1 M KCl indicated that beta-(3H)CCE binding site was eluted in the same fraction (molecular weight, 250,000) as the binding sites for (3H)flunitrazepam, (3H)muscimol and (3H)TBOB. GABA-stimulated 36Cl- influx into membrane vesicles prepared from the bovine cerebral cortex was stimulated and attenuated by flunitrazepam and beta-CCE, respectively. These effects of flunitrazepam and beta-CCE on the GABA-stimulated 36Cl- influx were antagonized by Ro15-1788. The present results suggest that the binding site for beta-CCE, which resides on GABAA receptor/benzodiazepine receptor/chloride ion channel complex, may be different from that for benzodiazepine. Possible roles of beta-CCE binding site in the allosteric inhibitions on benzodiazepine binding site as well as on the functional coupling between chloride ion channel and GABAA receptor are also suggested.

Do forests best mitigate CO2 emissions to the atmosphere by setting them aside for maximization of carbon storage or by management for fossil fuel substitution?

DEFF Research Database (Denmark)

Taeroe, Anders; Fayez Mustapha, Walid; Stupak, Inge

2017-01-01

fossil fuels and fossil fuel intensive materials. We defined a modelling framework for calculation of the carbon pools and fluxes along the forest energy and wood product supply chains over 200 years for three forest management alternatives (FMA): 1) a traditionally managed European beech forest...... the lowest CCE when using coal as the reference fossil fuel. With natural gas as the reference fossil fuel, the CCE of the business-as-usual and the energy poplar was nearly equal, with the unmanaged forest having the highest CCE after 40 years. CPTs ranged from 0 to 156 years, depending on the applied model...... assumptions. CCE and CPT were especially sensitive to the reference fossil fuel, material alternatives to wood, forest growth rates for the three FMAs, and energy conversion efficiencies. Assumptions about the long-term steady-state levels of carbon stored in the unmanaged forest had a limited effect on CCE...

High performance ceramic carbon electrode-based anodes for use in the Cu-Cl thermochemical cycle for hydrogen production

Energy Technology Data Exchange (ETDEWEB)

Ranganathan, Santhanam; Easton, E. Bradley [Faculty of Science, University of Ontario Institute of Technology, 2000 Simcoe Street North, Oshawa, Ontario L1H 7K4 (Canada)

2010-02-15

A high performance ceramic carbon electrode (CCE) was fabricated by the sol-gel method to study the CuCl electrolysis in Cu-Cl thermochemical cycle. The electrochemical behavior and stability of the CCE was investigated by polarization experiments at different concentrations of CuCl/HCl system. The CCE displayed excellent anodic performance and vastly outperformed the bare carbon fiber paper (CFP) even at high concentrations of CuCl (0.5 M) and HCl (6 M), which is explained in terms of increased active area and enhanced anion transport properties. Further enhancement of activity was achieved by coating the CCE layer onto both sides of the CFP substrate. (author)

Evaluation of European energy behavioural change programmes

Energy Technology Data Exchange (ETDEWEB)

Gynther, L.; Mikkonen, I. [Motiva Oy, Urho Kekkosenkatu 4-6 A, 00100 Helsinki (Finland); Smits, A. [NL Agency, Swentiboldstraat 21, 6137 AE Sittard (Netherlands)

2012-01-15

This article is based on the findings of the BEHAVE Project (Evaluation of Energy Behavioural Change Programmes) which was supported by the European Commission under the EU Intelligent Energy-Europe (IEE) Programme. The project started with a review of behavioural theories and their applicability in the development and evaluation of energy-related behavioural change programmes, progressed to a case study analysis and finished with a publication of guidelines for programme developers and policy makers. This paper concentrates on the results of the case study analysis and the recommendations arising from it. In the case study analysis, information was collected on almost 100 cases aiming at behavioural change in energy use from 11 European countries. More detailed information was collected on 41 cases which were subject to meta-analysis to identify success factors and weak points and to gather information on the current evaluation practices in such programmes. The meta-analysis was carried out in five phases: context (pre-planning), planning, implementation, monitoring and evaluation. Planning and evaluation were recognised as two of the most critical phases. Many of the programmes operated with quite formal plans but were typically not based on scientific theories or evidence. In many cases, there was lack of market segmentation; the goals were not targeted and the programmes tried to offer 'everything to everybody'. A multitude of ex-post evaluation methods for programme impacts were reported ranging from participant surveys, testing and comparison with control groups to top-down method evaluating the impact of several programmes focusing on the same target group. Process evaluation (25 cases) was slightly less common than impact evaluation (29 cases). Evaluation of the cost-effectiveness of the programmes was a rarity, most likely due to difficulties in quantitative impact evaluation.

Monitoring and Evaluation Toolkit for Climate Change Adaptation ...

International Development Research Centre (IDRC) Digital Library (Canada)

Many African countries, regions and organizations are making plans for climate change adaptation. If such plans are to be effective, they will need to be monitored and evaluated on an ongoing basis. This grant will support the integration of monitoring and evaluation (M&E) in climate change adaptation initiatives by ...

Evaluation of Liver Fibrosis Using Texture Analysis on Combined-Contrast-Enhanced Magnetic Resonance Images at 3.0T

Directory of Open Access Journals (Sweden)

Takeshi Yokoo

2015-01-01

Full Text Available Purpose. To noninvasively assess liver fibrosis using combined-contrast-enhanced (CCE magnetic resonance imaging (MRI and texture analysis. Materials and Methods. In this IRB-approved, HIPAA-compliant prospective study, 46 adults with newly diagnosed HCV infection and recent liver biopsy underwent CCE liver MRI following intravenous administration of superparamagnetic iron oxides (ferumoxides and gadolinium DTPA (gadopentetate dimeglumine. The image texture of the liver was quantified in regions-of-interest by calculating 165 texture features. Liver biopsy specimens were stained with Masson trichrome and assessed qualitatively (METAVIR fibrosis score and quantitatively (% collagen stained area. Using L1 regularization path algorithm, two texture-based multivariate linear models were constructed, one for quantitative and the other for quantitative histology prediction. The prediction performance of each model was assessed using receiver operating characteristics (ROC and correlation analyses. Results. The texture-based predicted fibrosis score significantly correlated with qualitative (r=0.698, P<0.001 and quantitative (r=0.757, P<0.001 histology. The prediction model for qualitative histology had 0.814–0.976 areas under the curve (AUC, 0.659–1.000 sensitivity, 0.778–0.930 specificity, and 0.674–0.935 accuracy, depending on the binary classification threshold. The prediction model for quantitative histology had 0.742–0.950 AUC, 0.688–1.000 sensitivity, 0.679–0.857 specificity, and 0.696–0.848 accuracy, depending on the binary classification threshold. Conclusion. CCE MRI and texture analysis may permit noninvasive assessment of liver fibrosis.

Safety Assessment of Multi Purpose Small Payload Rack(MSPR)

Science.gov (United States)

Mizutani, Yoshinobu; Takada, Satomi; Murata, Kosei; Ozawa, Daisaku; Kobayashi, Ryoji; Nakamura, Yasuhiro

2010-09-01

special controls based on ISS common safety assessment methodology. Safety evaluation results are reported in the Safety Assessment Report(SAR) 1). Regarding structural failure, unique hazards are especially evaluated considering not only the tolerance for launch load but also load by crewmembers or orbital loads. Regarding electrical shock, electricity design up to secondary power is evaluated in unique hazard from a view point of Electrical design suitable for high voltage(32VDC or more) circuit. Regarding rupture/leakage of pressure system, hazards of fuel supply line, waste line for combustion gas, and pressure system including CCE are evaluated. Also evaluation for contamination due to hazardous gas leakage from CCE is conducted. External propagation of fire from CCE is also evaluated. In this report, we will show the overview of the result of safety assessment and future plan toward critical design phase activity.

Enhancing reporting of behavior change intervention evaluations

NARCIS (Netherlands)

Abraham, C.; Johnson, B.T.; de Bruin, M.; Luszczynska, A.

2014-01-01

Many behavior change interventions for the prevention and treatment of HIV have been evaluated, but suboptimal reporting of evaluations hinders the accumulation of evidence and the replication of interventions. In this article, we address 4 practices contributing to this problem. First, detailed

ORF Alignment: NC_001143 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available yces cerevisiae] emb|CAA81846.1| CCE1 ... [Saccharomyces cerevisiae] sp|Q03702|CCE1_YEAST ... Cruciform cutting... ... [Saccharomyces cerevisiae] gb|AAB02883.1| cruciform ... cutting endon

Concurrent approach for evolving compact decision rule sets

Science.gov (United States)

Marmelstein, Robert E.; Hammack, Lonnie P.; Lamont, Gary B.

1999-02-01

The induction of decision rules from data is important to many disciplines, including artificial intelligence and pattern recognition. To improve the state of the art in this area, we introduced the genetic rule and classifier construction environment (GRaCCE). It was previously shown that GRaCCE consistently evolved decision rule sets from data, which were significantly more compact than those produced by other methods (such as decision tree algorithms). The primary disadvantage of GRaCCe, however, is its relatively poor run-time execution performance. In this paper, a concurrent version of the GRaCCE architecture is introduced, which improves the efficiency of the original algorithm. A prototype of the algorithm is tested on an in- house parallel processor configuration and the results are discussed.

Severe signal loss in diamond beam loss monitors in high particle rate environments by charge trapping in radiation-induced defects

Energy Technology Data Exchange (ETDEWEB)

Kassel, Florian; Boer, Wim de [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany); Guthoff, Moritz; Dabrowski, Anne [CERN, Meyrin (Switzerland)

2016-10-15

The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. After an integrated luminosity of a few fb{sup -1} corresponding to a few weeks of LHC operation, the CCE of the sCVD diamonds dropped by a factor of five or more and quickly approached the poor CCE of pCVD diamonds. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and recombination and hence reduces the CCE in a strongly non-linear way. A diamond irradiation campaign was started to investigate the rate-dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the transient current technique (TCT), the CCE was measured. The experimental results were used to create an effective deep trap model that takes the radiation damage into account. Using this trap model, the rate-dependent electrical field deformation and the CCE were simulated with the software SILVACO TCAD. The simulation, tuned to rate-dependent measurements from a strong radioactive source, was able to predict the non-linear decrease of the

Severe signal loss in diamond beam loss monitors in high particle rate environments by charge trapping in radiation-induced defects

International Nuclear Information System (INIS)

Kassel, Florian; Boer, Wim de; Guthoff, Moritz; Dabrowski, Anne

2016-01-01

The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. After an integrated luminosity of a few fb -1 corresponding to a few weeks of LHC operation, the CCE of the sCVD diamonds dropped by a factor of five or more and quickly approached the poor CCE of pCVD diamonds. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and recombination and hence reduces the CCE in a strongly non-linear way. A diamond irradiation campaign was started to investigate the rate-dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the transient current technique (TCT), the CCE was measured. The experimental results were used to create an effective deep trap model that takes the radiation damage into account. Using this trap model, the rate-dependent electrical field deformation and the CCE were simulated with the software SILVACO TCAD. The simulation, tuned to rate-dependent measurements from a strong radioactive source, was able to predict the non-linear decrease of the CCE in

Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle

International Nuclear Information System (INIS)

Ranganathan, S.; Easton, E.B.

2009-01-01

Sol-gel chemistry is becoming more popular for the synthesis of electrode materials. For example, the sol-gel reaction can be performed in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together via the ceramic binder, which can also promote ion transport. Furthermore, the CCE structure has a high active surface area and is chemical and thermally robust. We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments (cyclic voltammetry, electrochemical impedance spectroscopy) were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. Our initial results have shown that CCE-based electrodes vastly outperform a bare carbon electrode, and thus are highly promising and cost-effective electrode material. Subsequent experiments involved the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements will be presented. (author)

Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle

Energy Technology Data Exchange (ETDEWEB)

Ranganathan, S.; Easton, E.B. [Faculty of Science, Univ. of Ontario Inst. of Technology, Oshawa, Ontario (Canada)], E-mail: ranga@uoit.ca, Brad.Easton@uoit.ca

2009-07-01

Sol-gel chemistry is becoming more popular for the synthesis of electrode materials. For example, the sol-gel reaction can be performed in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together via the ceramic binder, which can also promote ion transport. Furthermore, the CCE structure has a high active surface area and is chemical and thermally robust. We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments (cyclic voltammetry, electrochemical impedance spectroscopy) were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. Our initial results have shown that CCE-based electrodes vastly outperform a bare carbon electrode, and thus are highly promising and cost-effective electrode material. Subsequent experiments involved the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements will be presented. (author)

Compound cycle engine for helicopter application

Science.gov (United States)

Castor, Jere G.

1986-01-01

The Compound Cycle Engine (CCE) is a highly turbocharged, power compounded, ultra-high power density, light-weight diesel engine. The turbomachinery is similar to a moderate pressure ratio, free power turbine engine and the diesel core is high speed and a low compression ratio. This engine is considered a potential candidate for future military light helicopter applications. This executive summary presents cycle thermodynamic (SFC) and engine weight analyses performed to establish general engine operating parameters and configuration. An extensive performance and weight analysis based on a typical two hour helicopter (+30 minute reserve) mission determined final conceptual engine design. With this mission, CCE performance was compared to that of a T-800 class gas turbine engine. The CCE had a 31% lower-fuel consumption and resulted in a 16% reduction in engine plus fuel and fuel tank weight. Design SFC of the CCE is 0.33 lb-HP-HR and installed wet weight is 0.43 lbs/HP. The major technology development areas required for the CCE are identified and briefly discussed.

CCE APPROACH THROUGH ABCD ANALYSIS OF ‘THEORY A’ ON ORGANIZATIONAL PERFORMANCE

OpenAIRE

Dr. P. S. Aithal; Dr. P. M. Suresh Kumar

2016-01-01

Theory A on organizational performance challenges the existing propositions on human behaviour and motivation. It is founded in the context of changed employee mindset of the modern day employee which has undergone enormous change due to changes in technology and means of production, production relations, customer and societal perception and one’s own expectations. The quest for creativity propels the employee to contribute to the organization drawing positive energy from his innate potential...

Evaluative language, cognitive effort and attitude change.

OpenAIRE

van der Pligt, J.; van Schie, E.C.M.; Martijn, C.

1994-01-01

Tested the hypotheses that evaluatively biased language influences attitudes and that the magnitude and persistence of attitude change depends on the amount of cognitive effort. 132 undergraduates participated in the experiment, which used material focusing on the issue of restricting adolescent driving over the weekends to reduce the number of fatal traffic accidents. Results indicate that evaluatively biased language can affect attitudes. Using words that evaluate the pro-position positivel...

Modeling charge collection efficiency degradation in partially depleted GaAs photodiodes using the 1- and 2-carrier Hecht equations

International Nuclear Information System (INIS)

Auden, E.C.; Vizkelethy, G.; Serkland, D.K.; Bossert, D.J.; Doyle, B.L.

2017-01-01

The Hecht equation can be used to model the nonlinear degradation of charge collection efficiency (CCE) in response to radiation-induced displacement damage in both fully and partially depleted GaAs photodiodes. CCE degradation is measured for laser-generated photocurrent as a function of fluence and bias in Al_0_._3Ga_0_._7As/GaAs/Al_0_._2_5Ga_0_._7_5As p-i-n photodiodes which have been irradiated with 12 MeV C and 7.5 MeV Si ions. CCE is observed to degrade more rapidly with fluence in partially depleted photodiodes than in fully depleted photodiodes. When the intrinsic GaAs layer is fully depleted, the 2-carrier Hecht equation describes CCE degradation as photogenerated electrons and holes recombine at defect sites created by radiation damage in the depletion region. If the GaAs layer is partially depleted, CCE degradation is more appropriately modeled as the sum of the 2-carrier Hecht equation applied to electrons and holes generated within the depletion region and the 1-carrier Hecht equation applied to minority carriers that diffuse from the field-free (non-depleted) region into the depletion region. Enhanced CCE degradation is attributed to holes that recombine within the field-free region of the partially depleted intrinsic GaAs layer before they can diffuse into the depletion region.

Modeling charge collection efficiency degradation in partially depleted GaAs photodiodes using the 1- and 2-carrier Hecht equations

Energy Technology Data Exchange (ETDEWEB)

Auden, E.C., E-mail: eauden@sandia.gov; Vizkelethy, G.; Serkland, D.K.; Bossert, D.J.; Doyle, B.L.

2017-05-15

The Hecht equation can be used to model the nonlinear degradation of charge collection efficiency (CCE) in response to radiation-induced displacement damage in both fully and partially depleted GaAs photodiodes. CCE degradation is measured for laser-generated photocurrent as a function of fluence and bias in Al{sub 0.3}Ga{sub 0.7}As/GaAs/Al{sub 0.25}Ga{sub 0.75}As p-i-n photodiodes which have been irradiated with 12 MeV C and 7.5 MeV Si ions. CCE is observed to degrade more rapidly with fluence in partially depleted photodiodes than in fully depleted photodiodes. When the intrinsic GaAs layer is fully depleted, the 2-carrier Hecht equation describes CCE degradation as photogenerated electrons and holes recombine at defect sites created by radiation damage in the depletion region. If the GaAs layer is partially depleted, CCE degradation is more appropriately modeled as the sum of the 2-carrier Hecht equation applied to electrons and holes generated within the depletion region and the 1-carrier Hecht equation applied to minority carriers that diffuse from the field-free (non-depleted) region into the depletion region. Enhanced CCE degradation is attributed to holes that recombine within the field-free region of the partially depleted intrinsic GaAs layer before they can diffuse into the depletion region.

Reliable change indices and standardized regression-based change score norms for evaluating neuropsychological change in children with epilepsy.

Science.gov (United States)

Busch, Robyn M; Lineweaver, Tara T; Ferguson, Lisa; Haut, Jennifer S

2015-06-01

Reliable change indices (RCIs) and standardized regression-based (SRB) change score norms permit evaluation of meaningful changes in test scores following treatment interventions, like epilepsy surgery, while accounting for test-retest reliability, practice effects, score fluctuations due to error, and relevant clinical and demographic factors. Although these methods are frequently used to assess cognitive change after epilepsy surgery in adults, they have not been widely applied to examine cognitive change in children with epilepsy. The goal of the current study was to develop RCIs and SRB change score norms for use in children with epilepsy. Sixty-three children with epilepsy (age range: 6-16; M=10.19, SD=2.58) underwent comprehensive neuropsychological evaluations at two time points an average of 12 months apart. Practice effect-adjusted RCIs and SRB change score norms were calculated for all cognitive measures in the battery. Practice effects were quite variable across the neuropsychological measures, with the greatest differences observed among older children, particularly on the Children's Memory Scale and Wisconsin Card Sorting Test. There was also notable variability in test-retest reliabilities across measures in the battery, with coefficients ranging from 0.14 to 0.92. Reliable change indices and SRB change score norms for use in assessing meaningful cognitive change in children following epilepsy surgery are provided for measures with reliability coefficients above 0.50. This is the first study to provide RCIs and SRB change score norms for a comprehensive neuropsychological battery based on a large sample of children with epilepsy. Tables to aid in evaluating cognitive changes in children who have undergone epilepsy surgery are provided for clinical use. An Excel sheet to perform all relevant calculations is also available to interested clinicians or researchers. Copyright © 2015 Elsevier Inc. All rights reserved.

Methodology for Evaluating Cost-effectiveness of Commercial Energy Code Changes

Energy Technology Data Exchange (ETDEWEB)

Hart, Philip R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Liu, Bing [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-01-31

This document lays out the U.S. Department of Energy’s (DOE’s) method for evaluating the cost-effectiveness of energy code proposals and editions. The evaluation is applied to provisions or editions of the American Society of Heating, Refrigerating and Air-Conditioning Engineers (ASHRAE) Standard 90.1 and the International Energy Conservation Code (IECC). The method follows standard life-cycle cost (LCC) economic analysis procedures. Cost-effectiveness evaluation requires three steps: 1) evaluating the energy and energy cost savings of code changes, 2) evaluating the incremental and replacement costs related to the changes, and 3) determining the cost-effectiveness of energy code changes based on those costs and savings over time.

3D-black-blood 3T-MRI for the diagnosis of thoracic large vessel vasculitis: A feasibility study

Energy Technology Data Exchange (ETDEWEB)

Treitl, Karla Maria; Saam, Tobias [Institute for Clinical Radiology, LMU Munich, Munich (Germany); German Center for Cardiovascular Disease Research (DZHK e.V.), Munich (Germany); Maurus, Stefan; Sommer, Nora Narvina; Coppenrath, Eva; Treitl, Marcus [Institute for Clinical Radiology, LMU Munich, Munich (Germany); Kooijman-Kurfuerst, Hendrik [Philips Healthcare, Hamburg (Germany); Czihal, Michael; Hoffmann, Ulrich [LMU Munich, Division of Vascular Medicine, Medical Clinic and Policlinic IV, Munich (Germany); Dechant, Claudia; Schulze-Koops, Hendrik [LMU Munich, Division of Rheumatology and Clinical Immunology, Medical Clinic and Policlinic IV, Munich (Germany)

2017-05-15

To evaluate the feasibility of T1w-3D black-blood turbo spin echo (TSE) sequence with variable flip angles for the diagnosis of thoracic large vessel vasculitis (LVV). Thirty-five patients with LVV, diagnosed according to the current standard of reference, and 35 controls were imaged at 3.0T using 1.2 x 1.3 x 2.0 mm{sup 3} fat-suppressed, T1w-3D, modified Volumetric Isotropic TSE Acquisition (mVISTA) pre- and post-contrast. Applying a navigator and peripheral pulse unit triggering (PPU), the total scan time was 10-12 min. Thoracic aorta and subclavian and pulmonary arteries were evaluated for image quality (IQ), flow artefact intensity, diagnostic confidence, concentric wall thickening and contrast enhancement (CWT, CCE) using a 4-point scale. IQ was good in all examinations (3.25 ± 0.72) and good to excellent in 342 of 408 evaluated segments (83.8 %), while 84.1 % showed no or minor flow artefacts. The interobserver reproducibility for the identification of CCE and CWT was 0.969 and 0.971 (p < 0.001) with an average diagnostic confidence of 3.47 ± 0.64. CCE and CWT were strongly correlated (Cohen's k = 0.87; P < 0.001) and significantly more frequent in the LVV-group (52.8 % vs. 1.0 %; 59.8 % vs. 2.4 %; P < 0.001). Navigated fat-suppressed T1w-3D black-blood MRI with PPU-triggering allows diagnosis of thoracic LVV. (orig.)

Repeat Mapping in Upper Monterey Canyon Captures the Effect of Sediment Transport Events of Known Magnitude and Duration on the Seafloor Morphology

Science.gov (United States)

Lundsten, E. M.; Anderson, K.; Caress, D. W.; Thomas, H. J.; Paull, C. K.; Maier, K. L.; Gwiazda, R.; Gales, J. A.; Talling, P.; Xu, J.; Parsons, D. R.

2017-12-01

As part of a multi-institution submarine canyon study, the Coordinated Canyon Experiment (CCE), high-resolution multibeam bathymetric surveys of the floor of Monterey Canyon, offshore California, were conducted to capture the changes in seafloor morphology directly related to the passage of sediment density flows documented during the study. The goals of this study were to monitor the passage of sediment density flows as they move through the axis of a submarine canyon in order to understand the velocity structure of these flows and to document the associated changes in seafloor morphology and the resultant deposits. The CCE consisted of an array of moorings and sensors deployed on the canyon floor during the 18-month period between October 2015 and April 2017. In addition, a mapping AUV (Autonomous Underwater Vehicle) repeatedly surveyed two sites along the canyon during the study. Differencing the repeat grids quantified the morphological changes directly related to specifically documented, individual flow events. The AUV carried a Reson 7125 multibeam echosounder (vertical precision of 0.15 m and horizontal resolution of 1.0 m). An inertial navigation system combined with a Doppler velocity logger allowed the AUV to fly pre-programmed grids at 3 knots while maintaining an altitude of 50 m above the seafloor and obtain a nominal line spacing of 130 m. The axial channel between 200 and 540 m water depth was surveyed six times. At least fifteen density flow events were captured by the array of CCE instruments within this AUV survey area. These events caused moorings as well as several large and small instruments to move down canyon significant distances at least 30 times. Difference grids show the canyon experienced erosion and deposition of up to +/- 3 m between surveys. The pair of surveys that straddle a sediment transport event on December 1, 2015 show the seafloor was altered only down to 420 m water depth, consistent with the observations on the CCE

Detection Capability Evaluation on Chang'e-5 Lunar Mineralogical Spectrometer (LMS)

Science.gov (United States)

Liu, Bin; Ren, Xin; Yan, Wei; Xu, Xuesen; Cai, Tingni; Liu, Dawei; Liu, Jianjun; Li, Chunlai

2016-04-01

The Chang'e-5 (CE-5) lunar sample return mission is scheduled to launch in 2017 to bring back lunar regolith and drill samples. The Chang'e-5 Lunar Mineralogical Spectrometer (LMS), as one of the three sets of scientific payload installed on the lander, is used to collect in-situ spectrum and analyze the mineralogical composition of the sampling site. It can also help to select the sampling site , and to compare the measured laboratory spectrum of returned sample with in-situ data. LMS employs acousto-optic tunable filters (AOTFs) and is composed of a VIS/NIR module (0.48μm-1.45μm) and an IR module (1.4μm -3.2μm). It has spectral resolution ranging from 3 to 25 nm, with a field of view (FOV) of 4.24°×4.24°. Unlike Chang'e-3 VIS/NIR Imaging Spectrometer (VNIS), the spectral coverage of LMS is extended from 2.4μm to 3.2μm, which has capability to identify H2O/OH absorption features around 2.7μm. An aluminum plate and an Infragold plate are fixed in the dust cover, being used as calibration targets in the VIS/NIR and IR spectral range respectively when the dust cover is open. Before launch, a ground verification test of LMS needs to be conducted in order to: 1) test and verify the detection capability of LMS through evaluation on the quality of image and spectral data collected for the simulated lunar samples; and 2) evaluate the accuracy of data processing methods by the simulation of instrument working on the moon. The ground verification test will be conducted both in the lab and field. The spectra of simulated lunar regolith/mineral samples will be collected simultaneously by the LMS and two calibrated spectrometers: a FTIR spectrometer (Model 102F) and an ASD FieldSpec 4 Hi-Res spectrometer. In this study, the results of the LMS ground verification test will be reported including the evaluation on the LMS spectral and image data quality, mineral identification and inversion ability, accuracy of calibration and geometric positioning .

Merging Developmental and Feminist Evaluation to Monitor and Evaluate Transformative Social Change

Science.gov (United States)

Haylock, Laura; Miller, Carol

2016-01-01

Programs seeking to challenge and change gender and power relationships require a nimble, evolving monitoring, evaluation, and learning (MEL) system that helps make sense of how nonlinear complex social change happens. This article describes efforts by Oxfam Canada to develop such a system for a women's rights and gender equality program. The…

Methodology for Evaluating Raw Material Changes to RSRM Elastomeric Insulation Materials

Science.gov (United States)

Mildenhall, Scott D.; McCool, Alex (Technical Monitor)

2001-01-01

The Reusable Solid Rocket Motor (RSRM) uses asbestos and silicon dioxide filled acrylonitrile butadiene rubber (AS-NBR) as the primary internal insulation to protect the case from heat. During the course of the RSRM Program, several changes have been made to the raw materials and processing of the AS-NBR elastomeric insulation material. These changes have been primarily caused by raw materials becoming obsolete. In addition, some process changes have been implemented that were deemed necessary to improve the quality and consistency of the AS-NBR insulation material. Each change has been evaluated using unique test efforts customized to determine the potential impacts of the specific raw material or process change. Following the evaluations, the various raw material and process changes were successfully implemented with no detectable effect on the performance of the AS-NBR insulation. This paper will discuss some of the raw material and process changes evaluated, the methodology used in designing the unique test plans, and the general evaluation results. A summary of the change history of RSRM AS-NBR internal insulation is also presented.

Frameworks for change in healthcare organisations: a formative evaluation of the NHS Change Model.

Science.gov (United States)

Martin, Graham P; Sutton, Elizabeth; Willars, Janet; Dixon-Woods, Mary

2013-08-01

Organisational change in complex healthcare systems is a multifaceted process. The English National Health Service recently introduced a 'Change Model' that seeks to offer an evidence-based framework for guiding change. We report findings from a formative evaluation of the NHS Change Model and make recommendations for those developing the Model and its users. The evaluation involved 28 interviews with managers and clinicians making use of the Change Model in relation to a variety of projects. Interviews were fully transcribed and were analysed using an approach based on the Framework method. Participants saw the Change Model as valuable and practically useful. Fidelity to core principles of the Model was variable: participants often altered the Model, especially when using it to orchestrate the work of others. In challenging organisational contexts, the Change Model was sometimes used to delegitimise opposition rather than identify shared purpose among different interest groups. Those guiding change may benefit from frameworks, guidance and toolkits to structure and inform their planning and activities. Participants' experiences suggested the Change Model has much potential. Further work on its design and on supporting materials may optimise the approach, but its utility rests in particular on organisational cultures that support faithful application. © The Author(s) 2013 Reprints and permissions:]br]sagepub.co.uk/journalsPermissions.nav.

Reliable Change Indices and Standardized Regression-Based Change Score Norms for Evaluating Neuropsychological Change in Children with Epilepsy

Science.gov (United States)

Busch, Robyn M.; Lineweaver, Tara T.; Ferguson, Lisa; Haut, Jennifer S.

2015-01-01

Reliable change index scores (RCIs) and standardized regression-based change score norms (SRBs) permit evaluation of meaningful changes in test scores following treatment interventions, like epilepsy surgery, while accounting for test-retest reliability, practice effects, score fluctuations due to error, and relevant clinical and demographic factors. Although these methods are frequently used to assess cognitive change after epilepsy surgery in adults, they have not been widely applied to examine cognitive change in children with epilepsy. The goal of the current study was to develop RCIs and SRBs for use in children with epilepsy. Sixty-three children with epilepsy (age range 6–16; M=10.19, SD=2.58) underwent comprehensive neuropsychological evaluations at two time points an average of 12 months apart. Practice adjusted RCIs and SRBs were calculated for all cognitive measures in the battery. Practice effects were quite variable across the neuropsychological measures, with the greatest differences observed among older children, particularly on the Children’s Memory Scale and Wisconsin Card Sorting Test. There was also notable variability in test-retest reliabilities across measures in the battery, with coefficients ranging from 0.14 to 0.92. RCIs and SRBs for use in assessing meaningful cognitive change in children following epilepsy surgery are provided for measures with reliability coefficients above 0.50. This is the first study to provide RCIs and SRBs for a comprehensive neuropsychological battery based on a large sample of children with epilepsy. Tables to aid in evaluating cognitive changes in children who have undergone epilepsy surgery are provided for clinical use. An excel sheet to perform all relevant calculations is also available to interested clinicians or researchers. PMID:26043163

Retrospective Evaluation of Topical Bimatoprost and Iris Pigmentation Change.

Science.gov (United States)

Zaleski-Larsen, Lisa A; Ruth, Nadine H; Fabi, Sabrina G

2017-12-01

Topical bimatoprost is a topical prostaglandin analog originally used to treat glaucoma and more recently used to cosmetically induce hypertrichosis of the eyelashes. Iris pigmentation change has been noted in the treatment of glaucoma but has not been assessed with the cosmetic periorbital application of bimatoprost. To evaluate for iris pigmentation change with the long-term cosmetic use of topical bimatoprost. A retrospective chart review in a cosmetic dermatology practice of women (N = 50) who consistently purchased topical bimatoprost over an average of 4.59 years was compared with that of age-matched non-bimatoprost patients (N = 50). A blinded evaluator assessed each patient for iris pigmentary change. No iris pigmentation change was noted with the cutaneous application of bimatoprost. The cutaneous application of bimatoprost appears to be safe with minimal risk for iris pigmentation change.

Critical Science Education in a Suburban High School Chemistry Class

Science.gov (United States)

Ashby, Patrick

To improve students' scientific literacy and their general perceptions of chemistry, I enacted critical chemistry education (CCE) in two "regular level" chemistry classes with a group of 25 students in a suburban, private high school as part of this study. CCE combined the efforts of critical science educators (Fusco & Calabrese Barton, 2001; Gilbert 2013) with the performance expectations of the Next Generation Science Standards (NGSS) (NGSS Lead States, 2013a) to critically transform the traditional chemistry curriculum at this setting. Essentially, CCE engages students in the critical exploration of socially situated chemistry content knowledge and requires them to demonstrate this knowledge through the practices of science. The purpose of this study was to gauge these students development of chemistry content knowledge, chemistry interest, and critical scientific literacy (CSL) as they engaged in CCE. CSL was a construct developed for this study that necessarily combined the National Research Center's (2012) definition of scientific literacy with a critical component. As such, CSL entailed demonstrating content knowledge through the practices of science as well as the ability to critically analyze the intersections between science content and socially relevant issues. A mixed methods, critical ethnographic approach framed the collection of data from open-ended questionnaires, focus group interviews, Likert surveys, pre- and post unit tests, and student artifacts. These data revealed three main findings: (1) students began to develop CSL in specific, significant ways working through the activities of CCE, (2) student participants of CCE developed a comparable level of chemistry content understanding to students who participated in a traditional chemistry curriculum, and (3) CCE developed a group of students' perceptions of interest in chemistry. In addition to being able to teach students discipline specific content knowledge, the implications of this study are

Reading for Reliability: Preservice Teachers Evaluate Web Sources about Climate Change

Science.gov (United States)

Damico, James S.; Panos, Alexandra

2016-01-01

This study examined what happened when 65 undergraduate prospective secondary level teachers across content areas evaluated the reliability of four online sources about climate change: an oil company webpage, a news report, and two climate change organizations with competing views on climate change. The students evaluated the sources at three time…

Interannual variations in snowpack in the Crown of the Continent Ecosystem

Science.gov (United States)

Selkowitz, D.J.; Fagre, D.B.; Reardon, B.A.

2002-01-01

Ecosystem changes such as glacier recession and alpine treeline advance have been documented over the previous 150 years in the Rocky Mountains of northern Montana and southern British Columbia and Alberta, a region known as the Crown of the Continent Ecosystem (CCE). Such changes are controlled, at least partially, by variations in snowpack. The CCE consists primarily of public lands, the majority of which is undeveloped or wilderness. Consequently, this region is well suited for an examination of long-term snowpack variation and associated ecosystem change. Data from nine SNOTEL sites provide an indication of the daily accumulation and ablation of snowpack over the period 1977-2001, as well as the relationship between precipitation, temperature and snowpack. 1 April data from 21 snow courses indicated the extent of regional snowpack variation and trends over the period 1950-2001, and 1 May data from three snow courses in Glacier National Park allow this record to be extended back to 1922. SNOTEL data suggest CCE snowpacks are larger and more persistent than in most regions of the western USA, and that water year precipitation is the primary control on 1 April snow water equivalent (SWE). Snow course data indicate that variations in both 1 April and 1 May mean SWE are closely tied to the Pacific decadal oscillation, an El Nino-southern oscillation-like interdecadal pattern of Pacific Ocean climate variability. Despite relatively stable snowpacks and summer temperatures since 1922, the glaciers in Glacier National Park have receded steadily during this period, implying a significant climatic shift between their Little Ice Age glacial maxima (ca 1860) and 1922. Published in 2002 by John Wiley and Sons, Ltd.

Standardization of enterococci density estimates by EPA qPCR methods and comparison of beach action value exceedances in river waters with culture methods

Science.gov (United States)

The U.S.EPA has published recommendations for calibrator cell equivalent (CCE) densities of enterococci in recreational waters determined by a qPCR method in its 2012 Recreational Water Quality Criteria (RWQC). The CCE quantification unit stems from the calibration model used to ...

Nafion/lead nitroprusside nanoparticles modified carbon ceramic electrode as a novel amperometric sensor for L-cysteine.

Science.gov (United States)

Razmi, H; Heidari, H

2009-05-01

This work describes the electrochemical and electrocatalytic properties of carbon ceramic electrode (CCE) modified with lead nitroprusside (PbNP) nanoparticles as a new electrocatalyst material. The structure of deposited film on the CCE was characterized by energy dispersive X-ray (EDX), Fourier transform infrared (FTIR), and scanning electron microscopy (SEM). The cyclic voltammogram (CV) of the PbNP modified CCE showed two well-defined redox couples due to [Fe(CN)5NO](3-)/[Fe(CN)5NO](2-) and Pb(IV)/Pb(II) redox reactions. The modified electrode showed electrocatalytic activity toward the oxidation of L-cysteine and was used as an amperometric sensor. Also, to reduce the fouling effect of L-cysteine and its oxidation products on the modified electrode, a thin film of Nafion was coated on the electrode surface. The sensor response was linearly changed with L-cysteine concentration in the range of 1 x 10(-6) to 6.72 x 10(-5)mol L(-1) with a detection limit (signal/noise ratio [S/N]=3) of 0.46 microM. The sensor sensitivity was 0.17 microA (microM)(-1), and some important advantages such as simple preparation, fast response, good stability, interference-free signals, antifouling properties, and reproducibility of the sensor for amperometric determination of L-cysteine were achieved.

Charge Collection Efficiency Simulations of Irradiated Silicon Strip Detectors

CERN Document Server

Peltola, T.

2014-01-01

During the scheduled high luminosity upgrade of LHC, the world's largest particle physics accelerator at CERN, the position sensitive silicon detectors installed in the vertex and tracking part of the CMS experiment will face more intense radiation environment than the present system was designed for. Thus, to upgrade the tracker to required performance level, comprehensive measurements and simulations studies have already been carried out. Essential information of the performance of an irradiated silicon detector is obtained by monitoring its charge collection efficiency (CCE). From the evolution of CCE with fluence, it is possible to directly observe the effect of the radiation induced defects to the ability of the detector to collect charge carriers generated by traversing minimum ionizing particles (mip). In this paper the numerically simulated CCE and CCE loss between the strips of irradiated silicon strip detectors are presented. The simulations based on Synopsys Sentaurus TCAD framework were performed ...

Ceramic carbon electrode-based anodes for use in the copper-chlorine thermochemical cycle

Energy Technology Data Exchange (ETDEWEB)

Ranganathan, S.; Easton, E.B. [Univ. of Ontario Inst. of Technology, Oshawa, ON (Canada). Faculty of Science

2009-07-01

A thermochemical cycle is a process by which water is decomposed into hydrogen and oxygen through a series of chemical reactions. The chemicals that are used in these reactions are regenerated and recycled during the process. Sol-gel chemistry is becoming more common for the synthesis of electrode materials. The sol-gel reaction can be conducted in the presence of a carbon black to form a ceramic carbon electrode (CCE). The resultant CCE structure contains electronically conductive carbon particle pathways that are bound together through the ceramic binder, which can also promote ion transport. The CCE structure also has a high active surface area and is chemically and thermally robust. This paper presented an investigation of CCE materials prepared using 3-aminopropyl trimethoxysilane. Several electrochemical experiments including cyclic voltammetry and electrochemical impedance spectroscopy were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the copper-chlorine thermochemical cycle. Subsequent experiments included the manipulation of the relative ratio of organosilane carbon precursors to gauge its impact on electrode properties and performance. An overview of the materials characterization and electrochemical measurements were also presented. Specifically, the paper presented the experiment with particular reference to the CCE preparation; electrochemical experiments; thermal analysis; and scanning electron microscopy. Results were also provided. These included TGA analysis; scanning electron microscopy analysis; electrochemical characterization; and anodic polarization. Characterization of these CCE material demonstrated that they had good thermal stability, could be used at high temperatures, and were therefore, very promising anode materials. 15 refs., 7 figs.

Evaluation of economic impact of climatic change on agro-forestry systems

Directory of Open Access Journals (Sweden)

Vittorio Gallerani

Full Text Available Climate change has a strong influence on agro-forestry systems. Present estimations evisage that changes in climate patterns and extreme events connected to climate change will have greater impacts in the future. This paper seeks to illustrate the articulation of the problems concerning the economic evaluation of climate change, with particularly attention to open problems and future lines of research. Research on this topic, though using methods and approaches consolidated in the disciplines of resource economics and evaluation, still have several open problems, particularly in the field of multidisciplinary studies of the man-environmental relations, policy evaluation and development of decision support systems for decision makers.

Development of cryogenic tracking detectors for very high luminosity experiments

CERN Document Server

Härkönen, J; Anbinderis, T; Bates, R; de Boer, W; Borchi, E; Bruzzi, M; Buttar, C; Chen, W; Cindro, V; Czellar, S; Eremin, V; Furgeri, A; Gaubas, E; Heijne, E; Ilyashenko, I; Kalesinskas, V; Krause, M; Li, Z; Luukka, P; Mandic, I; Menichelli, D; Mikuz, M; Militaru, O; Mueller, S; Niinikoski, T O; O’Shea, V; Parkes, C; Piotrzkowski, K; Pirollo, S; Pusa, P; Räisänen, J; Rouby, X; Tuominen, E; Tuovinen, E; Vaitkus, J; Verbitskaya, E; Väyrynen, S; Zavrtanik, M

2009-01-01

Experimental results and simulations of Charge Collection Efficiency (CCE) of Current Injected Detectors (CIDs) are focused. CID is a concept where the current is limited by the space charge. The injected carriers will be trapped by the deep levels. This induces a stable electric field through the entire bulk regardless of the irradiation fluence the detector has been exposed. Our results show that the CCE of CIDs is about two times higher than of regular detectors when irradiated up to 1×1016 cm−2. The higher CCE is achieved already at −50 °C temperatures.

Cholesterol Crystal Embolism and Chronic Kidney Disease.

Science.gov (United States)

Li, Xuezhu; Bayliss, George; Zhuang, Shougang

2017-05-24

Renal disease caused by cholesterol crystal embolism (CCE) occurs when cholesterol crystals become lodged in small renal arteries after small pieces of atheromatous plaques break off from the aorta or renal arteries and shower the downstream vascular bed. CCE is a multisystemic disease but kidneys are particularly vulnerable to atheroembolic disease, which can cause an acute, subacute, or chronic decline in renal function. This life-threatening disease may be underdiagnosed and overlooked as a cause of chronic kidney disease (CKD) among patients with advanced atherosclerosis. CCE can result from vascular surgery, angiography, or administration of anticoagulants. Atheroembolic renal disease has various clinical features that resemble those found in other kidney disorders and systemic diseases. It is commonly misdiagnosed in clinic, but confirmed by characteristic renal biopsy findings. Therapeutic options are limited, and prognosis is considered to be poor. Expanding knowledge of atheroembolic renal disease due to CCE opens perspectives for recognition, diagnosis, and treatment of this cause of progressive renal insufficiency.

arXiv Description of radiation damage in diamond sensors using an effective defect model

CERN Document Server

Kassel, Florian; Dabrowski, Anne; De Boer, Wim

The BCML system is a beam monitoring device in the CMS experiment at the LHC. As detectors poly-crystalline diamond sensors are used. Here high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the CCE. However, the loss in CCE was much more severe than expected. The reason why in real experiments the CCE is so much worse than in laboratory experiments is related to the rate of incident particles. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field, which in turn increases the trapping rate and hence reduces the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge the TCAD simulation program SILVACO was used. Two effective acceptor and donor levels were needed ...

Evaluative conditioning induces changes in sound valence

Directory of Open Access Journals (Sweden)

Anna C. Bolders

2012-04-01

Full Text Available Evaluative Conditioning (EC has hardly been tested in the auditory domain, but it is a potentially valuable research tool. In Experiment 1 we investigated whether the affective evaluation of short environmental sounds can be changed using affective words as unconditioned stimuli (US. Congruence effects on an affective priming task (APT for conditioned sounds demonstrated successful EC. Subjective ratings for sounds paired with negative words changed accordingly. In Experiment 2 we investigated whether the acquired valence remains stable after repeated presentation of the conditioned sound without the US or whether extinction occurs. The acquired affective value remained present, albeit weaker, even after 40 extinction trials. These results warrant the use of EC to study processing of short environmental sounds with acquired valence, even if this requires repeated stimulus presentations. This paves the way for studying processing of affective environmental sounds while effectively controlling low level-stimulus properties.

Do forests best mitigate CO2 emissions to the atmosphere by setting them aside for maximization of carbon storage or by management for fossil fuel substitution?

Science.gov (United States)

Taeroe, Anders; Mustapha, Walid Fayez; Stupak, Inge; Raulund-Rasmussen, Karsten

2017-07-15

Forests' potential to mitigate carbon emissions to the atmosphere is heavily debated and a key question is if forests left unmanaged to store carbon in biomass and soil provide larger carbon emission reductions than forests kept under forest management for production of wood that can substitute fossil fuels and fossil fuel intensive materials. We defined a modelling framework for calculation of the carbon pools and fluxes along the forest energy and wood product supply chains over 200 years for three forest management alternatives (FMA): 1) a traditionally managed European beech forest, as a business-as-usual case, 2) an energy poplar plantation, and 3) a set-aside forest left unmanaged for long-term storage of carbon. We calculated the cumulative net carbon emissions (CCE) and carbon parity times (CPT) of the managed forests relative to the unmanaged forest. Energy poplar generally had the lowest CCE when using coal as the reference fossil fuel. With natural gas as the reference fossil fuel, the CCE of the business-as-usual and the energy poplar was nearly equal, with the unmanaged forest having the highest CCE after 40 years. CPTs ranged from 0 to 156 years, depending on the applied model assumptions. CCE and CPT were especially sensitive to the reference fossil fuel, material alternatives to wood, forest growth rates for the three FMAs, and energy conversion efficiencies. Assumptions about the long-term steady-state levels of carbon stored in the unmanaged forest had a limited effect on CCE after 200 years. Analyses also showed that CPT was not a robust measure for ranking of carbon mitigation benefits. Copyright © 2017 Elsevier Ltd. All rights reserved.

Characterization of semiconductor and frontier materials by nuclear microprobe technology

International Nuclear Information System (INIS)

Zhu Jieqing; Li Xiaolin; Yang Changyi; Lu Rongrong; Wang Jiqing; Guo Panlin

2002-01-01

The nuclear microprobe technology is used to characterize the properties of semiconductor and other frontier materials at the stages of their synthesis, modification, integration and application. On the basis of the beam current being used, the analytical nuclear microprobe techniques being used in this project can be divided into two categories: high beam current (PIXE, RBS, PEB) or low beam current (IBIC, STIM) techniques. The material properties measured are the thickness and composition of a composite surface on a SiC ceramic, the sputtering-induced surface segregation and depth profile change in a Ag-Cu binary alloy, the irradiation effects on the CCE of CVD diamond, the CCE profile at a polycrystalline CVD diamond film and a GaAs diode at different voltage biases and finally, the characterization of individual sample on an integrated material chip. (author)

Baroreflex Coupling Assessed by Cross-Compression Entropy

Directory of Open Access Journals (Sweden)

Andy Schumann

2017-05-01

Full Text Available Estimating interactions between physiological systems is an important challenge in modern biomedical research. Here, we explore a new concept for quantifying information common in two time series by cross-compressibility. Cross-compression entropy (CCE exploits the ZIP data compression algorithm extended to bivariate data analysis. First, time series are transformed into symbol vectors. Symbols of the target time series are coded by the symbols of the source series. Uncoupled and linearly coupled surrogates were derived from cardiovascular recordings of 36 healthy controls obtained during rest to demonstrate suitability of this method for assessing physiological coupling. CCE at rest was compared to that of isometric handgrip exercise. Finally, spontaneous baroreflex interaction assessed by CCEBRS was compared between 21 patients suffering from acute schizophrenia and 21 matched controls. The CCEBRS of original time series was significantly higher than in uncoupled surrogates in 89% of the subjects and higher than in linearly coupled surrogates in 47% of the subjects. Handgrip exercise led to sympathetic activation and vagal inhibition accompanied by reduced baroreflex sensitivity. CCEBRS decreased from 0.553 ± 0.030 at rest to 0.514 ± 0.035 during exercise (p < 0.001. In acute schizophrenia, heart rate, and blood pressure were elevated. Heart rate variability indicated a change of sympathovagal balance. The CCEBRS of patients with schizophrenia was reduced compared to healthy controls (0.546 ± 0.042 vs. 0.507 ± 0.046, p < 0.01 and revealed a decrease of blood pressure influence on heart rate in patients with schizophrenia. Our results indicate that CCE is suitable for the investigation of linear and non-linear coupling in cardiovascular time series. CCE can quantify causal interactions in short, noisy and non-stationary physiological time series.

Dynamic Testing of the NASA Hypersonic Project Combined Cycle Engine Testbed for Mode Transition Experiments

Science.gov (United States)

2011-01-01

NASA is interested in developing technology that leads to more routine, safe, and affordable access to space. Access to space using airbreathing propulsion systems has potential to meet these objectives based on Airbreathing Access to Space (AAS) system studies. To this end, the NASA Fundamental Aeronautics Program (FAP) Hypersonic Project is conducting fundamental research on a Turbine Based Combined Cycle (TBCC) propulsion system. The TBCC being studied considers a dual flow-path inlet system. One flow-path includes variable geometry to regulate airflow to a turbine engine cycle. The turbine cycle provides propulsion from take-off to supersonic flight. The second flow-path supports a dual-mode scramjet (DMSJ) cycle which would be initiated at supersonic speed to further accelerate the vehicle to hypersonic speed. For a TBCC propulsion system to accelerate a vehicle from supersonic to hypersonic speed, a critical enabling technology is the ability to safely and effectively transition from the turbine to the DMSJ-referred to as mode transition. To experimentally test methods of mode transition, a Combined Cycle Engine (CCE) Large-scale Inlet testbed was designed with two flow paths-a low speed flow-path sized for a turbine cycle and a high speed flow-path designed for a DMSJ. This testbed system is identified as the CCE Large-Scale Inlet for Mode Transition studies (CCE-LIMX). The test plan for the CCE-LIMX in the NASA Glenn Research Center (GRC) 10- by 10-ft Supersonic Wind Tunnel (10x10 SWT) is segmented into multiple phases. The first phase is a matrix of inlet characterization (IC) tests to evaluate the inlet performance and establish the mode transition schedule. The second phase is a matrix of dynamic system identification (SysID) experiments designed to support closed-loop control development at mode transition schedule operating points for the CCE-LIMX. The third phase includes a direct demonstration of controlled mode transition using a closed loop control

Adaptation to climate change in agriculture: evaluation of options

International Nuclear Information System (INIS)

Dolan, A.H.; Smit, B.; Skinner, M.W.; Bradshaw, B.; Bryant, C.R.

2001-01-01

Adaptation was defined as the responses by stakeholders to actual or expected climatic stimuli or their effects to reduce vulnerability to adverse impacts or damage potential, or to realize opportunities associated with climate change. Planned policy initiatives representing change in the agricultural system were discussed in this report. An evaluation of adaptation options needed to be carried out before one could determine which adaptations should be promoted or implemented. The overall merit, suitability, utility or appropriateness of potential adaptation strategies or measures were examined. One interesting methodology was the Multiple Criteria Evaluation (MCE), which is designed to assess alternatives using more than one criterion. The criteria selected for this evaluation were: effectiveness, economic efficiency, flexibility, institutional compatibility, farmer implementation, and independent benefits. A selection of three adaptation options was made to better illustrate the utility of the evaluation framework., as follows: crop diversification, adoption of irrigation, and increase use of crop insurance. 122 refs., 6 tabs., 6 figs

Evaluate prevailing climate change on Great Lakes water levels

International Nuclear Information System (INIS)

Islam, M.

2009-01-01

'Full text:'In this paper, results of a comprehensive water mass balance modeling for the Great Lakes against prevailing and different anticipated climate change scenarios would be presented. Modeling is done in evaluating the changes in the lake storages and then changes in the lake's water level considering present condition, uncertainty and variability of climate and hydrologic conditions in the future. Inflow-outflow and consequent changes in the five Great Lake's storages are simulated for the last 30 years and then projected to evaluate the changes in the lake storages for the next 50 years. From the predicted changes in the lake storage data, water level is calculated using mass to linear conversion equation. Modeling and analysis results are expected to be helpful in understanding the possible impacts of the climate change on the Great Lakes water environment and preparing strategic plan for the sustainable management of lake's water resources. From the recent past, it is observed that there is a depleting trend in the lakes water level and hence there is a potential threat to lake's water environment and uncertainty of the availability of quality and quantity of water for the future generations, especially against prevailing and anticipated climate changes. For this reason, it is an urgent issue of understanding and quantifying the potential impacts of climate change on the Great Lake's water levels and storages. (author)

Ion burst event in the earth's dayside magnetosheath

International Nuclear Information System (INIS)

Paschalidis, N.P.; Krimigis, S.M.; Sibeck, D.G.; McEntire, R.W.; Zanetti, L.J.; Sarris, E.T.; Christon, S.P.

1991-01-01

The MEPA instrument on the AMPTE/CCE Spacecraft provided ion angular distributions as rapidly as every 6 sec for H, He, and O at energies of 10 keV to 2 MeV in the dayside magnetosheath within 8.75 R E , the CCE apogee. In this report the authors discuss a burst of energetic particles in the subsolar magnetosheath and its association with rapid changes in the local magnetic field direction in such a way that the magnetic field connected the spacecraft to the magnetopause during the enhancement. They find that magnetosheath angular distributions outside the burst peaked at 90 degree pitch angles, whereas during the burst they exhibited field aligned streaming either parallel or antiparallel to the magnetic field combined with a clear earthward gradient. The clear earthward gradients at E ≥ 10 KeV, the streaming, and the slope change in the burst-time magnetosheath spectrum at ∼10 KeV suggest magnetospheric source for the burst-time ≥ 10 KeV ions and heated solar wind for E < 10 KeV

Real Language Meets Real Business

Science.gov (United States)

Muirhead, Muirhead; Schechter, Sarah

2016-01-01

The Real Business Language Challenge was a collaborative pilot project between Coca-Cola Enterprises (CCE) and Routes into Languages East for Year 9 and 10 pupils. It was based on CCE's award-winning Real Business Challenge, part of its highly acclaimed education programme. The Real Business Language Challenge transformed the project into a…

Study of strontium sorption in Brazilian clays for their use as a barrier in repository of radioactive wastes

International Nuclear Information System (INIS)

Freire, Carolina Braccini; Tello, Cledola Cassia Oliveira de

2008-01-01

Wastes in general should be properly treated and stored. The the radioactive wastes also require suitable and safe management beginning in their generation until the storage in repository. The objective of this research was to characterize some Brazilian clays in order to evaluate the viability of their use in the backfill layer, one of the radioactive waste repository barriers. The main function of this barrier is to contribute in the delay of the radionuclides movement, and to prevent their release into the environment. Four clays provided by national suppliers were selected for the research: Ca-Bentonite (Dol 01), Na-Bentonite (Dol 02), Kaolinite (Ind 01) and Vermiculite (Ubm 04.) Their physical, chemical and mineralogical characteristics were determined, and also their sorption potential of Strontium cation. It was confirmed through theses results a direct relationship among their specific surface (SS), the capacity of cationic exchange (CCE) and pH. The CCE results followed this increasing order: Ind 01, Dol 01, and Dol 02. In accordance with the models of Freundlich (K f ) and Langmuir (M), the clays Dol 01 and Dol 02 were the best sorbers of Sr 2+ . The Gibbs free energy change (ΔG deg) was calculated for the sorption reactions between the clays and the cations, and it was negative for all clays, confirming the sorption reaction spontaneity. (author)

Department of Defense Technology Transfer (T2) Program

Science.gov (United States)

2014-04-08

January February (1st Monday) Disposal System Performance Spec Production Representative Articles CARD – Cost Analysis Requirements Description CCE...Supportability Objectives Exit Criteria Met APB MTA FMECA FTA LORA RCM MS B Threshold/objective tradeoffs – Revised Performance Attributes MS C MS A...Evaluation FTA – Failure Tree Analysis IOT&E – Initial Operational Test & Evaluation ISR – In-Service Review ISP – Information Support Plan ITR – Initial

Infection with the oncogenic human papillomavirus type 59 alters protein components of the cornified cell envelope

International Nuclear Information System (INIS)

Lehr, Elizabeth; Brown, Darron R.

2003-01-01

Infection of the genital tract with human papillomaviruses (HPVs) leads to proliferative and dysplastic epithelial lesions. The mechanisms used by the virus to escape the infected keratinocyte are not well understood. Infection of keratinocytes with HPV does not cause lysis, the mechanism used by many viruses to release newly formed virions. For HPV 11, a type associated with a low risk of neoplastic disease, the cornified cell envelope (CCE) of infected keratinocytes is thin and fragile, and transcription of loricrin, the major CCE protein, is reduced. The effects of high-risk HPV infection on components of the CCE have not been previously reported. HPV 59, an oncogenic genital type related to HPV types 18 and 45 was identified in a condylomata acuminata lesion. An extract of this lesion was used to infect human foreskin fragments, which were grown in athymic mice as xenografts. Continued propagation using extracts of xenografts permitted growth of additional HPV 59-infected xenografts. CCEs purified from HPV 59-infected xenografts displayed subtle morphologic abnormalities compared to those derived from uninfected xenografts. HPV 59-infected xenografts revealed dysplastic-appearing cells with mitotic figures. Detection of loricrin, involucrin, and cytokeratin 10 was reduced in HPV 59-infected epithelium, while small proline-rich protein 3 (SPR3) was increased. Reduction in loricrin was most apparent in regions of epithelium containing abundant HPV 59 DNA. Compared to uninfected epithelium, loricrin transcription was decreased in HPV 59-infected epithelium. We conclude that HPV 59 shares with HPV 11 the ability to alter CCE components and to specifically reduce transcription of the loricrin gene. Because loricrin is the major CCE protein, a reduction in this component could alter the physical properties of the CCE, thus facilitating virion release

A multisatellite case study of the expansion of a substorm current wedge in the near-Earth magnetotail

International Nuclear Information System (INIS)

Lopez, R.E.; Lui, A.T.Y.

1990-01-01

This study presents observations made by four spacecraft (AMPTE CCE, AMPTE IRM, GOES 5, and GOES 6) and two ground stations (San Juan and Tucson) during a substorm that occurred at ∼0830 UT on April 19, 1985. The spacecraft were arrayed in a configuration that allows for the examination of the spatial evolution of the substorm current wedge, CCE was located between the GOES spacecraft in longitude, but at a radial distance of 8.0 R E . IRM was located west of the other three spacecraft in the same sector as Tucson, but at a radial distance of 11.6 R E . The relative times at which the signature of the substorm current wedge was first observed at the GOES spacecraft and the ground stations are consistent with a simple longitudinally expanding current wedge. However, the times at which IRM and CCE observed the current wedge are not consistent with a current wedge that expanded only longitudinally, IRM first observed the signature of the current wedge at about the same time the signature was observed by GOES 6 and Tucson, and CCE observed the current wedge only after both GOES satellites and the ground stations had done so. Moreover, both GOES spacecraft observed signatures consistent with entry into the central plasma sheet before CCE and IRM did, even though we estimate that CCE was slightly closer to the neutral sheet than the geosynchronous spacecraft. The sequence of events suggests that during this substorm the disruption of the cross-tail current sheet, the formation of the substorm current wedge, and the expansion of the plasma sheet began in the near-Earth region, and subsequently spread tailward as well as longitudinally

A Catalyst-for-Change Approach to Evaluation Capacity Building

Science.gov (United States)

Garcia-Iriarte, Edurne; Suarez-Balcazar, Yolanda; Taylor-Ritzler, Tina; Luna, Maria

2011-01-01

Evaluation capacity building (ECB) has become a popular approach for helping community-based organizations (CBOs) to meet their funders' demands for accountability. This case study reports the ECB process with one staff member using a catalyst-for-change approach. The authors analyzed the role of the catalyst in diffusing evaluation knowledge and…

Colon Cancer Detection by ‘Rendezvous Colonoscopy’: Successful Removal of Stuck Colon Capsule by Conventional Colonoscopy

Directory of Open Access Journals (Sweden)

István Rácz

2010-02-01

Full Text Available Although capsule retention is a known complication of small bowel capsule endoscopy, initial studies with colon capsule endoscopy (CCE have not reported any capsule retention or sticking neither in the small bowel nor in the colon. We report a complication of CCE when the stuck colon capsule was passed through the malignant colon stricture and removed by the aid of a flexible colonoscope. During CCE in a 76-year-old iron deficiency anemia patient the real-time viewing system indicated the colon capsule to be stuck in a malignant ascending colon stricture for more than two hours. With the aim to avoid complete capsule retention, immediate colonoscopy was performed. The stuck capsule was caught by a polypectomy snare, passed through the tumor stricture and finally removed from the large bowel. The current case describes the usefulness of the real-time viewing system. Similar situations may occur during the forthcoming spread of CCE and the present case is an example of how to manage the potentially risky stuck colon capsule condition.

A Cultivated Form of a Red Seaweed (Chondrus crispus, Suppresses β-Amyloid-Induced Paralysis in Caenorhabditis elegans

Directory of Open Access Journals (Sweden)

Jatinder Singh Sangha

2015-10-01

Full Text Available We report here the protective effects of a methanol extract from a cultivated strain of the red seaweed, Chondrus crispus, against β-amyloid-induced toxicity, in a transgenic Caenorhabditis elegans, expressing human Aβ1-42 gene. The methanol extract of C. crispus (CCE, delayed β-amyloid-induced paralysis, whereas the water extract (CCW was not effective. The CCE treatment did not affect the transcript abundance of amy1; however, Western blot analysis revealed a significant decrease of Aβ species, as compared to untreated worms. The transcript abundance of stress response genes; sod3, hsp16.2 and skn1 increased in CCE-treated worms. Bioassay guided fractionation of the CCE yielded a fraction enriched in monogalactosyl diacylglycerols (MGDG that significantly delayed the onset of β-amyloid-induced paralysis. Taken together, these results suggested that the cultivated strain of C. crispus, whilst providing dietary nutritional value, may also have significant protective effects against β-amyloid-induced toxicity in C. elegans, partly through reduced β-amyloid species, up-regulation of stress induced genes and reduced accumulation of reactive oxygen species (ROS.

Evaluation method for change of concentration of nuclear fuel material

International Nuclear Information System (INIS)

Kiyono, Takeshi; Ando, Ryohei.

1997-01-01

The present invention provides a method of evaluating the change of concentration of compositions of nuclear fuel element materials loaded to a reactor along with neutron irradiation based on analytic calculation not relying on integration with time. Namely, the method of evaluating the change of concentration of nuclear fuel materials comprises evaluating the changing concentration of nuclear fuel materials based on nuclear fission, capturing of neutrons and radioactive decaying along with neutron irradiation. In this case, an optional nuclide on a nuclear conversion chain is determined as a standard nuclide. When the main fuel material is Pu-239, it is determined as the standard nuclide. The ratio of the concentration of the standard nuclide to that of the nuclide as an object of the evaluation can be expressed by the ratio of the cross sectional area of neutron nuclear reaction of the standard nuclide to the cross sectional area of the neutron nuclear reaction of the nuclide as the object of the evaluation. Accordingly, the concentration of the nuclide as the object of the evaluation can be expressed by an analysis formula shown by an analysis function for the ratio of the concentration of the standard nuclide to the cross section of the neutron nuclear reaction. As a result, by giving an optional concentration of the standard nuclide to the analysis formula, the concentration of each of other nuclides can be determined analytically. (I.S.)

Hydrology under change: an evaluation protocol to investigate how hydrological models deal with changing catchments

Science.gov (United States)

G. Thirel; V. Andreassian; C. Perrin; J.-N. Audouy; L. Berthet; Pamela Edwards; N. Folton; C. Furusho; A. Kuentz; J. Lerat; G. Lindstrom; E. Martin; T. Mathevet; R. Merz; J. Parajka; D. Ruelland; J. Vaze

2015-01-01

Testing hydrological models under changing conditions is essential to evaluate their ability to cope with changing catchments and their suitability for impact studies. With this perspective in mind, a workshop dedicated to this issue was held at the 2013 General Assembly of the International Association of Hydrological Sciences (IAHS) in Göteborg, Sweden, in July 2013...

Monitoring and evaluation of strategic change programme implementation-Lessons from a case analysis.

Science.gov (United States)

Neumann, Jan; Robson, Andrew; Sloan, Diane

2018-02-01

This study considered the monitoring and evaluation of a large-scale and domestic and global strategic change programme implementation. It considers the necessary prerequisites to overcome challenges and barriers that prevent systematic and effective monitoring and evaluation to take place alongside its operationalisation. The work involves a case study based on a major industrial company from the energy sector. The change programme makes particular reference to changes in business models, business processes, organisation structures as well as Enterprise Resource Planning infrastructure. The case study focussed on the summative evaluation of the programme post-implementation. This assessment involved 25 semi-structured interviews with employees across a range of managerial strata capturing more than 65 roles within the change programme at both local and global levels. Data relating to their perception of evaluation effectiveness and shortcomings were analysed by means of template analysis. The study identifies responsibilities for executing an evaluation alongside various methods and tools that are appropriate, thereby focussing on the "Who" (roles, responsibility for particular activities) and "How" (methods and tools) rather than "What" to monitor and evaluate. The findings are presented generically so they offer new insights and transferability for practitioners involved in managing strategic change and its associated evaluation. Copyright © 2017 Elsevier Ltd. All rights reserved.

Recurrent neural networks with specialized word embeddings for health-domain named-entity recognition.

Science.gov (United States)

Jauregi Unanue, Iñigo; Zare Borzeshi, Ehsan; Piccardi, Massimo

2017-12-01

Previous state-of-the-art systems on Drug Name Recognition (DNR) and Clinical Concept Extraction (CCE) have focused on a combination of text "feature engineering" and conventional machine learning algorithms such as conditional random fields and support vector machines. However, developing good features is inherently heavily time-consuming. Conversely, more modern machine learning approaches such as recurrent neural networks (RNNs) have proved capable of automatically learning effective features from either random assignments or automated word "embeddings". (i) To create a highly accurate DNR and CCE system that avoids conventional, time-consuming feature engineering. (ii) To create richer, more specialized word embeddings by using health domain datasets such as MIMIC-III. (iii) To evaluate our systems over three contemporary datasets. Two deep learning methods, namely the Bidirectional LSTM and the Bidirectional LSTM-CRF, are evaluated. A CRF model is set as the baseline to compare the deep learning systems to a traditional machine learning approach. The same features are used for all the models. We have obtained the best results with the Bidirectional LSTM-CRF model, which has outperformed all previously proposed systems. The specialized embeddings have helped to cover unusual words in DrugBank and MedLine, but not in the i2b2/VA dataset. We present a state-of-the-art system for DNR and CCE. Automated word embeddings has allowed us to avoid costly feature engineering and achieve higher accuracy. Nevertheless, the embeddings need to be retrained over datasets that are adequate for the domain, in order to adequately cover the domain-specific vocabulary. Copyright © 2017 Elsevier Inc. All rights reserved.

Multi Criteria Evaluation Module for RiskChanges Spatial Decision Support System

Science.gov (United States)

Olyazadeh, Roya; Jaboyedoff, Michel; van Westen, Cees; Bakker, Wim

2015-04-01

Multi-Criteria Evaluation (MCE) module is one of the five modules of RiskChanges spatial decision support system. RiskChanges web-based platform aims to analyze changes in hydro-meteorological risk and provides tools for selecting the best risk reduction alternative. It is developed under CHANGES framework (changes-itn.eu) and INCREO project (increo-fp7.eu). MCE tool helps decision makers and spatial planners to evaluate, sort and rank the decision alternatives. The users can choose among different indicators that are defined within the system using Risk and Cost Benefit analysis results besides they can add their own indicators. Subsequently the system standardizes and prioritizes them. Finally, the best decision alternative is selected by using the weighted sum model (WSM). The Application of this work is to facilitate the effect of MCE for analyzing changing risk over the time under different scenarios and future years by adopting a group decision making into practice and comparing the results by numeric and graphical view within the system. We believe that this study helps decision-makers to achieve the best solution by expressing their preferences for strategies under future scenarios. Keywords: Multi-Criteria Evaluation, Spatial Decision Support System, Weighted Sum Model, Natural Hazard Risk Management

Contribution of the working group 2 to the fourth evaluation report of the inter government expert group on the climatic change. Evaluation 2007 of the climatic changes: impacts, adaptation and vulnerability

International Nuclear Information System (INIS)

2007-01-01

This document exposes the results of the fourth evaluation report of the working group II of the inter government experts group on the climatic change. This evaluation presents the today scientific understanding of the climatic change impacts on the humans and their adaptation ability and vulnerability. It is based on the GIEC evaluations and new knowledge added since the third evaluation report. (A.L.B.)

Education to Thrive in a Heterogeneous and Democratic Society - A Task for Citizenship and Character Education? Results of Case Studies in Three Berlin Schools

Directory of Open Access Journals (Sweden)

Ewa Bacia

2017-09-01

Findings: Findings: The results of the case studies provide numerous insights into the issue’s complexity and highlight the need to discuss the goals as well as different models of CCE more broadly. Since the understanding of goals and appropriate means of CCE differs strongly depending on cultural and school context, analyzing CCE in the context of heterogeneity in democratic societies implies multidimensional questions. Practical implications: Future research needs to include more members of the studied school communities in the process of participatory action research: Deeper insight into the field can be achieved by integrating multiple perspectives. At the same time more members of the school community can reflect on the study outcomes, which might facilitate their direct implementation into practice.

Ensonifying Change: Repeat Ultra-High-Resolution Surveys in Monterey Canyon before and after Passage of a Turbidity Current

Science.gov (United States)

Wolfson-Schwehr, M.; Paull, C. K.; Caress, D. W.; Carvajal, C.; Thomas, H. J.; Maier, K. L.; Parsons, D. R.; Simmons, S.

2017-12-01

Turbidity currents are one of the primary means of global sediment transport, yet our understanding of how they interact with the seafloor is hindered by the limited number of direct measurements. The Coordinated Canyon Experiment (CCE; October 2015 - April 2017) has made great strides in addressing this issue by providing direct measurements of turbidity currents and detailed observations of the resulting seafloor change in Monterey Canyon, offshore California. Here we focus on a section of the canyon at 1850-m water depth, where a Seafloor Instrument Node (SIN) recorded passage of three turbidity currents using a range of sensors, including three upward-looking acoustic Doppler current profilers. The fastest event at this site had a maximum velocity of 2.8 m/s, and dragged the 430-Kg SIN 26 m down-canyon. Repeat mapping surveys were conducted four times during the CCE, utilizing a prototype ultra-high-resolution mapping system mounted on the ROV Doc Ricketts. The survey platform hosts a 400-kHz Reson 7125 multibeam sonar, a 3DatDepth SL1 subsea LiDAR, two stereo color cameras, and a Kearfott SeaDevil INS. At a survey altitude of 2.5 m above the bed, the system provides remarkable 5-cm resolution multibeam bathymetry, 1-cm resolution LiDAR bathymetry, and 2-mm resolution photomosaics, and can cover a 100-m2 survey area. Surveys of the SIN site prior to and after the fastest event show areas of net deposition/erosion of 60 cm and 20 cm, respectively. Net deposition occurred in the topographic lows between bedforms, while erosion was focused on the bedform crests. At the end of the experiment, transects of sediment cores were taken by ROV within areas of net deposition. The cores show a variety of sedimentary facies, including muds, sands, gravel, and organic rich layers. Gravel layers have sharp erosive bases. The repeat surveys document the dynamic nature of flute-like scours as the flow events erode and deposit material along the canyon floor, as well as the

Evaluation of early changes of cartilage biomarkers following ...

African Journals Online (AJOL)

Evaluation of early changes of cartilage biomarkers following arthroscopic meniscectomy in young Egyptian adults. ... Asked Questions about PDFs. Alternatively, you can download the PDF file directly to your computer, from where it can be opened using a PDF reader. To download the PDF, click the Download link above.

Regulation of capacitative and non-capacitative Ca2+ entry in A7r5 vascular smooth muscle cells

Directory of Open Access Journals (Sweden)

COLIN W TAYLOR

2004-01-01

Full Text Available A capacitative Ca2+ entry (CCE pathway, activated by depletion of intracellular Ca2+ stores, is thought to mediate much of the Ca2+ entry evoked by receptors that stimulate phospholipase C (PLC. However, in A7r5 vascular smooth muscle cells, vasopressin, which stimulates PLC, empties intracellular Ca2+ stores but simultaneously inhibits their ability to activate CCE. The diacylglycerol produced with the IP3 that empties the stores is metabolized to arachidonic and this leads to activation of nitric oxide (NO synthase, production of NO and cyclic GMP, and consequent activation of protein kinase G. The latter inhibits CCE. In parallel, NO directly activates a non-capacitative Ca2+ entry (NCCE pathway, which is entirely responsible for the Ca2+ entry that occurs in the presence of vasopressin. This reciprocal regulation of two Ca2+ entry pathways ensures that there is sequential activation of first NCCE in the presence of vasopressin, and then a transient activation of CCE when vasopressin is removed. We suggest that the two routes for Ca2+ entry may selectively direct Ca2+ to processes that mediate activation and then recovery of the cell.

Quantifying the co-benefits of energy-efficiency policies: a case study of the cement industry in Shandong Province, China.

Science.gov (United States)

Hasanbeigi, Ali; Lobscheid, Agnes; Lu, Hongyou; Price, Lynn; Dai, Yue

2013-08-01

In 2010, China's cement industry accounted for more than half of the world's total cement production. The cement industry is one of the most energy-intensive and highest carbon dioxide (CO2)-emitting industries, and thus a key industrial contributor to air pollution in China. For example, it is the largest source of particulate matter (PM) emissions in China, accounting for 40% of industrial PM emissions and 27% of total national PM emissions. In this study, we quantify the co-benefits of PM10 and sulfur dioxide (SO2) emission reductions that result from energy-saving measures in the cement industry in Shandong Province, China. We use a modified form of the cost of conserved energy (CCE) equation to incorporate the value of these co-benefits. The results show that more than 40% of the PM and SO2 emission reduction potential of the electricity-saving measures is cost effective even without taking into account the co-benefits for the electricity-saving measures. The results also show that including health benefits from PM10 and/or SO2 emission reductions reduces the CCE of the fuel-saving measures. Two measures that entail changing products (production of blended cement and limestone Portland cement) result in the largest reduction in CCE when co-benefits were included, since these measures can reduce both PM10 and SO2 emissions, whereas the other fuel-saving measures do not reduce PM10. Published by Elsevier B.V.

Characterization of 150μm thick epitaxial silicon detectors from different producers after proton irradiation

International Nuclear Information System (INIS)

Hoedlmoser, H.; Moll, M.; Haerkoenen, J.; Kronberger, M.; Trummer, J.; Rodeghiero, P.

2007-01-01

Epitaxial (EPI) silicon has recently been investigated for the development of radiation tolerant detectors for future high-luminosity HEP experiments. A study of 150μm thick EPI silicon diodes irradiated with 24GeV/c protons up to a fluence of 3x10 15 p/cm 2 has been performed by means of Charge Collection Efficiency (CCE) measurements, investigations with the Transient Current Technique (TCT) and standard CV/IV characterizations. The aim of the work was to investigate the impact of radiation damage as well as the influence of the wafer processing on the material performance by comparing diodes from different manufacturers. The changes of CCE, full depletion voltage and leakage current as a function of fluence are reported. While the generation of leakage current due to irradiation is similar in all investigated series of detectors, a difference in the effective doping concentration can be observed after irradiation. In the CCE measurements an anomalous drop in performance was found even for diodes exposed to very low fluences (5x10 13 p/cm 2 ) in all measured series. This result was confirmed for one series of diodes in TCT measurements with an infrared laser. TCT measurements with a red laser showed no type inversion up to fluences of 3x10 15 p/cm 2 for n-type devices whereas p-type diodes undergo type inversion from p- to n-type for fluences higher than ∼2x10 14 p/cm 2

Avanços na abordagem do carcinoma precoce de esôfago

Directory of Open Access Journals (Sweden)

Vitor Arantes

Full Text Available Nos países ocidentais, o carcinoma de células escamosas de esôfago (CCE geralmente é detectado em estágio avançado, quando as possibilidades de cura são remotas e o prognóstico reservado. Entretanto, nos anos recentes, ocorreu uma série de avanços na abordagem do CCE de esôfago, tais como a identificação dos grupos de risco para o surgimento desta neoplasia; o uso da endoscopia de alta resolução e cromoendoscopia com lugol favorecendo o diagnóstico do CCE em estágios iniciais; e o desenvolvimento de técnicas endoscópicas de ressecção tumoral endoluminal em monobloco denominada dissecção endoscópica de submucosa. Este progresso tem possibilitado a aplicação do tratamento endoscópico minimamente invasivo com potencial curativo em pacientes selecionados com CCE superficial de esôfago. O presente artigo de revisão, elaborado por um grupo multicêntrico internacional, tem como objetivo primário contribuir para o entendimento dos principais avanços recentes ocorridos no manejo do CCE precoce de esôfago. Como objetivo secundário, pretende propiciar uma revisão detalhada e minuciosa da estratégia técnica de DES desenvolvida pelos experts japoneses, de forma a colaborar para a difusão deste conceito e a incorporação destas tecnologias na Medicina Brasileira e Latino-americana.

The effect of charge collection recovery in silicon p-n junction detectors irradiated by different particles

International Nuclear Information System (INIS)

Verbitskaya, E.; Abreu, M.; Anbinderis, P.; Anbinderis, T.; D'Ambrosio, N.; Boer, W. de; Borchi, E.; Borer, K.; Bruzzi, M.; Buontempo, S.; Casagrande, L.; Chen, W.; Cindro, V.; Dezillie, B.; Dierlamm, A.; Eremin, V.; Gaubas, E.; Gorbatenko, V.; Granata, V.; Grigoriev, E.; Grohmann, S.; Hauler, F.; Heijne, E.; Heising, S.; Hempel, O.; Herzog, R.; Haerkoenen, J.; Ilyashenko, I.; Janos, S.; Jungermann, L.; Kalesinskas, V.; Kapturauskas, J.; Laiho, R.; Li, Z.; Mandic, I.; De Masi, Rita; Menichelli, D.; Mikuz, M.; Militaru, O.; Niinikoski, T.O.; O'Shea, V.; Pagano, S.; Palmieri, V.G.; Paul, S.; Perea Solano, B.; Piotrzkowski, K.; Pirollo, S.; Pretzl, K.; Rato Mendes, P.; Ruggiero, G.; Smith, K.; Sonderegger, P.; Sousa, P.; Tuominen, E.; Vaitkus, J.; Da Via, C.; Wobst, E.; Zavrtanik, M.

2003-01-01

The recovery of the charge collection efficiency (CCE) at low temperatures, the so-called 'Lazarus effect', was studied in Si detectors irradiated by fast reactor neutrons, by protons of medium and high energy, by pions and by gamma-rays. The experimental results show that the Lazarus effect is observed: (a) after all types of irradiation; (b) before and after space charge sign inversion; (c) only in detectors that are biased at voltages resulting in partial depletion at room temperature. The experimental temperature dependence of the CCE for proton-irradiated detectors shows non-monotonic behaviour with a maximum at a temperature defined as the CCE recovery temperature. The model of the effect for proton-irradiated detectors agrees well with that developed earlier for detectors irradiated by neutrons. The same midgap acceptor-type and donor-type levels are responsible for the Lazarus effect in detectors irradiated by neutrons and by protons. A new, abnormal 'zigzag'-shaped temperature dependence of the CCE was observed for detectors irradiated by all particles (neutrons, protons and pions) and by an ultra-high dose of γ-rays, when operating at low bias voltages. This effect is explained in the framework of the double-peak electric field distribution model for heavily irradiated detectors. The redistribution of the space charge region depth between the depleted regions adjacent to p + and n + contacts is responsible for the 'zigzag'- shaped curves. It is shown that the CCE recovery temperature increases with reverse bias in all detectors, regardless of the type of radiation

Nebraska Prostate Cancer Research Program

Science.gov (United States)

2014-10-01

Music tinyurl.co m/cce7atz :30 pm...Book Club Tempo of Twilight tinyurl.co m/7wqzx pq 7PM Fireside Chat Ayman El- Mohandes Arts Festival tinyurl.com /7fgzp5g Arts Festival ...t a n d T a le n t S h o w :30 pm 06 :00 pm VP Music tinyurl.co m/cce7atz :30 pm Book

An evaluation of CPD learning and impact upon positive practice change.

Science.gov (United States)

Lee, Nancy-Jane

2011-05-01

This paper explores positive practice change in nursing and health care practice following continuing professional development (CPD). It is derived from a commissioned evaluation study within the United Kingdom (UK). Evaluation data was gathered using semi structured discussions with CPD participants, a convenience sample of line managers and University module leaders. Findings suggest that professional peer attitudes and support, when harnessed effectively in the practice setting, strongly enhance positive change. Conversely a lack of engagement with practice peers, a lack of strategic support and not knowing how to access support hinder change. The study found that learning need was often explored through personal development planning and appraisal, however there was little systematic follow up, review and support following learning. Interestingly the individual personal drive and enthusiasm of practitioners was perceived as the strongest factor helping practice change, while policy drivers and national health targets were secondary. Possible strategies to enhance positive practice change are explored. Copyright © 2010 Elsevier Ltd. All rights reserved.

Seizing market shaping opportunities for vaccine cold chain equipment.

Science.gov (United States)

Azimi, Tara; Franzel, Lauren; Probst, Nina

2017-04-19

Gavi, the Vaccine Alliance, supports immunisation programmes in eligible countries to reach children with lifesaving vaccines. Dramatic improvement in the scale and performance of current cold chain systems is required to extend the reach of immunisation services - especially for children living in remote locations - to advance progress towards full vaccine coverage. Achieving these improvements will require a healthier market for cold chain equipment where the products meet user needs, are sustainably priced, and are available in sufficient quantities to meet demand. Yet evidence suggests that the cold chain market has suffered from several failures including limited demand visibility, fragmented procurement, and insufficient information exchange between manufacturers and buyers on needs and equipment performance. One of Gavi's strategic goals is to shape markets for vaccines and other immunisation products, including cold chain equipment and in 2015, Gavi created a new mechanism - the Cold Chain Equipment (CCE) Optimisation Platform - to strengthen country cold chain systems by offering financial support and incentives for higher performing CCE. The main objective of the CCE Platform is to get more equipment that is efficient, sustainable, and better performing deployed to every health facility where it is required at an affordable price. To achieve these objectives, Gavi is putting in place tested market shaping approaches and tools adapted for the CCE market: the development of market strategies or 'roadmaps'; improvement of product performance through the development of target product profiles (TPPs); strategic engagement with CCE manufacturers and countries to enhance information sharing; and tailoring procurement tactics to the CCE market. These approaches and tools will allow for increased demand and supply of higher-performing, cost-effective and quality products. By strengthening immunisation systems with improved cold chain equipment, Gavi countries can

A novel cascade organic Rankine cycle (ORC) system for waste heat recovery of truck diesel engines

International Nuclear Information System (INIS)

Chen, Tao; Zhuge, Weilin; Zhang, Yangjun; Zhang, Lei

2017-01-01

Highlights: • A confluent cascade expansion ORC (CCE-ORC) system is proposed. • Cyclopentane is considered as the most suitable fluid for this system. • The CCE-ORC system performance under full operating conditions is analyzed. • The BSFC of diesel engine can be reduced by 9.2% with the CCE-ORC system. • Performance comparison of CCE-ORC and dual-loop ORC is conducted. - Abstract: Waste heat recovery (WHR) of engines has attracted increasingly more concerns recently, as it can improve engine thermal efficiency and help truck manufacturers meet the restrictions of CO_2 emission. The organic Rankine cycle (ORC) has been considered as the most potential technology of WHR. To take full advantage of waste heat energy, the waste heat in both exhaust gases and the coolant need to be recovered; however, conventional multi-source ORC systems are too complex for vehicle applications. This paper proposed a confluent cascade expansion ORC (CCE-ORC) system for engine waste heat recovery, which has simpler architecture, a smaller volume and higher efficiency compared with conventional dual-loop ORC systems. Cyclopentane is analyzed to be regarded as the most suitable working fluid for this novel system. A thermodynamic simulation method is established for this system, and off-design performance of main components and the working fluid side pressure drop in the condenser have been taken into consideration. System performance simulations under full engine operating conditions are conducted for the application of this system on a heavy-duty truck diesel engine. Results show that the engine peak thermal efficiency can be improved from 45.3% to 49.5% where the brake specific fuel consumption (BSFC) decreases from 185.6 g/(kW h) to 169.9 g/(kW h). The average BSFC in the frequently operating region can decrease by 9.2% from 187.9 g/(kW h) to 172.2 g/(kW h). Compared with the conventional dual-loop ORC system, the CCE-ORC system can generate 8% more net power, while the

Air gasification of rice husk in bubbling fluidized bed reactor with bed heating by conventional charcoal.

Science.gov (United States)

Makwana, J P; Joshi, Asim Kumar; Athawale, Gaurav; Singh, Dharminder; Mohanty, Pravakar

2015-02-01

An experimental study of air gasification of rice husk was conducted in a bench-scale fluidized bed gasifier (FBG) having 210 mm diameter and 1600 mm height. Heating of sand bed material was performed using conventional charcoal fuel. Different operating conditions like bed temperature, feeding rate and equivalence ratio (ER) varied in the range of 750-850 °C, 25-31.3 kg/h, and 0.3-0.38, respectively. Flow rate of air was kept constant (37 m(3)/h) during FBG experiments. The carbon conversion efficiencies (CCE), cold gas efficiency, and thermal efficiency were evaluated, where maximum CCE was found as 91%. By increasing ER, the carbon conversion efficiency was decreased. Drastic reduction in electric consumption for initial heating of gasifier bed with charcoal compared to ceramic heater was ∼45%. Hence rice husk is found as a potential candidate to use directly (without any processing) in FBG as an alternative renewable energy source from agricultural field. Copyright © 2014 Elsevier Ltd. All rights reserved.

Characterisation of a monolithic active pixel sensor for electron detection in the energy range 10-20 keV

International Nuclear Information System (INIS)

Matheson, J.; Moldovan, G.; Clark, A.; Prydderch, M.; Turchetta, R.; Derbyshire, G.; Kirkland, A.; Allinson, N.

2009-01-01

As part of a feasibility study into the use of novel electron detectors for X-ray photoelectron emission microscopes (XPEEM), we have characterised the imaging performance of a back-illuminated monolithic active pixel sensor (MAPS) operating under both integrating and counting modes for electrons in the energy range 10-20 keV. For integrating mode, we present the detective quantum efficiency (DQE), which shows marked improvements over conventional indirect detectors based on microchannel plates. We also present the modulation transfer function (MTF) and noise power spectrum (NPS), again demonstrating significantly improved performance. For counting mode, we present the quantum efficiency (QE) as a function of incident electron energy. We have evaluated the charge collection efficiency (CCE) and we thereby demonstrate the presence of a ∼200 nm thick dead layer that is linked with reduced CCE at low electron energies. Based on our findings, we believe that the MAPS technology is well matched to future XPEEM instruments using aberration correction.

Cytotoxic effects of betaxolol on healthy corneal endothelial cells both in vitro and in vivo

Directory of Open Access Journals (Sweden)

Ying Miao

2014-02-01

Full Text Available AIM: To demonstrate the cytotoxic effect of betaxolol and its underlying mechanism on human corneal endothelial cells(HCE cells in vitro and cat corneal endothelial cells(CCE cells in vivo, providing experimental basis for safety anti-glaucoma drug usage in clinic of ophthalmology.METHODS: In vivo and in vitro experiments were conducted to explore whether and how betaxolol participates in corneal endothelial cell injury. The in vitro morphology, growth status, plasma membrane permeability, DNA fragmentation, and ultrastructure of HCE cells treated with 0.021875-0.28g/L betaxolol were examined by light microscope, 3-(4,5-dimethylthiahiazo (-z-y1-3,5-di-phenytetrazoliumromide (MTT assay, acridine orange (AO/ethidium bromide (EB double-fluorescent staining, DNA agarose gel electrophoresis, and transmission electron microscope (TEM. The in vivo density, morphology, and ultrastructure of CCE cells, corneal thickness, and eye pressure of cat eyes treated with 0.28g/L betaxolol were investigated by specular microscopy, applanation tonometer, alizarin red staining, scanning electron microscope (SEM, and TEM.RESULTS: Exposure to betaxolol at doses from 0.0875g/L to 2.8g/L induced morphological and ultrastructural changes of in vitro cultured HCE cells such as cytoplasmic vacuolation, cellular shrinkage, structural disorganization, chromatin condensation, and apoptotic body appearance. Simultaneously, betaxolol elevated plasma membrane permeability and induced DNA fragmentation of these cells in a dose-dependent manner in AO/EB staining. Furthermore, betaxolol at a dose of 2.8g/L also induced decrease of density of CCE cells in vivo, and non-hexagonal and shrunk apoptotic cells were also found in betaxolol-treated cat corneal endothelia.CONCLUSION: Betaxolol has significant cytotoxicity on HCE cells in vitro by inducing apoptosis of these cells, and induced apoptosis of CCE cells in vivo as well. The findings help provide new insight into the apoptosis

Evaluation of the Teaching Standards at Institutions of Higher Education Looks Forward to "Five Changes"

Science.gov (United States)

Zhentian, Liu

2009-01-01

In order to promote the sustained and healthy development of teaching evaluation work, five changes should be brought about in the evaluation of the level of undergraduate teaching at China's institutions of higher education: Change teaching evaluation from a specific item of work to a system of a long-term and normative nature; change teaching…

OH/H2O Detection Capability Evaluation on Chang'e-5 Lunar Mineralogical Spectrometer (LMS)

Science.gov (United States)

Liu, Bin; Ren, Xin; Liu, Jianjun; Li, Chunlai; Mu, Lingli; Deng, Liyan

2016-10-01

The Chang'e-5 (CE-5) lunar sample return mission is scheduled to launch in 2017 to bring back lunar regolith and drill samples. The Chang'e-5 Lunar Mineralogical Spectrometer (LMS), as one of the three sets of scientific payload installed on the lander, is used to collect in-situ spectrum and analyze the mineralogical composition of the samplingsite. It can also help to select the sampling site, and to compare the measured laboratory spectrum of returned sample with in-situ data. LMS employs acousto-optic tunable filters (AOTFs) and is composed of a VIS/NIR module (0.48μm-1.45μm) and an IR module (1.4μm -3.2μm). It has spectral resolution ranging from 3 to 25 nm, with a field of view (FOV) of 4.24°×4.24°. Unlike Chang'e-3 VIS/NIR Imaging Spectrometer (VNIS), the spectral coverage of LMS is extended from 2.4μm to 3.2μm, which has capability to identify H2O/OH absorption features around 2.7μm. An aluminum plate and an Infragold plate are fixed in the dust cover, being used as calibration targets in the VIS/NIR and IR spectral range respectively when the dust cover is open. Before launch, a ground verification test of LMS needs to be conducted in order to: 1) test and verify the detection capability of LMS through evaluation on the quality of image and spectral data collected for the simulated lunar samples; and 2) evaluate the accuracy of data processing methods by the simulation of instrument working on the moon. The ground verification test will be conducted both in the lab and field. The spectra of simulated lunar regolith/mineral samples will be collected simultaneously by the LMS and two calibrated spectrometers: a FTIR spectrometer (Model 102F) and an ASD FieldSpec 4 Hi-Res spectrometer. In this study, the results of the LMS ground verification test will be reported, and OH/H2O Detection Capability will be evaluated especially.

Changing Climate, Challenging Choices: Identifying and Evaluating Climate Change Adaptation Options for Protected Areas Management in Ontario, Canada

Science.gov (United States)

Lemieux, Christopher J.; Scott, Daniel J.

2011-10-01

Climate change will pose increasingly significant challenges to managers of parks and other forms of protected areas around the world. Over the past two decades, numerous scientific publications have identified potential adaptations, but their suitability from legal, policy, financial, internal capacity, and other management perspectives has not been evaluated for any protected area agency or organization. In this study, a panel of protected area experts applied a Policy Delphi methodology to identify and evaluate climate change adaptation options across the primary management areas of a protected area agency in Canada. The panel identified and evaluated one hundred and sixty five (165) adaptation options for their perceived desirability and feasibility. While the results revealed a high level of agreement with respect to the desirability of adaptation options and a moderate level of capacity pertaining to policy formulation and management direction, a perception of low capacity for implementation in most other program areas was identified. A separate panel of senior park agency decision-makers used a multiple criterion decision-facilitation matrix to further evaluate the institutional feasibility of the 56 most desirable adaptation options identified by the initial expert panel and to prioritize them for consideration in a climate change action plan. Critically, only two of the 56 adaptation options evaluated by senior decision-makers were deemed definitely implementable, due largely to fiscal and internal capacity limitations. These challenges are common to protected area agencies in developed countries and pervade those in developing countries, revealing that limited adaptive capacity represents a substantive barrier to biodiversity conservation and other protected area management objectives in an era of rapid climate change.

Evaluation of technological measures to cope with climate change

Energy Technology Data Exchange (ETDEWEB)

Shimizu, Hiroshi; Moriguchi, Yulchi [National Inst. for Environmental Studies, Onogawa Tsukuba (Japan)

1993-12-31

Because the global warming (climate change) is recognized as a highly probable phenomenon in the next century, the countermeasures to cope with this issue is really Important. International discussion Is progressing towards the conclusion of the treaty to stabilize global warming. Therefore, now is the time to take concrete action to reduce the emission to the greenhouse gases (GHG). To find the way to reduce the emission of the GHG, the procedure as next should be taken. (1) Systematic estimation of GHG emission (GHG analysis), (2) Identification of conventional and Innovative technologies, (3) Assessment of individual sectoral technologies, (4) Comprehensive evaluation of countermeasures as a whole. Both in the U.S.A. and Japan, this kind of research have been made independently. Among these processes, the standard methodologies should be established on the GHG analysis, the assessment of individual technologies and the comprehensive evaluation. From such a background, it is important to discuss the way to evaluate technological measures to cope with climate change between the specialist from the U.S.A. and Japan. And still required to search the possibility to establish a joint project between both countries.

Enhancing interdisciplinary climate change work through comprehensive evaluation

Directory of Open Access Journals (Sweden)

Jenna Klink

2017-01-01

Full Text Available This paper shares the details of an evaluation plan from an interdisciplinary climate change project that developed decision support tools (DSTs for agricultural advisors and farmers. It showcases how evaluation enhanced the project work by providing opportunities for the team to reflect on and use data to improve performance. The plan included both formative and summative approaches, team member interviews to assess team functioning, usability testing of DSTs, outreach and marketing campaign evaluation. Outreach evaluation included surveying those reached, monitoring project website traffic, and tracking and mapping outreach details. Marketing evaluation included pre-testing campaign materials, assessing open and click rates of email campaign, and monitoring associated traffic to website. The Useful to Usable (U2U team was generally high functioning, but team interviews allowed the evaluators and leaders to discern factors that were influencing intended outcomes, respond to needs, assign resources, and catalyze activities that were crucial in shaping the outcomes. Usability testing surfaced issues related to default values and search and help features that were addressed by the team and resulted in improved usability. Outreach evaluation found geographic and methodological gaps that were filled, resulting in more target audiences reached and more effective methods used (e.g., hands-on events. Marketing evaluation allowed for improving contact lists over time and improving campaign messaging before deployment. Evaluators and project leaders working on similar projects may adapt or utilize methods detailed in this paper, along with the recommendations, while designing and implementing improvement-oriented evaluation plans.

Twinning "Practices of Change" with "Theory of Change": Room for Emergence in Advocacy Evaluation

Science.gov (United States)

Arensman, Bodille; van Waegeningh, Cornelie; van Wessel, Margit

2018-01-01

Theory of change (ToC) is currently "the" approach for the evaluation and planning of international development programs. This approach is considered especially suitable for complex interventions. We question this assumption and argue that ToC's focus on cause-effect logic and intended outcomes does not do justice to the recursive nature…

Reactive endplate marrow changes: a systematic morphologic and epidemiologic evaluation

International Nuclear Information System (INIS)

Karchevsky, Michael; Schweitzer, Mark E.; Carrino, John A.; Zoga, Adam; Montgomery, Douglas; Parker, Laurence

2005-01-01

To evaluate the morphology and location of vertebral endplate changes, and to analyze their association with age, gender, and body mass index (BMI). At 1.5 T (T1-weighted, T2-weighted/STIR) 100 lumbar spines were evaluated separately by three observers. The readers classified the endplate bone marrow abnormalities on sagittal MR images according to the definitions of Modic et al. Findings were localized by disc segment; whether in the upper and/or lower endplate; and within each endplate divided into 15 segments. Disc space narrowing, as well as disc desiccation, was also noted at each vertebral level. In addition, endplate changes were correlated with age, gender, and BMI (weight(kg)/height(m) 2 ). A total of 15,000 data points were studied and 422 total changes recorded. A total of 99 vertebral levels were affected in 58 patients. Of these, 171 were of type I, 242 were of type II, and 9 were of type III. L4 - L5 and L5 - S1 vertebral levels were most commonly involved, having (142, 4.73%) and (116, 3.87%) changes respectively (P<0.0001). The upper and lower aspects of the endplate were affected similarly. Changes most frequently occurred at the anterior aspect of the endplate (P<0.0001). Endplate marrow changes were associated with increasing age (P<0.0001) and, surprisingly, male gender (P<0.0001). Endplate changes were not associated with BMI. The fatty pattern was most common, with the sclerotic pattern being rare. Endplate marrow changes most often occurred at the anterior aspect of the endplate, particularly at L4 - L5 and L5 - S1 levels. Modic changes occur more frequently with aging, evidence of their degenerative etiology. They were, however, not related to body habitus, but to weight and male gender. (orig.)

Reactive endplate marrow changes: a systematic morphologic and epidemiologic evaluation

Energy Technology Data Exchange (ETDEWEB)

Karchevsky, Michael [Hahnemann University Hospital, Department of Radiology, Philadelphia (United States); Thomas Jefferson University Hospital, Department of Radiology, Philadelphia (United States); Schweitzer, Mark E. [Hospital for Joint Diseases, Department of Radiology, New York (United States); Carrino, John A.; Zoga, Adam; Montgomery, Douglas; Parker, Laurence [Thomas Jefferson University Hospital, Department of Radiology, Philadelphia (United States)

2005-03-01

To evaluate the morphology and location of vertebral endplate changes, and to analyze their association with age, gender, and body mass index (BMI). At 1.5 T (T1-weighted, T2-weighted/STIR) 100 lumbar spines were evaluated separately by three observers. The readers classified the endplate bone marrow abnormalities on sagittal MR images according to the definitions of Modic et al. Findings were localized by disc segment; whether in the upper and/or lower endplate; and within each endplate divided into 15 segments. Disc space narrowing, as well as disc desiccation, was also noted at each vertebral level. In addition, endplate changes were correlated with age, gender, and BMI (weight(kg)/height(m){sup 2}). A total of 15,000 data points were studied and 422 total changes recorded. A total of 99 vertebral levels were affected in 58 patients. Of these, 171 were of type I, 242 were of type II, and 9 were of type III. L4 - L5 and L5 - S1 vertebral levels were most commonly involved, having (142, 4.73%) and (116, 3.87%) changes respectively (P<0.0001). The upper and lower aspects of the endplate were affected similarly. Changes most frequently occurred at the anterior aspect of the endplate (P<0.0001). Endplate marrow changes were associated with increasing age (P<0.0001) and, surprisingly, male gender (P<0.0001). Endplate changes were not associated with BMI. The fatty pattern was most common, with the sclerotic pattern being rare. Endplate marrow changes most often occurred at the anterior aspect of the endplate, particularly at L4 - L5 and L5 - S1 levels. Modic changes occur more frequently with aging, evidence of their degenerative etiology. They were, however, not related to body habitus, but to weight and male gender. (orig.)

Characteristics of rainfall triggering of debris flows in the Chenyulan watershed, Taiwan

Directory of Open Access Journals (Sweden)

J. C. Chen

2013-04-01

Full Text Available This paper reports the variation in rainfall characteristics associated with debris flows in the Chenyulan watershed, central Taiwan, between 1963 and 2009. The maximum hourly rainfall Im, the maximum 24 h rainfall Rd, and the rainfall index RI (defined as the product RdIm were analysed for each rainfall event that triggered a debris flow within the watershed. The corresponding number of debris flows initiated by each rainfall event (N was also investigated via image analysis and/or field investigation. The relationship between N and RI was analysed. Higher RI of a rainfall event would trigger a larger number of debris flows. This paper also discusses the effects of the Chi-Chi earthquake (CCE on this relationship and on debris flow initiation. The results showed that the critical RI for debris flow initiation had significant variations and was significantly lower in the years immediately following the CCE of 1999, but appeared to revert to the pre-earthquake condition about five years later. Under the same extreme rainfall event of RI = 365 cm2 h−1, the value of N in the CCE-affected period could be six times larger than that in the non-CCE-affected periods.

Effects of current crowding on light extraction efficiency of conventional GaN-based light-emitting diodes.

Science.gov (United States)

Cao, Bin; Li, Shuiming; Hu, Run; Zhou, Shengjun; Sun, Yi; Gan, Zhiying; Liu, Sheng

2013-10-21

Current crowding effects (CCEs) on light extraction efficiency (LEE) of conventional GaN-based light-emitting diodes (LEDs) are analyzed through Monte Carlo ray-tracing simulation. The non-uniform radiative power distribution of the active layer of the Monte Carlo model is obtained based on the current spreading theory and rate equation. The simulation results illustrate that CCE around n-pad (n-CCE) has little effect on LEE, while CCE around p-pad (p-CCE) results in a notable LEE droop due to the significant absorption of photons emitted under p-pad. LEE droop is alleviated by a SiO₂ current blocking layer (CBL) and reflective p-pad. Compared to the conventional LEDs without CBL, the simulated LEE of LEDs with CBL at 20 A/cm² and 70 A/cm² is enhanced by 7.7% and 19.0%, respectively. It is further enhanced by 7.6% and 11.4% after employing a reflective p-pad due to decreased absorption. These enhancements are in accordance with the experimental results. Output power of LEDs with CBL is enhanced by 8.7% and 18.2% at 20 A/cm² and 70 A/cm², respectively. And the reflective p-pad results in a further enhancement of 8.9% and 12.7%.

Evaluation of biogas production rate and biochemical changes in ...

African Journals Online (AJOL)

The rate of biogas generation and biochemical changes in pig dung used in a simple mobile biogas digester designed and constructed at the Department of Environmental Technology, Federal University of Technology Owerri, Nigeria were evaluated. Measurable gas production started 4 days after feeding the digester with ...

Ceramic carbon electrode-based anodes for use in the Cu-Cl thermochemical cycle

Energy Technology Data Exchange (ETDEWEB)

Ranganathan, Santhanam; Easton, E. Bradley [Faculty of Science, University of Ontario Institute of Technology, 2000 Simcoe Street North, Oshawa, Ontario (Canada)

2010-05-15

We have investigated CCE materials prepared using 3-aminopropyl trimethoxysilane. Electrochemical experiments were performed to characterize their suitability as anode electrode materials for use in the electrochemical step of the Cu-Cl thermochemical cycle. CCE-based electrodes vastly outperform a bare carbon electrode. Optimization of the organosilicate loading revealed maximum electrode performance was achieved with 36 wt% and was explained in terms of the optimal balance of active area and anion transport properties. (author)

Evaluation of regenerative phase change drywalls: low-energy building application

Energy Technology Data Exchange (ETDEWEB)

Darkwa, K. [Nottingham Trent Unv., Applied Energy and Environmental Engineering Unit, Nottingham (United Kingdom)

1999-07-01

An integrated phase change drywall system has been analytically evaluated for low-energy building applications. The mathematical model indicates that it is possible to attain higher levels of thermal performance and efficiency with lower values of transfer units (NTU). Even though the model does not take into account the variable nature of the thermophysical properties of phase change materials (PCMs), reasonable thermal performance is achievable. Experimental validation is therefore recommended. (Author)

Evaluation of osseous changes of TMJ in internal derangement and osteoarthritis patients using MRI

International Nuclear Information System (INIS)

Cho, Su Beom; Koh, Kwang Joon

2001-01-01

To evaluate the osseous changes of TMJ in internal derangement and osteoarthritis patients using MRI. MR images of 111 TMJs in 64 patients were analyzed to evaluate the osseous changes. 111 TMJs were divided into 6 groups according to the radiologic Stages by Schellhas and Wilkes. On MR images, we evaluate the osseous changes of articular eminence and condylar head. The most frequent Stage in internal derangement of TMJ was Stage Ι. And 38 joints (25.2%) revealed osteoarthritis with internal derangement. When osseous change of articular eminence and condylar head occur, flattening was the most common osseous change. Sclerosis was observed in all Stages and osteophytosis of condylar head was observed in Stage ΙΙ (1.8%) and ΙΙΙ (0.9%). Out of 28 joints with osteoarthritis, 6 joints (21.4%) showed joint effusion. MR image revealed abnormal configuration of disk, but the detection of minimal osseous change was subtle

Acceptability of the Risk Importance Measures in Evaluation of a Change

International Nuclear Information System (INIS)

Dimitrijevic, V. B.; Chapman, J. R.

1996-01-01

In this paper, the authors discuss insights gained from evaluating changes to plant design and operational practices. Evaluation of a change is performed in order to provide an answer to two fundamental questions: what is the impact and is the impact acceptable? In order to determine 'the acceptability of an impact', the risk-based technologies today provide various ranking schemes. They are based on the existing IPE studies or PSA models and use of standard risk importance measures. In 'ad hoc' applications of risk importance measures, the specific nature of the analyzed change is often neglected. This paper attempts to capture the most common problems in the application of importance measures, and defines the limits of this application. The authors' position is that the use of risk importance information as the sole basis to accept or reject with ranking results, after the basis for the rank is meaningfully established. (author)

Policy, systems, and environmental change in the Mississippi Delta: considerations for evaluation design.

Science.gov (United States)

Kegler, Michelle C; Honeycutt, Sally; Davis, Melvin; Dauria, Emily; Berg, Carla; Dove, Cassandra; Gamble, Abigail; Hawkins, Jackie

2015-04-01

Community-level policy, systems, and environmental (PSE) change strategies may offer an economical and sustainable approach to chronic disease prevention. The rapidly growing number of untested but promising PSE strategies currently underway offers an exciting opportunity to establish practice-based evidence for this approach. This article presents lessons learned from an evaluation of a community-based PSE initiative targeting stroke and cardiovascular disease prevention in the Mississippi Delta. Its purpose is to describe one approach to evaluating this type of PSE initiative, to stimulate discussion about best practices for evaluating PSE strategies, and to inform future evaluation and research efforts to expand practice-based evidence. The evaluation used a descriptive mixed-methods design and focused on the second year of a multisectoral, multiyear initiative. Cross-sectional data were collected in the summer and fall of 2010 using four data collection instruments: a grantee interview guide (n = 32), a health council member survey (n = 256), an organizational survey (n = 60), and a grantee progress report (n = 26). Fifty-eight PSE changes were assessed across five sectors: health, faith, education, worksite, and community/city government. PSE strategies aligned with increased access to physical activity opportunities, healthy food and beverage options, quality health care, and reduced exposure to tobacco. Results showed that grantees were successful in completing a series of steps toward PSE change and that sector-specific initiatives resulted in a range of PSE changes that were completed or in progress. Considerations for designing evaluations of community-based PSE initiatives are discussed. © 2015 Society for Public Health Education.

Optical Fiber Grating based Sensors

DEFF Research Database (Denmark)

Michelsen, Susanne

2003-01-01

In this thesis differenct optical fiber gratings are used for sensor purposes. If a fiber with a core concentricity error (CCE) is used, a directional dependent bend sensor can be produced. The CCE direction can be determined by means of diffraction. This makes it possible to produce long......-period gratings in a fiber with a CCE direction parallel or perpendicular to the writing direction. The maximal bending sensitivity is independent on the writing direction, but the detailed bending response is different in the two cases. A temperature and strain sensor, based on a long-period grating and two...... sampled gratings, was produced and investigated. It is based on the different temperature and strain response of these gratings. Both a transfer matrix method and an overlap calculation is performed to explain the sensor response. Another type of sensor is based on tuning and modulation of a laser...

Charge collection efficiency recovery in heavily irradiated silicon detectors operated at cryogenic temperatures

CERN Document Server

Da Vià, C; Berglund, P; Borchi, E; Borer, K; Bruzzi, Mara; Buontempo, S; Casagrande, L; Chapuy, S; Cindro, V; Dimcovski, Zlatomir; D'Ambrosio, N; de Boer, Wim; Dezillie, B; Esposito, A P; Granat, V; Grigoriev, E; Heijne, Erik H M; Heising, S; Janos, S; Koivuniemi, J H; Konotov, I; Li, Z; Lourenço, C; Mikuz, M; Niinikoski, T O; Pagano, S; Palmieri, V G; Paul, S; Pirollo, S; Pretzl, Klaus P; Ropotar, I; Ruggiero, G; Salmi, J; Seppä, H; Suni, I; Smith, K; Sonderegger, P; Valtonen, M J; Zavrtanik, M

1998-01-01

The charge collection efficiency (CCE) of high resistivity silicon detectors, previously neutron irradiated up to 2*10/sup 15/ n/cm/sup 2/, was measured at different cryogenic temperatures and different bias voltages. In order to $9 study reverse annealing (RA) effects, a few samples were heated to 80 degrees C and kept at room temperature for several months after irradiation. For comparison other samples (NRA) where kept at -10 C after irradiation. The RA and $9 NRA samples, measured at 250 V forward and reverse bias voltage, present a common temperature threshold at 150 K. Below 120 K the CCE is constant and ranges between 55and 65 0.000000or the RA and NRA sample respectively. Similar CCE $9 was measured for a device processed with low resistivity contacts (OHMIC), opening the prospect for a consistent reduction of the cost of large area particle tracking. (7 refs).

Capacity-coupled multidischarge for atmospheric plasma production

International Nuclear Information System (INIS)

Mase, Hiroshi; Fujiwara, Tamiya; Sato, Noriyoshi

2003-01-01

We propose a method of plasma production by capacity-coupled multidischarge (CCMD) at atmospheric pressure. The discharge gaps in the CCMD consist of a common electrode and a number of compact electrodes (CCE) which are directly coupled with small capacitors for quenching the discharge. A simple CCE structure is provided by a cylindrical capacitor, the inner conductor of which is used as a gap electrode. A short pulse discharge is observed to appear homogeneously at each CCE. A charge transfer for the single-pulsed discharge is 10-100 times as large as that of the conventional dielectric barrier discharge. A high efficiency of ozone production has been confirmed in the CCMD using O 2 gas. A device configuration of the CCMD is quite flexible with respect to its geometrical shape and size. The CCMD could be used to produce plasmas for various kinds of industrial applications at atmospheric pressure

Welfare Evaluation and the Economic Impacts of Climate Change on ...

International Development Research Centre (IDRC) Digital Library (Canada)

Welfare Evaluation and the Economic Impacts of Climate Change on Water Supply ... In a context of positive economic growth, demand for water is expected to ... Socially equitable climate action is essential to strengthen the resilience of all ...

The need for simultaneous evaluation of ecosystem services and land use change

Science.gov (United States)

Euliss, Ned H.; Smith, Loren M.; Liu, Shu-Guang; Feng, Min; Mushet, David M.; Auch, Roger F.; Loveland, Thomas R.

2010-01-01

We are living in a period of massive global change. This rate of change may be almost without precedent in geologic history (1). Even the most remote areas of the planet are influenced by human activities. Modern landscapes have been highly modified to accommodate a growing human population that the United Nations has forecast to peak at 9.1 billion by 2050. Over this past century, reliance on services from ecosystems has increased significantly and, over past decades, sustainability of our modern, intensively managed ecosystems has been a topic of serious international concern (1). Numerous papers addressing a particular land-use change effect on specific ecosystem services have recently been published. For example, there is currently great interest in increasing biofuel production to achieve energy inde- pendence goals and recent papers have independently focused attention on impacts of land-use change on single ecosystem services such as carbon sequestration (2) and many others (e.g., water availability, biodiversity, pollination). However, land-use change clearly affects myriad ecosystem services simultaneously. Hence, a broader perspective and context is needed to evaluate and understand interrelated affects on multiple ecosystem services, especially as we strive for the goal of sustainably managing global ecosystems. Similarly, land uses affect ecosystem services synergistically; single land-use evaluations may be misleading because the overall impact on an ecosystem is not evaluated. A more holistic approach would provide a means and framework to characterize how land-use change affects provisioning of goods and services of complete ecosystems.

Spatial and temporal snowpack variation in the crown of the continent ecosystem

Science.gov (United States)

Selkowitz, D.J.; Fagre, D.B.; Reardon, B.A.

2002-01-01

Snowpack related ecosystem changes such as glacier recession and alpine treeline advance have been documented in the Crown of the Continent Ecosystem (CCE) over the course of the previous 150 years. Using data from the Natural Resource Conservation Service's SNOTEL sites and snow course surveys, we examined the spatial and temporal variation in snowpack in the region. SNOTEL data suggest CCE snowpacks are larger and more persistent than in most regions of the Western U.S., and that water year precipitation, rather than mean temperature, is the primary control on April 1 snow water equivalent (SWE). Snow course data indicate a statistically significant downward trend in mean April 1 SWE for the period 1950-2001 but no statistically significant trend in mean May 1 SWE for the longer period 1922-2001. Further analysis reveals that variations in both April 1 and May 1 mean SWE are closely tied to the Pacific Decadal Oscillation, an ENSO-like interdecadal pattern of Pacific Ocean climate variability. Despite no significant trend in mean May 1 SWE between 1922-2001, glaciers in Glacier National Park receded steadily during this period, implying changing climatic conditions crossed a threshold for glacier mass balance maintenace sometime between the Little Ice Age glacial maxima and 1922.

Evaluation of lumbar vertebral bone marrow changes with MR imaging

Energy Technology Data Exchange (ETDEWEB)

Kakitsubata, Yousuke; Nabeshima, Kazuki; Kakitsubata, Sachiko; Watanabe, Katsushi (Miyazaki Medical Coll., Kiyotake (Japan))

1993-11-01

Seven hundred nine magnetic resonance (MR) imaging studies of the lumbar spine were reviewed to assess the signal intensity (SI) changes in vertebral bone marrow. Marrow changes were classified into four types according to their SI changes on T1-weighted images (T1-WI) and T2-WI. Type 1 changes (decreased SI on T1-WI and increased SI on T2-WI) were identified in 28 patients (3.9%), type 2 changes (increased SI on T1-WI and isointense or slightly increased SI on T2-WI) in 184 (26%), type 3 changes (decreased SI on both T1-WI and T2-WI) in 71 (10%), and type 4 changes (linearly increased SI on T1-WI in the center of the vertebral body) in 142 (20%). Plain radiographs showed sclerotic changes in patients with type 3. In patients with type 1 or 4 changes, no focal abnormalities were observed. Histological evaluation of type 1 change revealed fibrous tissue including cartilaginous formation. Focal replacement by fatty tissue was observed in type 2 and type 4 changes. Bone sclerosis was observed in type 4 change. Type 1, type 2 and type 3 changes, which occurred commonly in the old and in the lower lumbar level, appear to reflect a spectrum of degenerative changes of the bone marrow including both pathological and physiological ones. (author).

Enhanced sensitivity of A549 cells to the cytotoxic action of anticancer drugs via suppression of Nrf2 by procyanidins from Cinnamomi Cortex extract

Energy Technology Data Exchange (ETDEWEB)

Ohnuma, Tomokazu; Matsumoto, Takashi; Itoi, Ayano; Kawana, Ayako; Nishiyama, Takahito; Ogura, Kenichiro [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan); Hiratsuka, Akira, E-mail: hiratuka@toyaku.ac.jp [Department of Drug Metabolism and Molecular Toxicology, School of Pharmacy, Tokyo University of Pharmacy and Life Sciences, 1432-1 Horinouchi, Hachioji-shi, Tokyo 192-0392 (Japan)

2011-10-07

Highlights: {yields} We found a novel inhibitor of Nrf2 known as a chemoresistance factor. {yields} Overexpressed Nrf2 in lung cancer cells was suppressed by Cinnamomi Cortex extract. {yields} Cytotoxic action of anticancer drugs in cells treated with the extract was enhanced. {yields} Procyanidin tetramers and pentamers were active components in suppressing Nrf2. -- Abstract: Nuclear factor-E2-related factor 2 (Nrf2) is an important cytoprotective transcription factor because Nrf2-regulated enzymes play a key role in antioxidant and detoxification processes. Recent studies have reported that lung cancer cells overexpressing Nrf2 exhibit increased resistance to chemotherapy. Suppression of overexpressed Nrf2 is needed for a new therapeutic approach against lung cancers. In the present study, we found that Cinnamomi Cortex extract (CCE) has an ability to suppress Nrf2-regulated enzyme activity and Nrf2 expression in human lung cancer A549 cells with high Nrf2 activity. Moreover, we demonstrated that CCE significantly enhances sensitivity of A549 cells to the cytotoxic action of doxorubicin and etoposide as well as increasing the intracellular accumulation of both drugs. These results suggest that CCE might be an effective concomitant agent to reduce anticancer drug resistance derived from Nrf2 overexpression. Bioactivity-guided fractionation revealed that procyanidin tetramers and pentamers contained in CCE were active components in suppressing Nrf2.

Caracterização de colágenos tipos I e III no estroma do carcinoma de células escamosas cutâneo em cães

Directory of Open Access Journals (Sweden)

S.A.O. Bedoya

2016-02-01

Full Text Available O carcinoma de células escamosas (CCE é uma neoplasia epitelial maligna que acomete cães e diversas outras espécies, incluindo a humana. O CCE afeta vários sítios anatômicos e pode desenvolver metástase. O objetivo deste estudo foi a caracterização das fibras de colágenos tipos I e III no estroma do CCE cutâneo de cães. Para este trabalho, utilizaram-se 44 amostras de pele incluídas em parafina e que tiveram prévio diagnóstico de CCE. As amostras foram processadas histologicamente e coradas com hematoxilina/eosina para confirmação do diagnóstico e classificação do grau de diferenciação tumoral e com a coloração histoquímica de picrosirius para observação dos colágenos tipos I e III. O colágeno tipo III mostrou maior expressão nos CCEs cutâneos bem diferenciados. O papel do colágeno do tipo III nas neoplasias não está bem esclarecido, e outros fatores além do grau de diferenciação celular podem estar envolvidos em sua expressão e determinar sua importância na biologia tumoral.

Technology developments for a compound cycle engine

Science.gov (United States)

Bobula, George A.; Wintucky, William T.; Castor, J. G.

1988-01-01

The Compound Cycle Engine (CCE) is a highly turbocharged, power compounded power plant which combines the light weight pressure rise capability of a gas turbine with the high efficiency of a diesel. When optimized for a rotorcraft, the CCE will reduce fuel burned for a typical 2 hour (plus 30 min reserve) mission by 30 to 40 percent when compared to a conventional advanced technology gas turbine. The CCE can provide a 50 percent increase in range-payload product on this mission. Results of recent activities in a program to establish the technology base for a CCE are presented. The objective of this program is to research and develop those critical technologies which are necessary for the demonstration of a multicylinder diesel core in the early 1990s. A major accomplishment was the initial screening and identification of a lubricant which has potential for meeting the material wear rate limits of the application. An in-situ wear measurement system also was developed to provide accurate, readily obtainable, real time measurements of ring and liner wear. Wear data, from early single cylinder engine tests, are presented to show correlation of the in-situ measurements and the system's utility in determining parametric wear trends. A plan to demonstrate a compound cycle engine by the mid 1990s is included.

Study of Cesium and Strontium sorption in Brazilian clays for their use as a barrier in repositories of radioactive wastes; Estudo de sorcao de cesio e estroncio em argilas nacionais para sua utilizacao como barreira em repositorios de rejeitos radioativos

Energy Technology Data Exchange (ETDEWEB)

Freire, Carolina Braccini

2007-07-01

Wastes in general should be properly treated and stored. Then the radioactive wastes also require suitable and safe management beginning in their generation until the storage in repository. The main purpose of the radioactive waste management is to preserve the human beings and the environment. The objective of this research was to characterize some Brazilian clays in order to evaluate the viability of their use in the backfill layer, one of the radioactive waste repository barriers. The main function of this barrier is to contribute in the delay of the radionuclides movement, and to prevent their release into the environment. Four clays provided by national suppliers were selected for the research: Ca-Montmorillonite (Dol 01), Na-Montmorillonite (Dol 02), Kaolinite (Ind 01) and Vermiculite (Ubm 04). Their physical, chemical and mineralogical characteristics were determined, and also their sorption potential of Cesium and Strontium cations. It was confirmed through these results a direct relationship among their specific surface (SS), the capacity of cationic exchange (CCE) and pH. The CCE results followed this increasing order: Ind 01, Dol 01, and Dol 02. In accordance with the models of Freundlich (KJ) and Langmuir (M), the clays Dol 01 and Dol 02 were the best sorbers of Sr{sup 2+}. The Ind 01 and Ubm 04 were the best ones in the case of Cs{sup +}. The Gibbs free energy change ({delta}G deg) was calculated for the sorption reactions between the clays and the cations, and it was negative for all clays, confirming the sorption reaction spontaneity. (author)

Study of Cesium and Strontium sorption in Brazilian clays for their use as a barrier in repositories of radioactive wastes

International Nuclear Information System (INIS)

Freire, Carolina Braccini

2007-01-01

Wastes in general should be properly treated and stored. Then the radioactive wastes also require suitable and safe management beginning in their generation until the storage in repository. The main purpose of the radioactive waste management is to preserve the human beings and the environment. The objective of this research was to characterize some Brazilian clays in order to evaluate the viability of their use in the backfill layer, one of the radioactive waste repository barriers. The main function of this barrier is to contribute in the delay of the radionuclides movement, and to prevent their release into the environment. Four clays provided by national suppliers were selected for the research: Ca-Montmorillonite (Dol 01), Na-Montmorillonite (Dol 02), Kaolinite (Ind 01) and Vermiculite (Ubm 04). Their physical, chemical and mineralogical characteristics were determined, and also their sorption potential of Cesium and Strontium cations. It was confirmed through these results a direct relationship among their specific surface (SS), the capacity of cationic exchange (CCE) and pH. The CCE results followed this increasing order: Ind 01, Dol 01, and Dol 02. In accordance with the models of Freundlich (KJ) and Langmuir (M), the clays Dol 01 and Dol 02 were the best sorbers of Sr 2+ . The Ind 01 and Ubm 04 were the best ones in the case of Cs + . The Gibbs free energy change (ΔG deg) was calculated for the sorption reactions between the clays and the cations, and it was negative for all clays, confirming the sorption reaction spontaneity. (author)

Challenging the premises of international policy review

DEFF Research Database (Denmark)

Feinstein, Noah Weeth; Læssøe, Jeppe; Blum, Nicole

2013-01-01

In 2009, a think tank called the International Alliance of Leading Education Institutes (IALEI) announced the results of a study entitled Climate Change and Sustainable Development: The Response from Education. Intended for a policy audience, the study offered a glimpse into the status of Education...... for Sustainable Development (ESD) and an early look at the emergence of Climate Change Education (CCE), in 10 different nations. As with most international reports, the IALEI report provoked many questions, some of which are more broadly relevant to scholarship and practice. This paper introduces a review...

Quantitative evaluation of changes in eyeball shape in emmetropization and myopic changes based on elliptic fourier descriptors.

Science.gov (United States)

Ishii, Kotaro; Iwata, Hiroyoshi; Oshika, Tetsuro

2011-11-04

To evaluate changes in eyeball shape in emmetropization and myopic changes using magnetic resonance imaging (MRI) and elliptic Fourier descriptors (EFDs). The subjects were 105 patients (age range, 1 month-19 years) who underwent head MRI. The refractive error was determined in 30 patients, and eyeball shape was expressed numerically by principal components analysis of standardized EFDs. In the first principal component (PC1; the oblate-to-prolate change), the proportion of variance/total variance in the development of the eyeball shape was 76%. In all subjects, PC1 showed a significant correlation with age (Pearson r = -0.314; P = 0.001), axial length (AL, r = -0.378; P eyeball shape from oblate to prolate was clarified by quantitative analysis based on EFDs. The results showed clear differences between age groups with regard to changes in the shape of the eyeball, the correlation between these changes, and refractive status changes.

Evaluating mobile phone applications for health behaviour change: A systematic review.

Science.gov (United States)

McKay, Fiona H; Cheng, Christina; Wright, Annemarie; Shill, Jane; Stephens, Hugh; Uccellini, Mary

2018-01-01

Introduction Increasing smartphones access has allowed for increasing development and use of smart phone applications (apps). Mobile health interventions have previously relied on voice or text-based short message services (SMS), however, the increasing availability and ease of use of apps has allowed for significant growth of smartphone apps that can be used for health behaviour change. This review considers the current body of knowledge relating to the evaluation of apps for health behaviour change. The aim of this review is to investigate approaches to the evaluation of health apps to identify any current best practice approaches. Method A systematic review was conducted. Data were collected and analysed in September 2016. Thirty-eight articles were identified and have been included in this review. Results Articles were published between 2011- 2016, and 36 were reviews or evaluations of apps related to one or more health conditions, the remaining two reported on an investigation of the usability of health apps. Studies investigated apps relating to the following areas: alcohol, asthma, breastfeeding, cancer, depression, diabetes, general health and fitness, headaches, heart disease, HIV, hypertension, iron deficiency/anaemia, low vision, mindfulness, obesity, pain, physical activity, smoking, weight management and women's health. Conclusion In order to harness the potential of mobile health apps for behaviour change and health, we need better ways to assess the quality and effectiveness of apps. This review is unable to suggest a single best practice approach to evaluate mobile health apps. Few measures identified in this review included sufficient information or evaluation, leading to potentially incomplete and inaccurate information for consumers seeking the best app for their situation. This is further complicated by a lack of regulation in health promotion generally.

Compulsory Project-Level Involvement and the Use of Program-Level Evaluations: Evaluating the Local Systemic Change for Teacher Enhancement Program

Science.gov (United States)

Johnson, Kelli; Weiss, Iris R.

2011-01-01

In 1995, the National Science Foundation (NSF) contracted with principal investigator Iris Weiss and an evaluation team at Horizon Research, Inc. (HRI) to conduct a national evaluation of the Local Systemic Change for Teacher Enhancement program (LSC). HRI conducted the core evaluation under a $6.25 million contract with NSF. This program…

Severe signal loss in diamond beam loss monitors in high particle rate environments by charge trapping in radiation-induced defects

CERN Document Server

Kassel, Florian; Dabrowski, Anne; de Boer, Wim

2016-01-01

The beam condition monitoring leakage (BCML) system is a beam monitoring device in the compact muon solenoid (CMS) experiment at the large hadron collider (LHC). As detectors 32 poly-crystalline (pCVD) diamond sensors are positioned in rings around the beam pipe. Here, high particle rates occur from the colliding beams scattering particles outside the beam pipe. These particles cause defects, which act as traps for the ionization, thus reducing the charge collection efficiency (CCE). However, the loss in CCE was much more severe than expected from low rate laboratory measurements and simulations, especially in single-crystalline (sCVD) diamonds, which have a low initial concentration of defects. The reason why in real experiments the CCE is much worse than in laboratory experiments is related to the ionization rate. At high particle rates the trapping rate of the ionization is so high compared with the detrapping rate, that space charge builds up. This space charge reduces locally the internal electric field,...

Toward a web-based real-time radiation treatment planning system in a cloud computing environment.

Science.gov (United States)

Na, Yong Hum; Suh, Tae-Suk; Kapp, Daniel S; Xing, Lei

2013-09-21

To exploit the potential dosimetric advantages of intensity modulated radiation therapy (IMRT) and volumetric modulated arc therapy (VMAT), an in-depth approach is required to provide efficient computing methods. This needs to incorporate clinically related organ specific constraints, Monte Carlo (MC) dose calculations, and large-scale plan optimization. This paper describes our first steps toward a web-based real-time radiation treatment planning system in a cloud computing environment (CCE). The Amazon Elastic Compute Cloud (EC2) with a master node (named m2.xlarge containing 17.1 GB of memory, two virtual cores with 3.25 EC2 Compute Units each, 420 GB of instance storage, 64-bit platform) is used as the backbone of cloud computing for dose calculation and plan optimization. The master node is able to scale the workers on an 'on-demand' basis. MC dose calculation is employed to generate accurate beamlet dose kernels by parallel tasks. The intensity modulation optimization uses total-variation regularization (TVR) and generates piecewise constant fluence maps for each initial beam direction in a distributed manner over the CCE. The optimized fluence maps are segmented into deliverable apertures. The shape of each aperture is iteratively rectified to be a sequence of arcs using the manufacture's constraints. The output plan file from the EC2 is sent to the simple storage service. Three de-identified clinical cancer treatment plans have been studied for evaluating the performance of the new planning platform with 6 MV flattening filter free beams (40 × 40 cm(2)) from the Varian TrueBeam(TM) STx linear accelerator. A CCE leads to speed-ups of up to 14-fold for both dose kernel calculations and plan optimizations in the head and neck, lung, and prostate cancer cases considered in this study. The proposed system relies on a CCE that is able to provide an infrastructure for parallel and distributed computing. The resultant plans from the cloud computing are

Toward a web-based real-time radiation treatment planning system in a cloud computing environment

International Nuclear Information System (INIS)

Na, Yong Hum; Kapp, Daniel S; Xing, Lei; Suh, Tae-Suk

2013-01-01

To exploit the potential dosimetric advantages of intensity modulated radiation therapy (IMRT) and volumetric modulated arc therapy (VMAT), an in-depth approach is required to provide efficient computing methods. This needs to incorporate clinically related organ specific constraints, Monte Carlo (MC) dose calculations, and large-scale plan optimization. This paper describes our first steps toward a web-based real-time radiation treatment planning system in a cloud computing environment (CCE). The Amazon Elastic Compute Cloud (EC2) with a master node (named m2.xlarge containing 17.1 GB of memory, two virtual cores with 3.25 EC2 Compute Units each, 420 GB of instance storage, 64-bit platform) is used as the backbone of cloud computing for dose calculation and plan optimization. The master node is able to scale the workers on an ‘on-demand’ basis. MC dose calculation is employed to generate accurate beamlet dose kernels by parallel tasks. The intensity modulation optimization uses total-variation regularization (TVR) and generates piecewise constant fluence maps for each initial beam direction in a distributed manner over the CCE. The optimized fluence maps are segmented into deliverable apertures. The shape of each aperture is iteratively rectified to be a sequence of arcs using the manufacture’s constraints. The output plan file from the EC2 is sent to the simple storage service. Three de-identified clinical cancer treatment plans have been studied for evaluating the performance of the new planning platform with 6 MV flattening filter free beams (40 × 40 cm 2 ) from the Varian TrueBeam TM STx linear accelerator. A CCE leads to speed-ups of up to 14-fold for both dose kernel calculations and plan optimizations in the head and neck, lung, and prostate cancer cases considered in this study. The proposed system relies on a CCE that is able to provide an infrastructure for parallel and distributed computing. The resultant plans from the cloud computing are

Outcome indicators for the evaluation of energy policy instruments and technical change

International Nuclear Information System (INIS)

Neij, Lena; Astrand, Kerstin

2006-01-01

The aim of this paper is to propose a framework for the evaluation of policy instruments designed to affect development and dissemination of new energy technologies. The evaluation approach is based on the analysis of selected outcome indicators describing the process of technical change, i.e. the development and dissemination of new energy technologies, on the basis of a socio-technical systems approach. The outcome indicators are used to analyse the effect, in terms of outcome, and outcome scope of the policy instruments as well as the extent to which the policy instruments support diversity, learning and institutional change. The analysis of two cases of evaluations, of energy efficiency policy and wind energy policy in Sweden, shows that the approach has several advantages, allowing continuous evaluation and providing important information for the redesign of policy instruments. There are also disadvantages associated with the approach, such as complexity, possible high cost and the requirement of qualified evaluators. Nevertheless, it is concluded that the information on the continuous performance of different policy instruments and their effects on the introduction and dissemination of new energy technologies, provided by this evaluation approach, is essential for an improved adaptation and implementation of energy and climate policy

Evaluating Transcription Factor Activity Changes by Scoring Unexplained Target Genes in Expression Data.

Directory of Open Access Journals (Sweden)

Evi Berchtold

Full Text Available Several methods predict activity changes of transcription factors (TFs from a given regulatory network and measured expression data. But available gene regulatory networks are incomplete and contain many condition-dependent regulations that are not relevant for the specific expression measurement. It is not known which combination of active TFs is needed to cause a change in the expression of a target gene. A method to systematically evaluate the inferred activity changes is missing. We present such an evaluation strategy that indicates for how many target genes the observed expression changes can be explained by a given set of active TFs. To overcome the problem that the exact combination of active TFs needed to activate a gene is typically not known, we assume a gene to be explained if there exists any combination for which the predicted active TFs can possibly explain the observed change of the gene. We introduce the i-score (inconsistency score, which quantifies how many genes could not be explained by the set of activity changes of TFs. We observe that, even for these minimal requirements, published methods yield many unexplained target genes, i.e. large i-scores. This holds for all methods and all expression datasets we evaluated. We provide new optimization methods to calculate the best possible (minimal i-score given the network and measured expression data. The evaluation of this optimized i-score on a large data compendium yields many unexplained target genes for almost every case. This indicates that currently available regulatory networks are still far from being complete. Both the presented Act-SAT and Act-A* methods produce optimal sets of TF activity changes, which can be used to investigate the difficult interplay of expression and network data. A web server and a command line tool to calculate our i-score and to find the active TFs associated with the minimal i-score is available from https://services.bio.ifi.lmu.de/i-score.

Evaluation of geriatric changes in dogs

Directory of Open Access Journals (Sweden)

Soumyaranjan Pati

2015-03-01

Full Text Available Aim: The present study has been envisaged to ascertain the old age for critical management of geriatric dogs considering the parameters of externally visible changes, haemato-biochemical alterations and urine analysis in geriatric dogs approaching senility. Materials and Methods: The study was undertaken in the Department of Veterinary Pathology in collaboration with Teaching Veterinary Clinic complex spanning a period of 1 year. For screening of geriatric dogs, standard geriatric age chart of different breeds was followed. The external characteristics such as hair coat texture, dental wear and tear, skin texture and glaucoma were taken as a marker of old age. Haematology, serum biochemistry and urine analysis were also included in the study. Results: External visible changes like greying of hair, dull appearance of hair coat, glaucoma, osteoarthritis, dental wear and tear were commonly encountered in the aged dogs. The haemoglobin, total erythrocyte count and packed cell volume showed a decreasing trend in the geriatric groups. Biochemical values like total protein, albumin, calcium level showed a decreasing trend while urea level with an increasing trend in geriatric dogs without any much alteration in serum glutamicoxaloacetic transaminse, serum glutamic-pyruvate transaminase, cholesterol and creatinine. Physical examination of urine revealed yellow, amber, red, deep red color with turbidity and higher specific gravity. Chemical examination revealed presence of protein, glucose, ketone bodies, blood and bilirubin on some cases. The culture and sensitivity test of the urine samples revealed presence of bacteria with sensitive and resistance to some antibiotics. Conclusion: External visible changes are still the golden standard of determining the old age in dogs. Haemato-biochemical evaluation can be useful for correlating with the pathophysiological status of the animal. Biochemical analysis of urine can be employed rightly as kidney

Formative Evaluation of the Behavior Change Components within a Colorado Weatherization Assistance Program

Science.gov (United States)

Sandoval, Perla K.

A formative evaluation of behavior change elements of an ongoing Weatherization Assistance Program (WAP) offered by the Energy Resource Center (E.R.C.) in Denver, CO was conducted. The WAP as administered by the E.R.C. in Colorado saves residents an average 15% of energy consumption (E.R.C., 2015). However, research suggests that adding behavioral components to WAPs could increase energy savings to 21-26% (Gregory, 1992; APPRAISE, 2002). The goal of this evaluation is to provide recommendations to E.R.C. for program changes using Community Based Social Marketing (CBSM) and Theory of Planned Behavior. The CBSM Step 1- Step 3 is the focus of this formative evaluation. This program evaluation has four components: 1) review of written materials, 2) interviews with staff, 3) surveys mailed to E.R.C. clients and 4) in-home observations conducted with E.R.C. clients. Results of this formative evaluation has 3 sections of behaviors recommended for future intervention high priority, mid priority, and low priority recommendations based on CBSM penetration, probability, and impact factors. Behaviors that are listed as high priority for E.R.C. Behavioral intervention are cold water washing, hang drying, setting back thermostats, and window coverings. Overall increase in staff engagement is also recommended to be pursued. Each staff level is also given recommendations on how to engage in behavior change interventions.

Using an Engaged Scholarship Symposium to Change Perceptions: Evaluation Results

Science.gov (United States)

Varkey, Sapna; Smirnova, Olga; Gallien, Tara Lee

2018-01-01

Engaged scholarship (ES) entails a symbiotic relationship between the community and the university. This article reports results from an evaluation of an ES symposium Eastern Carolina University held to increase awareness of ES as a means for integrating research, teaching, and service and to potentially change unfavorable perceptions about ES…

Protein (Viridiplantae): 145354532 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 436017:4420 predicted protein Ostreococcus lucimarinus CCE9901 MSTRRPTTRARADDGFARDDDEDDGAHDDVAANTIVVYTKPGCCLCDGLKDKLDAAVDAAARAPPGASL...ECLRDFALCVRDVSTNAAWAESYAGSVPRVFVRVAVDAASTERSSVVSREFARPPPKRAAARVAEDLASLVRRACAPARAGWTVVTTTAWDAPSSSF ...

Rapid Structural Design Change Evaluation with AN Experiment Based FEM

Science.gov (United States)

Chu, C.-H.; Trethewey, M. W.

1998-04-01

The work in this paper proposes a dynamic structural design model that can be developed in a rapid fashion. The approach endeavours to produce a simplified FEM developed in conjunction with an experimental modal database. The FEM is formulated directly from the geometry and connectivity used in an experimental modal test using beam/frame elements. The model sacrifices fine detail for a rapid development time. The FEM is updated at the element level so the dynamic response replicates the experimental results closely. The physical attributes of the model are retained, making it well suited to evaluate the effect of potential design changes. The capabilities are evaluated in a series of computational and laboratory tests. First, a study is performed with a simulated cantilever beam with a variable mass and stiffness distribution. The modal characteristics serve as the updating target with random noise added to simulate experimental uncertainty. A uniformly distributed FEM is developed and updated. The results show excellent results, all natural frequencies are within 0·001% with MAC values above 0·99. Next, the method is applied to predict the dynamic changes of a hardware portal frame structure for a radical design change. Natural frequency predictions from the original FEM differ by as much as almost 18% with reasonable MAC values. The results predicted from the updated model produce excellent results when compared to the actual hardware changes, the first five modal natural frequency difference is around 5% and the corresponding mode shapes producing MAC values above 0·98.

[Remediation efficiency of lead-contaminated soil at an industrial site by ultrasonic-assisted chemical extraction].

Science.gov (United States)

Wang, Xin-jie; Huang, Jin-lou; Liu, Zhi-qiang; Yue, Xi

2013-09-01

This research chose five lead-contaminated sites of a lead-acid battery factory to analyze the speciation distribution and concentration of lead. Under the same conditions (0.1 mol x L(-1) EDTA,30 min, 25 degrees C), the removal effect of heavy metal was compared between ultrasonic-assisted chemical extraction (UCE) and conventional chemical extraction ( CCE), and the variation of lead speciation was further explored. The results showed that the lead removal efficiency of UCE was significantly better than CCE. The lead removal efficiency of WS, A, B, C and BZ was 10.06%, 48.29%, 48.69%, 53.28% and 36.26% under CCE. While the removal efficiency of the UCE was 22.42%, 69.31%, 71.00%, 74.49% and 71.58%, with the average efficiency higher by 22%. By comparing the speciation distribution of the two washing methods, it was found that the acid extractable content maintained or decreased after UCE, whereas it showed an increasing trend after CCE. The reduction effect of the reducible was as high as 98% by UCE. UCE also showed a more efficient reduction effect of the organic matter-sulfite bounded form and the residual form. Hence, it is feasible to improve the washing efficiency of heavy metal contained in soil by conducting the cleaning process with the help of ultrasonic wave, which is a simple and fast mean to remove lead from contaminated sites.

Charge losses in silicon sensors and electric-field studies at the Si-SiO2 interface

International Nuclear Information System (INIS)

Poehlsen, Thomas

2013-07-01

Electric fields and charge losses in silicon sensors before and after irradiation with x-rays, protons, neutrons or mixed irradiation are studied in charge-collection measurements. Electron-hole pairs (eh pairs) are generated at different positions in the sensor using sub-ns pulsed laser light of different wavelengths. Light of 1063 nm, 830 nm and 660 nm wavelength is used to generate eh pairs along the whole sensor depth, a few μm below the surface and very close to the surface, respectively. Segmented p + n silicon strip sensors are used to study the electric field below the SiO 2 separating the strip implants. The sensors are investigated before and after irradiation with 12 keV X-rays to a dose of 1 MGy. It is found that the electric field close to the Si-SiO 2 interface depends on both the irradiation dose and the biasing history. For the non-irradiated sensors the observed dependence of the electric field on biasing history and humidity is qualitatively as expected from simulations of the electrostatic potential for different boundary conditions at the surface. Depending on the biasing history incomplete collection of electrons, full charge collection or incomplete collection of holes is observed. After the bias voltage is changed, the amount of observed charge losses is time dependent with time constants being a function of humidity. For the irradiated sensors an increased effective oxide charge density and more electron losses are observed compared to the non-irradiated sensors. Due to positive oxide charges which are always present at the Si-SiO 2 interface an electronaccumulation layer forms, if the oxide charge is not compensated by charges on top of the passivation. If negative charges overcompensate the oxide charge, a hole-accumulation layer forms. In both cases the number of accumulated charges can be temporarily increased by incomplete charge collection of either electrons or holes. How many additional charge carriers can be added to the

Charge losses in silicon sensors and electric-field studies at the Si-SiO{sub 2} interface

Energy Technology Data Exchange (ETDEWEB)

Poehlsen, Thomas

2013-07-15

Electric fields and charge losses in silicon sensors before and after irradiation with x-rays, protons, neutrons or mixed irradiation are studied in charge-collection measurements. Electron-hole pairs (eh pairs) are generated at different positions in the sensor using sub-ns pulsed laser light of different wavelengths. Light of 1063 nm, 830 nm and 660 nm wavelength is used to generate eh pairs along the whole sensor depth, a few {mu}m below the surface and very close to the surface, respectively. Segmented p{sup +}n silicon strip sensors are used to study the electric field below the SiO{sub 2} separating the strip implants. The sensors are investigated before and after irradiation with 12 keV X-rays to a dose of 1 MGy. It is found that the electric field close to the Si-SiO{sub 2} interface depends on both the irradiation dose and the biasing history. For the non-irradiated sensors the observed dependence of the electric field on biasing history and humidity is qualitatively as expected from simulations of the electrostatic potential for different boundary conditions at the surface. Depending on the biasing history incomplete collection of electrons, full charge collection or incomplete collection of holes is observed. After the bias voltage is changed, the amount of observed charge losses is time dependent with time constants being a function of humidity. For the irradiated sensors an increased effective oxide charge density and more electron losses are observed compared to the non-irradiated sensors. Due to positive oxide charges which are always present at the Si-SiO{sub 2} interface an electronaccumulation layer forms, if the oxide charge is not compensated by charges on top of the passivation. If negative charges overcompensate the oxide charge, a hole-accumulation layer forms. In both cases the number of accumulated charges can be temporarily increased by incomplete charge collection of either electrons or holes. How many additional charge carriers can be

Evaluation of masticatory function after maxillectomy using a colour-changing chewing gum.

Science.gov (United States)

Shibuya, Y; Ishida, S; Kobayashi, M; Hasegawa, T; Nibu, K; Komori, T

2013-03-01

The purpose of this study was to identify the risk factors associated with the masticatory dysfunction after maxillectomy using a colour-changing chewing gum. Thirty-nine patients who underwent maxillectomy between January 2002 and May 2010 in the Department of Kobe University Hospital were recruited for this study. There were 20 male and 19 female subjects, with a median age of 73·3 years (range of 44-90) at the time of surgery. The intra-oral conditions after maxillectomy were classified by HS classification, and the masticatory function was evaluated by a colour-changing chewing gum and the results of a modified Sato's questionnaire. The scores of the colour-changing gum were closely correlated with the scores of the modified Sato's questionnaire (r = 0·661, P gum test masticatory dysfunction were the number of anchor teeth ≤2 and a soft palate defect. A colour-changing gum was found to be useful for evaluating the post-operative masticatory function, and it was important to conserve the anchor teeth and the soft palate to avoid masticatory dysfunction. © 2012 Blackwell Publishing Ltd.

Using Impact-Relevant Sensitivities to Efficiently Evaluate and Select Climate Change Scenarios

Science.gov (United States)

Vano, J. A.; Kim, J. B.; Rupp, D. E.; Mote, P.

2014-12-01

We outline an efficient approach to help researchers and natural resource managers more effectively use global climate model information in their long-term planning. The approach provides an estimate of the magnitude of change of a particular impact (e.g., summertime streamflow) from a large ensemble of climate change projections prior to detailed analysis. These estimates provide both qualitative information as an end unto itself (e.g., the distribution of future changes between emissions scenarios for the specific impact) and a judicious, defensible evaluation structure that can be used to qualitatively select a sub-set of climate models for further analysis. More specifically, the evaluation identifies global climate model scenarios that both (1) span the range of possible futures for the variable/s most important to the impact under investigation, and (2) come from global climate models that adequately simulate historical climate, providing plausible results for the future climate in the region of interest. To identify how an ecosystem process responds to projected future changes, we methodically sample, using a simple sensitivity analysis, how an impact variable (e.g., streamflow magnitude, vegetation carbon) responds locally to projected regional temperature and precipitation changes. We demonstrate our technique over the Pacific Northwest, focusing on two types of impacts each in three distinct geographic settings: (a) changes in streamflow magnitudes in critical seasons for water management in the Willamette, Yakima, and Upper Columbia River basins; and (b) changes in annual vegetation carbon in the Oregon and Washington Coast Ranges, Western Cascades, and Columbia Basin ecoregions.

Description of radiation damage in diamond sensors using an effective defect model

International Nuclear Information System (INIS)

Kassel, Florian; Guthoff, Moritz; Dabrowski, Anne; Boer, Wim de

2017-01-01

The Beam Condition Monitoring Leakage (BCML) system is a beam monitoring device in the CMS experiment at the LHC consisting of 32 poly-crystalline (pCVD) diamond sensors. The BCML sensors, located in rings around the beam, are exposed to high particle rates originating from the colliding beams. These particles cause lattice defects, which act as traps for the ionized charge carrier leading to a reduced charge collection efficiency (CCE). The radiation induced CCE degradation was, however, much more severe than expected from low rate laboratory measurements. Measurement and simulations presented in this paper show that this discrepancy is related to the rate of incident particles. At high particle rates, the trapping rate of the ionization is strongly increased compared to the detrapping rate leading to an increased build-up of space charge. This space charge locally reduces the internal electric field increasing the trapping rate and hence reducing the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge, the TCAD simulation program SILVACO was used. It allows to introduce the defects as effective donor and acceptor levels, and can calculate the electric field from Transient Current Technique (TCT) signals and CCE as a function of the effective trap properties, like density, energy level, and trapping cross section. After each irradiation step, these properties were fitted to the data on the electric field from the TCT signals and CCE. Two effective acceptor and donor levels were needed to fit the data after each step. It turned out that the energy levels and cross sections could be kept constant and the trap density was proportional to the cumulative fluence of the irradiation steps. The highly non-linear rate dependent diamond polarization and the resulting signal loss can be simulated using this effective defect model and is in agreement with the measurement results

Description of radiation damage in diamond sensors using an effective defect model

Energy Technology Data Exchange (ETDEWEB)

Kassel, Florian [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany); CERN, Meyrin (Switzerland); Guthoff, Moritz; Dabrowski, Anne [CERN, Meyrin (Switzerland); Boer, Wim de [Institute for Experimental Nuclear Physics (IEKP), KIT, Karlsruhe (Germany)

2017-11-15

The Beam Condition Monitoring Leakage (BCML) system is a beam monitoring device in the CMS experiment at the LHC consisting of 32 poly-crystalline (pCVD) diamond sensors. The BCML sensors, located in rings around the beam, are exposed to high particle rates originating from the colliding beams. These particles cause lattice defects, which act as traps for the ionized charge carrier leading to a reduced charge collection efficiency (CCE). The radiation induced CCE degradation was, however, much more severe than expected from low rate laboratory measurements. Measurement and simulations presented in this paper show that this discrepancy is related to the rate of incident particles. At high particle rates, the trapping rate of the ionization is strongly increased compared to the detrapping rate leading to an increased build-up of space charge. This space charge locally reduces the internal electric field increasing the trapping rate and hence reducing the CCE even further. In order to connect these macroscopic measurements with the microscopic defects acting as traps for the ionization charge, the TCAD simulation program SILVACO was used. It allows to introduce the defects as effective donor and acceptor levels, and can calculate the electric field from Transient Current Technique (TCT) signals and CCE as a function of the effective trap properties, like density, energy level, and trapping cross section. After each irradiation step, these properties were fitted to the data on the electric field from the TCT signals and CCE. Two effective acceptor and donor levels were needed to fit the data after each step. It turned out that the energy levels and cross sections could be kept constant and the trap density was proportional to the cumulative fluence of the irradiation steps. The highly non-linear rate dependent diamond polarization and the resulting signal loss can be simulated using this effective defect model and is in agreement with the measurement results

Change Detection in High-Resolution Remote Sensing Images Using Levene-Test and Fuzzy Evaluation

Science.gov (United States)

Wang, G. H.; Wang, H. B.; Fan, W. F.; Liu, Y.; Liu, H. J.

2018-04-01

High-resolution remote sensing images possess complex spatial structure and rich texture information, according to these, this paper presents a new method of change detection based on Levene-Test and Fuzzy Evaluation. It first got map-spots by segmenting two overlapping images which had been pretreated, extracted features such as spectrum and texture. Then, changed information of all map-spots which had been treated by the Levene-Test were counted to obtain the candidate changed regions, hue information (H component) was extracted through the IHS Transform and conducted change vector analysis combined with the texture information. Eventually, the threshold was confirmed by an iteration method, the subject degrees of candidate changed regions were calculated, and final change regions were determined. In this paper experimental results on multi-temporal ZY-3 high-resolution images of some area in Jiangsu Province show that: Through extracting map-spots of larger difference as the candidate changed regions, Levene-Test decreases the computing load, improves the precision of change detection, and shows better fault-tolerant capacity for those unchanged regions which are of relatively large differences. The combination of Hue-texture features and fuzzy evaluation method can effectively decrease omissions and deficiencies, improve the precision of change detection.

Evaluating U.S. States climate change initiatives

International Nuclear Information System (INIS)

Silva, P.

2004-01-01

This paper evaluates sub-federal efforts to mitigate climate change in the United States through a range of climate-relevant initiatives, identifying principal trends and detailing climate-relevant initiatives in several states. These strategies include renewable electricity mandates, State and regional greenhouse gas emissions inventories, mandatory greenhouse gas emissions reporting, State greenhouse gas emissions caps, greenhouse gas emissions reductions from motor vehicles, and greenhouse gas emissions cap-and-trade programs for electric generation in several States. Many municipalities in the United States are also pursuing a range of climate-relevant initiatives, those actions are beyond the scope of this paper, but it should be noted they also influence state and national consideration of climate-relevant initiatives in the United States. (author)

Evaluating U.S. States climate change initiatives

Energy Technology Data Exchange (ETDEWEB)

Silva, P

2004-07-01

This paper evaluates sub-federal efforts to mitigate climate change in the United States through a range of climate-relevant initiatives, identifying principal trends and detailing climate-relevant initiatives in several states. These strategies include renewable electricity mandates, State and regional greenhouse gas emissions inventories, mandatory greenhouse gas emissions reporting, State greenhouse gas emissions caps, greenhouse gas emissions reductions from motor vehicles, and greenhouse gas emissions cap-and-trade programs for electric generation in several States. Many municipalities in the United States are also pursuing a range of climate-relevant initiatives, those actions are beyond the scope of this paper, but it should be noted they also influence state and national consideration of climate-relevant initiatives in the United States. (author)

Soil structure changes evaluated with computed tomography

International Nuclear Information System (INIS)

Pires, Luiz Fernando

2010-01-01

The objective of this work was to evaluate in millimetric scale changes in soil bulk density and porosity, using the gamma-ray computed tomography in soil samples with disturbed structure due to wetting and drying (W-D) cycles. Soil samples with 98.1 cm 3 were sieved using a 2 mm mesh and homogeneously packed in PVC cylinders. Soil samples were submitted to 1, 2, and 3 W-D cycles. Control samples were not submitted to W-D cycles. After repetitions of W-D cycles, soil sample porosity decreased and soil layers became denser. Computed tomography allowed a continuous analysis of soil bulk density and also soil porosity along millimetric (0.08 cm) layers, what cannot be provided by traditional methods used in soil physics. (author)

Sifting through course evaluations: medical student comments driving surgery curriculum changes.

Science.gov (United States)

French, Judith C; Bickett, Melissa M; Iocono, Joseph A

2013-01-01

Student empowerment of curriculum changes is a double-edged sword. When examining our third-year surgery course every year, we debate where the line is between improving education through student input against allowing the students to design "an easy course." Written student comments on end-of-course evaluations (from the academic years 2006-2007 to 2010-2011) were analyzed using the qualitative approach described by Miles and Huberman. We compared the grouped comments to the course changes that were made over these years to determine what extent were we listening to students. Finally, we took the course changes made and juxtaposed them with student grades and with student course perceptions provided by the end-of-course evaluation analysis. We identified 17 alterations to our curriculum since the year 2007-2008 and of those, 12 are directly related to student comments. Some examples of our changes were a grading-scale alteration, grouping of workshops, and adding a shelf examination review session. The overall course ratings by the students steadily rose over the 5-year period (2.57 to 3.39), while the percentages of A's earned by students decreased over that same time until the year 2010-2011 when the percent of A's earned increased by over 30%. Because of the fact that 12 of 17 course changes can be directly related back to the student comments, we feel confident that we are listening to students. The increase in perception of the course through the first 4 years did not coincide with higher grades. The changes made have been instrumental in the course winning the best clerkship award for the last 4 years. Copyright © 2013 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

Evaluating Organizational Change at a Multinational Transportation Corporation: Method and Reflections

Science.gov (United States)

Plakhotnik, Maria S.

2016-01-01

The purpose of this perspective on practice is to share my experience conducting an organizational change evaluation using qualitative methodology at a multinational transportation company Global Logistics. I provide a detailed description of the three phase approach to data analysis and my reflections on the process.

Colombia's space policy: An analysis of six years of progress and challenges

Science.gov (United States)

Becerra, Jairo

2014-07-01

This paper analyzes Colombia's space policy: its successes, its failures and what it still needs to achieve. The paper examines the interaction among the different players, and how this policy contributes to economic and social development of the country. And postulates that, unless a real national plan of action, with specific milestones and budget as well as a managing agency are developed, this policy may be in danger of disappearing. The Colombian Space Commission (Comisión Colombiana del Espacio, or CCE) was created by Presidential Decree 2442 in 2006. It is a multi-sectorial entity, in charge of coordinating, planning, and leading in the implementation of national policies for the development and application of space technologies. The CCE was also charged with the drafting of plans and programs in this field. The CCE began with only a few members (15) and today is comprised of 47 members: 13 ministries, 4 administrative departments, another 21 governmental entities and 9 universities, the latter acting as consultants. The Vice-President of the Republic is the President of the CCE. These different actors gave great importance to the development of Colombia's space sector, and 6 years later, they are continuing support and development the country's space policy. This analysis takes into account three aspects: first, achieving the objectives of the CCE: the creation and development of a national space policy for Colombia; secondly, focussing on “target groups” and “end users”; and thirdly, the “outcomes” or achievements to date. Some conclusions are worth highlighting: first, the warm reception and support of the CCE by both the public and private sectors on high levels, but the poor knowledge of the national space policy by the Colombian people and the small and medium companies. Secondly, in the context of public policy [9], the strategic plan called “National Policy in regard to Space Activities”, is caught between two phases: the formulation

Method of evaluation of solar collector cost under fuel price change

International Nuclear Information System (INIS)

Klychev, Sh. I.; Sadykova, N. S.; Saifiev, A. U.; Ismanzhanov, A. I.; Samiev, M.

2013-01-01

When we take into account the problems of large-scale use of solar energy, the matters of economic perspectives of solar plants in the future become vital. We present the method on whose basis evaluation of the cost of solar collectors is performed taking into account the change in the fuel prices. The method is based on the approach to evaluation of the cost of energy generated by the solar plants offered previously by the authors. Assuming that the components of expenditures for production are not changed, we obtained that the cost of solar collectors will grow, at approximately the same ratio as the growth of the prices for fuel (energy). Thus, the problem of creation of the economically effective solar collectors should be solved already today, at the existing prices for materials and fuel. At present, it is assumed that competitiveness of the solar plants will increase with the growth of the fuel prices. (authors)

Detecting land cover change by evaluating the internal covariance matrix of the extended Kalman filter

CSIR Research Space (South Africa)

Salmon, BP

2012-07-01

Full Text Available - fective way to monitor and evaluate land cover changes. An operator making an image-to-image comparison is still a com- mon method in most organizations when mapping land cover change, which is time consuming and resource intensive. Au- tomated change...

Evaluation of the significance of abrupt changes in precipitation and runoff process in China

Science.gov (United States)

Xie, Ping; Wu, Ziyi; Sang, Yan-Fang; Gu, Haiting; Zhao, Yuxi; Singh, Vijay P.

2018-05-01

Abrupt changes are an important manifestation of hydrological variability. How to accurately detect the abrupt changes in hydrological time series and evaluate their significance is an important issue, but methods for dealing with them effectively are lacking. In this study, we propose an approach to evaluate the significance of abrupt changes in time series at five levels: no, weak, moderate, strong, and dramatic. The approach was based on an index of correlation coefficient calculated for the original time series and its abrupt change component. A bigger value of correlation coefficient reflects a higher significance level of abrupt change. Results of Monte-Carlo experiments verified the reliability of the proposed approach, and also indicated the great influence of statistical characteristics of time series on the significance level of abrupt change. The approach was derived from the relationship between correlation coefficient index and abrupt change, and can estimate and grade the significance levels of abrupt changes in hydrological time series. Application of the proposed approach to ten major watersheds in China showed that abrupt changes mainly occurred in five watersheds in northern China, which have arid or semi-arid climate and severe shortages of water resources. Runoff processes in northern China were more sensitive to precipitation change than those in southern China. Although annual precipitation and surface water resources amount (SWRA) exhibited a harmonious relationship in most watersheds, abrupt changes in the latter were more significant. Compared with abrupt changes in annual precipitation, human activities contributed much more to the abrupt changes in the corresponding SWRA, except for the Northwest Inland River watershed.

Evaluating Structural Change Approaches to Health Promotion: An Exploratory Scoping Review of a Decade of U.S. Progress

Science.gov (United States)

Asada, Yuka; Lieberman, Lisa D.; Neubauer, Leah C.; Hanneke, Rosie; Fagen, Michael C.

2018-01-01

Structural change approaches--also known as policy and environmental changes--are becoming increasingly common in health promotion, yet our understanding of how to evaluate them is still limited. An exploratory scoping review of the literature was conducted to understand approaches and methods used to evaluate structural change interventions in…

AN EXPERIMENTAL EVALUATION OF AUDIO-VISUAL METHODS--CHANGING ATTITUDES TOWARD EDUCATION.

Science.gov (United States)

LOWELL, EDGAR L.; AND OTHERS

AUDIOVISUAL PROGRAMS FOR PARENTS OF DEAF CHILDREN WERE DEVELOPED AND EVALUATED. EIGHTEEN SOUND FILMS AND ACCOMPANYING RECORDS PRESENTED INFORMATION ON HEARING, LIPREADING AND SPEECH, AND ATTEMPTED TO CHANGE PARENTAL ATTITUDES TOWARD CHILDREN AND SPOUSES. TWO VERSIONS OF THE FILMS AND RECORDS WERE NARRATED BY (1) "STARS" WHO WERE…

Room-temperature particle detectors with guard rings based on semi-insulating InP co-doped with Ti and Zn

International Nuclear Information System (INIS)

Yatskiv, R.; Zdansky, K.; Pekarek, L.

2009-01-01

Particle detectors made with a guard-ring (GR) electrode, operating at room temperature, have been studied. The detectors were fabricated on a semi-insulating InP crystal co-doped with Ti and Zn, grown using the Liquid-Encapsulated Czochralski technique. The detection performance of the particle detectors was evaluated using alpha particles emitted from a 241 Am source. Good detector performance has been achieved with measured charge-collection efficiencies of 99.9% and 98.2% and FWHM energy resolutions of 0.9% and 2.1%. The measurements were carried out at 230 K for negative and positive bias voltages of the irradiated electrode. The good performance is due to the SI properties of the material which has been achieved by doping with suitable Ti atoms and co-doping with a low concentration of Zn acceptors, sufficient to fully compensate shallow donors. Electron and hole charge-collection efficiencies (CCEs) were measured at various temperatures. At room temperature, unlike at low temperature (T<250 K), the hole CCE was better than the electron CCE, which can be explained by the presence of electron-trapping centres in InP with a temperature-dependent capture rate.

Economic and Ecological Evaluation of Land Use Change: Evidence from Karelia

Directory of Open Access Journals (Sweden)

Anton Sergeevich Strokov

2017-06-01

Full Text Available Land use change and a shift in economic activity often bring to unpredictable consequences for local ecosystems. There is a necessity of making preliminary evaluation and analysis of comparing the different types of economic and ecological transformation, including cost and benefit analysis, not only for business and local population, but for the whole environment. We give an example of a particular animal husbandry farm in Karelia and show how potential change in economic specialization can be effective on a 10 years horizon. Among other land use types, we chose peat mining and wetland conservation. Each type of activities was complexly evaluated with different types of costs and benefits. In the paper, we use a method of land use change evaluation including the value of ecosystem services. The monetary values of ecosystem services are given with the respect to foreign analogues and taking into account local realities and prices. Our results have shown that the most beneficial for the society and the environment is wetland conservation, due to their berries picking service, which are highly appreciated on the market, and due to low costs for the third parties, since wetlands contain regulative and refinery services for local ecosystems. As a contrary peat mining is a profitable business, but pollutes the environment because of carbon emissions into the atmosphere. The current specialization for animal husbandry is neither an optimal solution because of low profitability of the chosen farm. The results of the research can be used for optimization in regional politics in the sphere of agriculture and environment economics in order to protect the ecological balance between human activities and nature.

Three-dimensional structure of a swarm of the salp Thalia democratica within a cold-core eddy off southeast Australia

Science.gov (United States)

Everett, J. D.; Baird, M. E.; Suthers, I. M.

2011-12-01

Swarms of the salp Thalia democratica periodically occur off southeast Australia following the austral spring bloom of phytoplankton. In October 2008 a filament of upwelled water was advected south by the adjacent East Australian Current and formed a 30 km diameter cold-core eddy (CCE). The three-dimensional structure of a subsurface swarm of T. democratica within the eddy was examined using both oblique and vertical hauls and an optical plankton counter (OPC) deployed on a towed body. The CCE displayed distinct uplift of the nutricline and elevated fluorescence. Net samples show the zooplankton community was dominated by T. democratica, comprising 73%-88% of zooplankton abundance. The size distribution of T. democratica measured from net samples was 0.5-5 mm and was used to interpret the OPC transects, which showed the swarm formed a 15 km diameter disc located 20-40 m deep in the center of the eddy. The maximum salp abundance was in the pycnocline and coincided with the subsurface fluorescence maximum. The mean abundance of T. democratica size particles within the disc was 5003 individuals m-3 (ind. m-3), contrasted with only 604 ind. m-3 at the outer edge of the eddy. The vertically concentrated and horizontally constrained disc-shaped salp swarm occurred at the interface of salp-bearing inner shelf water and nutrient-rich upwelled water in a CCE. The physical processes that formed the CCE on the inshore edge of the western boundary current led to the largest density of salps recorded.

Evaluating Change in Behavioral Preferences: Multidimensional Scaling Single-Ideal Point Model

Science.gov (United States)

Ding, Cody

2016-01-01

The purpose of the article is to propose a multidimensional scaling single-ideal point model as a method to evaluate changes in individuals' preferences under the explicit methodological framework of behavioral preference assessment. One example is used to illustrate the approach for a clear idea of what this approach can accomplish.

Cerebellar clear cell ependymoma in a 10 year old girl

Energy Technology Data Exchange (ETDEWEB)

Thinzar Aye Nyein; Moon, Ah Rim; Hwang, Sun Chul; Hong, Hyun Sook; Lee, A Leum; Chang, Kee Hyun; Kim, Hee Kyung; Chin, Su Sie [Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of); Park, Ji Sang [Soonchunhyang University Gumi Hospital, Gumi (Korea, Republic of)

2016-01-15

Clear cell ependymoma (CCE) is a histological rare variant (1–5%) of ependymoma, which is distinguished from other histological subtypes by the presence of fusiform cells arrayed radially around small blood vessels. These alleged perivascular pseudorosettes are significant characteristic features of ependymomas. About 95% of infratentorial ependymomas are found in the fourth ventricle and the remainder occurs as cerebellopontine angle lesions. In previous reports, the cerebellum is found to be a rare location for ependymoma. In this study we report one case of CCE originating from the cerebellar hemisphere, showing unusual morphology on 3T MRI.

Conference Report: "Health Policy and Programs Evaluative Research for Social Change". An Ibero-American Symposium

Directory of Open Access Journals (Sweden)

Francisco Mercado-Martínez

2008-05-01

Full Text Available This is a report of the "Health Policy and Programs Evaluative Research for Social Change" Ibero-American Symposium held in Guadalajara, Mexico November 1-3, 2006. Attendees represented eight countries, and were associated with NGO's and academic and health services organizations. The most important themes included in the debates were the meaning of qualitative and evaluative health research for social change, the challenges of teaching for change, ethical challenges, and possibilities for making the findings of qualitative research available to different groups or stakeholders (users, policy makers, professionals, and the population as a whole. URN: urn:nbn:de:0114-fqs0802194

Development of climate change scenarios to evaluate the impacts of temperature change on the energy demand in south of Quebec

International Nuclear Information System (INIS)

Chamount, D.

2008-01-01

'Full text': In year 2000, Hydro-Quebec Distribution began to integrate temperature change in the planning of Quebec energy demand. With the evolution of knowledge in climate change science and the availability of larger ensemble of climate projections from GCMs (Global Climate Model), the methodology has progressively improved and uncertainties are now more efficiently taken into account. Inclusion of temperature evolution in the estimation of energy demand covers two issues : 1) the adjustment of climate normals as reference values and 2) integration of the climate change scenario in long term planning (horizon 2040). Recently, the analysis of an ensemble of climate simulations produced from 17 different GCMs forced by 3 emissions scenarios for a total of 39 projections, enabled these two aspects to be effectively addressed. Following the analysis the use of linear temperature increase on a monthly basis is recommended for the needs of addressing climate change impacts on energy demand. Higher slope values are obtained during winter while lower ones are present in summer. Heating and cooling degree days have then been calculated for an optimistic, median and pessimistic climate change scenario to evaluate economic impacts of temperature change on three energy sources: hydro-power, natural gas and heating oil. The evaluation was carried out taking into account not only the temperature change scenario but demographical and economical scenarios as well. Obviously, temperature increase will cause opposite effects for the winter and summer seasons (reducing energy demand for heating purpose during winter while increasing cooling demand during summer). However, comparing energy sources, combustibles might see a more important decrease than hydro-power. Overall, the net effect of temperature change on energy demand is quite small: a reduction of 2 to 3% is projected. (author)

Evaluation of CHANGE, an Involuntary Cognitive Program for High-Risk Inmates

Science.gov (United States)

Hogan, Nancy L.; Lambert, Eric G.; Barton-Bellessa, Shannon M.

2012-01-01

Prison violence is a major concern in most correctional institutions. One intervention frequently used to reduce violent behavior is cognitive therapy. An involuntary cognitive program at a Midwestern state prison was evaluated for its impact on official misconduct. A total of 213 inmates were randomly assigned to the treatment (CHANGE) group (n =…

Students' Evaluations about Climate Change

Science.gov (United States)

Lombardi, Doug; Brandt, Carol B.; Bickel, Elliot S.; Burg, Colin

2016-01-01

Scientists regularly evaluate alternative explanations of phenomena and solutions to problems. Students should similarly engage in critical evaluation when learning about scientific and engineering topics. However, students do not often demonstrate sophisticated evaluation skills in the classroom. The purpose of the present study was to…

Building capacity for change: evaluation of an organisation-wide leadership development program.

Science.gov (United States)

Schultz, Tim; Shoobridge, Jodie; Harvey, Gill; Carter, Libby; Kitson, Alison

2018-05-23

Objective. This study evaluated Leading 4 Change, a change leadership development program designed to support healthcare middle managers through a period of significant organisational change and enhance workplace resilience. Methods. A mixed methods evaluation was conducted within the program's framework of a quality improvement activity. Quantitative measures were participant responses (n=160) to online questionnaires, which were compared before and after the program, using an uncontrolled pre-post study design. Four questionnaires were used: Resilience @ Work, General Self-Efficacy, the 11-item Learning Organization Survey and organisational climate. Differences between the pre- and post-program periods were compared using linear mixed-effects models, incorporating repeated measures between 'pre' and 'post' periods. Qualitative data were obtained by interviewing four participants on three occasions during the program, and through text responses provided by participants during a presentation session after the program finished. Both interview data and textual data were subjected to thematic analysis. Results. Integration of data from quantitative and qualitative analyses generated three main findings: (1) participants were satisfied and engaged with the program, which met their learning objectives; (2) the program led to increased workplace resilience, in particular the ability to manage stress and self-efficacy for individuals; and (3) organisational learning perceptions were unchanged. Conclusion. Although conducted during a period of intense internal and external pressure, Leading 4 Change led to demonstrable effects. It effectively engaged middle managers across a health system. However, there was no evidence that the effect of the program extended beyond individual participants to their perceptions of their work environment as a learning organisation. What is known about the topic? Although much has been written about change management and change leadership

Protein (Viridiplantae): 145355221 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 436017:4609 distinct from photosynthetic electron transfer catalyst, CYC6, partial Ostreococcus lucimarinus CCE9901 RDLERNGVATKEDISNLIERGKGKMPGYGESCAPKGACTFGARLDAEEIDALATYVLDRAAVDW ...

49 CFR 40.297 - Does anyone have the authority to change a SAP's initial evaluation?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Does anyone have the authority to change a SAP's... the Return-to-Duty Process § 40.297 Does anyone have the authority to change a SAP's initial... managed-care provider, any service agent) may change in any way the SAP's evaluation or recommendations...

Value for money of changing healthcare services? Economic evaluation of quality improvement

Science.gov (United States)

Severens, J

2003-01-01



 There are many instances of perceived or real inefficiencies in health service delivery. Both healthcare providers and policy makers need to know the impact and cost of applying strategies to change the behaviour of individuals or organisations. Quality improvement or implementation research is concerned with evaluating the methods of behavioural change. Addressing inefficiencies in healthcare services raises a series of issues, beginning with how inefficiency itself should be defined. The basic concepts of cost analysis and economic evaluations are explained and a model for working through the economic issues of quality improvement is discussed. This model combines the costs and benefits of corrected inefficiency with the costs and degree of behavioural change achieved by a quality improvement method in the policy maker's locality. It shows why it may not always be cost effective for policy makers to address suboptimal behaviour. Both the interpretation of quality improvement research findings and their local application need careful consideration. The limited availability of applicable quality improvement research may make it difficult to provide robust advice on the value for money of many behavioural quality improvement strategies. PMID:14532369

Neurochemical–structural changes evaluation of brain in patients with obstructive sleep apnea syndrome

International Nuclear Information System (INIS)

Algin, Oktay; Gokalp, Gokhan; Ocakoglu, Gokhan; Ursavas, Ahmet; Taskapilioglu, Ozlem; Hakyemez, Bahattin

2012-01-01

Purpose: To evaluate neurochemical and structural changes in the patients with newly diagnosed obstructive sleep apnea syndrome (OSAS) by MR spectroscopy (MRS), T2 relaxometry, and diffusion weighted imaging (DWI). Material and methods: Following the acquisition of routine cranial MR, MRS, T2 relaxometry, and DWI images; spectroscopic metabolite ratios and DWI–T2 relaxometry findings of the thalami, hippocampi, frontal white matter (FWM) and frontal cortex of 24 OSAS patients and 9 controls were statistically compared. The relationship between two groups was evaluated with Mann–Whitney test. Results: Spectroscopic measurements in the frontal cortex and frontal white matter of the OSAS patients revealed significantly lower NAA/Cr ratios than those of the control group (P = 0.004 and P = 0.006, respectively). The measurements in the frontal white matter of the OSAS patients exhibited significantly lower NAA/Cho ratios compared with those of the control group (P = 0.005). Thalamic Cho/Cr ratios of the patient group were significantly higher than those of the control group (P = 0.002). In terms of the ADC–T2 relaxometry values, there was no significant relationship between the patient and the control groups (P > 0.05). Conclusion: MRS is a useful and non-invasive modality in showing neurochemical changes in various regions of the brain but our data does not show any change on diffusion weighting or T2 quantification in the OSAS group. DWI and T2 relaxometry appear to be not effective techniques to evaluate the brain structural changes of the patients with newly diagnosed OSAS.

Evaluation of physical activity web sites for use of behavior change theories.

Science.gov (United States)

Doshi, Amol; Patrick, Kevin; Sallis, James F; Calfas, Karen

2003-01-01

Physical activity (PA) Web sites were assessed for their use of behavior change theories, including constructs of the health belief model, Transtheoretical Model, social cognitive theory, and the theory of reasoned action and planned behavior. An evaluation template for assessing PA Web sites was developed, and content validity and interrater reliability were demonstrated. Two independent raters evaluated 24 PA Web sites. Web sites varied widely in application of theory-based constructs, ranging from 5 to 48 on a 100-point scale. The most common intervention strategies were general information, social support, and realistic goal areas. Coverage of theory-based strategies was low, varying from 26% for social cognitive theory to 39% for health belief model. Overall, PA Web sites provided little assessment, feedback, or individually tailored assistance for users. They were unable to substantially tailor the on-line experience for users at different stages of change or different demographic characteristics.

Squared Euclidean distance: a statistical test to evaluate plant community change

Science.gov (United States)

Raymond D. Ratliff; Sylvia R. Mori

1993-01-01

The concepts and a procedure for evaluating plant community change using the squared Euclidean distance (SED) resemblance function are described. Analyses are based on the concept that Euclidean distances constitute a sample from a population of distances between sampling units (SUs) for a specific number of times and SUs. With different times, the distances will be...

"Expectations to Change" ((E2C): A Participatory Method for Facilitating Stakeholder Engagement with Evaluation Findings

Science.gov (United States)

Adams, Adrienne E.; Nnawulezi, Nkiru A.; Vandenberg, Lela

2015-01-01

From a utilization-focused evaluation perspective, the success of an evaluation is rooted in the extent to which the evaluation was used by stakeholders. This paper details the "Expectations to Change" (E2C) process, an interactive, workshop-based method designed to engage primary users with their evaluation findings as a means of…

Re-evaluating occupational heat stress in a changing climate.

Science.gov (United States)

Spector, June T; Sheffield, Perry E

2014-10-01

The potential consequences of occupational heat stress in a changing climate on workers, workplaces, and global economies are substantial. Occupational heat stress risk is projected to become particularly high in middle- and low-income tropical and subtropical regions, where optimal controls may not be readily available. This commentary presents occupational heat stress in the context of climate change, reviews its impacts, and reflects on implications for heat stress assessment and control. Future efforts should address limitations of existing heat stress assessment methods and generate economical, practical, and universal approaches that can incorporate data of varying levels of detail, depending on resources. Validation of these methods should be performed in a wider variety of environments, and data should be collected and analyzed centrally for both local and large-scale hazard assessments and to guide heat stress adaptation planning. Heat stress standards should take into account variability in worker acclimatization, other vulnerabilities, and workplace resources. The effectiveness of controls that are feasible and acceptable should be evaluated. Exposure scientists are needed, in collaboration with experts in other areas, to effectively prevent and control occupational heat stress in a changing climate. © The Author 2014. Published by Oxford University Press on behalf of the British Occupational Hygiene Society.

Right-Wing Authoritarianism Predicts weakened Attitude Change in an Evaluative Counter-conditioning Paradigm

OpenAIRE

Beffara, Brice; Mermillod, Martial; Mierop, Adrien; Bret, Amélie; Corneille, Olivier

2017-01-01

RWA is associated with higher social prejudice. It is unclear, however, (i) whether RWA plays a role in attitude acquisition or attitude change (or both), and (ii) whether it influences attitudes unrelated to in/outgroup concerns. We relied on an evaluative conditioning-then-counter-conditioning paradigm simulating prejudice formation and change to examine this question. Neutral fictive group exemplars were first conditioned positively or negatively (attitude learning) and then counter-condit...

EVALUATION OF EARLY ISCHEMIC CHANGES IN STROKE PATIENTS TREATED WITH THROMBOLYTIC THERAPY

OpenAIRE

Kolevski Goran; Korneti-Pekevska Kostandina

2016-01-01

Introduction:The aim of this study is to evaluate early brain ischemic changes on CT scan in stroke patients in correlation with the clinical outcome, as well as to evaluate if there is prognostic and predictive features that can be used. Patients and methods: We examined 20 patients with acute ischemic stroke, from which 12 were male and 8 were female, at the age from 47 to 76 years. Results: The hyperdense medial artery (HMA) sign was present in 10 (50%) patients. Concerning the ASPECTS s...

Suppressor screen and phenotype analyses revealed an emerging role of the Monofunctional peroxisomal enoyl-CoA hydratase 2 in compensated cell enlargement

Directory of Open Access Journals (Sweden)

Mana eKatano

2016-02-01

Full Text Available Efficient use of seed nutrient reserves is crucial for germination and establishment of plant seedlings. Mobilizing seed oil reserves in Arabidopsis involves β-oxidation, the glyoxylate cycle, and gluconeogenesis, which provide essential energy and the carbon skeletons needed to sustain seedling growth until photoautotrophy is acquired. We demonstrated that H+-PPase activity is required for gluconeogenesis. Lack of H+-PPase in fugu5 mutants increases cytosolic pyrophosphate (PPi levels, which partially reduces sucrose synthesis de novo and inhibits cell division. In contrast, post-mitotic cell expansion in cotyledons was unusually enhanced, a phenotype called compensation. Therefore, it appears that PPi inhibits several cellular functions, including cell cycling, to trigger compensated cell enlargement (CCE. Here, we mutagenized fugu5-1 seeds with 12C6+ heavy-ion irradiation and screened mutations that restrain CCE to gain insight into the genetic pathway(s involved in CCE. We isolated A#3-1, in which cell size was severely reduced, but cell number remained similar to that of original fugu5-1. Moreover, cell number decreased in A#3-1 single mutant (A#3-1sm, similar to that of fugu5-1, but cell size was almost equal to that of the wild type. Surprisingly, A#3-1 mutation did not affect CCE in other compensation exhibiting mutant backgrounds, such as an3-4 and fugu2-1/fas1-6. Subsequent map-based cloning combined with genome sequencing and HRM curve analysis identified enoyl-CoA hydratase 2 (ECH2 as the causal gene of A#3-1. The above phenotypes were consistently observed in the ech2-1 allele and supplying sucrose restored the morphological and cellular phenotypes in fugu5-1, ech2-1, A#3-1sm, fugu5-1 ech2-1 and A#3-1;fugu5-1. Taken together, these results suggest that defects in either H+-PPase or ECH2 compromise cell proliferation due to defects in mobilizing stored lipids. In contrast, ECH2 alone likely promotes CCE during the post-mitotic cell

Sustaining Rocky Mountain landscapes: Science, policy and management for the Crown of the Continent ecosystem

Science.gov (United States)

Prato, Tony; Fagre, Daniel B.

2007-01-01

Prato and Fagre offer the first systematic, multi-disciplinary assessment of the challenges involved in managing the Crown of the Continent Ecosystem ( CCE), an area of the Rocky Mountains that includes northwestern Montana, southwestern Alberta, and southeastern British Columbia. The spectacular landscapes, extensive recreational options, and broad employment opportunities of the CCE have made it one of the fastest growing regions in the United States and Canada, and have lead to a shift in its economic base from extractive resource industries to service-oriented recreation and tourism industries. In the process, however, the amenities and attributes that draw people to this “New West” are under threat. Pastoral scenes are disappearing as agricultural lands and other open spaces are converted to residential uses, biodiversity is endangered by the fragmentation of fish and wildlife habitats, and many areas are experiencing a decline in air and water quality. Sustaining Rocky Mountain Landscapes provides a scientific basis for communities to develop policies for managing the growth and economic transformation of the CCE without sacrificing the quality of life and environment for which the land is renowned. This forthcoming edited volume focuses on five aspects of sustaining mountain landscapes in the CCE and similar regions in the Rocky Mountains. The five aspects are: 1) how social, economic, demo graphic and environmental forces are transforming ecosystem structure and function, 2) trends in use and conditions for human and environmental resources, 3) activating science, policy and education to enhance sustainable landscape management, 4) challenges to sustainable management of public and private lands, and 5) future prospects for achieving sustainable landscapes.

Evaluating Process Quality Based on Change Request Data - An Empirical Study of the Eclipse Project

Science.gov (United States)

Schackmann, Holger; Schaefer, Henning; Lichter, Horst

The information routinely collected in change request management systems contains valuable information for monitoring of the process quality. However this data is currently utilized in a very limited way. This paper presents an empirical study of the process quality in the product portfolio of the Eclipse project. It is based on a systematic approach for the evaluation of process quality characteristics using change request data. Results of the study offer insights into the development process of Eclipse. Moreover the study allows assessing applicability and limitations of the proposed approach for the evaluation of process quality.

The evaluation of behavioural changes in brain-injured patients: SOFMER recommendations for clinical practice.

Science.gov (United States)

Prouteau, A; Stéfan, A; Wiart, L; Mazaux, J M

2016-02-01

Behavioural changes are the main cause of difficulties in interpersonal relationships and social integration among traumatic brain injury (TBI) patients. The Société française de médecine physique et réadaptation (SOFMER) decided to develop recommendations for the treatment and care provision for these problem under the auspices of the French health authority, the Haute Autorité de la santé (HAS). Assessment of behaviour is essential to describe, understand and define situations, assess any change and suggest lines for intervention. The relationship of these behavioural changes with the brain lesion is likewise of crucial importance in legal and forensic expertise. Using a literature review and expert opinions, the aim was to define the optimal conditions for the collection of data on behavioural changes in individuals having sustained brain trauma, to identify the situations in which they arise, to review the instruments available, and to suggest lines of intervention. A literature search identified 981 articles, among which 122 on the target subject were selected and analysed in detail and confronted with the experience of professionals and user representatives. A first draft of the recommendations was produced by the working group, and then submitted to a review group for opinions and complements. The literature on this subject is heterogeneous, and presents low levels of evidence. No article enabled the development of recommendations above the "expert opinion" level. After prior clarification of the aims of the evaluation, it is recommended first to carefully describe the changes in behaviour, from patient and third-person narratives, and where possible from direct observations. The information enabling the description of the phenomena occurring should be collected by different individuals (multi-source evaluation): the patient, his or her close circle, and professionals with different training backgrounds (multidisciplinary evaluation). The analysis of

Ameliorative Effect of Cactus (Opuntia ficus indica Extract on Lithium-Induced Nephrocardiotoxicity: A Biochemical and Histopathological Study

Directory of Open Access Journals (Sweden)

Anouar ben Saad

2017-01-01

Full Text Available Opuntia ficus indica (family Cactaceae is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days. Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect.

Ameliorative Effect of Cactus (Opuntia ficus indica) Extract on Lithium-Induced Nephrocardiotoxicity: A Biochemical and Histopathological Study.

Science.gov (United States)

Saad, Anouar Ben; Rjeibi, Ilhem; Ncib, Sana; Zouari, Nacim; Zourgui, Lazhar

2017-01-01

Opuntia ficus indica (family Cactaceae) is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE) against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days). Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect.

Residential energy efficiency: Progress since 1973 and future potential

Science.gov (United States)

Rosenfeld, Arthur H.

1985-11-01

Today's 85 million U.S. homes use 100 billion of fuel and electricity (1150/home). If their energy intensity (resource energy/ft2) were still frozen at 1973 levels, they would use 18% more. With well-insulated houses, need for space heat is vanishing. Superinsulated Saskatchewan homes spend annually only 270 for space heat, 150 for water heat, and 400 for appliances, yet they cost only 2000±1000 more than conventional new homes. The concept of Cost of Conserved Energy (CCE) is used to rank conservation technologies for existing and new homes and appliances, and to develop supply curves of conserved energy and a least cost scenario. Calculations are calibrated with the BECA and other data bases. By limiting investments in efficiency to those whose CCE is less than current fuel and electricity prices, the potential residential plus commercial energy use in 2000 AD drops to half of that estimated by DOE, and the number of power plants needed drops by 200. For the whole buildings sector, potential savings by 2000 are 8 Mbod (worth 50B/year), at an average CCE of 10/barrel.

Ameliorative Effect of Cactus (Opuntia ficus indica) Extract on Lithium-Induced Nephrocardiotoxicity: A Biochemical and Histopathological Study

Science.gov (United States)

Ncib, Sana

2017-01-01

Opuntia ficus indica (family Cactaceae) is used in the treatment of a variety of conditions including metal-induced toxicity. The study reports the protective effects of Opuntia ficus indica (CCE) against lithium carbonate-induced toxicity in rats. Nephrocardiotoxicity was induced in male Wistar rats by single dose of lithium carbonate (25 mg/kg b.w twice daily for 30 days). Aqueous extract of Opuntia ficus indica was administered at the dose of 100 mg/kg of b.w by gavage for 60 days. Obtained results revealed that administration of lithium carbonate caused a significant increase in serum creatinine, uric acid, and urea levels. Additionally, a significant decrease in the level of renal and cardiac SOD, CAT, and GPx activities was associated with a significant increase of MDA levels in lithium carbonate group more than those of the control. However, the treatment of experimental rats with CCE prevented these alterations and maintained the antioxidant status. The histopathological observations supported the biochemical evidences of nephrocardioprotection. CCE supplementation could protect against lithium carbonate-induced renal and cardiac injuries in rats, plausibly by the upregulation of antioxidant enzymes and inhibition of MDA to confer the protective effect. PMID:29376078

Evaluating organizational change in health care: the patient-centered hospital model.

Science.gov (United States)

Fiorio, Carlo V; Gorli, Mara; Verzillo, Stefano

2018-02-08

An increasing number of hospitals react to recent demographic, epidemiological and managerial challenges moving from a traditional organizational model to a Patient-Centered (PC) hospital model. Although the theoretical managerial literature on the PC hospital model is vast, quantitative evaluations of the performance of hospitals that moved from the traditional to the PC organizational structure is scarce. However, quantitative analysis of effects of managerial changes is important and can provide additional argument in support of innovation. We take advantage of a quasi-experimental setting and of a unique administrative data set on the population of hospital discharge charts (HDCs) over a period of 9 years of Lombardy, the richest and one of the most populated region of Italy. During this period three important hospitals switched to the PC model in 2010, whereas all the others remained with the functional organizational model. This allowed us to develop a difference-in-difference analysis of some selected measures of efficiency and effectiveness for PC hospitals focusing on the "between-variability" of the 25 major diagnostic categories (MDCs) in each hospital and estimating a difference-in-difference model. We contribute to the literature that addresses the evaluation of healthcare and hospital change by providing a quantitative estimation of efficiency and effectiveness changes following to the implementation of the PC hospital model. Results show that both efficiency and effectiveness have significantly increased in the average MDC of PC hospitals, thus confirming the need for policy makers to invest in new organizational models close to the principles of PC hospital structures. Although an organizational change towards the PC model can be a costly process, implying a rebalancing of responsibilities and power among hospital personnel (e.g. medical and nursing staff), our results suggest that changing towards a PC model can be worthwhile in terms of both

Comparison between two methods to evaluate temperature changes produced by composite light curing units and polymerization techniques.

Science.gov (United States)

Loureiro, F H F; Consani, S; Guiraldo, R D; Consani, R L X; Berger, S B; Carvalho, R V; Correr-Sobrinho, L; Sinhoreti, M A C

2011-10-01

This study evaluated the temperature change into the pulp chamber during the light curing of composite resin by direct (bovine tooth) and indirect (matrix) methods. Direct method: fifty standardized cavities (2x2x2 mm) were prepared in bovine incisors, which were randomly assigned to evaluation of the temperature changes in the pulp chamber. Indirect method: temperature changes were evaluated through a dentine slice of 1.0 mm thickness in a elastomer cubic mold (2x2x2 mm). Filtek Z250 composite resin (3M/ESPE) was photo-activated using three light curing units: quartz-tungsten-halogen (QTH) by continuous, soft-start or intermittent light modulations; light emitting diode (LED); and plasma arc-curing (PAC). Ten groups (N.=10) were established according to technique evaluation and photo-activation methods. All experiments were carried out in a controlled environment (37 °C and 50 ± 10% relative humidity). The temperature changes were recorded using a digital thermometer attached to a type-K thermocouple in contact with the dentin slice (indirect method) or in contact with the axial wall (dentin) of pulp chamber (direct method). The results were submitted to ANOVA and Tukey's test (α=0.05). Temperature changes were statistically higher for the matrix indirect method (2.56 ºC) than bovine teeth direct method (1.17ºC). The change temperature was statistically higher for the PAC (1.77 ºC) when compared to other photo-activation modes in bovine teeth direct method. The two methods of temperature evaluation were different, however indirect method detected the higher temperature increase. Higher energy density arising from the light curing units and polymerization techniques promoted higher temperature increase.

Charge collection efficiency of irradiated silicon detector operated at cryogenic temperatures

International Nuclear Information System (INIS)

Borer, K.; Janos, S.; Palmieri, V.G.; Dezillie, B.; Li, Z.; Collins, P.; Niinikoski, T.O.; Lourenco, C.; Sonderegger, P.; Borchi, E.; Bruzzi, M.; Pirollo, S.; Granata, V.; Pagano, S.; Chapuy, S.; Dimcovski, Z.; Grigoriev, E.; Bell, W.; Devine, S.R.H.; O'Shea, V.; Smith, K.; Berglund, P.; Boer, W. de; Hauler, F.; Heising, S.; Jungermann, L.; Casagrande, L.; Cindro, V.; Mikuz, M.; Zavartanik, M.; Via, C. da; Esposito, A.; Konorov, I.; Paul, S.; Schmitt, L.; Buontempo, S.; D'Ambrosio, N.; Pagano, S.; Ruggiero, G.; Eremin, V.; Verbitskaya, E.

2000-01-01

The charge collection efficiency (CCE) of heavily irradiated silicon diode detectors was investigated at temperatures between 77 and 200 K. The CCE was found to depend on the radiation dose, bias voltage value and history, temperature, and bias current generated by light. The detector irradiated to the highest fluence 2x10 15 n/cm 2 yields a MIP signal of at least 15000 e - both at 250 V forward bias voltage, and at 250 V reverse bias voltage in the presence of a light-generated current. The 'Lazarus effect' was thus shown to extend to fluences at least ten times higher than was previously studied

Mechanical and morphological evaluation of age-related changes in the Beagle spine

International Nuclear Information System (INIS)

Gillett, N.A.; Gerlach, R.; Cassidy, J.; Brown, S.

1986-01-01

Age-related changes were evaluated in the spines of Beagle dogs by biomechanical testing, radiology and pathology. Thirty age-matched healthy Beagle dogs were divided into five groups having mean ages of 2, 5, 8, 11, and 14 years. Spinal radiographs of anesthetized dogs were taken prior to euthanasia and on defleshed pines following necropsy. Cervical, thoracic, and lumbar segments were tested in compression to calculate peak stress, peak strain, and elastic modulus. Adjacent spinal segments were examined histologically. Histological evidence of the disc degeneration and changes in the mechanical properties of the intervertebral disc joint preceded radiographical evidence of spondylosis. Changes in the mechanical properties of the disc space were probably a result of the disc degeneration rather than the spondylytic lesions. 3 references, 4 figures

Methods for the economic evaluation of changes to the organisation and delivery of health services: principal challenges and recommendations.

Science.gov (United States)

Meacock, Rachel

2018-04-20

There is a requirement for economic evaluation of health technologies seeking public funding across Europe. Changes to the organisation and delivery of health services, including changes to health policy, are not covered by such appraisals. These changes also have consequences for National Health Service (NHS) funds, yet undergo no mandatory cost-effectiveness assessment. The focus on health technologies may have occurred because larger-scale service changes pose more complex challenges to evaluators. This paper discusses the principal challenges faced when performing economic evaluations of changes to the organisation and delivery of health services and provides recommendations for overcoming them. The five principal challenges identified are as follows: undertaking ex-ante evaluation; evaluating impacts in terms of quality-adjusted life years; assessing costs and opportunity costs; accounting for spillover effects; and generalisability. Of these challenges, methods for estimating the impact on costs and quality-adjusted life years are those most in need of development. Methods are available for ex-ante evaluation, assessing opportunity costs and examining generalisability. However, these are rarely applied in practice. The general principles of assessing the cost-effectiveness of interventions should be applied to all NHS spending, not just that involving health technologies. Advancements in this area have the potential to improve the allocation of scarce NHS resources.

A new method to determine the water activity and the net isosteric heats of sorption for low moisture foods at elevated temperatures.

Science.gov (United States)

Tadapaneni, Ravi Kiran; Yang, Ren; Carter, Brady; Tang, Juming

2017-12-01

In recent years, research studies have shown that the thermal resistance of foodborne pathogens in the low moisture foods is greatly influenced by the water activity (a w ) at temperatures relevant to thermal treatments for pathogen control. Yet, there has been a lack of an effective method for accurate measurement of a w at those temperatures. Thus, the main aim of this study was to evaluate a new method for measuring a w of food samples at elevated temperatures. An improved thermal cell with a relative humidity and temperature sensor was used to measure the a w of the three different food samples, namely, organic wheat flour, almond flour, and non-fat milk powder, over the temperature range between 20 and 80°C. For a constant moisture content, the a w data was used to estimate the net isosteric heat of sorption (q st ). The q st values were then used in the Clausius Clapeyron equation (CCE) equation to estimate the moisture sorption isotherm for all test food samples at different temperatures. For all the tested samples of any fixed moisture content, a w value generally increased with the temperature. The energy for sorption decreased with increasing moisture content. With the experimentally determined q st value, CCE describes well about the changes in a w of the food samples between 20 and 80°C. This study presents a method to obtain a w of a food sample for a specific moisture content at different temperatures which could be extended to obtain q st values for different moisture contents and hence, the moisture sorption isotherm of a food sample at different temperatures. Copyright © 2017 Elsevier Ltd. All rights reserved.

Explaining Employees' Evaluations of Organizational Change with the Job-Demands Resources Model

Science.gov (United States)

van Emmerik, I. J. Hetty; Bakker, Arnold B.; Euwema, Martin C.

2009-01-01

Purpose: Departing from the Job Demands-Resources (JD-R) model, the paper examined the relationship between job demands and resources on the one hand, and employees' evaluations of organizational change on the other hand. Design/methodology/approach: Participants were 818 faculty members within six faculties of a Dutch university. Data were…

Long-term Satellite NDVI Data Sets: Evaluating Their Ability to Detect Ecosystem Functional Changes in South America.

Science.gov (United States)

Baldi, Germán; Nosetto, Marcelo D; Aragón, Roxana; Aversa, Fernando; Paruelo, José M; Jobbágy, Esteban G

2008-09-03

In the last decades, South American ecosystems underwent important functional modifications due to climate alterations and direct human intervention on land use and land cover. Among remotely sensed data sets, NOAA-AVHRR "Normalized Difference Vegetation Index" (NDVI) represents one of the most powerful tools to evaluate these changes thanks to their extended temporal coverage. In this paper we explored the possibilities and limitations of three commonly used NOAA-AVHRR NDVI series (PAL, GIMMS and FASIR) to detect ecosystem functional changes in the South American continent. We performed pixel-based linear regressions for four NDVI variables (average annual, maximum annual, minimum annual and intra-annual coefficient of variation) for the 1982-1999 period and (1) analyzed the convergences and divergences of significant multi-annual trends identified across all series, (2) explored the degree of aggregation of the trends using the O-ring statistic, and (3) evaluated observed trends using independent information on ecosystem functional changes in five focal regions. Several differences arose in terms of the patterns of change (the sign, localization and total number of pixels with changes). FASIR presented the highest proportion of changing pixels (32.7%) and GIMMS the lowest (16.2%). PAL and FASIR data sets showed the highest agreement, with a convergence of detected trends on 71.2% of the pixels. Even though positive and negative changes showed substantial spatial aggregation, important differences in the scale of aggregation emerged among the series, with GIMMS showing the smaller scale (≤11 pixels). The independent evaluations suggest higher accuracy in the detection of ecosystem changes among PAL and FASIR series than with GIMMS, as they detected trends that match expected shifts. In fact, this last series eliminated most of the long term patterns over the continent. For example, in the "Eastern Paraguay" and "Uruguay River margins" focal regions, the

Evaluating the Impacts of Climate Change on Soil Erosion Rates in Central Mexico

Directory of Open Access Journals (Sweden)

Santos Martínez-Santiago

2017-07-01

Full Text Available Although water-eroded soil (WES resulting from human activities has been recognized as the leading global cause of land degradation, the soil erosion risks from climate change are not clear. Studies have reported that WES is the second most significant cause of soil loss in Mexico, and its future trajectory has not been sufficiently evaluated. The aims of this study are to 1 determine the impacts of climate change on WES and its distribution for the State of Aguascalientes, Mexico, and to 2 compare the present and future soil loss rates for the study unit (SU. The State of Aguascalientes is located in the “Region del Bajio.” The impact of climate change on WES was evaluated using the near-future divided world scenario (A2 presented in the IPCC Fourth Assessment Report. Daily temperature and precipitation data from 18 weather stations were downscaled to model historic laminar water erosion (HLWE and changes therein in the A2 near-future scenario for 2010–2039 (LWEScA2. Due to future changes in mean annual rainfall (MAR levels, a change in the LWEScA2 of between 1.6 and 8.9% could result in average soil losses up to 475.4 t ha-1 yr-1, representing a loss of slightly more than a 30-mm layer of mountain soil per year. The risk zones, classified as class 4 for LWE, are located to western of the State in part of municipalities of Calvillo, Jesus María, San José de Gracia y Cosio, where there are typical hills and falls with soil very sensitive to rain erosion.

A Comparison of Autonomous Regulation and Negative Self-Evaluative Emotions as Predictors of Smoking Behavior Change among College Students

Science.gov (United States)

Lee, Hyoung S.; Catley, Delwyn; Harris, Kari Jo

2011-01-01

This study compared autonomous self-regulation and negative self-evaluative emotions as predictors of smoking behavior change in college student smokers (N=303) in a smoking cessation intervention study. Although the two constructs were moderately correlated, latent growth curve modeling revealed that only autonomous regulation, but not negative self-evaluative emotions, was negatively related to the number of days smoked. Results suggest that the two variables tap different aspects of motivation to change smoking behaviors, and that autonomous regulation predicts smoking behavior change better than negative self-evaluative emotions. PMID:21911436

A comparison of autonomous regulation and negative self-evaluative emotions as predictors of smoking behavior change among college students.

Science.gov (United States)

Lee, Hyoung S; Catley, Delwyn; Harris, Kari Jo

2012-05-01

This study compared autonomous self-regulation and negative self-evaluative emotions as predictors of smoking behavior change in college student smokers (N = 303) in a smoking cessation intervention study. Although the two constructs were moderately correlated, latent growth curve modeling revealed that only autonomous regulation, but not negative self-evaluative emotions, was negatively related to the number of days smoked. Results suggest that the two variables tap different aspects of motivation to change smoking behaviors, and that autonomous regulation predicts smoking behavior change better than negative self-evaluative emotions.

Performance evaluation on solar still integrated with nano-composite phase change materials

International Nuclear Information System (INIS)

Rajasekhar, G.; Eswaramoorthy, M.

2015-01-01

This paper communicates the performance evaluation of single slope solar still integrated with nano-composite phase change materials and compare with the experimental results of with and without phase change materials. A solar still with 1 m"2 surface area is developed with non-selective coating of absorber sheet with the provision of thermal energy storage materials. The solar still is tested on typical days with and without thermal energy storage materials. It is found that from the experimental studies that nano-materials (Al_2O_3) dispersed in paraffin wax is giving better cumulative yield of distillate than paraffin wax alone and without paraffin wax thermal storage. The daily efficiency of the solar still is computed for solar still with nano-composite phase change materials is 45% and solar still paraffin wax alone thermal storage is 40% and solar still without any thermal storage is 38%. It is concluded from the experimental studies; solar still integrated with nano-composite phase change materials gives better performance than with and without phase change material alone. (authors)

Evaluating change in virtual reality adoption for brain injury rehabilitation following knowledge translation.

Science.gov (United States)

Glegg, Stephanie M N; Holsti, Liisa; Stanton, Sue; Hanna, Steven; Velikonja, Diana; Ansley, Barbara; Sartor, Denise; Brum, Christine

2017-04-01

To evaluate the impact of knowledge translation (KT) on factors influencing virtual reality (VR) adoption and to identify support needs of therapists. Intervention will be associated with improvements in therapists' perceived ease of use and self-efficacy, and an associated increase in intentions to use VR. Single group mixed-methods pre-test-post-test evaluation of convenience sample of physical, occupational and rehabilitation therapists (n=37) from two brain injury rehabilitation centres. ADOPT-VR administered pre/post KT intervention, consisting of interactive education, clinical manual, technical and clinical support. Increases in perceived ease of use (p=0.000) and self-efficacy (p=0.001), but not behavioural intention to use VR (p=0.158) were found following KT, along with decreases in the frequency of perceived barriers. Post-test changes in the frequency and nature of perceived facilitators and barriers were evident, with increased emphasis on peer influence, organisational-level supports and client factors. Additional support needs were related to clinical reasoning, treatment programme development, technology selection and troubleshooting. KT strategies hold potential for targeting therapists' perceptions of low self-efficacy and ease of use of this technology. Changes in perceived barriers, facilitators and support needs at post-test demonstrated support for repeated evaluation and multi-phased training initiatives to address therapists' needs over time. Implications for Rehabilitation Therapists' learning and support needs in integrating virtual reality extend beyond technical proficiency to include clinical decision-making and application competencies spanning the entire rehabilitation process. Phased, multi-faceted strategies may be valuable in addressing therapists' changing needs as they progress from novice to experienced virtual reality users. The ADOPT-VR is a sensitive measure to re-evaluate the personal, social, environmental, technology

Age-related changes in normal adult pancreas: MR imaging evaluation

International Nuclear Information System (INIS)

Sato, Tomohiro; Ito, Katsuyoshi; Tamada, Tsutomu; Sone, Teruki; Noda, Yasufumi; Higaki, Atsushi; Kanki, Akihiko; Tanimoto, Daigo; Higashi, Hiroki

2012-01-01

Objective: To investigate age-related changes in normal adult pancreas as identified by magnetic resonance imaging (MRI). Materials and methods: We examined 115 patients without pancreatic diseases (21–90 years) who underwent upper abdominal MRI to evaluate the normal pancreatic MRI findings related to aging. The parameters examined were the pancreatic anteroposterior (AP) diameter, pancreatic lobulation, pancreatic signal intensity (SI), depiction of the main pancreatic duct (MPD), grade of the visual SI decrease on the opposed-phase T1-weighted images compared with in-phase images, and enhancement effect of the pancreas in the arterial phase of dynamic imaging. Results: The pancreatic AP diameter significantly reduced (head, p = 0.0172; body, p = 0.0007; tail, p < 0.0001), and lobulation (p < 0.0001) and parenchymal fatty change (p < 0.0001) became more evident with aging. No significant correlation was observed between aging and pancreatic SI, however the SI on the in-phase T1-weighted images tended to decrease with aging. No significant correlation was observed between aging and the depiction of the MPD as well as aging and contrast enhancement. Conclusion: MRI findings of pancreatic atrophy, lobulation, and fatty degeneration are characteristic changes related to aging, and it is necessary to recognize these changes in the interpretation of abdominal MRI in patients with and without pancreatic disease

Changing approaches of prosecutors towards juvenile repeated sex-offenders: A Bayesian evaluation.

Science.gov (United States)

Bandyopadhyay, Dipankar; Sinha, Debajyoti; Lipsitz, Stuart; Letourneau, Elizabeth

2010-06-01

Existing state-wide data bases on prosecutors' decisions about juvenile offenders are important, yet often un-explored resources for understanding changes in patterns of judicial decisions over time. We investigate the extent and nature of change in judicial behavior towards juveniles following the enactment of a new set of mandatory registration policies between 1992 and 1996 via analyzing the data on prosecutors' decisions of moving forward for youths repeatedly charged with sexual violence in South Carolina. We use a novel extension of random effects logistic regression model for longitudinal binary data via incorporating an unknown change-point year. For convenient physical interpretation, our models allow the proportional odds interpretation of effects of the explanatory variables and the change-point year with and without conditioning on the youth-specific random effects. As a consequence, the effects of the unknown change-point year and other factors can be interpreted as changes in both within youth and population averaged odds of moving forward. Using a Bayesian paradigm, we consider various prior opinions about the unknown year of the change in the pattern of prosecutors' decision. Based on the available data, we make posteriori conclusions about whether a change-point has occurred between 1992 and 1996 (inclusive), evaluate the degree of confidence about the year of change-point, estimate the magnitude of the effects of the change-point and other factors, and investigate other provocative questions about patterns of prosecutors' decisions over time.

Persuasion Model and Its Evaluation Based on Positive Change Degree of Agent Emotion

Science.gov (United States)

Jinghua, Wu; Wenguang, Lu; Hailiang, Meng

For it can meet needs of negotiation among organizations take place in different time and place, and for it can make its course more rationality and result more ideal, persuasion based on agent can improve cooperation among organizations well. Integrated emotion change in agent persuasion can further bring agent advantage of artificial intelligence into play. Emotion of agent persuasion is classified, and the concept of positive change degree is given. Based on this, persuasion model based on positive change degree of agent emotion is constructed, which is explained clearly through an example. Finally, the method of relative evaluation is given, which is also verified through a calculation example.

Learning to Like Exercising: Evaluative Conditioning Changes Automatic Evaluations of Exercising and Influences Subsequent Exercising Behavior.

Science.gov (United States)

Antoniewicz, Franziska; Brand, Ralf

2016-04-01

This multistudy report used an experimental approach to alter automatic evaluations of exercise (AEE). First, we investigated the plasticity of AEE (study 1). A computerized evaluative conditioning task was developed that altered the AEE of participants in two experimental groups (acquisition of positive/negative associations involving exercising) and a control group (η2 part. = .11). Second, we examined connections between changes in AEE and subsequent exercise behavior (chosen intensity on a bike ergometer; study 2) in individuals that were placed in groups according to their baseline AEE. Group differences in exercise behavior were detected (η2 part. = .29). The effect was driven by the performance of the group with preexisting negative AEE that acquired more positive associations. This illustrates the effect of altered AEE on subsequent exercise behavior and the potential of AEE as a target for exercise intervention.

Evaluation of the Knowledge and Attitude Changes of Mothers in Neonatal Care

Directory of Open Access Journals (Sweden)

Şahin Hamilçıkan

2017-06-01

Full Text Available Aim: The aim was to determine the initial knowledge of mothers about neonatal care and evaluate their knowledge, care and attitude changes following individual education. Materials and Methods: Questionnaire forms designed on the subject of infant care and nutrition were given to mothers right after delivery. Before being discharged they were informed by the doctor and breastfeeding nurse about nutrition, infant care, and the most common mistakes. These forms were reapplied on the 15th and 30th days in neonatal polyclinic controls and the changes were evaluated. The correct information was repeated to the mothers who were detected to have misinformation and wrong attitudes in the evaluations in each form application period. Results: A total of 100 mothers and their infants were included in the study. No difference was determined in the nutrition rates of infants with food other than breast milk on the first day, 15th and 30th days. However, the breastfeeding rates obtained were higher on the 30th day than on the 15th, with an interval of two hours, and in general breastfeeding rates were low on the 15th and 30th days. The rates of bathing the infants with and without a bathtub net were determined to be high on the 15th and 30th days. The change in the infants’ sleeping positions, the place of sleep, and the presence of rails/guards around the crib on the 15th and 30th days were not found to be significant compared to the 1st day. There was a significant increase in the umbilical care rates on the 15th and 30th days. The increase in washing the clothes of the infants with soap powder, and the decrease in swaddling after the education were found to be significant. Furthermore, it was determined that the mothers received infant care information more frequently from the healthcare organisation on the 15th and 30th days compared to the 1st day. The highest correlation between the maternal education level and the post-education knowledge and

Performance Based Evaluation of Concrete Strength under Various Curing Conditions to Investigate Climate Change Effects

Directory of Open Access Journals (Sweden)

Tae-Kyun Kim

2015-07-01

Full Text Available Recently, the manifestation of global warming-induced climate change has been observed through super typhoons, heavy snowfalls, torrential rains, and extended heat waves. These climate changes have been occurring all over the world and natural disasters have caused severe damage and deterioration of concrete structures and infrastructure. In an effort to deal with these problems due to extreme and abnormal climate changes, studies have been conducted to develop construction technologies and design guidelines. Nevertheless, study results applicable to construction sites continue to be ineffective and insufficient. Therefore, this study proposes ways to cope with climate change by considering the effect of concrete curing condition variations on concrete material performance. More specifically, the 3-, 7- and 28-day compressive and split tensile strength properties of concrete mix cured under various climatic factors including temperature, relative humidity, wind speed, and sunlight exposure time were evaluated to determine whether the concrete meets the current design requirements. Thereafter, a performance based evaluation (PBE was performed using satisfaction probabilities based on the test values to understand the problems associated with the current mix proportion design practice and to identify countermeasures to deal with climate change-induced curing conditions.

Evaluation of inventory change report (ICR) in 2008/2009 - 2012/2013 in MBA.RI-B

International Nuclear Information System (INIS)

Agustinus Suprijanto; Suratno; Sigit Pramana

2013-01-01

Evaluation has been performed for Inventory Change Report (ICR) in 2008/2009 - 2012/2013 in MBA.RI-B (MBA = Material Balance Area) (RI-B = Center for Accelerator and Material Process Technology). The evaluation performed on the inventory change report of nuclear material document. Changes in inventories occur when there is acceptance or shipment of nuclear materials outside nuclear facilities. Successive reports changes in inventory of nuclear material in 2008/2009 comprised 3 sheets ICR document numbers (153, 154 and 155), in 2009/2010 comprised 1 sheet ICR document number (159), in 2010/2011 comprised 3 sheets ICR document numbers (164, 165 and 166), and in 2012/2013 comprised 2 sheets ICR document numbers (175 and 176). From these data report changes in inventory of nuclear material can be concluded that in MBA.RI-B has been the displacement of nuclear material activities includes receipt of nuclear material from other nuclear facilities and shipments of nuclear materials out of facilities for research and development includes receipt 4 times from RI-E and 1 times from RI-A and 3 times shipment to RI-E. (author)

The British Climate Change Act: a critical evaluation and proposed alternative approach

International Nuclear Information System (INIS)

Pielke Jr, Roger A

2009-01-01

This paper evaluates the United Kingdom's Climate Change Act of 2008 in terms of the implied rates of decarbonization of the UK economy for a short-term and a long-term target established in law. The paper uses the Kaya identity to structure the evaluation, employing both a bottom up approach (based on projections of future UK population, economic growth, and technology) and a top down approach (deriving implied rates of decarbonization consistent with the targets and various rates of projected economic growth). Both approaches indicate that the UK economy would have to achieve annual rates of decarbonization in excess of 4 or 5%. To place these numbers in context, the UK would have to achieve the 2006 carbon efficiency of France by about 2015, a level of effort comparable to the building of about 30 new nuclear power plants, displacing an equivalent amount of fossil energy. The paper argues that the magnitude of the task implied by the UK Climate Change Act strongly suggests that it is on course to fail, and discusses implications.

Changing the Smoking Trajectory: Evaluating the Impact of School-Based Tobacco Interventions on Changes to Susceptibility to Future Smoking

Directory of Open Access Journals (Sweden)

Adam G. Cole

2017-10-01

Full Text Available School-based programs and policies can reduce student smoking rates. However, their impact on never-smoking students has not been investigated despite the clear transition between non-susceptible, susceptible, and ever tried smoking statuses. The objective of this paper was to examine the longitudinal student-level impact of six changes in school-based tobacco control programs and policies on student transitions in susceptibility to smoking over one year. Two multinomial logistic regression models identified the relative risk of a change in self-reported susceptibility to smoking or in trying a cigarette among never-smoking students in each of the six intervention schools compared to the relative risk among never-smoking students in control schools. Model 1 identified the relative risk of a change in smoking susceptibility status among baseline non-susceptible never smoking students, while Model 2 identified the relative risk of a change in smoking susceptibility status among baseline susceptible never smoking students. Students at some intervention schools were at increased risk of becoming susceptible to or trying a cigarette at one year follow-up. Intervention studies should examine changes to susceptibility to future smoking when evaluating impact to ensure that school-based tobacco control programs and policies do not negatively change the risk status of never-smoking students.

An Integrated Approach to Evaluate Urban Adaptive Capacity to Climate Change

Directory of Open Access Journals (Sweden)

Qiangsheng Hu

2018-04-01

Full Text Available Climate change and accelerated urbanization have posed severe challenges to urban development, resulting in a growing series of climate and environmental problems that have a significant impact on industrial production and urban life. In a developing country such as China, more than 57% of the population lives in urban areas. It is vital for these cities to adapt to climate-induced risks. A better understanding of how to improve adaptive capacity could enhance the ability to achieve a desirable state when the city experiences stress. This paper used an integrated approach for evaluating the urban adaptive capacity to climate change. It developed the evaluation index system of urban adaptive capacity (UAC based on the driver–pressure–state–impact–response model (DPSIR, and adopted grey relational analysis (GRA and the entropy method to analyze the level of UAC in Changsha, the capital city of Hunan Province, from 2006 to 2015. The results revealed that the UAC of Changsha showed a significant increase from 2006 to 2015. Among the five first-grade indicators, the response dimension had the greatest influence on the improvement of UAC. The study may provide suggestions for adaptive capacity building and sustainable development in other urban areas.

Development of risk matrices for evaluating climatic change responses of forested habitats

Science.gov (United States)

Louis R. Iverson; Stephen N. Matthews; Anantha M. Prasad; Matthew P. Peters; Gary. Yohe

2012-01-01

We present an approach to assess and compare risk from climate change among multiple species through a risk matrix, in which managers can quickly prioritize for species that need to have strategies developed, evaluated further, or watched. We base the matrix upon earlier work towards the National Climate Assessment for potential damage to infrastructures from climate...

EVALUATION OF RATIONAL FUNCTION MODEL FOR GEOMETRIC MODELING OF CHANG'E-1 CCD IMAGES

Directory of Open Access Journals (Sweden)

Y. Liu

2012-08-01

Full Text Available Rational Function Model (RFM is a generic geometric model that has been widely used in geometric processing of high-resolution earth-observation satellite images, due to its generality and excellent capability of fitting complex rigorous sensor models. In this paper, the feasibility and precision of RFM for geometric modeling of China's Chang'E-1 (CE-1 lunar orbiter images is presented. The RFM parameters of forward-, nadir- and backward-looking CE-1 images are generated though least squares solution using virtual control points derived from the rigorous sensor model. The precision of the RFM is evaluated by comparing with the rigorous sensor model in both image space and object space. Experimental results using nine images from three orbits show that RFM can precisely fit the rigorous sensor model of CE-1 CCD images with a RMS residual error of 1/100 pixel level in image space and less than 5 meters in object space. This indicates that it is feasible to use RFM to describe the imaging geometry of CE-1 CCD images and spacecraft position and orientation. RFM will enable planetary data centers to have an option to supply RFM parameters of orbital images while keeping the original orbit trajectory data confidential.

Radiation hardness of GaAs sensors against gamma-rays, neutrons and electrons

Energy Technology Data Exchange (ETDEWEB)

Šagátová, Andrea, E-mail: andrea.sagatova@stuba.sk [Institute of Nuclear and Physical Engineering, Faculty of Electrical Engineering and Information Technology, Slovak University of Technology, Ilkovičova 3, 812 19 Bratislava (Slovakia); University Centre of Electron Accelerators, Slovak Medical University, Ku kyselke 497, 911 06 Trenčín (Slovakia); Zaťko, Bohumír; Dubecký, František [Institute of Electrical Engineering, Slovak Academy of Sciences, Dúbravská cesta 9, 841 04 Bratislava (Slovakia); Ly Anh, Tu [Faculty of Applied Science, University of Technology VNU HCM, 268 Ly Thuong Kiet Street, District 10, Ho Chi Minh City (Viet Nam); Nečas, Vladimír; Sedlačková, Katarína; Pavlovič, Márius [Institute of Nuclear and Physical Engineering, Faculty of Electrical Engineering and Information Technology, Slovak University of Technology, Ilkovičova 3, 812 19 Bratislava (Slovakia); Fülöp, Marko [University Centre of Electron Accelerators, Slovak Medical University, Ku kyselke 497, 911 06 Trenčín (Slovakia)

2017-02-15

Highlights: • Radiation hardness of SI GaAs detectors against gamma-rays, neutrons and electrons was compared. • Good agreement was achieved between the experimental results and displacement damage factor of different types of radiation. • CCE and FWHM first slightly improved (by 1–8%) and just then degraded with the cumulative dose. • An increase of detection efficiency with cumulative dose was observed. - Abstract: Radiation hardness of semi-insulating GaAs detectors against {sup 60}Co gamma-rays, fast neutrons and 5 MeV electrons was compared. Slight improvements in charge collection efficiency (CCE) and energy resolution in FWHM (Full Width at Half Maximum) were observed at low doses with all kinds of radiation followed by their degradation. The effect occurred at a dose of about 10 Gy of neutrons (CCE improved by 1%, FWHM by 5% on average), at 1 kGy of electrons (FWHM decreased by 3% on average) and at 10 kGy of gamma-rays (CCE raised by 5% and FWHM dropped by 8% on average), which is in agreement with the relative displacement damage of the used types of radiation. Gamma-rays of MeV energies are 1000-times less damaging than similar neutrons and electrons about 10-times more damaging than photons. On irradiating the detectors with neutrons and electrons, we observed a global increase in their detection efficiency, which was caused probably by enlargement of the active detector area as a consequence of created radiation defects in the base material. Detectors were still functional after a dose of 1140 kGy of ∼1 MeV photons, 104 kGy of 5 MeV electrons but only up to 0.576 kGy of fast (∼2 to 30 MeV) neutrons.

A general equilibrium evaluation of trade policy changes in Moldova Republic

Directory of Open Access Journals (Sweden)

S. Alanoca

1999-08-01

Full Text Available Taking into account that the economy of Moldova is open to the international markets, it is necessary to study the macroeconomic actions of the country, that are expressed in the elaboration of structural changes in the trade policy, in the exchange rate, in the evaluation of its influence on the Moldavian producers and consumers, and on the income of the government budget. These questions will be the object of the proposed article.

Hooked on a feeling: Affective anti-smoking messages are more effective than cognitive messages at changing implicit evaluations of smoking

Directory of Open Access Journals (Sweden)

Colin Tucker Smith

2015-10-01

Full Text Available Because implicit evaluations are thought to underlie many aspects of behavior, researchers have started looking for ways to change them. We examine whether and when persuasive messages alter strongly-held implicit evaluations of smoking. In smokers, an affective anti-smoking message led to more negative implicit evaluations on four different implicit measures as compared to a cognitive anti-smoking message which seemed to backfire. Additional analyses suggested that the observed effects were mediated by the feelings and emotions raised by the messages. In non-smokers, both the affective and cognitive message engendered slightly more negative implicit evaluations. We conclude that persuasive messages change implicit evaluations in a way that depends on properties of the message and of the participant. Thus, our data open new avenues for research directed at tailoring persuasive messages to change implicit evaluations.

Hooked on a feeling: affective anti-smoking messages are more effective than cognitive messages at changing implicit evaluations of smoking.

Science.gov (United States)

Smith, Colin Tucker; De Houwer, Jan

2015-01-01

Because implicit evaluations are thought to underlie many aspects of behavior, researchers have started looking for ways to change them. We examine whether and when persuasive messages alter strongly held implicit evaluations of smoking. In smokers, an affective anti-smoking message led to more negative implicit evaluations on four different implicit measures as compared to a cognitive anti-smoking message which seemed to backfire. Additional analyses suggested that the observed effects were mediated by the feelings and emotions raised by the messages. In non-smokers, both the affective and cognitive message engendered slightly more negative implicit evaluations. We conclude that persuasive messages change implicit evaluations in a way that depends on properties of the message and of the participant. Thus, our data open new avenues for research directed at tailoring persuasive messages to change implicit evaluations.

Hyperdynamic circulatory changes in liver cirrhosis: Comparative evaluation by doppler ultrasonography with normal subjects

International Nuclear Information System (INIS)

Im, Dae Wook; Baik, Soon Koo; Suh, Jung In; Kim, Jae Woo; Park, Yong Soon; Kim, Hyun Soo; Lee, Dong Ki; Kwon, Sang Ok

2001-01-01

To evaluate the cardiovascular and splanchnic hemodynamic changes in patients with liver cirrhosis and to compare with those of the normal controls using doppler ultrasonography. A total of 129 patients including 23 of Child-Pugh class A, 24 of class A, 24 of class B, 30 of class C, and 52 of the control group were included. Cardiac output (CO), systemic vascular resistance index (SVRI), and blood flow and pulsatility index (PI) of the superior mesenteric artery (SMA) were evaluated and compared among each groups. CO and SMA blood flow in the cirrhotic group were significantly higher than those in the control group, and the increase in CO and SMA blood flow showed a statistically significant correlation with the degree of liver dysfunction (p 2 =0.230). Hyperdynamic circulatory changes such as increases in CO and splanchnic blood flow were present in patients with liver cirrhosis. These changes may contribute to the development and maintenance of the portal hypertension due to an increase in portal blood flow an increase in portal blood flow.

Update on the Active Magnetospheric Particle Tracer Explorers (AMPTE) program

International Nuclear Information System (INIS)

Mcentire, R.W.

1987-01-01

The principles involved in the AMPTE mission's active experiments are discussed together with the role of the AMPTE satellites (the Germany's Ion Release Module, IRM, the United Kingdom Subsatellite, and the U.S Charge Composition Explorer, CCE) in and the results of the ion-release experiments. The AMPTE orbit profile is described, with the times of solar-wind and magnetotail ion releases (two barium and two lithium releases were carried out as the IRM precessed through the magnetosheath) shown schematically. In addition to the results on the Van Allen radiation belts obtained through the ion-release experiments, studies of the radiation belts with the new generation of sensors aboard the CCE and IRM are described. 25 references

Hanford site water table changes 1950-1980: data observations and evaluation

International Nuclear Information System (INIS)

Zimmerman, D.A.; Reisenauer, A.E.; Black, G.D.; Young, M.A.

1986-04-01

The basalt formations underlying the Hanford site are being considered for characterization and evaluation as a deep geologic repository for defense and commercial radioactive wastes. To understand the hydrology of the Hanford area, we need to know if the ground-water system is in steady state and what impact a change in surface stress from artificial recharge may have on the underlying basalt aquifers. Researchers at Pacific Northwest Laboratory are supporting efforts to understand these issues by illustrating how changes in wastewater disposal activities at the Hanford site have altered the configuration of the water table surface with time. The objective of this work was to determine the magnitude and direction of changes in the elevation of the water table across the Hanford site from 1950 to 1980. Plots of the magnitudes of water-level changes occurring over 5-year intervals from 1950 through 1980 are presented. The water-level changes that occurred during each 5-year interval are related to water discharges from nuclear fuel reprocessing facilities or other discharge sources. The plots of water-level changes show large water-level increases in the vicinity of the Separations Area (200 East and 200 West) from 1950 to 1960; the rate of increase of water-level changes grows more slowly from 1960 to 1970, while the areal extent of the mounding continues to expand. Only small changes occur from 1970 to 1980; during this time period, the unconfined system appears to be in approximate equilibrium with the sources. Based on previous experience, it is believed that an increase in ground-water mounding will begin to appear near the 200 East Area B Pond as a result of the increased discharges from the restart of PUREX in 1983

Spectroscopic evaluation of painted layer structural changes induced by gamma radiation in experimental models

International Nuclear Information System (INIS)

Manea, Mihaela M.; Moise, Ioan V.; Virgolici, Marian; Negut, Constantin D.; Barbu, Olimpia-Hinamatsuri; Cutrubinis, Mihalis; Fugaru, Viorel; Stanculescu, Ioana R.; Ponta, Corneliu C.

2012-01-01

The degradation of cultural heritage objects by insects and microorganisms is an important issue for conservators, art specialists and humankind in general. Gamma irradiation is an efficient method of polychrome wooden artifacts disinfestation. Color changes and other modifications in the physical chemical properties of materials induced by gamma irradiation are feared by cultural heritage responsible committees and they have to be evaluated objectively and precisely. In this paper FTIR and FT-Raman spectroscopy methods were used to investigate the structural changes in some experimental models of tempera paint layers on wood following 11 kGy gamma irradiation at two dose rates. Radiation chemistry depends on the particular pigment, matrix formed by protein, resin (in case of varnished samples) and water presence. For the majority of painted layer in experimental models very small spectral variations were observed. Small changes in the FTIR spectra were observed for the raw sienna experimental model: for the higher dose rate the egg yolk protein oxidation peaks and the CH stretching bands due to lipids degradation products increased. - Highlights: ► Experimental models of tempera paint layers on wood were γ-irradiated at two dose rates. ► Changes induced by γ-irradiation were evaluated by vibrational spectroscopy. ► Minor spectral variations of painted layer were observed. ► Raw sienna FTIR spectra showed little changes of egg yolk and lipids at higher dose rate. ► Gamma irradiation is recommended for disinfection of painted wooden artifacts.

Electric field deformation in diamond sensors induced by radiation defects

Energy Technology Data Exchange (ETDEWEB)

Kassel, Florian; Boer, Wim de; Boegelspacher, Felix; Dierlamm, Alexander; Mueller, Thomas; Steck, Pia [Institut fuer Experimentelle Kernphysik (IEKP), Karlsruher Institut fuer Technologie (KIT) (Germany); Dabrowski, Anne; Guthoff, Moritz [CERN (Switzerland)

2016-07-01

The BCML system is a beam monitoring device in the CMS experiment at the LHC. As detectors 32 poly-crystalline CVD diamond sensors are positioned in a ring around the beam pipe at a distance of ±1.8 m and ±14.4 m from the interaction point. The radiation hardness of the diamond sensors in terms of measured signal during operation was significantly lower than expected from laboratory measurements. At high particle rates, such as those occurring during the operation of the LHC, a significant fraction of the defects act as traps for charge carriers. This space charge modifies the electrical field in the sensor bulk leading to a reduction of the charge collection efficiency (CCE). A diamond irradiation campaign was started to investigate the rate dependent electrical field deformation with respect to the radiation damage. Besides the electrical field measurements via the Transient Current Technique, the CCE was measured. The experimental results were used to create an effective trap model that takes the radiation damage into account. Using this trap model the rate dependent electrical field deformation and the CCE were simulated with the software ''SILVACO TCAD''. This talk compares the experimental measurement results with the simulations.

Semiconductor pixel detectors for digital mammography

International Nuclear Information System (INIS)

Novelli, M.; Amendolia, S.R.; Bisogni, M.G.; Boscardin, M.; Dalla Betta, G.F.; Delogu, P.; Fantacci, M.E.; Quattrocchi, M.; Rosso, V.; Stefanini, A.; Venturelli, L.; Zucca, S.

2003-01-01

We present some results obtained with silicon and gallium arsenide pixel detectors to be applied in the field of digital mammography. Even though GaAs is suitable for medical imaging applications thanks to its atomic number, which allows a very good detection efficiency, it often contains an high concentrations of traps which decrease the charge collection efficiency (CCE). So we have analysed both electrical and spectroscopic performance of different SI GaAs diodes as a function of concentrations of dopants in the substrate, in order to find a material by which we can obtain a CCE allowing the detection of all the photons that interact in the detector. Nevertheless to be able to detect low contrast details, efficiency and CCE are not the only parameters to be optimized; also the stability of the detection system is fundamental. In the past we have worked with Si pixel detectors; even if its atomic number does not allow a good detection efficiency at standard thickness, it has a very high stability. So keeping in mind the need to increase the Silicon detection efficiency we performed simulations to study the behaviour of the electrical potential in order to find a geometry to avoid the risk of electrical breakdown

Semiconductor pixel detectors for digital mammography

Energy Technology Data Exchange (ETDEWEB)

Novelli, M. E-mail: marzia.novelli@pi.infn.it; Amendolia, S.R.; Bisogni, M.G.; Boscardin, M.; Dalla Betta, G.F.; Delogu, P.; Fantacci, M.E.; Quattrocchi, M.; Rosso, V.; Stefanini, A.; Venturelli, L.; Zucca, S

2003-08-21

We present some results obtained with silicon and gallium arsenide pixel detectors to be applied in the field of digital mammography. Even though GaAs is suitable for medical imaging applications thanks to its atomic number, which allows a very good detection efficiency, it often contains an high concentrations of traps which decrease the charge collection efficiency (CCE). So we have analysed both electrical and spectroscopic performance of different SI GaAs diodes as a function of concentrations of dopants in the substrate, in order to find a material by which we can obtain a CCE allowing the detection of all the photons that interact in the detector. Nevertheless to be able to detect low contrast details, efficiency and CCE are not the only parameters to be optimized; also the stability of the detection system is fundamental. In the past we have worked with Si pixel detectors; even if its atomic number does not allow a good detection efficiency at standard thickness, it has a very high stability. So keeping in mind the need to increase the Silicon detection efficiency we performed simulations to study the behaviour of the electrical potential in order to find a geometry to avoid the risk of electrical breakdown.

Simultaneous Detection of Genetically Modified Organisms in a Mixture by Multiplex PCR-Chip Capillary Electrophoresis.

Science.gov (United States)

Patwardhan, Supriya; Dasari, Srikanth; Bhagavatula, Krishna; Mueller, Steffen; Deepak, Saligrama Adavigowda; Ghosh, Sudip; Basak, Sanjay

2015-01-01

An efficient PCR-based method to trace genetically modified food and feed products is in demand due to regulatory requirements and contaminant issues in India. However, post-PCR detection with conventional methods has limited sensitivity in amplicon separation that is crucial in multiplexing. The study aimed to develop a sensitive post-PCR detection method by using PCR-chip capillary electrophoresis (PCR-CCE) to detect and identify specific genetically modified organisms in their genomic DNA mixture by targeting event-specific nucleotide sequences. Using the PCR-CCE approach, novel multiplex methods were developed to detect MON531 cotton, EH 92-527-1 potato, Bt176 maize, GT73 canola, or GA21 maize simultaneously when their genomic DNAs in mixtures were amplified using their primer mixture. The repeatability RSD (RSDr) of the peak migration time was 0.06 and 3.88% for the MON531 and Bt176, respectively. The RSD (RSDR) of the Cry1Ac peak ranged from 0.12 to 0.40% in multiplex methods. The method was sensitive in resolving amplicon of size difference up to 4 bp. The PCR-CCE method is suitable to detect multiple genetically modified events in a composite DNA sample by tagging their event specific sequences.

Simulating the impact of climate change on rice production in Asia and evaluating options for adaptation.

NARCIS (Netherlands)

Matthews, R.B.; Kropff, M.J.; Horie, T.; Bachelet, D.

1997-01-01

The likely effects of climate change caused by increasing atmospheric carbon dioxide levels on rice production in Asia were evaluated using two rice crop simulation models, ORYZA1 and SIMRIW, running under fixed-change' climate scenarios and scenarios predicted for a doubled-CO2 (2xCO2) atmosphere

Evaluation of the changes of landscape types of Slovakia

Directory of Open Access Journals (Sweden)

Zita IZAKOVIČOVÁ

2013-07-01

Full Text Available In the last period landscape protection, its representative types more and more comes to the limelight. In October 2000 the European Landscape Convention - also known as the Florence Convention was adopted. The aims of this Convention are to promote landscape protection, management and planning, and to organise European co-operation on landscape issues.  Contracting states ought to analyse the landscape types on the whole area of their countries, to analyse their features, record their changes, specify motive power and pressure forming them and assess selected types with respect to special values attributed by engaged participants and inhabitants. Knowledge and identification of single landscape types enable the intensification of care of diversity of single landscape types and landscape biodiversity. It is an unavoidable condition in the strategic planning process and effective protection of regionally special landscape.Slovakia signed ELC in 2005 and became an active participant in its implementation. The Institute of the Landscape Ecology of Slovak Academy of Sciences elaborated methodology for specification and evaluation of the representative landscape types of Slovakia (RLTS.RLTS are defined as homogeneous units considering the landscape character, functions and current land-use. GIS (Geographical Information Systems tool was used to create RLTS, in particular by overlaying of abiotic landscape structure (type of relief, quaternary deposits, climatic regions, and soil types and land-cover map (CORINE Land Cover 2006 - CLC at national scale. This process yielded to a patched map of homogeneous areas, which were further interpreted, generalized, and regionalized to a final map of RLTS.Landscape types of Slovakia were defined by the synthesis of the mentioned maps. Totally there were identified 126 basic landscape types. Each landscape type represents unique combination of land-use in different abiotic conditions and gives the unique

The Feasibility Evaluation of Land Use Change Detection Using GAOFEN-3 Data

Science.gov (United States)

Huang, G.; Sun, Y.; Zhao, Z.

2018-04-01

GaoFen-3 (GF-3) satellite, is the first C band and multi-polarimetric Synthetic Aperture Radar (SAR) satellite in China. In order to explore the feasibility of GF-3 satellite in remote sensing interpretation and land-use remote sensing change detection, taking Guangzhou, China as a study area, the full polarimetric image of GF-3 satellite with 8 m resolution of two temporal as the data source. Firstly, the image is pre-processed by orthorectification, image registration and mosaic, and the land-use remote sensing digital orthophoto map (DOM) in 2017 is made according to the each county. Then the classification analysis and judgment of ground objects on the image are carried out by means of ArcGIS combining with the auxiliary data and using artificial visual interpretation, to determine the area of changes and the category of change objects. According to the unified change information extraction principle to extract change areas. Finally, the change detection results are compared with 3 m resolution TerraSAR-X data and 2 m resolution multi-spectral image, and the accuracy is evaluated. Experimental results show that the accuracy of the GF-3 data is over 75 % in detecting the change of ground objects, and the detection capability of new filling soil is better than that of TerraSAR-X data, verify the detection and monitoring capability of GF-3 data to the change information extraction, also, it shows that GF-3 can provide effective data support for the remote sensing detection of land resources.

Intertemporal evaluation criteria for climate change policy: the basic ethical issues

OpenAIRE

Buchholz, Wolfgang; Schymura, Michael

2011-01-01

The evaluation of long-term effects of climate change in cost-benefit analysis has a long tradition in environmental economics. Since the publication of the Stern Review in 2006 the debate about the "appropriate" discounting of future welfare and utility levels was revived and the most renowned scholars of the profession participated in this debate. But it seems that some contributions dealing with the Stern Review and the Review itself mixed up normative and positive issues to defend the own...

Dynamic evaluation of CMAQ part I: Separating the effects of changing emissions and changing meteorology on ozone levels between 2002 and 2005 in the eastern US

Science.gov (United States)

A dynamic evaluation of the Community Multiscale Air Quality (CMAQ) modeling system version 5.0.1 was conducted to evaluate the model's ability to predict changes in ozone levels between 2002 and 2005, a time period characterized by emission reductions associated with the EPA's N...

Evaluation of sclerosis in Modic changes of the spine using susceptibility-weighted magnetic resonance imaging

Energy Technology Data Exchange (ETDEWEB)

Böker, Sarah M., E-mail: Sarah-maria.boeker@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany); Bender, Yvonne Y., E-mail: Yi-na.bender@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany); Adams, Lisa C., E-mail: Lisa.adams@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany); Fallenberg, Eva M., E-mail: Eva.fallenberg@charite.de [Department of Radiology, Charité, Augustenburger Platz 1, 13353 Berlin (Germany); Wagner, Moritz, E-mail: Moritz.wagner@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany); Hamm, Bernd, E-mail: Bernd.hamm@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany); Makowski, Marcus R., E-mail: Marcus.makowski@charite.de [Department of Radiology, Charité, Charitéplatz 1, 10117 Berlin (Germany)

2017-03-15

Highlights: • SWMR allows a reliable detection of sclerosis in Modic changes. • SWI has a better accuracy for detection of sclerosis in Modic changes than T1/T2w MR. • By applying SWMR the use of additional CT/radiography can be minimized. - Abstract: Purpose: To evaluate the diagnostic performance of susceptibility-weighted magnetic resonance imaging (SWMR) for the differentiation of sclerotic and non-sclerotic Modic changes (MC) of the spine compared to computed tomography (CT) and radiographs. Materials and methods: The Institutional Ethics-Review-Board approved this prospective study in advance. Written consent was obtained from all subjects. SWMR and standard T1/T2 MR of the cervical (n = 21) and/or lumbar spine (n = 34) were performed in 54 patients. 21 patients served as control. 18 patients were evaluated with CT; in all other patients radiographs were available. 67 Modic changes were identified on T1/T2 MR. On SWMR changes were classified as sclerotic and non-sclerotic based on signal intensity measurements. The sensitivity and specificity of SWMR and T1/T2 MR for differentiating between sclerotic and non-sclerotic Modic changes were determined with CT and radiographs as reference standard. Results: On SWMR, signal measurements between sclerotic and non-sclerotic Modic changes differed significantly (p < 0.01). On T1- and T2-weighted MR no significant difference (p > 0.05) was measured. On SWMR, a reliable differentiation between sclerotic and non-sclerotic Modic changes could be achieved, with a sensitivity of 100% and specificity of 95%. In contrast, the combination of T1-/T2-weighted MR yielded a significantly lower sensitivity to detect sclerosis (20%). Conclusion: SWMR allows a reliable detection of sclerosis in Modic changes with a higher accuracy compared to standard spine MR sequences, using radiographs and CT as reference standard.

Robustness-based evaluation of hydropower infrastructure design under climate change

Directory of Open Access Journals (Sweden)

Mehmet Ümit Taner

2017-01-01

Full Text Available The conventional tools of decision-making in water resources infrastructure planning have been developed for problems with well-characterized uncertainties and are ill-suited for problems involving climate nonstationarity. In the past 20 years, a predict-then-act-based approach to the incorporation of climate nonstationarity has been widely adopted in which the outputs of bias-corrected climate model projections are used to evaluate planning options. However, the ambiguous nature of results has often proved unsatisfying to decision makers. This paper presents the use of a bottom-up, decision scaling framework for the evaluation of water resources infrastructure design alternatives regarding their robustness to climate change and expected value of performance. The analysis begins with an assessment of the vulnerability of the alternative designs under a wide domain of systematically-generated plausible future climates and utilizes downscaled climate projections ex post to inform likelihoods within a risk-based evaluation. The outcomes under different project designs are compared by way of a set of decision criteria, including the performance under the most likely future, expected value of performance across all evaluated futures and robustness. The method is demonstrated for the design of a hydropower system in sub-Saharan Africa and is compared to the results that would be found using a GCM-based, scenario-led analysis. The results indicate that recommendations from the decision scaling analysis can be substantially different from the scenario-led approach, alleviate common shortcomings related to the use of climate projections in water resources planning, and produce recommendations that are more robust to future climate uncertainty.

Evaluation of environmental burdens caused by changes of food waste management systems in Seoul, Korea

International Nuclear Information System (INIS)

Lee, Suk-Hui; Choi, Ki-In; Osako, Masahiro; Dong, Jong-In

2007-01-01

During the last decade, there have been remarkable changes in food waste management in Korea following a ban on direct landfilling. To evaluate the environmental impacts of food waste management systems, we examined individual treatment systems with the LCA approach - landfill, incineration, composting, and feed manufacturing - and estimated the change from 1997 to 2005. The efficient system was different in each impact category, but it was evaluated that landfill is the main contributor to human toxicity and global warming (based on fossil CO 2 ). In contrast, due to the increase of food waste recycling, acidification, eutrophication, and fresh water aquatic ecotoxicity impact was increased. Especially, the high energy consumption and generated residue in recycling systems caused the large burdens in toxicity categories

A GIS BASED EVALUATION OF LAND USE CHANGES AND ECOLOGICAL CONNECTIVITY INDEX

Directory of Open Access Journals (Sweden)

Poppy Indrayani

2017-03-01

Full Text Available Recently, the Makassar region is a significant land use planning and management issue, and has many impacts on the ecological function and structure landscape. With the development and infrastructure initiatives mostly around the urban centers, the urbanization and sprawl would impact the environment and the natural resources. Therefore, environmental management and careful strategic spatial planning in landscape ecological network is crucial when aiming for sustainable development. In this paper, the impacts of land use changes from 1997 to 2012 on the landscape ecological connectivity in the Makassar region were evaluated using Geographic Information System (GIS. The resulted GIS analysis clearly showed that land use changes occurring in the Makassar region have caused profound changes in landscape pattern. The spatial model had a predictive capability allowing the quantitative assessment and comparison of the impacts resulting from different land use on the ecological connectivity index. The results had an effective performance in identifying the vital ecological areas and connectivity prior to development plan in areas.

Evaluation of Aneurysm Neck Angle Change After Endovascular Aneurysm Repair Clinical Investigations

Energy Technology Data Exchange (ETDEWEB)

Le, Trong Binh; Moon, Mi Hyoung [Inha University Hospital, Endovascular Training Center (Korea, Republic of); Jeon, Yong Sun, E-mail: radjeon@inha.ac.kr [Inha University Hospital, Inha University School of Medicine, Department of Radiology (Korea, Republic of); Hong, Kee Chun [Inha University School of Medicine, Department of Vascular Surgery (Korea, Republic of); Cho, Soon Gu [Inha University Hospital, Inha University School of Medicine, Department of Radiology (Korea, Republic of); Park, Keun-Myoung [Inha University School of Medicine, Department of Vascular Surgery (Korea, Republic of)

2016-05-15

PurposeTo evaluate the aneurysm neck angle changes and post-endovascular aneurysm repair (EVAR) complications.MethodsWe retrospectively analyzed 72 cases of elective EVAR for abdominal aortic aneurysm among 109 consecutive cases from December 2005 to April 2014. Patients were divided into angulated and non-angulated groups. The angulated group was defined as neck angulation ≥60°. Neck angle was evaluated pre- and post-EVAR during short- (within 1 month), mid- (3–6 months), and long-term (>1 year) follow-up. Aneurysm sac diameter change, aneurysm neck morphology other than angulation, endoleaks, and other post-procedural complications were also documented.ResultsA total of 34 patients were enrolled in the angulated group. There were no statistical differences in age, sex, follow-up duration, and aneurysm neck profile between the two groups (p > 0.05). Both groups showed statistically significant and consistent decreases in angulation during the follow-up period (p < 0.01). The angulated group revealed 22.45 % more straightening than the non-angulated group. Recoil of the Endurant device occurred in the angulated group. No statistically significant intergroup differences were observed in any endoleaks, complications, or re-intervention rates (p > 0.05). Pre-EVAR angle was the only predictor for post-procedural angle change (p < 0.001).ConclusionEVAR is applicable for patients with highly angulated aneurysm neck and provides consistent neck straightening over long-term follow-up. Recoil was evident in the angulated group using the Endurant device.

Use of spherical coordinates to evaluate three-dimension facial changes after orthognathic surgery

Energy Technology Data Exchange (ETDEWEB)

Yoon, Suk Ja; Ryu, Sun Youl; Hwang, Hyeon Shik; Kang, Byung Cheol; Lee, Jae [School of Dentistry, Chonnam National University, Gwangju (Korea, Republic of); Wang, Rui Feng [Dept. of Biologic and Material Sciences, School of Dentistry, University of Michigan, Ann Arbor (United States); Palomo, Juan M. [Dept. of Orthodontics, School of Dental Medicine, Case Western Reserve University, Cleveland (United States)

2014-03-15

This study aimed to assess the three-dimensional (3D) facial changes after orthognathic surgery by evaluating the spherical coordinates of facial lines using 3D computed tomography (CT). A 19-year-old girl was diagnosed with class III malocclusion and facial asymmetry. Orthognathic surgery was performed after orthodontic treatment. Facial CT scans were taken before and after orthognathic surgery. The patient had a menton deviation of 12.72 mm before surgery and 0.83 mm after surgery. The spherical coordinates of four bilateral facial lines (ramal height, ramal lateral, ramal posterior and mandibular body) were estimated from CT scans before and after surgery on the deviated and opposite side. The spherical coordinates of all facial lines changed after orthognathic surgery. Moreover, the bilateral differences of all facial lines changed after surgery, and no bilateral differences were zero. The spherical coordinate system was useful to compare differences between the presurgical and postsurgical changes to facial lines.

Evaluation of Staining-Dependent Colour Changes in Resin Composites Using Principal Component Analysis.

Science.gov (United States)

Manojlovic, D; Lenhardt, L; Milićević, B; Antonov, M; Miletic, V; Dramićanin, M D

2015-10-09

Colour changes in Gradia Direct™ composite after immersion in tea, coffee, red wine, Coca-Cola, Colgate mouthwash, and distilled water were evaluated using principal component analysis (PCA) and the CIELAB colour coordinates. The reflection spectra of the composites were used as input data for the PCA. The output data (scores and loadings) provided information about the magnitude and origin of the surface reflection changes after exposure to the staining solutions. The reflection spectra of the stained samples generally exhibited lower reflection in the blue spectral range, which was manifested in the lower content of the blue shade for the samples. Both analyses demonstrated the high staining abilities of tea, coffee, and red wine, which produced total colour changes of 4.31, 6.61, and 6.22, respectively, according to the CIELAB analysis. PCA revealed subtle changes in the reflection spectra of composites immersed in Coca-Cola, demonstrating Coca-Cola's ability to stain the composite to a small degree.

Use of spherical coordinates to evaluate three-dimension facial changes after orthognathic surgery

International Nuclear Information System (INIS)

Yoon, Suk Ja; Ryu, Sun Youl; Hwang, Hyeon Shik; Kang, Byung Cheol; Lee, Jae; Wang, Rui Feng; Palomo, Juan M.

2014-01-01

This study aimed to assess the three-dimensional (3D) facial changes after orthognathic surgery by evaluating the spherical coordinates of facial lines using 3D computed tomography (CT). A 19-year-old girl was diagnosed with class III malocclusion and facial asymmetry. Orthognathic surgery was performed after orthodontic treatment. Facial CT scans were taken before and after orthognathic surgery. The patient had a menton deviation of 12.72 mm before surgery and 0.83 mm after surgery. The spherical coordinates of four bilateral facial lines (ramal height, ramal lateral, ramal posterior and mandibular body) were estimated from CT scans before and after surgery on the deviated and opposite side. The spherical coordinates of all facial lines changed after orthognathic surgery. Moreover, the bilateral differences of all facial lines changed after surgery, and no bilateral differences were zero. The spherical coordinate system was useful to compare differences between the presurgical and postsurgical changes to facial lines.

Evaluation of Water Quality Change of Brackish Lake in Snowy Cold Regions Accompanying Climate Change

Science.gov (United States)

Kudo, K.; Hasegawa, H.; Nakatsugawa, M.

2017-12-01

This study addresses evaluation of water quality change of brackish lake based on the estimation of hydrological quantities resulting from long-term hydrologic process accompanying climate change. For brackish lakes, such as Lake Abashiri in Eastern Hokkaido, there are concerns about water quality deterioration due to increases in water temperature and salinity. For estimating some hydrological quantities in the Abashiri River basin, including Lake Abashiri, we propose the following methods: 1) MRI-NHRCM20, a regional climate model based on the Representative Concentration Pathways adopted by IPCC AR5, 2) generalized extreme value distribution for correcting bias, 3) kriging adopted variogram for downscaling and 4) Long term Hydrologic Assessment model considering Snow process (LoHAS). In addition, we calculate the discharge from Abashiri River into Lake Abashiri by using estimated hydrological quantities and a tank model, and simulate impacts on water quality of Lake Abashiri due to climate change by setting necessary conditions, including the initial conditions of water temperature and water quality, the pollution load from the inflow rivers, the duration of ice cover and salt pale boundary. The result of the simulation of water quality indicates that climate change is expected to raise the water temperature of the lake surface by approximately 4°C and increase salinity of surface of the lake by approximately 4psu, also if salt pale boundary in the lake raises by approximately 2-m, the concentration of COD, T-N and T-P in the bottom of the lake might increase. The processes leading to these results are likely to be as follows: increased river water flows in along salt pale boundary in lake, causing dynamic flow of surface water; saline bottom water is entrained upward, where it mixes with surface water; and the shear force acting at salt pale boundary helps to increase the supply of salts from bottom saline water to the surface water. In the future, we will

VA Health Care: Processes to Evaluate, Implement, and Monitor Organizational Structure Changes Needed

Science.gov (United States)

2016-09-01

their families , such as medallions and markers for headstones that signify veterans’ service. Page 3 GAO-16-803 VHA Organizational ... Research Oversight, and Chief Nursing Page 8 GAO-16-803 VHA Organizational Structure Officer. Also, the Chief Financial Officer and...VA HEALTH CARE Processes to Evaluate, Implement, and Monitor Organizational Structure Changes Needed Report to

Scale interactions in economics: application to the evaluation of the economic damages of climatic change and of extreme events

International Nuclear Information System (INIS)

Hallegatte, S.

2005-06-01

Growth models, which neglect economic disequilibria, considered as temporary, are in general used to evaluate the damaging effects generated by climatic change. This work shows, through a series of modeling experiences, the importance of disequilibria and of endogenous variability of economy in the evaluation of damages due to extreme events and climatic change. It demonstrates the impossibility to separate the evaluation of damages from the representation of growth and of economic dynamics: the comfort losses will depend on both the nature and intensity of impacts and on the dynamics and situation of the economy to which they will apply. Thus, the uncertainties about the damaging effects of future climatic changes come from both scientific uncertainties and from uncertainties about the future organization of our economies. (J.S.)

Measuring change in vulnerable adolescents: findings from a peer education evaluation in South Africa.

Science.gov (United States)

Swartz, Sharlene; Deutsch, Charles; Makoae, Mokhantšo; Michel, Barbara; Harding, James Hamilton; Garzouzie, Gabrielle; Rozani, Amanda; Runciman, Toby; Van der Heijden, Ingrid

2012-11-01

In the context of poverty and HIV and AIDS, peer education is thought to be capable of providing vulnerable youth with psychosocial support as well as information and decision-making skills otherwise limited by scarce social and material resources. As a preventative education intervention method, peer education is a strategy aimed at norms and peer group influences that affect health behaviours and attitudes. However, too few evaluations of peer-led programmes are available, and they frequently fail to reflect real differences between those who have been recipients of peer education and those who have not. This article reports on an evaluation of a pilot peer-led intervention, entitled Vhutshilo, implemented on principles agreed upon through a collaborative effort in South Africa by the Harvard School of Public Health and the Centre for the Support of Peer Education (the Rutanang collaboration). Vhutshilo targeted vulnerable adolescents aged 14-16 years living in some of South Africa's under-resourced communities. The research design was a mixed-method (qualitative and quantitative), longitudinal, quasi-experimental evaluation. Tools used included a quantitative survey questionnaire (n = 183) and semi-structured interviews (n = 32) with beneficiaries of peer education. Surveys were administered twice for beneficiaries of peer education (n = 73), immediately after completion of the programme (post-test) and 4 months later (delayed post-test), and once for control group members (n = 110). The three main methodological limitations in this study were the use of a once-off control group assessment as the baseline for comparison, without a pre-test, due to timing and resource constraints; a small sample size (n = 183), which reduced the statistical power of the evaluation; and the unavailability of existing tested survey questions to measure the impact of peer education and its role in behaviour change. This article reports on the difficulties of

'Change4Life Smart Swaps': quasi-experimental evaluation of a natural experiment.

Science.gov (United States)

Wrieden, Wendy L; Levy, Louis B

2016-09-01

To evaluate the impact on food purchasing behaviour of the 'Change4Life Smart Swaps' campaign to encourage families to make small changes to lower-fat or lower-sugar versions of commonly eaten foods and drinks. Quasi-experimental study comparing the proportion of swaps made by an intervention group (267 families who had signed up to the 'Smart Swaps' campaign promoted through various media, including television and radio advertising in early 2014) and a comparison group (135 families resident in Wales, signed up for 'Change4Life' materials, but not directly exposed to the 'Smart Swaps' campaign). During weeks 1, 2 and 3 of the campaign participants were asked to record their purchases of dairy products, carbonated drinks and breakfast cereals, using a mobile phone app questionnaire, when making a purchase within the category. England and Wales. Families registered with 'Change4Life'. In weeks 2 and 3 a significantly higher percentage of the intervention group had made 'smart swaps' than the comparison group. After week 3, 58 % of participants had swapped to a lower-fat dairy product compared with 26 % of the comparison group (Ppurchased a lower-sugar drink compared with 19 % of the comparison group (P=0·01), and 24 % had made a change to a lower-sugar cereal compared with 12 % of the comparison group (P=0·009). In the short term a national campaign to change purchase habits towards healthier products may have some merit but the sustainability of change requires further investigation.

Contribution of the working group 2 to the fourth evaluation report of the inter government expert group on the climatic change. Evaluation 2007 of the climatic changes: impacts, adaptation and vulnerability; Contribution du Groupe de travail 2 au quatrieme rapport d'evaluation du Groupe d'expert intergouvernemental sur l'evolution du climat. Bilan 2007 des changements climatiques: impacts, adaptation et vulnerabilite

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This document exposes the results of the fourth evaluation report of the working group II of the inter government experts group on the climatic change. This evaluation presents the today scientific understanding of the climatic change impacts on the humans and their adaptation ability and vulnerability. It is based on the GIEC evaluations and new knowledge added since the third evaluation report. (A.L.B.)

SWFSC/MMTD/CCE: California Harbor Porpoise Survey (CAHPS) 1995

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — A ship-based marine mammal survey in California from Point Conception, California to the California-Oregon border, with the survey extent limited to waters from the...

Longitudinal change in the neural bases of adolescent social self-evaluations: effects of age and pubertal development.

Science.gov (United States)

Pfeifer, Jennifer H; Kahn, Lauren E; Merchant, Junaid S; Peake, Shannon J; Veroude, Kim; Masten, Carrie L; Lieberman, Matthew D; Mazziotta, John C; Dapretto, Mirella

2013-04-24

Self-evaluations undergo significant transformation during early adolescence, developing in parallel with the heightened complexity of teenagers' social worlds. Intuitive theories of adolescent development, based in part on animal work, suggest that puberty is associated with neural-level changes that facilitate a "social reorientation" (Nelson et al., 2005). However, direct tests of this hypothesis using neuroimaging are limited in humans. This longitudinal fMRI study examined neurodevelopmental trajectories associated with puberty, self-evaluations, and the presumed social reorientation during the transition from childhood to adolescence. Participants (N = 27, mean age = 10.1 and 13.1 years at time points one and two, respectively) engaged in trait evaluations of two targets (the self and a familiar fictional other), across two domains of competence (social and academic). Responses in ventromedial PFC increased with both age and pubertal development during self-evaluations in the social domain, but not in the academic domain. These results suggest that changes in social self-evaluations are intimately connected with biology, not just peer contexts, and provide important empirical support for the relationship between neurodevelopment, puberty, and social functioning.

Renographic indices for evaluation of changes in graft function

Energy Technology Data Exchange (ETDEWEB)

El-Maghraby, T.A.F.; Eck-Smit, B.L.F. van; Pauwels, E.K.J. [Division of Nuclear Medicine, Department of Radiology, Leiden University Medical Centre, Leiden (Netherlands); Fijter, J.W. de [Department of Nephrology, Leiden University Medical Centre, Leiden (Netherlands); Zwinderman, A.H. [Department of Medical Statistics, Leiden University Medical Centre, Leiden (Netherlands); El-Haddad, S.I. [Department of Oncology and Nuclear Medicine, Cairo University (Egypt)

1998-11-01

Radionuclide renal diagnostic studies play an important role in assessing renal allograft function, especially in the early post-transplant period. In the past two decades various quantitative parameters have been derived from the radionuclide renogram to evaluate changes in perfusion and/or function of the kidney allograft. In this review article we discuss the quantitative parameters that have been used to assess graft condition, with emphasis on the early postoperative period. These quantitative methods are divided into parameters used for assessing renal graft perfusion and parameters used for evaluating parenchymal function. The blood flow in renal transplants can be quantified (a) by measuring the rate of activity appearance in the kidney graft, (b) by calculating the ratio of the integral activity under the transplanted kidney and arterial curves and (c) by calculating the renal vascular transit time. In this article we review a number of parenchymal uptake and excretion indices, such as the accumulation index, the graft uptake capacity at 2 and 10 min, the excretion index and the elimination index. The literature on these parameters shows that they have some practical disadvantages. In addition, values suffer from significant overlap when various graft pathologies coexist. A retrospective study was designed in our institution to evaluate the clinical usefulness of some of the frequently used previously published methods in which the graft function is quantitatively assessed in the early post-transplant period. The quantitative parameters studied which were reasonably reproducible in our hands included: global perfusion index (GPI), cortical perfusion index (CPI), vascular transit time, and the parenchymal parameters uptake capacity at 2 min (UC{sub 2}) and elimination index (K{sub 3/20}). The patient population in this study consisted of 43 patients with 157 technetium-99m mercaptylacetyltriglycine renograms. The perfusion indices GPI and CPI did not allow

Gathering Time-Series Data for Evaluating Behavior-Change Campaigns in Developing Countries: Reactivity of Diaries and Interviews

Science.gov (United States)

Tobias, Robert; Inauen, Jennifer

2010-01-01

Gathering time-series data of behaviors and psychological variables is important to understand, guide, and evaluate behavior-change campaigns and other change processes. However, repeated measurement can affect the phenomena investigated, particularly frequent face-to-face interviews, which are often the only option in developing countries. This…

Evaluating Changes in Climate Literacy among Middle and High School Students who Participate in Climate Change Education Modules

Science.gov (United States)

DeWaters, J.; Powers, S.; Dhaniyala, S.; Small, M.

2012-12-01

Middle school (MS) and high school (HS) teachers have developed and taught instructional modules that were created through their participation in Clarkson University's NASA-funded Project-Based Global Climate Change Education project. A quantitative survey was developed to help evaluate the project's impact on students' climate literacy, which includes content knowledge as well as affective and behavioral attributes. Content objectives were guided primarily by the 2009 document, Climate Literacy: The Essential Principles of Climate Sciences. The survey was developed according to established psychometric principles and methodologies in the sociological and educational sciences which involved developing and evaluating a pool of survey items, adapted primarily from existing climate surveys and questionnaires; preparing, administering, and evaluating two rounds of pilot tests; and preparing a final instrument with revisions informed by both pilot assessments. The resulting survey contains three separate subscales: cognitive, affective, and behavioral, with five self-efficacy items embedded within the affective subscale. Cognitive items use a multiple choice format with one correct response; non-cognitive items use a 5-point Likert-type scale with options generally ranging from "strongly agree" to "strongly disagree" (affective), or "almost always" to "hardly ever" (behavioral). Three versions of the survey were developed and administered using an on-line Zoomerang™ platform to college students/adults; HS students; and MS students, respectively. Instrument validity was supported by using items drawn from existing surveys, by reviewing/applying prior research in climate literacy, and through comparative age-group analysis. The internal consistency reliability of each subscale, as measured by Cronbach's alpha, ranges from 0.78-0.86 (cognitive), 0.87-0.89 (affective) and 0.84-0.85 (behavioral), all satisfying generally accepted criteria for internal reliability of

The Role of Ethnographic Interviewing in Climate Change Evaluation Research: Investigating Intended and Unintended program effects

Science.gov (United States)

Lloro-Bidart, T.

2012-12-01

Ethnographic interviewing is an under-utilized tool in climate change evaluation research, even though it has the potential to serve as a powerful method of data collection. The utility of the ethnographic interview lies in its ability to elicit responses from program participants describing what a program is in practice, shedding light on both intended and unintended program impacts. Drawing on evaluation work involving a federally-funded climate change grant at the University of California, Riverside, I will discuss how to design an ethnographic interview protocol in an effort to share "best practices" with other climate change evaluators. Particular attention will be given to applying ethnographic approaches to various program types, even those differing from the one discussed. I will share some of the concrete findings from my work on this grant, to serve as examples of the kinds of data evaluators can collect when employing an ethnographic approach to interviewing. UC Riverside's climate change grant is multi-faceted, however the component studied ethnographically was a science fair mentoring program. About twenty K-12 students from high poverty, ethnically diverse schools who expressed an interest in participating in science fair were paired up with graduate student mentors to simultaneously research climate change and design authentic science fair projects to compete at various levels. Since one of the stated goals of the grant is to "stimulate…students to consider climate science as a career track through experiential education activities" I was particularly interested in how student experiences with the project might differ from school science which has historically "pushed out" ethnically diverse students like those in many of Riverside's schools. (In the program students are able to interact one-on-one with a mentor and in school settings there is typically one teacher for more than thirty students). I also sought to understand student perceptions of

Consideration of environmental change in the safety evaluation: Long-term climate scenarios in the Iberian Peninsula

International Nuclear Information System (INIS)

Recreo Jimenez, F.; Ruiz Rivas, C.

1997-01-01

The main objective of this report is twofold. On the one hand, to define the most likely sequences of climate states in the Iberian Peninsula for a period of 125 Ka into the future, to the next interglacial stage, 125 Ka AP; on the other hand, to establish potential climate scenarios during such a period of time determining also the variability ranges of primary climate and climate-related variables of interest to the post-closure performance assessment and underground repository safety evaluations. The report reviews the potential effects of environmental changes on the performance of underground radioactive waste repositories, emphasizing the consideration given to long-term climatic changes in radioactive waste disposal system safety evaluations. (Author)

Multi-criteria evaluation of CMIP5 GCMs for climate change impact analysis

Science.gov (United States)

Ahmadalipour, Ali; Rana, Arun; Moradkhani, Hamid; Sharma, Ashish

2017-04-01

Climate change is expected to have severe impacts on global hydrological cycle along with food-water-energy nexus. Currently, there are many climate models used in predicting important climatic variables. Though there have been advances in the field, there are still many problems to be resolved related to reliability, uncertainty, and computing needs, among many others. In the present work, we have analyzed performance of 20 different global climate models (GCMs) from Climate Model Intercomparison Project Phase 5 (CMIP5) dataset over the Columbia River Basin (CRB) in the Pacific Northwest USA. We demonstrate a statistical multicriteria approach, using univariate and multivariate techniques, for selecting suitable GCMs to be used for climate change impact analysis in the region. Univariate methods includes mean, standard deviation, coefficient of variation, relative change (variability), Mann-Kendall test, and Kolmogorov-Smirnov test (KS-test); whereas multivariate methods used were principal component analysis (PCA), singular value decomposition (SVD), canonical correlation analysis (CCA), and cluster analysis. The analysis is performed on raw GCM data, i.e., before bias correction, for precipitation and temperature climatic variables for all the 20 models to capture the reliability and nature of the particular model at regional scale. The analysis is based on spatially averaged datasets of GCMs and observation for the period of 1970 to 2000. Ranking is provided to each of the GCMs based on the performance evaluated against gridded observational data on various temporal scales (daily, monthly, and seasonal). Results have provided insight into each of the methods and various statistical properties addressed by them employed in ranking GCMs. Further; evaluation was also performed for raw GCM simulations against different sets of gridded observational dataset in the area.

Evaluation of the dentin changes in teeth subjected to endodontic treatment and photodynamic therapy

Directory of Open Access Journals (Sweden)

Mariane Floriano Lopes Santos LACERDA

Full Text Available Abstract Introduction Antimicrobial photodynamic therapy (PDT is an efficient adjuvant technique to promote disinfection of the root canal system. Therefore, it is important to investigate changes to dentin morphology and permeability induced by the use of diode laser on the root dentin. Objective The purpose of this study was to investigate morphological changes and the percentage of apical leakage after the use of laser. Material and method Forty single-rooted teeth were instrumented using rotary system and irrigated. Teeth were randomly divided in two groups: G1 - not exposed to PDT (control, and G2 - pretreated with toluidine blue photosensitizer and irradiated with AsGaAl laser diode. Ten teeth in each group were evaluated by SEM for morphological changes. The other ten teeth were filled and stained with Rhodamine B to evaluate the apical leakage. Result The results showed significant difference between G1 and G2 (p 0.001. The apical leakage was significantly higher in G2 than in G1 (p <0.001 - Student's t-test. Conclusion It was concluded that the use of low-level laser reduced the smear layer and opened the dentinal tubules. Use of laser increased the permeability of the apical dentin.

Evaluation of macular thickness change after inferior oblique muscle recession surgery

Directory of Open Access Journals (Sweden)

Ece Turan-Vural

2014-01-01

Full Text Available Purpose: This study aimed to evaluate the changes in macular thickness following inferior oblique muscle recession surgery. Materials and Methods: Thirty-eight eyes from 21 patients undergoing ocular muscle surgery were included. Patients were grouped into three groups based on the type of surgical intervention: Group I (n = 12, inferior oblique recession surgery alone; Group II (n = 12, inferior oblique plus horizontal muscle surgery; Group III (n = 14, horizontal muscle surgery alone. Each eye was scanned using the optical coherence tomography (OCT device preoperatively and on the first postoperative day to measure macular thickness. Results: Following surgery, a significant increase in foveal thickness occurred in Group I (P < 0.05 and Group II (P < 0.01. In addition, a statistically significant difference was observed between the groups with regard to the increase in foveal thickness (P = 0.016, with significantly lower changes in Group III. Conclusion: Our findings suggested that inferior oblique muscle recession surgery is associated with an increase in macular thickness.

Evaluation of diel patterns of relative changes in cell turgor of tomato plants using leaf patch clamp pressure probes

NARCIS (Netherlands)

Lee, K.M.; Driever, S.M.; Heuvelink, E.; Rüger, S.; Zimmermann, U.; Gelder, de A.; Marcelis, L.F.M.

2012-01-01

Relative changes in cell turgor of leaves of well-watered tomato plants were evaluated using the leaf patch clamp pressure probe (LPCP) under dynamic greenhouse climate conditions. Leaf patch clamp pressure changes, a measure for relative changes in cell turgor, were monitored at three different

A multi-criteria evaluation method for climate change mitigation policy instruments

International Nuclear Information System (INIS)

Konidari, Popi; Mavrakis, Dimitrios

2007-01-01

This paper presents an integrated multi-criteria analysis method for the quantitative evaluation of climate change mitigation policy instruments. The method consists of: (i) a set of criteria supported by sub-criteria, all of which describe the complex framework under which these instruments are selected by policy makers and implemented, (ii) an Analytical Hierarchy Process (AHP) process for defining weight coefficients for criteria and sub-criteria according to the preferences of three stakeholders groups and (iii) a Multi-Attribute Theory (MAUT)/Simple Multi-Attribute Ranking Technique (SMART) process for assigning grades to each instrument that is evaluated for its performance under a specific sub-criterion. Arguments for the selected combination of these standard methods and definitions for criteria/sub-criteria are quoted. Consistency and robustness tests are performed. The functionality of the proposed method is tested by assessing the aggregate performances of the EU emission trading scheme at Denmark, Germany, Greece, Italy, Netherlands, Portugal, Sweden and United Kingdom. Conclusions are discussed

Evidence for free-living Bacteroides in Cladophora along the shores of the Great Lakes

Science.gov (United States)

Whitman, Richard L.; Byappanahalli, Muruleedhara; Spoljaric, Ashley; Przybyla-Kelly, Katarzyna; Shively, Dawn A.; Nevers, Meredith

2014-01-01

Bacteroides is assumed to be restricted to the alimentary canal of animals and humans and is considered to be non-viable in ambient environments. We hypothesized that Bacteroides could persist and replicate within beach-stranded Cladophora glomerata mats in southern Lake Michigan, USA. Mean Bacteroides concentration (per GenBac3 Taqman quantitative PCR assay) during summer 2012 at Jeorse Park Beach was 5.2 log calibrator cell equivalents (CCE) g-1 dry weight (dw), ranging from 3.7 to 6.7. We monitored a single beach-stranded mat for 3 wk; bacterial concentrations increased by 1.6 log CCE g-1 dw and correlated significantly with ambient temperature (p = 0.003). Clonal growth was evident, as observed by >99% nucleotide sequence similarity among clones. In in vitro studies, Bacteroides concentrations increased by 5.5 log CCE g-1 after 7 d (27°C) in fresh Cladophora collected from rocks. Partial sequencing of the 16S rRNA gene of 36 clones from the incubation experiment showed highly similar genotypes (≥97% sequence overlap). The closest enteric Bacteroides spp. from the National Center for Biotechnology Information database were only 87 to 91% similar. Genomic similarity, clonality, growth, and persistence collectively suggest that putative, free-living Bacteroides inhabit Cladophora mats of southern Lake Michigan. These findings may have important biological, medical, regulatory, microbial source tracking, and public health implications.

Transcranial radiograph and magnetic resonance imaging in the evaluation of osseous changes of the temporomandibular joint

International Nuclear Information System (INIS)

Cho, Soo Beom; Koh, Kwang Joon

2002-01-01

To evaluate the diagnostic accuracy of transcranial radiographs and magnetic resonance imaging (MRI) of the temporomandibular joint (TMJ) in the assessment of osseous changes of the condylar head and articular eminence. Osseous changes of the TMJ were evaluated in forty-three patients. Osseous changes of the condylar head and articular eminence were observed in 41 joints and 64 joints, respectively on transcranial radiographs, and 48 joints and 59 joints, respectively on MRI. The flattening, sclerosis, erosion, and osteophyte formation of the condylar heads were observed in 36.6%, 43.9%, 12.2%, and 7.3%, respectively on transcranial radiographs compared with 35.4%, 20.8%, 37.5%, and 6.3%, respectively on MRI. While, the flattening, sclerosis, and erosion of the articular eminences were observed in 26.6%, 67.2%, and 6.2%, respectively on transcranial radiographs compared with 32.2%, 59.3%, and 8.5%, respectively on MRI. There were no statistical differences between transcranial radiographs and MRI scans in the detection of osseous changes of the TMJ. However, MRI scans were superior to the transcranial radiographs in the detection of erosion of the condylar head (p<0.01).

Transcranial radiograph and magnetic resonance imaging in the evaluation of osseous changes of the temporomandibular joint

Energy Technology Data Exchange (ETDEWEB)

Cho, Soo Beom; Koh, Kwang Joon [School of Dentistry, Chonbuk National University, Chonju (Korea, Republic of)

2002-06-15

To evaluate the diagnostic accuracy of transcranial radiographs and magnetic resonance imaging (MRI) of the temporomandibular joint (TMJ) in the assessment of osseous changes of the condylar head and articular eminence. Osseous changes of the TMJ were evaluated in forty-three patients. Osseous changes of the condylar head and articular eminence were observed in 41 joints and 64 joints, respectively on transcranial radiographs, and 48 joints and 59 joints, respectively on MRI. The flattening, sclerosis, erosion, and osteophyte formation of the condylar heads were observed in 36.6%, 43.9%, 12.2%, and 7.3%, respectively on transcranial radiographs compared with 35.4%, 20.8%, 37.5%, and 6.3%, respectively on MRI. While, the flattening, sclerosis, and erosion of the articular eminences were observed in 26.6%, 67.2%, and 6.2%, respectively on transcranial radiographs compared with 32.2%, 59.3%, and 8.5%, respectively on MRI. There were no statistical differences between transcranial radiographs and MRI scans in the detection of osseous changes of the TMJ. However, MRI scans were superior to the transcranial radiographs in the detection of erosion of the condylar head (p<0.01).

Team Sport in the Workplace? A RE-AIM Process Evaluation of ‘Changing the Game’

OpenAIRE

Andrew Brinkley; Hilary McDermot; Fehmidah Munir

2017-01-01

Background: The workplace is a priority setting to promote health. Team sports can be an effective way to promote both physical and social health. This study evaluated the potential enablers and barriers for outcomes of a workplace team sports intervention programme‘Changing the Game’ (CTG). This study was conducted in a FTSE 100 services organisation. This process evaluation was conducted using the RE-AIM framework. Methods: A mixed methods approach was used. Data were collected from the par...

The usefulness of GPS bicycle tracking data for evaluating the impact of infrastructure change on cycling behaviour.

Science.gov (United States)

Heesch, Kristiann C; Langdon, Michael

2016-02-01

Issue addressed A key strategy to increase active travel is the construction of bicycle infrastructure. Tools to evaluate this strategy are limited. This study assessed the usefulness of a smartphone GPS tracking system for evaluating the impact of this strategy on cycling behaviour. Methods Cycling usage data were collected from Queenslanders who used a GPS tracking app on their smartphone from 2013-2014. 'Heat' and volume maps of the data were reviewed, and GPS bicycle counts were compared with surveillance data and bicycle counts from automatic traffic-monitoring devices. Results Heat maps broadly indicated that changes in cycling occurred near infrastructure improvements. Volume maps provided changes in counts of cyclists due to these improvements although errors were noted in geographic information system (GIS) geo-coding of some GPS data. Large variations were evident in the number of cyclists using the app in different locations. These variations limited the usefulness of GPS data for assessing differences in cycling across locations. Conclusion Smartphone GPS data are useful in evaluating the impact of improved bicycle infrastructure in one location. Using GPS data to evaluate differential changes in cycling across multiple locations is problematic when there is insufficient traffic-monitoring devices available to triangulate GPS data with bicycle traffic count data. So what? The use of smartphone GPS data with other data sources is recommended for assessing how infrastructure improvements influence cycling behaviour.

Green shoots of recovery: a realist evaluation of a team to support change in general practice.

Science.gov (United States)

Bartlett, Maggie; Basten, Ruth; McKinley, Robert K

2017-02-08

A multidisciplinary support team for general practice was established in April 2014 by a local National Health Service (NHS) England management team. This work evaluates the team's effectiveness in supporting and promoting change in its first 2 years, using realist methodology. Primary care in one area of England. Semistructured interviews were conducted with staff from 14 practices, 3 key senior NHS England personnel and 5 members of the support team. Sampling of practice staff was purposive to include representatives from relevant professional groups. The team worked with practices to identify areas for change, construct action plans and implement them. While there was no specified timescale for the team's work with practices, it was tailored to each. In realist evaluations, outcomes are contingent on mechanisms acting in contexts, and both an understanding of how an intervention leads to change in a socially constructed system and the resultant changes are outcomes. The principal positive mechanisms leading to change were the support team's expertise and its relationships with practice staff. The 'external view' provided by the team via its corroborative and normalising effects was an important mechanism for increasing morale in some practice contexts. A powerful negative mechanism was related to perceptions of 'being seen as a failing practice' which included expressions of 'shame'. Outcomes for practices as perceived by their staff were better communication, improvements in patients' access to appointments resulting from better clinical and managerial skill mix, and improvements in workload management. The support team promoted change within practices leading to signs of the 'green shoots of recovery' within the time frame of the evaluation. Such interventions need to be tailored and responsive to practices' needs. The team's expertise and relationships between team members and practice staff are central to success. Published by the BMJ Publishing Group

Mid-term evaluation of the Climate Change Action Fund: Science, Impacts and Adaptation (SIA) block

International Nuclear Information System (INIS)

2001-11-01

In 1998, the Climate Change Action Fund was established by the Government of Canada. Its budget represented 150 million dollars over a three year period, and was an additional 625 million dollars in the federal budget of February 2000 was allocated for climate change initiatives, of which 150 million dollars were earmarked over a three year period to the Climate Change Action Fund. To provide input for Treasury Board Submissions looking for funding approval in the future, it was necessary to conduct a mid-term evaluation focused on program performance to date. The period covered by the evaluation was September 2000 to the end of January 2001. This report examined the performance of the Science, Impact and Adaptation Block (SIA). Based on a series of interviews with representatives of Block managers, Technical and Executive Policy Committees, successful applicants, unsuccessful applicants and peer reviewers, as well as a review of the documentation maintained by SIA, it addressed the following issues: Block relevance, progress/success to date, and effectiveness in meeting the objectives. It was determined that the objectives displayed relevance to the climate change agenda of the federal government, progress to date was considered satisfactory, and most of the objectives should be met in a timely fashion. A summary of the findings was included in this document along with recommendations pertaining to the findings. 3 tabs., 1 fig

A model for evaluating stream temperature response to climate change in Wisconsin

Science.gov (United States)

Stewart, Jana S.; Westenbroek, Stephen M.; Mitro, Matthew G.; Lyons, John D.; Kammel, Leah E.; Buchwald, Cheryl A.

2015-01-01

Expected climatic changes in air temperature and precipitation patterns across the State of Wisconsin may alter future stream temperature and flow regimes. As a consequence of flow and temperature changes, the composition and distribution of fish species assemblages are expected to change. In an effort to gain a better understanding of how climatic changes may affect stream temperature, an approach was developed to predict and project daily summertime stream temperature under current and future climate conditions for 94,341 stream kilometers across Wisconsin. The approach uses a combination of static landscape characteristics and dynamic time-series climatic variables as input for an Artificial Neural Network (ANN) Model integrated with a Soil-Water-Balance (SWB) Model. Future climate scenarios are based on output from downscaled General Circulation Models (GCMs). The SWB model provided a means to estimate the temporal variability in groundwater recharge and provided a mechanism to evaluate the effect of changing air temperature and precipitation on groundwater recharge and soil moisture. The Integrated Soil-Water-Balance and Artificial Neural Network version 1 (SWB-ANNv1) Model was used to simulate daily summertime stream temperature under current (1990–2008) climate and explained 76 percent of the variation in the daily mean based on validation at 67 independent sites. Results were summarized as July mean water temperature, and individual stream segments were classified by thermal class (cold, cold transition, warm transition, and warm) for comparison of current (1990–2008) with future climate conditions.

Can commonly used profile planes be used to evaluate changes in lower lip position?

Science.gov (United States)

Buschang, Peter H; Fretty, Kimberly; Campbell, Phillip M

2011-07-01

To determine the validity of five profile planes commonly used to describe the horizontal changes of the lower lip during orthodontic treatment. Pretreatment and posttreatment cephalograms of 79 patients (12.4 ± 2.8 years of age) were evaluated. Lower lip (labrale inferiorus) changes over time were measured relative to the Rickett's E-line, Steiner's S1-line, Burstone's B-line, Sushner's S2-line, and Holdaway's H-line. As an independent measure of actual horizontal lip changes, the labrale inferiorus was measured relative to a stable reference plane registered on the sella and oriented on the SN-7°. The lower lip actually moved anteriorly 2.35 ± 3.35 mm during orthodontic treatment; the five profile planes indicated that the lower lip moved to a more retrusive, posterior position. The five profile planes also showed no statistically significant sex differences in terms of the treatment changes that occurred, while the actual lip changes showed that males exhibited significantly greater changes than females. Actual treatment changes showed that the lower lip moved to a more protrusive position with nonextraction than with extraction treatments, changes that were not evident based on the five profile lines. While lip changes based on the five profile planes demonstrated moderately high to high intercorrelations ranging from 0.81 to 0.97, they showed only weak correlations (r planes measured similar aspects of positional change, none of them closely reflected the actual lower lip changes that occurred. These planes should not be used to measure changes in lip position that occur during treatment.

Evaluation of the magnetic and mechanical properties of reactor pressure vessel steels by incremental permeability change curve measurements

International Nuclear Information System (INIS)

Ebine, N.; Suzuki, M.

2001-01-01

Incremental permeability measurement was performed for two types of structural steels along with the magnetization of their hysteresis minor-loop. The obtained incremental permeability change curve has two sharp peaks, and the width between the two peaks is correlated with the coercivity. Hence the existence of good correlation was verified. On the basis of this result, nondestructive measurement experiments were carried out with planar coils to evaluate changes in the material properties of ferromagnetic structural steel plates. Changes in output voltages from planar coils with different test plates were correlated with their mechanical and magnetic properties. The correlation is so good that the measurement method adopted in this work could be used for nondestructive evaluation of material degradation in ferromagnetic structural steels. (author)

Using theory of change to design and evaluate public health interventions: a systematic review.

Science.gov (United States)

Breuer, Erica; Lee, Lucy; De Silva, Mary; Lund, Crick

2016-05-06

Despite the increasing popularity of the theory of change (ToC) approach, little is known about the extent to which ToC has been used in the design and evaluation of public health interventions. This review aims to determine how ToCs have been developed and used in the development and evaluation of public health interventions globally. We searched for papers reporting the use of "theory of change" in the development or evaluation of public health interventions in databases of peer-reviewed journal articles such as Scopus, Pubmed, PsychInfo, grey literature databases, Google and websites of development funders. We included papers of any date, language or study design. Both abstracts and full text papers were double screened. Data were extracted and narratively and quantitatively summarised. A total of 62 papers were included in the review. Forty-nine (79 %) described the development of ToC, 18 (29 %) described the use of ToC in the development of the intervention and 49 (79 %) described the use of ToC in the evaluation of the intervention. Although a large number of papers were included in the review, their descriptions of the ToC development and use in intervention design and evaluation lacked detail. The use of the ToC approach is widespread in the public health literature. Clear reporting of the ToC process and outputs is important to strengthen the body of literature on practical application of ToC in order to develop our understanding of the benefits and advantages of using ToC. We also propose a checklist for reporting on the use of ToC to ensure transparent reporting and recommend that our checklist is used and refined by authors reporting the ToC approach.

An Evaluation of an Intervention to Change First-Year Psychology Students' Theory of Intelligence

Science.gov (United States)

Skipper, Yvonne

2015-01-01

Some people hold an entity theory of intelligence: they think of intelligence as innate. In contrast, others hold an incremental theory, believing that intelligence can be changed. Previous research has shown that an incremental theory is associated with positive outcomes. The aim of this paper was to evaluate an intervention which promoted an…

Issues in evaluation of ecosystem change in response to global change

Energy Technology Data Exchange (ETDEWEB)

Dowlatabadi, H.; Shevliakova, E.; Kandlikar, M.

1994-12-31

Uncertainty analysis of our integrated climate assessment model has revealed the importance of obtaining better market and non-market impacts. Improving market and non-market damage assessments has necessitated advances in the theoretical and applied dimensions of the problem. The assessment of climate change impacts on ecosystems provides a severe test for the new ideas being put forward. This paper provides a brief overview of, (i) the challenges inherent in modeling ecosystem dynamics; (ii) the problem of selecting an appropriate metric of change; and, (iii) the thorny issue of how to place a monetary value on market and non-market impacts. We focus on two central issues in estimation of impacts: (i) before climate change, are the systems being impacted (both ecological and economic) in equilibrium? and (ii) how quickly do ecological and related economic systems adapt to change? In addition, we attempt to be comprehensive in laying out the magnitude of the challenge ahead.

Follow-up CT Evaluation of the Mural Changes in Active Takayasu Arteritis

International Nuclear Information System (INIS)

Kim, Sang Young; Park, Jae Hyung; Chung, Jin Wook; Kim, Hyo Cheol; Lee, Whal; So, Young Ho; Jae, Hwan Jun

2007-01-01

We wanted to evaluate the mural changes by CT on the follow-up examination of patients with active Takayasu arteritis. The study included 18 patients, (4 males and 14 females), with active Takayasu arteritis. A total of 44 CT examinations were done during the follow-up period (mean: 55.6 months). At the time of the last follow-up CT, the disease, on the basis of the erythrocyte sedimentation rate (ESR), was found to be inactive in five patients and the disease was active and persistent in 13 patients. The thickness and CT attenuation of the aortic wall on the precontrast, arterial and venous phases were measured on the initial and the follow-up CT examinations. The ratio of the mural attenuation over that of the back muscle on the initial CT was compared with the ratio found on the follow-up CT. The initial CT findings included high density and calcifications of the aortic wall in the precontrast images and a thickened wall with enhancements in the arterial and the venous phases. A low-attenuation ring was demonstrated in the venous phase in 15 patients (83%). On the follow-up evaluation, the mean mural thickness decreased significantly from 4.1 mm to 2.4 mm. The mean mural attenuation ratio in the venous phase decreased significantly from 1.9 to 1.3 (p 0.001). The low attenuation ring was identified in seven patients (39%) who had only with active, persistent Takayasu arteritis. The mural changes demonstrated by the follow-up CT evaluations for the patients with active Takayasu arteritis included a decrease of the mural thickness and enhancement, disappearance of the low-attenuation ring on the venous phase, and an increase of the mural attenuation and calcification on the precontrast phase

Effects of Land Use Changes on Some Soil Chemical Properties in Khoy, West Azerbaijan Province

Directory of Open Access Journals (Sweden)

Arezoo Taghipour

2016-02-01

Full Text Available Introduction: Intensified agriculture over a long-term is an important factor in soil change phenomena that can cause some unwanted effects on soil properties. To examine this hypothesis, chemical properties of the soils under sunflower cultivation over five decades and adjoining virgin lands were investigated in order to monitor changes caused by long-term cropping. The studied soils are influenced by continuous sunflower cultivation along with flooding irrigation and using chemical fertilizers for over five decades Materials and Methods: This research was undertaken at Khoy area (38o 10′ to 38o 40′ N latitude and 44o 15′ to 45o 10′ E latitude as the northern part of western-Azarbaijan province in the north-west Iran. The Khoy area is characterized by a semi-arid climate (mean annual rainfall of 300 mm linked with soil moisture and temperature regimes of xeric and mesic, respectively. Agriculturally, the studied area is cropped continuously by sunflower-wheat or barley rotations for over five decades and has received irrigation water from rainfall, groundwater, or seasonal river water. Forty soil surface samples (0-30 cm belonging to 10 soil series from the cultivated soils and the adjoining uncultivated soils were samplied and analyzed for the different chemical properties. In each soil serie, the samples (cultivated soil and adjacent virgin land were selected in similar slope, aspect, drainage condition, and parent materials. Soil analyses were involved soil pH and electrical conductivity (EC, soil organic carbon (SOC, Calcium carbonate equivalent (CCE, cation exchange capacity (CEC, total N, soluble K, exchangeable K, and available K. Potassium absorption ration (PAR was calculated by the concentration of solution K, Ca, Mg and exchangeable potassium percentage (EPP was calculated by exchangeable Na and CEC values Results and Discussion: This study illustrate that long-term continuous sunflower cropping had considerable effects on

Eliciting change in at-risk elders (ECARE): evaluation of an elder abuse intervention program.

Science.gov (United States)

Mariam, Lydia Morris; McClure, Regina; Robinson, J B; Yang, Janet A

2015-01-01

The current study evaluated the effectiveness of a community-based elder abuse intervention program that assists suspected victims of elder abuse and self-neglect through a partnership with local law enforcement. This program, Eliciting Change in At-Risk Elders, involves building alliances with the elder and family members, connecting the elder to supportive services that reduce risk of further abuse, and utilizing motivational interviewing-type skills to help elders overcome ambivalence regarding making difficult life changes. Risk factors of elder abuse decreased over the course of the intervention and nearly three-quarters of participants made progress on their treatment goal, advancing at least one of Prochaska and DiClemente's (1983) stages of change (precontemplation, contemplation, preparation, action, and maintenance). Forty-three percent of elders moved into the stages of action and maintenance regarding their goal. The usefulness of eliciting change via longer-term relationships with vulnerable elders in entrenched elder abuse situations is discussed.

Evaluation of corneal changes after myopic LASIK using the Pentacam®

Directory of Open Access Journals (Sweden)

Khairat YM

2013-09-01

Full Text Available Yehia M Khairat, Yasser H Mohamed, Ismail ANO Moftah, Narden N Fouad Department of Ophthalmology, Faculty of Medicine, El-Minya University, Egypt Background: In this study, we used a Pentacam® device to evaluate the corneal changes that occur after laser-assisted in situ keratomileusis (LASIK. Methods: Our study included 60 eyes of 32 patients. All patients were treated for myopia and myopic astigmatism using LASIK. The eyes were examined preoperatively and 3 months postoperatively using a Pentacam to assess corneal changes with regard to curvature, elevation, and asphericity of the cornea. Results: A statistically significant decrease in mean keratometric power of the anterior corneal surface (P = 0.001 compared with its pre-LASIK value was detected after 3 months, but there was no significant change in keratometric power of the posterior surface (P = 0.836. Asphericity (Q-value of the anterior and posterior surfaces increased significantly after LASIK (P = 0.001. A significant forward bulge of the anterior corneal surface 4 mm and 7 mm from the central zone was detected 3 months post-LASIK (P = 0.001 for both, but there was no significant increase in posterior elevation at 4 mm and 7 mm from the center (P = 0.637 and P = 0.26, respectively. No cases of post-LASIK ectasia were detected. Correlation between different parameters of the corneal surface revealed an indirect relation between changes in pachymetry and anterior corneal elevation at 4 mm and 7 mm from the central zone (r = −0.27, P = 0.13, and r = −0.37, P = 0.04, respectively, and a direct proportion between changes in pachymetry and mean keratometric power of the anterior and posterior corneal surfaces (r = 0.7, P = 0.001 and r = 0.4, P = 0.028, respectively. Conclusion: LASIK causes significant changes at the anterior corneal surface but the effect is subtle and insignificant at the posterior surface. Keywords: LASIK, laser-assisted in situ keratomileusis, Pentacam®, corneal

The earth's ring current - Present situation and future thrusts

Science.gov (United States)

Williams, D. J.

1987-01-01

Particle distributions, currents, and the ring current situation prior to the August 1984 launch of the AMPTE Charge Composition Explorer (CCE) are discussed. CCE results which demonstrate the capability of these new measurements to pursue questions of ring current sources, energization, and transport are presented. Consideration is given to various ring current generation mechanisms which have been discussed in the literature, and a two-step generation process which to a certain extent unifies the previous mechanisms is presented. The first in-situ global observations of ring current decay as obtained through the detection of energetic neutral atoms generated by charge exchange interactions between the ring current and hydrogen geocorona are discussed, as well as the possibility of using the detection of energetic neutral atoms to obtain global images of the earth's ring current.

High-time resolution measurements of upstream magnetic field and plasma conditions during flux transfer events at the Earth's dayside magnetopause

International Nuclear Information System (INIS)

Jacob, J.D.; Cattell, C.

1993-01-01

This paper presents preliminary analysis of six flux transfer events which were observed simultaneously by IRM and CCE. IRM was able to measure magnetic fields and pressures far from the earth, while CCE made observations at the earth's magnetopause. The objective is to better understand the coupling of energy and momentum into the earth's magnetosphere, by in this case trying to better understand the processes active in flux transfer events. For three of the events the observations were made on common field lines, and IRM observed fluctuations in B z large enough to cause a south to north swing in the interplanetary magnetic field (IMF). Pressure pulses were observed during two of these events. For the other three events there was no such consistent behavior of IMF direction or pressure pulses

Evaluating the impact of climate change on landslide occurrence, hazard, and risk: from global to regional scale.

Science.gov (United States)

Gariano, Stefano Luigi; Guzzetti, Fausto

2017-04-01

According to the fifth report of the Intergovernmental Panel on Climate Change, "warming of the climate system is unequivocal". The influence of climate changes on slope stability and landslides is also undisputable. Nevertheless, the quantitative evaluation of the impact of global warming, and the related changes in climate, on landslides remains a complex question to be solved. The evidence that climate and landslides act at only partially overlapping spatial and temporal scales complicates the evaluation. Different research fields, including e.g., climatology, physics, hydrology, geology, hydrogeology, geotechnics, soil science, environmental science, and social science, must be considered. Climatic, environmental, demographic, and economic changes are strictly correlated, with complex feedbacks, to landslide occurrence and variation. Thus, a holistic, multidisciplinary approach is necessary. We reviewed the literature on landslide-climate studies, and found a bias in their geographical distribution, with several studies centered in Europe and North America, and large parts of the world not investigated. We examined advantages and drawbacks of the approaches adopted to evaluate the effects of climate variations on landslides, including prospective modelling and retrospective methods that use landslide and climate records, and paleo-environmental information. We found that the results of landslide-climate studies depend more on the emission scenarios, the global circulation models, the regional climate models, and the methods to downscale the climate variables, than on the description of the variables controlling slope processes. Using ensembles of projections based on a range of emissions scenarios would reduce (or at least quantify) the uncertainties in the obtained results. We performed a preliminary global assessment of the future landslide impact, presenting a global distribution of the projected impact of climate change on landslide activity and abundance

76 FR 10135 - Public Housing Evaluation and Oversight: Changes to the Public Housing Assessment System (PHAS...

Science.gov (United States)

2011-02-23

... Vol. 76 Wednesday, No. 36 February 23, 2011 Part III Department of Housing and Urban Development 24 CFR Parts 901, 902, and 907 Public Housing Evaluation and Oversight: Changes to the Public Housing...

Measuring change over time: the use of geotagged photographs to evaluate the weathering of monuments

Science.gov (United States)

Doehne, E.

2012-04-01

Evaluating the condition of weathered stone surfaces on a monument, building or sculpture requires information on how those surfaces have evolved. In a number of cases, the documentation related to a site or object is either not readily available or has been lost (due to war, fire, etc.). Exploring the use of geotagged photographs to supplement the evaluation of surface changes to monuments was tested using two sites: the Mausoleum at the Huntington Library, Art Collections, and Botanical Gardens in San Marino, California and the Duomo in Florence, Italy. Increasingly, photographs are being geo-located or geotagged, either automatically via GPS/WiFi or manually. Geolocation tags increase the value of a photograph to researchers by providing the geographic location where the image was taken, often along with the date and time the photograph was acquired. Estimates of the number of geolocated photographs posted to the Internet include 148 million on Flickr.com (as of June 3, 2011) increasing to 172 million as of January 15, 2012. On Panarimo.com five million geolocated images were archived as of October 2007. Tools such as auto-geotag and PhotoOverlay are making it easier for users to locate and exactly position existing photographs and historic photographs on sites such as Google Earth (PhotoOverlays are images that are directly embedded in the Google Earth's landscape). 42 photo sharing websites are listed currently on Wikipedia, with seven having Alexa rankings of less than 200, indicating the popularity of photo sharing and the vast nature of this resource. Preliminary results from the Huntington and the Duomo indicate that geolocated images are indeed a useful tool for aiding in understanding stone weathering patterns and changes over time. However, greater software support and new tools are needed to enable researchers to search, organize and analyze groups of photographs from a single geolocation. Such software would have obvious uses beyond the conservation

Social Change and Sport: A Sociological Evaluation

Directory of Open Access Journals (Sweden)

Yılmaz KAPLAN

2013-12-01

Full Text Available This study aims to discuss the relation between social change and sports from a sociological point of view. This study is descriptive in its aim, periodic (discussion in the length of time it covers and theoretical based on literature in its techniqu e. “Social change” is a value judgement - free concept which does not indicate a direction but determines the new situation, the difference occurring in the society compared to the former era or situation. Every society changes in time; however, it cou ld at times be „‟positive‟‟ (in the direction of development, progress, etc... and „‟negative‟‟ at other times (in the direction of regress, deconstruction, etc.... As a social institution, sport, while affecting some social institutions (family, edu cation, economics, politics, religion, communication, healthcare, law, is also affected by them. The process of social change has affected, moreover, has determined sports. As a social event, phenomenon, and institution, sports gains its meaning in the society that it takes place; and it both gets affected by the changes in the society and affects these changes there. It could be the „‟reason‟‟ and the „‟result‟‟ of social changes. Radical changes in the sports and even in the rules of branche s of sports are made depending on the changing social needs, preferences and expectations. Although there isn‟t an obligatory relation between „‟social progress‟‟ and „‟sports‟‟ theoretically, it can be said that the process of social progress contributes to sports and vice versa.

Depolarization changes during acute myocardial ischemia by evaluation of QRS slopes: standard lead and vectorial approach.

Science.gov (United States)

Romero, Daniel; Ringborn, Michael; Laguna, Pablo; Pahlm, Olle; Pueyo, Esther

2011-01-01

Diagnosis and risk stratification of patients with acute coronary syndromes can be improved by adding information from the depolarization phase (QRS complex) to the conventionally used ST-T segment changes. In this study, ischemia-induced changes in the main three slopes of the QRS complex, upward ( ℑ(US)) and downward ( ℑ(DS) ) slopes of the R wave as well as the upward ( ℑ(TS)) slope of the terminal S wave, were evaluated as to represent a robust measure of pathological changes within the depolarization phase. From ECG recordings both in a resting state (control recordings) and during percutaneous coronary intervention (PCI)-induced transmural ischemia, we developed a method for quantification of ℑ(US), ℑ(DS), and ℑ(TS) that incorporates dynamic ECG normalization so as to improve the sensitivity in the detection of ischemia-induced changes. The same method was also applied on leads obtained by projection of QRS loops onto their dominant directions. We show that ℑ(US), ℑ(DS), and ℑ(TS) present high stability in the resting state, thus providing a stable reference for ischemia characterization. Maximum relative factors of change ( ℜ(ℑ)) during PCI were found in leads derived from the QRS loop, reaching 10.5 and 13.7 times their normal variations in the control for ℑ(US) and ℑ(DS), respectively. For standard leads, the relative factors of change were 6.01 and 9.31. The ℑ(TS) index presented a similar behavior to that of ℑ(DS). The timing for the occurrence of significant changes in ℑ(US) and ℑ(DS) varied with lead, ranging from 30 s to 2 min after initiation of coronary occlusion. In the present ischemia model, relative ℑ(DS) changes were smaller than ST changes in most leads, however with only modest correlation between the two indices, suggesting they present different information about the ischemic process. We conclude that QRS slopes offer a robust tool for evaluating depolarization changes during myocardial ischemia.

Evaluating Multispectral Snowpack Reflectivity With Changing Snow Correlation Lengths

Science.gov (United States)

Kang, Do Hyuk; Barros, Ana P.; Kim, Edward J.

2016-01-01

This study investigates the sensitivity of multispectral reflectivity to changing snow correlation lengths. Matzler's ice-lamellae radiative transfer model was implemented and tested to evaluate the reflectivity of snow correlation lengths at multiple frequencies from the ultraviolet (UV) to the microwave bands. The model reveals that, in the UV to infrared (IR) frequency range, the reflectivity and correlation length are inversely related, whereas reflectivity increases with snow correlation length in the microwave frequency range. The model further shows that the reflectivity behavior can be mainly attributed to scattering rather than absorption for shallow snowpacks. The largest scattering coefficients and reflectivity occur at very small correlation lengths (approximately 10(exp -5 m) for frequencies higher than the IR band. In the microwave range, the largest scattering coefficients are found at millimeter wavelengths. For validation purposes, the ice-lamella model is coupled with a multilayer snow physics model to characterize the reflectivity response of realistic snow hydrological processes. The evolution of the coupled model simulated reflectivities in both the visible and the microwave bands is consistent with satellite-based reflectivity observations in the same frequencies. The model results are also compared with colocated in situ snow correlation length measurements (Cold Land Processes Field Experiment 2002-2003). The analysis and evaluation of model results indicate that the coupled multifrequency radiative transfer and snow hydrology modeling system can be used as a forward operator in a data-assimilation framework to predict the status of snow physical properties, including snow correlation length.

Contribution of the working group 2 to the fourth evaluation report of the inter government expert group on the climatic change. Evaluation 2007 of the climatic changes: impacts, adaptation and vulnerability; Contribution du Groupe de travail 2 au quatrieme rapport d'evaluation du Groupe d'expert intergouvernemental sur l'evolution du climat. Bilan 2007 des changements climatiques: impacts, adaptation et vulnerabilite

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This document exposes the results of the fourth evaluation report of the working group II of the inter government experts group on the climatic change. This evaluation presents the today scientific understanding of the climatic change impacts on the humans and their adaptation ability and vulnerability. It is based on the GIEC evaluations and new knowledge added since the third evaluation report. (A.L.B.)

Evaluation of the results of a randomized controlled trial : how to define changes between baseline and follow-up

NARCIS (Netherlands)

Twisk, J.; Proper, K.

2004-01-01

The most common way to evaluate the effect of an intervention is to compare the intervention and non-intervention groups regarding the change in the outcome variable between baseline and follow-up; however, there are many different ways to define "changes". The purpose of this article is to

Evaluating the Impact of Land Use Change on Submerged Aquatic Vegetation Stressors in Mobile Bay

Science.gov (United States)

Al-Hamdan, Mohammad; Estes, Maurice G., Jr.; Quattrochi, Dale; Thom, Ronald; Woodruff, Dana; Judd, Chaeli; Ellis, Jean; Watson, Brian; Rodriquez, Hugo; Johnson, Hoyt

2009-01-01

Alabama coastal systems have been subjected to increasing pressure from a variety of activities including urban and rural development, shoreline modifications, industrial activities, and dredging of shipping and navigation channels. The impacts on coastal ecosystems are often observed through the use of indicator species. One such indicator species for aquatic ecosystem health is submerged aquatic vegetation (SAV). Watershed and hydrodynamic modeling has been performed to evaluate the impact of land use change in Mobile and Baldwin counties on SAV stressors and controlling factors (temperature, salinity, and sediment) in Mobile Bay. Watershed modeling using the Loading Simulation Package in C++ (LSPC) was performed for all watersheds contiguous to Mobile Bay for land use scenarios in 1948, 1992, 2001, and 2030. Landsat-derived National Land Cover Data (NLCD) were used in the 1992 and 2001 simulations after having been reclassified to a common classification scheme. The Prescott Spatial Growth Model was used to project the 2030 land use scenario based on current trends. The LSPC model simulations provided output on changes in flow, temperature, and sediment for 22 discharge points into the Bay. Theses results were inputted in the Environmental Fluid Dynamics Computer Code (EFDC) hydrodynamic model to generate data on changes in temperature, salinity, and sediment on a grid with four vertical profiles throughout Mobile Bay. The changes in the aquatic ecosystem were used to perform an ecological analysis to evaluate the impact on SAV habitat suitability. This is the key product benefiting the Mobile Bay coastal environmental managers that integrates the influences of temperature, salinity, and sediment due to land use driven flow changes with the restoration potential of SAVs.

Inhibitory self-control moderates the effect of changed implicit food evaluations on snack food consumption.

Science.gov (United States)

Haynes, Ashleigh; Kemps, Eva; Moffitt, Robyn

2015-07-01

The current study used a modified implicit association test (IAT) to change implicit evaluations of unhealthy snack food and tested its effects on subsequent consumption. Furthermore, we investigated whether these effects were moderated by inhibitory self-control. A sample of 148 women (17-25 years) motivated to manage weight through healthy eating completed an IAT intervention, and pre- and post-intervention IATs assessing implicit evaluations of unhealthy food. The intervention IAT trained participants to pair unhealthy food stimuli with either positive or negative stimuli. A task disguised as a taste-test was used to assess consumption of unhealthy snack foods. Inhibitory self-control was measured using a self-report scale. As predicted, the implicit evaluation of unhealthy food became more negative from pre- to post-training among participants in the food negative pairing condition; however, there was no corresponding change in the food positive pairing condition. The effect of the training on snack consumption was moderated by inhibitory self-control with only participants low in inhibitory self-control having lower snack intake following the food negative training. This finding is consistent with dual-process models of behaviour which predict that self-control capacity renders impulses less influential on behaviour. Furthermore, it suggests that an intervention that retrains implicit food evaluations could be effective at reducing unhealthy eating, particularly among those with low inhibitory self-control. Copyright © 2015 Elsevier Ltd. All rights reserved.

Contextualising the self and social change making: an evaluation of the Young Social Pioneers program

Directory of Open Access Journals (Sweden)

Naomi Berman

2012-03-01

Full Text Available This article presents the findings of an evaluation of an innovative Australian social entrepreneurship and leadership program to highlight some of the challenges young social change makers face as they attempt to influence change in their local, national and international environments. Through an investigation of an innovative Australian social entrepreneurship program, this article demonstrates how reflexive, communicative and participatory practices position young people at the forefront of new forms of civic engagement and that there are certain needs relating to the development of self and community which must to be addressed in order that these young social actors can fulfil their civic aspirations. The findings of the evaluation reported here demonstrate that if social entrepreneur programs are to be successful in providing a service to young people, they need to foster the creation of environments characterised by collectivism, collaboration and opportunities for self development while providing practical solutions to common barriers faced by social entrepreneurs

Bone Structural Changes and Estimated Strength After Gastric Bypass Surgery Evaluated by HR-pQCT

DEFF Research Database (Denmark)

Frederiksen, Katrine Diemer; Hanson, Stine; Hansen, Stinus

2016-01-01

Roux-en-Y gastric bypass surgery (RYGB) is an effective treatment of morbid obesity, with positive effects on obesity-related complications. The treatment is associated with bone loss, which in turn might increase fracture risk. The aim of this study was to evaluate changes in bone mineral density...... (BMD) and bone architecture assessed using dual-energy X-ray absorptiometry (DXA) and high-resolution peripheral quantitative computed tomography (HR-pQCT), 6 and 12 months after RYGB, and correlate them to changes in selected biochemical markers. A prospective cohort study included 25 morbidly obese...

Qualitative evaluation of Chang method of attenuation correction on heart SPECT by using custom made heart phantom

International Nuclear Information System (INIS)

Takavar, A.; Eftekhari, M.; Beiki, D.; Saghari, M.; Mostaghim, N.; Sohrabi, M.

2003-01-01

SPECT detects γ- rays from administrated radiopharmaceutical within the patient body. γ-rays pass through different tissues before reaching detectors and are attenuated. Attenuation can cause artifacts; therefore different and used to minimize attenuation effects. In our study efficacy of Chang method was evaluated for attenuation purpose, using a custom made heart phantom. Due to different tissues surrounding heart, evaluation is not uniform more over activity distribution around heart is also non- uniform. In Chang method distribution of radioactivity and attenuation due to the surrounding tissue is considered uniform. Our phantom is a piece of plastic producing similar SPECT image as left ventricle. A dual head, ADAC system was used in our study. Images were taken by 180 d ig C (limited angle) and 360 d ig C (total rotation). Images are compared with and without attenuation correction. Our results indicate that Chang attenuation correction method is not capable of eliminating attenuation artifact completely in particular attenuation effects caused by breast

Identifying MRI markers to evaluate early treatment-related changes post-laser ablation for cancer pain management

Science.gov (United States)

Tiwari, Pallavi; Danish, Shabbar; Madabhushi, Anant

2014-03-01

Laser interstitial thermal therapy (LITT) has recently emerged as a new treatment modality for cancer pain management that targets the cingulum (pain center in the brain), and has shown promise over radio-frequency (RF) based ablation which is reported to provide temporary relief. One of the major advantages enjoyed by LITT is its compatibility with magnetic resonance imaging (MRI), allowing for high resolution in vivo imaging to be used in LITT procedures. Since laser ablation for pain management is currently exploratory and is only performed at a few centers worldwide, its short-, and long-term effects on the cingulum are currently unknown. Traditionally treatment effects are evaluated by monitoring changes in volume of the ablation zone post-treatment. However, this is sub-optimal since it involves evaluating a single global parameter (volume) to detect changes pre-, and post-MRI. Additionally, the qualitative observations of LITT-related changes on multi-parametric MRI (MPMRI) do not specifically address differentiation between the appearance of treatment related changes (edema, necrosis) from recurrence of the disease (pain recurrence). In this work, we explore the utility of computer extracted texture descriptors on MP-MRI to capture early treatment related changes on a per-voxel basis by extracting quantitative relationships that may allow for an in-depth understanding of tissue response to LITT on MRI, subtle changes that may not be appreciable on original MR intensities. The second objective of this work is to investigate the efficacy of different MRI protocols in accurately capturing treatment related changes within and outside the ablation zone post-LITT. A retrospective cohort of studies comprising pre- and 24-hour post-LITT 3 Tesla T1-weighted (T1w), T2w, T2-GRE, and T2-FLAIR acquisitions was considered. Our scheme involved (1) inter-protocol as well as inter-acquisition affine registration of pre- and post-LITT MRI, (2) quantitation of MRI parameters

National program of fight against the climate change. 2. annual evaluation and forecasting

International Nuclear Information System (INIS)

2002-01-01

This conference discussed the actions realized in the framework of the National Plan of Fight against the Climatic Change (PNLCC). The first part presents the problem, the evaluation of the PNLCC application and the control tools. the second part is devoted to the transport sector and the second to the buildings and the electric power demand control. The last part deals with the prospective and the challenges of the PNLCC. (A.L.B.)

Evaluating of the relation among emphysematous changes detected by the chest CT, the smoking history and the respiratory function

International Nuclear Information System (INIS)

Hayase, Taichiro; Higuchi, Tomoaki; Iwamoto, Tomohiro

2008-01-01

An influence of smoking on the respiratory function and pulmonary emphysema is well known. However, there are few reports evaluating the relation between smoking and emphysematous changes detected by the chest CT. In this study, we evaluated the relation among emphysematous changes detected by the chest CT, the smoking history and the respiratory function (%VC, FEV 1.0 %). Four hundred and sixty-six healthy members of Self-defense force (mean age; 50.1±5.32 years; all men) were recruited in this study. Emphysematous changes were confirmed by the chest CT in 26 subjects. (5.56%, group A) The remaining 440 subjects showed no emphysematous changes. (group B) On the other hand, 8 subjects (1.7%) were FEV 1.0 % 1.0 % was 76.7±4.7% in group A and 82.5±5.0% in group B (P<0.05). %VC was 117±11.3% in group A and 112±13.2% in group B (P<0.05). In addition, risk to show emphysematous changes in CT was high among the patients whose Brinkmann index (BI) value was over 600 (Odds ratio, 8.2; 95% confidence interval (CI), 3.5 to 18.5). We conducted that it is possible to evaluate the influence of smoking on the respiratory function by the CT as well as respiratory function test. (author)

Cone-beam computed tomography evaluation of dental, skeletal, and alveolar bone changes associated with bonded rapid maxillary expansion

Directory of Open Access Journals (Sweden)

Namrata Dogra

2016-01-01

Full Text Available Aims and Objectives: To evaluate skeletal changes in maxilla and its surrounding structures, changes in the maxillary dentition and maxillary alveolar bone changes produced by bonded rapid maxillary expansion (RME using cone-beam computed tomography (CBCT. Materials and Methods: The sample consisted of 10 patients (6 males and 4 females with age range 12 to 15 years treated with bonded RME. CBCT scans were performed at T1 (pretreatment and at T2 (immediately after expansion to evaluate the dental, skeletal, and alveolar bone changes. Results: RME treatment increased the overall skeletal parameters such as interorbital, zygomatic, nasal, and maxillary widths. Significant increases in buccal maxillary width was observed at first premolar, second premolar, and first molar level. There was a significant increase in arch width both on the palatal side and on the buccal side. Significant tipping of right and left maxillary first molars was seen. There were significant reductions in buccal bone plate thickness and increase in palatal bone plate thickness. Conclusions: Total expansion achieved with RME was a combination of dental, skeletal and alveolar bone changes. At the first molar level, 28.45% orthopedic, 16.03% alveolar bone bending, and 55.5% orthodontic changes were observed.

Quantitative evaluation of changes in pleural effusion using digital images of the chest

International Nuclear Information System (INIS)

Nishiike, Shigeaki; Fujimura, Ichiro; Sagara, Kenji; Sakashita, Keiji

2000-01-01

Exposure data recognition (EDR) is a function of FCR that automatically determines the optimal density of images. This function makes it difficult to evaluate changes in pleural effusion on sequential chest CR. We developed a method to quantify the amount of pleural effusion using the digital value and S value of chest CR. We evaluated the efficacy of the method to quantify the amount of pleural effusion using these values of chest CR in clinical settings. The study period was from December 1996 to January 1999. Study 1: Chest CR was carried out before and after pleural cavity drainage in 70 cases. The volume calculated with the method using the digital value and S value of CR [x(ml)] was compared with the drained volume [y1] on both sides. Study 2: Change in pleural effusion was estimated with a method using CT (y2) and with the method using the digital value and S value of CR (x). The relationship of these two data was investigated. Study 1: The regression equations between x and y1 were y1=1.05x+21.1 (r 2 =0.89) on the right side and y1=0.95x+69.7 (r 2 =0.68) on the left side. Study 2: The regression equations between x and y2 were y2=0.75x-1.88 (r 2 =0.70) on the right side and y2=0.87x-1.27 (r 2 =0.65) on the left side. The method using the digital value and S value of CR was effective for quantifying changes in pleural effusion. (author)

Soil water content evaluation considering time-invariant spatial pattern and space-variant temporal change

Science.gov (United States)

Hu, W.; Si, B. C.

2013-10-01

Soil water content (SWC) varies in space and time. The objective of this study was to evaluate soil water content distribution using a statistical model. The model divides spatial SWC series into time-invariant spatial patterns, space-invariant temporal changes, and space- and time-dependent redistribution terms. The redistribution term is responsible for the temporal changes in spatial patterns of SWC. An empirical orthogonal function was used to separate the total variations of redistribution terms into the sum of the product of spatial structures (EOFs) and temporally-varying coefficients (ECs). Model performance was evaluated using SWC data of near-surface (0-0.2 m) and root-zone (0-1.0 m) from a Canadian Prairie landscape. Three significant EOFs were identified for redistribution term for both soil layers. EOF1 dominated the variations of redistribution terms and it resulted in more changes (recharge or discharge) in SWC at wetter locations. Depth to CaCO3 layer and organic carbon were the two most important controlling factors of EOF1, and together, they explained over 80% of the variations in EOF1. Weak correlation existed between either EOF2 or EOF3 and the observed factors. A reasonable prediction of SWC distribution was obtained with this model using cross validation. The model performed better in the root zone than in the near surface, and it outperformed conventional EOF method in case soil moisture deviated from the average conditions.

Hyperdynamic circulatory changes in liver cirrhosis: Comparative evaluation by doppler ultrasonography with normal subjects

Energy Technology Data Exchange (ETDEWEB)

Im, Dae Wook; Baik, Soon Koo; Suh, Jung In; Kim, Jae Woo; Park, Yong Soon; Kim, Hyun Soo; Lee, Dong Ki; Kwon, Sang Ok [Yonsei University, Wonju College of Medicine, Wonju (Korea, Republic of)

2001-12-15

To evaluate the cardiovascular and splanchnic hemodynamic changes in patients with liver cirrhosis and to compare with those of the normal controls using doppler ultrasonography. A total of 129 patients including 23 of Child-Pugh class A, 24 of class A, 24 of class B, 30 of class C, and 52 of the control group were included. Cardiac output (CO), systemic vascular resistance index (SVRI), and blood flow and pulsatility index (PI) of the superior mesenteric artery (SMA) were evaluated and compared among each groups. CO and SMA blood flow in the cirrhotic group were significantly higher than those in the control group, and the increase in CO and SMA blood flow showed a statistically significant correlation with the degree of liver dysfunction (p<0.01). SVRI and SMA PI reflecting vascular resistance in the cirrhotic group were significantly lower than those in the control group, and the decrease in SVRI and SMA PI also showed a statistically significant correlation with the degree of liver dysfunction (p<0.01). SMA blood flow showed a statistically significant inverse relationship with SMA PI (R{sup 2}=0.230). Hyperdynamic circulatory changes such as increases in CO and splanchnic blood flow were present in patients with liver cirrhosis. These changes may contribute to the development and maintenance of the portal hypertension due to an increase in portal blood flow an increase in portal blood flow.

Evaluation of climate change impacts on energy demand

DEFF Research Database (Denmark)

Taseska, Verica; Markovska, Natasa; Callaway, John M.

2012-01-01

change and the energy demand in Macedonia. The analyses are conducted using the MARKAL (MARKet ALlocation)-Macedonia model, with a focus on energy demand in commercial and residential sectors (mainly for heating and cooling). Three different cases are developed: 1) Base Case, which gives the optimal...... electricity production mix, taking into account country’s development plans (without climate change); 2) Climate Change Damage Case, which introduces the climate changes by adjusting the heating and cooling degree days inputs, consistent with the existing national climate scenarios; and 3) Climate Change...... Adaptation Case, in which the optimal electricity generation mix is determined by allowing for endogenous capacity adjustments in the model. This modeling exercise will identify the changes in the energy demand and in electricity generation mix in the Adaptation Case, as well as climate change damages...

Developing a complex intervention for diet and activity behaviour change in obese pregnant women (the UPBEAT trial); assessment of behavioural change and process evaluation in a pilot randomised controlled trial.

Science.gov (United States)

Poston, Lucilla; Briley, Annette L; Barr, Suzanne; Bell, Ruth; Croker, Helen; Coxon, Kirstie; Essex, Holly N; Hunt, Claire; Hayes, Louise; Howard, Louise M; Khazaezadeh, Nina; Kinnunen, Tarja; Nelson, Scott M; Oteng-Ntim, Eugene; Robson, Stephen C; Sattar, Naveed; Seed, Paul T; Wardle, Jane; Sanders, Thomas A B; Sandall, Jane

2013-07-15

Complex interventions in obese pregnant women should be theoretically based, feasible and shown to demonstrate anticipated behavioural change prior to inception of large randomised controlled trials (RCTs). The aim was to determine if a) a complex intervention in obese pregnant women leads to anticipated changes in diet and physical activity behaviours, and b) to refine the intervention protocol through process evaluation of intervention fidelity. We undertook a pilot RCT of a complex intervention in obese pregnant women, comparing routine antenatal care with an intervention to reduce dietary glycaemic load and saturated fat intake, and increase physical activity. Subjects included 183 obese pregnant women (mean BMI 36.3 kg/m2). Compared to women in the control arm, women in the intervention arm had a significant reduction in dietary glycaemic load (33 points, 95% CI -47 to -20), (p change. Physical discomfort and sustained barriers to physical activity were common at 28 weeks' gestation. Process evaluation identified barriers to recruitment, group attendance and compliance, leading to modification of intervention delivery. This pilot trial of a complex intervention in obese pregnant women suggests greater potential for change in dietary intake than for change in physical activity, and through process evaluation illustrates the considerable advantage of performing an exploratory trial of a complex intervention in obese pregnant women before undertaking a large RCT. ISRCTN89971375.

Evaluation of how a curriculum change in nurse education was managed through the application of a business change management model: A qualitative case study.

Science.gov (United States)

Chowthi-Williams, Annette; Curzio, Joan; Lerman, Stephen

2016-01-01

Curriculum changes are a regular feature of nurse education, yet little is known about how such changes are managed. Research in this arena is yet to emerge. Evaluation of how a curriculum change in nurse education was managed through the application of a business change management model. A qualitative case study: the single case was the new curriculum, the Primary Care Pathway. One executive, three senior managers, two academics and nineteen students participated in this study in one faculty of health and social care in a higher education institution. The findings suggest that leadership was pivotal to the inception of the programme and guiding teams managed the change and did not take on a leadership role. The vision for the change and efforts to communicate it did not reach the frontline. Whilst empowerment was high amongst stakeholders and students, academics felt dis-empowered. Short-term wins were not significant in keeping up the momentum of change. The credibility of the change was under challenge and the concept of the new programme was not yet embedded in academia. Differences between the strategic and operational part of the organisation surfaced with many challenges occurring at the implementation stage. The business change model used was valuable, but was found to not be applicable during curriculum changes in nurse education. A new change model emerged, and a tool was developed alongside to aid future curriculum changes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Youth transitioning out of foster care: an evaluation of a Supplemental Security Income policy change.

Science.gov (United States)

King, Laura; Rukh-Kamaa, Aneer

2013-01-01

Youths with disabilities face numerous challenges when they transition to adulthood. Those who are aging out of foster care face the additional challenge of losing their foster care benefits, although some will be eligible for Supplemental Security Income (SSI) payments after foster care ceases. However, the time needed to process SSI applications exposes those youths to a potential gap in the receipt of benefits as they move between foster care and SSI. We evaluate the effects of a 2010 Social Security Administration policy change that allows such youths to apply for SSI payments 60 days earlier than the previous policy allowed. The change provides additional time for processing claims before the applicant ages out of the foster care system. We examine administrative records on SSI applications from before and after the policy change to determine if the change has decreased the gap between benefits for the target population.

Learning Change from Synthetic Aperture Radar Images: Performance Evaluation of a Support Vector Machine to Detect Earthquake and Tsunami-Induced Changes

Directory of Open Access Journals (Sweden)

Marc Wieland

2016-09-01

Full Text Available This study evaluates the performance of a Support Vector Machine (SVM classifier to learn and detect changes in single- and multi-temporal X- and L-band Synthetic Aperture Radar (SAR images under varying conditions. The purpose is to provide guidance on how to train a powerful learning machine for change detection in SAR images and to contribute to a better understanding of potentials and limitations of supervised change detection approaches. This becomes particularly important on the background of a rapidly growing demand for SAR change detection to support rapid situation awareness in case of natural disasters. The application environment of this study thus focuses on detecting changes caused by the 2011 Tohoku earthquake and tsunami disaster, where single polarized TerraSAR-X and ALOS PALSAR intensity images are used as input. An unprecedented reference dataset of more than 18,000 buildings that have been visually inspected by local authorities for damages after the disaster forms a solid statistical population for the performance experiments. Several critical choices commonly made during the training stage of a learning machine are being assessed for their influence on the change detection performance, including sampling approach, location and number of training samples, classification scheme, change feature space and the acquisition dates of the satellite images. Furthermore, the proposed machine learning approach is compared with the widely used change image thresholding. The study concludes that a well-trained and tuned SVM can provide highly accurate change detections that outperform change image thresholding. While good performance is achieved in the binary change detection case, a distinction between multiple change classes in terms of damage grades leads to poor performance in the tested experimental setting. The major drawback of a machine learning approach is related to the high costs of training. The outcomes of this study, however

Evaluation of risk impact of changes to Completion Times addressing model and parameter uncertainties

International Nuclear Information System (INIS)

Martorell, S.; Martón, I.; Villamizar, M.; Sánchez, A.I.; Carlos, S.

2014-01-01

This paper presents an approach and an example of application for the evaluation of risk impact of changes to Completion Times within the License Basis of a Nuclear Power Plant based on the use of the Probabilistic Risk Assessment addressing identification, treatment and analysis of uncertainties in an integrated manner. It allows full development of a three tired approach (Tier 1–3) following the principles of the risk-informed decision-making accounting for uncertainties as proposed by many regulators. Completion Time is the maximum outage time a safety related equipment is allowed to be down, e.g. for corrective maintenance, which is established within the Limiting Conditions for Operation included into Technical Specifications for operation of a Nuclear Power Plant. The case study focuses on a Completion Time change of the Accumulators System of a Nuclear Power Plant using a level 1 PRA. It focuses on several sources of model and parameter uncertainties. The results obtained show the risk impact of the proposed CT change including both types of epistemic uncertainties is small as compared with current safety goals of concern to Tier 1. However, what concerns to Tier 2 and 3, the results obtained show how the use of some traditional and uncertainty importance measures helps in identifying high risky configurations that should be avoided in NPP technical specifications no matter the duration of CT (Tier 2), and other configurations that could take part of a configuration risk management program (Tier 3). - Highlights: • New approach for evaluation of risk impact of changes to Completion Times. • Integrated treatment and analysis of model and parameter uncertainties. • PSA based application to support risk-informed decision-making. • Measures of importance for identification of risky configurations. • Management of important safety issues to accomplish safety goals

Evaluating Women’s Labour in 1990s Japan: The Changing Labour Standards Law

Directory of Open Access Journals (Sweden)

Kirsti Rawstron

2011-01-01

Full Text Available This article outlines the legislative changes regarding Japanese working women in the 1990s, specifically the changes to the Labour Standards Law. This Law was altered in 1997 (effective 1999 by the removal of a number of provisions known as the Women’s ‘Protection’ Provisions (josei hogo kitei. These gender-specific provisions restricted Japanese women from working particular jobs and hours, and limited overtime and holiday work. The role of these gender-specific provisions is examined through a collection of articles from four of Japan’s mainstream daily, widely-circulated newspapers: the Asahi Shinbun, the Mainichi Shinbun, the Nihon Keizai Shinbun, and the Yomiuri Shinbun. These newspapers were of the opinion that the provisions were simultaneously protective and restrictive towards women. The newspapers all supported the removal of the provisions in order to increase equality in Japan’s workforce and society. However, all presented strong concerns that Japanese society was unable to support these changes. This article situates the law reform within the wider context of 1990s Japan, by tracing the links between labour legislation and socio-cultural issues in Japan, particularly the low fertility rate. This article closes with an evaluation of changes within Japanese society and working habits since the removal of the provisions.

Evaluation of Biochemical Changes in Chronic Arsenic Poisoning among Bangladeshi Patients

Directory of Open Access Journals (Sweden)

Laila N. Islam

2005-12-01

Full Text Available An estimated 40 million people in Bangladesh have been suffering from arsenic toxicity-related diseases because of drinking water contamination with high levels of naturally occurring arsenic. To evaluate the biochemical changes in chronic arsenic exposure, a total of 115 exposed subjects diagnosed as arsenicosis patients were examined and interviewed, and 120 unexposed volunteers were enrolled in this study. Drinking water, urine and peripheral blood samples were collected from all participants and analyzed. The average levels of arsenic in the drinking water and spot urine samples of the arsenicosis patients were 218.18g/L and 234.68g/L, respectively, and duration of exposure was 7.6 ± 5.2 yrs that ranged from 1-25 yrs. Prevalence of diabetes mellitus among chronic arsenic-exposed subjects was about 2.8 times higher than the unexposed subjects. The activities of alkaline phosphatase were significantly elevated in the patients, 197 U/L compared to 149 U/L in the controls, but alanine transaminase and aspartate transaminase were mostly normal. The patients had significantly lower levels of serum creatinine, 0.97 mg/dL compared to 1.15 mg/dL in the controls; but had significantly elevated levels of total protein, 84 g/L and 77 g/L respectively. The mean level of inorganic phosphate in the serum of arsenicosis patients was 6.4 mg/dL compared to 4.6 mg/dL in the unexposed subjects and the level was significantly higher, indicating substitution of the pentavalent arsenate for the phosphate ion causing underutilization of the latter. Evaluation of the lipid profiles showed while the levels of triacylglycerol were not much different, the patients had significantly lower levels of cholesterol, HDL-cholesterol and LDL-cholesterol compared to the unexposed subjects. These findings suggest significant changes in biochemical parameters in human arsenic toxicity.

Evaluating the transitional mosaic: frameworks of change from Neanderthals to Homo sapiens in eastern Europe

Science.gov (United States)

Davies, William; White, Dustin; Lewis, Mark; Stringer, Chris

2015-06-01

Defining varying spatial and temporal analytical scales is essential before evaluating the responses of late Neanderthals and early Homo sapiens to Abrupt Environmental Transitions (AETs) and environmental disasters for the period 130-25 ka. Recent advances in addressing the population histories and interactions (using both genetic and archaeological evidence) of Neanderthals and H. sapiens have encouraged consideration of more subtle dynamics of archaeological change. Descriptions of change based on methodologies pioneered some 160 years ago are no longer adequate to explain the patterning we now see in the record. New chronological results, using multiple dating methods, allow us to begin to unpick the spatial and temporal scales of change. Isochronic markers (such as specific volcanic eruptions) can be used to create temporal frameworks (lattices), and results from other dating techniques compared against them. A combination of chronological lattices and direct dating of diagnostic artefacts and human fossils permits us, for the first time, to have greater confidence in connecting human (recent hominin) species and their behavioural responses to environmental conditions, and in quantifying scales of change over time and space (time-transgression). The timing of innovations, particularly those in bone, antler and ivory, can be directly quantified and tested, and used to re-evaluate longstanding models of cultural change. This paper also uses these new chronologies to explore the ecologies of late Neanderthals and early H. sapiens: their population densities, mobilities, resources exploited and possible interactions. Environmental productivity estimates are used to generate new questions of potential population densities and mobilities, and thus the sensitivity of these groups to environmental perturbations. Scales and intensities of effect on environments from natural disasters and AETs (notably Heinrich Events and the Campanian Ignimbrite eruption) are defined

Evaluating fuzzy operators of an object-based image analysis for detecting landslides and their changes

Science.gov (United States)

Feizizadeh, Bakhtiar; Blaschke, Thomas; Tiede, Dirk; Moghaddam, Mohammad Hossein Rezaei

2017-09-01

This article presents a method of object-based image analysis (OBIA) for landslide delineation and landslide-related change detection from multi-temporal satellite images. It uses both spatial and spectral information on landslides, through spectral analysis, shape analysis, textural measurements using a gray-level co-occurrence matrix (GLCM), and fuzzy logic membership functionality. Following an initial segmentation step, particular combinations of various information layers were investigated to generate objects. This was achieved by applying multi-resolution segmentation to IRS-1D, SPOT-5, and ALOS satellite imagery in sequential steps of feature selection and object classification, and using slope and flow direction derivatives from a digital elevation model together with topographically-oriented gray level co-occurrence matrices. Fuzzy membership values were calculated for 11 different membership functions using 20 landslide objects from a landslide training data. Six fuzzy operators were used for the final classification and the accuracies of the resulting landslide maps were compared. A Fuzzy Synthetic Evaluation (FSE) approach was adapted for validation of the results and for an accuracy assessment using the landslide inventory database. The FSE approach revealed that the AND operator performed best with an accuracy of 93.87% for 2005 and 94.74% for 2011, closely followed by the MEAN Arithmetic operator, while the OR and AND (*) operators yielded relatively low accuracies. An object-based change detection was then applied to monitor landslide-related changes that occurred in northern Iran between 2005 and 2011. Knowledge rules to detect possible landslide-related changes were developed by evaluating all possible landslide-related objects for both time steps.

Evaluation of the climate change impact on wind resources in Taiwan Strait

International Nuclear Information System (INIS)

Chang, Tsang-Jung; Chen, Chun-Lung; Tu, Yi-Long; Yeh, Hung-Te; Wu, Yu-Ting

2015-01-01

Highlights: • We propose a new statistical downscaling framework to evaluate the climate change impact on wind resources in Taiwan Strait. • The statistical model relates Weibull distribution parameters to output of a GCM model and regression coefficients. • Validation of the simulated wind speed distribution presents an acceptable agreement with meteorological data. • Three chosen GCMs show the same tendency that the eastern half of Taiwan Strait stores higher wind resources. - Abstract: A new statistical downscaling framework is proposed to evaluate the climate change impact on wind resources in Taiwan Strait. In this framework, a two-parameter Weibull distribution function is used to estimate the wind energy density distribution in the strait. An empirically statistical downscaling model that relates the Weibull parameters to output of a General Circulation Model (GCM) and regression coefficients is adopted. The regression coefficients are calculated using wind speed results obtained from a past climate (1981–2000) simulation reconstructed by a Weather Research and Forecasting (WRF) model. These WRF-reconstructed wind speed results are validated with data collected at a weather station on an islet inside the strait. The comparison shows that the probability distributions of the monthly wind speeds obtained from WRF-reconstructed and measured wind speed data are in acceptable agreement, with small discrepancies of 10.3% and 7.9% for the shape and scale parameters of the Weibull distribution, respectively. The statistical downscaling framework with output from three chosen GCMs (i.e., ECHAM5, CM2.1 and CGCM2.3.2) is applied to evaluate the wind energy density distribution in Taiwan Strait for three future climate periods of 2011–2040, 2041–2070, and 2071–2100. The results show that the wind energy density distributions in the future climate periods are higher in the eastern half of Taiwan Strait, but reduce slightly by 3% compared with that in the

Superior radiation tolerance of thin epitaxial silicon detectors

CERN Document Server

Kramberger, G; Fretwurst, E; Honniger, F; Lindström, G; Pintilie, I; Röder, R; Schramm, A; Stahl, J

2003-01-01

For the LHC upgrade (fluences up to 10**1**6 p/cm**2) epi-Si devices are shown to be a viable solution. No type inversion was measured up to 1.3 multiplied by 10**1**524 GeV/c protons/cm**2 and the charge collection efficiency (CCE) remained close to 100%. For reactor neutrons CCE was measured to be 60% at 8 multiplied by 10**1**5 n/cm **2. Annealing measurements have shown that only moderate cooling during beam off periods would be necessary. As a tentative explanation for the superior quality of these devices, we assume that radiation-induced donor generation leads to compensation effects of deep acceptors. In the future, we will extend the experiments to fluences up to 10**1**6 p/cm**2 and use also different variants of the epi-Si material and device geometry.

Electromagnetic ion cyclotron waves observed in the plasma depletion layer

Science.gov (United States)

Anderson, B. J.; Fuselier, S. A.; Murr, D.

1991-01-01

Observations from AMPTE/CCE in the earth's magnetosheath on October 5, 1984 are presented to illustrate 0.1 - 4.0 Hz magnetic field pulsations in the subsolar plasma depletion layer (PDL) for northward sheath field during a magnetospheric compression. The PDL is unambiguously identified by comparing CCE data with data from IRM in the upstream solar wind. Pulsations in the PDL are dominated by transverse waves with F/F(H+) 1.0 or less and a slot in spectral power at F/F(H+) = 0.5. The upper branch is left hand polarized while the lower branch is linearly polarized. In the sheath the proton temperature anisotropy is about 0.6 but it is about 1.7 in the PDL during wave occurrence. The properties and correlation of waves with increased anisotropy indicate that they are electromagnetic ion cyclotron waves.

Specific binding of 125I-rErythropoietin to Friend polycythemia virus-transformed erythroleukemia cells purified by centrifugal elutriation

International Nuclear Information System (INIS)

Correa, P.N.; Bard, V.; Axelrad, A.A.

1990-01-01

We have used countercurrent centrifugal elutriation (CCE) to determine the distribution of cells with respect to cell volume and buoyant density for an erythroleukemia cell line (JG6) transformed by the polycythemia strain of Friend virus (FV-P), and to determine the effect of inducing the cells to differentiate with dimethylsulfoxide (DMSO) on this distribution. CCE made it possible to obtain suspensions of modal JG6 populations virtually free of dead cells and uniform with respect to volume and buoyant density. These modal populations were assayed for specific binding of erythropoietin (Epo). Between 500 and 550 Epo receptors per cell were detected. These belonged to a single class having a dissociation constant of 0.36 nM. DMSO induction of differentiation of the JG6 cells had no effect on the number of Epo receptors expressed

The Joint NASA/Goddard-University of Maryland Research Program in Charged Particle and High Energy Photon Detector Technology

Science.gov (United States)

Ipavich, F. M.

1990-01-01

The Univ. of Maryland portion investigated the following areas. The Space Physics Group performed studies of data from the AMPTE/CCE spacecraft CHEM experiment and found that the ratio of solar wind to photospheric abundances decreased rather smoothly with the first ionization potential (FIP) of the ion with the low FIP ion being about a factor of two overabundant. Carbon and hydrogen fit this trend particularly well. Several occurrences were analyzed of field aligned beams observed when CCE was upstream of the Earth's bow shock. Also using CHEM data, ring current intensity and composition changes during the main and recovery phases of the great geomagnetic storm that occurred in February 1986 was examined in detail. Still using CHEM data, ring current characteristics were examined in a survey of 20 magnetic storms ranging in size from -50 nT to -312 nT. A study was done of energetic ion anisotropy characteristics in the Earth's magnetosheath region using data from the UMD/MPE experiment on ISEE-1. The properties were analyzed of approx. 30 to 130 keV/e protons and alpha particles upstream of six quasi-parallel interplanetary shocks that passed by the ISEE-3 spacecraft during 1978 to 1979. Work from NASA-Goddard include studies from the High Energy Cosmic Ray Group, Low Energy Cosmic Ray Group, Low Energy Gamma Ray Group, High Energy Astrophysics Theory Group, and the X ray Astronomy Group.

Applying the Quadruple Process model to evaluate change in implicit attitudinal responses during therapy for panic disorder.

Science.gov (United States)

Clerkin, Elise M; Fisher, Christopher R; Sherman, Jeffrey W; Teachman, Bethany A

2014-01-01

This study explored the automatic and controlled processes that may influence performance on an implicit measure across cognitive-behavioral group therapy for panic disorder. The Quadruple Process model was applied to error scores from an Implicit Association Test evaluating associations between the concepts Me (vs. Not Me) + Calm (vs. Panicked) to evaluate four distinct processes: Association Activation, Detection, Guessing, and Overcoming Bias. Parameter estimates were calculated in the panic group (n = 28) across each treatment session where the IAT was administered, and at matched times when the IAT was completed in the healthy control group (n = 31). Association Activation for Me + Calm became stronger over treatment for participants in the panic group, demonstrating that it is possible to change automatically activated associations in memory (vs. simply overriding those associations) in a clinical sample via therapy. As well, the Guessing bias toward the calm category increased over treatment for participants in the panic group. This research evaluates key tenets about the role of automatic processing in cognitive models of anxiety, and emphasizes the viability of changing the actual activation of automatic associations in the context of treatment, versus only changing a person's ability to use reflective processing to overcome biased automatic processing. Copyright © 2013 Elsevier Ltd. All rights reserved.

Technical evaluation of the proposed changes in the technical specifications for emergency power sources for the Big Rock Point nuclear power plant

International Nuclear Information System (INIS)

Latorre, V.R.

1979-12-01

The technical evaluation is presented for the proposed changes to the Technical Specifications for emergency power sources for the Big Rock Point nuclear power plant. The criteria used to evaluate the acceptability of the changes include those delineated in IEEE Std-308-1974, and IEEE Std-450-1975 as endorsed by US NRC Regulatory Guide 1.129

Evaluation of longitudinal loading of tank trains during motion in longitudinal changes of gradient

Directory of Open Access Journals (Sweden)

S.V. Myamlin

2013-06-01

Full Text Available Purpose. To research the tank train longitudinal loading during motion by track sections with changes of gradient. The trains of different length that consist of bogie tank wagons should be examined. Influence of cargo type on longitudinal loading of train during motion in concave section of track should be evaluated. Methodology. The level of the largest longitudinal forces was estimated by mathematical simulation. It was assumed that change of gradient is formed by two grades with baffle platforms, length 50 meters, so that the algebraic difference of limiting grades vary from 10‰ to 40‰, pitch 10‰. The initial speeds were 40, 60, 80, 100, 120 km/h. For evaluation of the longitudinal loading the regulating braking and motion "by coasting" was considered. For evaluation of buffing loads the entry to the concave gradient change of expanded train is considered, and in order to determine the quasi-static forces the compressed train is considered. Findings. As a result of calculations the dependencies of maximal longitudinal forces in the trains on the cargo type, the algebraic difference of the grades, the number of tank wagons, the initial speed, motion modes, and initial gaps condition in the train were obtained. Originality. The longitudinal loading of freight cars of different length formed by the similar bogie tank wagons with one locomotive was obtained. The locomotive is placed in the train head during motion in concave track sections with various algebraic difference of the grades "on coasting" and during the regulating braking mode. The obtained results can be used for parameters standardization of profile elevation of the track. Practical value. The obtained results show that during operation of tank trains on track sections of complex breakage the most dangerous is regulating braking of preliminary compressed trains during entering on concave parts of track. Level of the greatest buffing and quasi-static longitudinal forces is

Evaluation of low-grade glioma structural changes after chemotherapy using DTI-based histogram analysis and functional diffusion maps

Energy Technology Data Exchange (ETDEWEB)

Castellano, Antonella; Iadanza, Antonella; Falini, Andrea [San Raffaele Scientific Institute and Vita-Salute San Raffaele University, Neuroradiology Unit and CERMAC, Milano (Italy); Donativi, Marina [University of Salento, Department of Mathematics and Physics ' ' Ennio De Giorgi' ' and A.D.A.M. (Advanced Data Analysis in Medicine), Lecce (Italy); Ruda, Roberta; Bertero, Luca; Soffietti, Riccardo [University of Torino, Department of Neuro-oncology, Turin (Italy); De Nunzio, Giorgio [University of Salento, Department of Mathematics and Physics ' ' Ennio De Giorgi' ' and A.D.A.M. (Advanced Data Analysis in Medicine), Lecce (Italy); INFN (National Institute of Nuclear Physics), Lecce (Italy); Riva, Marco; Bello, Lorenzo [Universita degli Studi di Milano, Milan, and Humanitas Research Hospital, Department of Medical Biotechnology and Translational Medicine, Rozzano, MI (Italy); Rucco, Matteo [University of Camerino, School of Science and Technology, Computer Science Division, Camerino, MC (Italy)

2016-05-15

To explore the role of diffusion tensor imaging (DTI)-based histogram analysis and functional diffusion maps (fDMs) in evaluating structural changes of low-grade gliomas (LGGs) receiving temozolomide (TMZ) chemotherapy. Twenty-one LGG patients underwent 3T-MR examinations before and after three and six cycles of dose-dense TMZ, including 3D-fluid-attenuated inversion recovery (FLAIR) sequences and DTI (b = 1000 s/mm{sup 2}, 32 directions). Mean diffusivity (MD), fractional anisotropy (FA), and tensor-decomposition DTI maps (p and q) were obtained. Histogram and fDM analyses were performed on co-registered baseline and post-chemotherapy maps. DTI changes were compared with modifications of tumour area and volume [according to Response Assessment in Neuro-Oncology (RANO) criteria], and seizure response. After three cycles of TMZ, 20/21 patients were stable according to RANO criteria, but DTI changes were observed in all patients (Wilcoxon test, P ≤ 0.03). After six cycles, DTI changes were more pronounced (P ≤ 0.005). Seventy-five percent of patients had early seizure response with significant improvement of DTI values, maintaining stability on FLAIR. Early changes of the 25th percentiles of p and MD predicted final volume change (R{sup 2} = 0.614 and 0.561, P < 0.0005, respectively). TMZ-related changes were located mainly at tumour borders on p and MD fDMs. DTI-based histogram and fDM analyses are useful techniques to evaluate the early effects of TMZ chemotherapy in LGG patients. (orig.)

Testing and Development of a Shrouded Gas Turbine Engine in a Freejet Facility

National Research Council Canada - National Science Library

Garcia, Hector

2000-01-01

.... The combined cycle engine (CCE) could be incorporated into a variety of applications. The building of a new freejet facility and engine test rig at the Naval Postgraduate School enabled dynamic testing of the ongoing development of a turboramjet...

AN EVALUATION OF FARMERS’ PERCEPTIONS OF AND ADAPTATION TO THE EFFECTS OF CLIMATE CHANGE IN KENYA

Directory of Open Access Journals (Sweden)

Hilary K. Ndambiri

2013-07-01

Full Text Available The study was carried out to evaluate how farmers in Kyuso District have perceived and adapted to climate change. Data was collected from 246 farmers from six locations sampled out through a multistage and simple random sampling procedure. The Heckman probit model was fitted to the data to avoid sample selection bias since not every farmer who may perceive climate change responds by adapting. The analysis revealed that 94% of farmers in Kyuso District had a perception that climate was changing and as a result, 85% of these farmers had responded by adapting. In this regard, age of the household head, gender, education, farm experience, household size, distance to the nearest market, access to irrigation water, local agro-ecology, on and off farm income, access to information on climate change through extension services, access to credit, changes in temperature and precipitation were found to have significant influence on the probability of farmers to perceive and/or adapt to climate change. With the level of perception to climate change being more than that of adaptation, the study suggests that more policy efforts should be geared towards helping farmers to adapt to climate change

Evaluation of Degradation Kinetic of Tomato Paste Color in Heat Processing and Modeling of These Changes by Response Surface Methodology

Directory of Open Access Journals (Sweden)

M. Ganjeh

2015-12-01

Full Text Available Color is an important qualitative factor in tomato products such as tomato paste which is affected by heat processing. The main goal of this study was to evaluate the degradation kinetics of tomato paste color during heat processing by Arrhenius equation and modeling of these changes by response surface methodology (RSM. Considering this purpose, tomato paste was processed at three temperatures of 60, 70 and 80 °C for 25-100 minutes and by three main color indices including L, a and b, a/b ratio, total color difference (TCD, Saturation index (SI and hue angle (HU was analyzed. Degradation kinetics of these parameters was evaluated by Arrhenius equation and their changing trends were modeled by RSM. All parameters except TCA (zero order followed a first order reaction. The b index by highest and TCA and a/b by least activation energies had the maximum and minimum sensitivity to the temperature changes, respectively. Also, TCD and b had the maximum and minimum changing rates, respectively. All responses were influenced by independent parameters (the influence of temperature was more than time and RSM was capable of modeling and predicting these responses. In general, Arrhenius equation was appropriate to evaluate degradation kinetics of tomato paste color changes and RSM was able to estimate independent and interaction effects of time and temperature so that quadratic models were capable to predict these changes by a high accuracy (R2 > 0.95.

The Evaluation of Climate Change Risks

Directory of Open Access Journals (Sweden)

Constantin POPESCU

2012-11-01

Full Text Available Nowadays, it is acknowledged that climatic changes represent a serious threat for the environment and, so, this problem has been approached at numerous conferences, conventions and summits. The climate is strongly influenced by the changes in the atmospheric concentrations of certain gases that hold the solar radiations on the Earth’s surface (the greenhouse effect. The water vapors and the carbon dioxide (CO2 present in the atmosphere have always generated a natural greenhouse effect, without which the Earth surface would be 33o C lower than it is today. Other greenhouse gases are: methane (CH4, nitrogen protoxide (N2O, and the halogenated compounds such as chlorofluorocarbons (CFCs. During the last hundred years, man’s activity has led to the increase of the atmospheric concentration of the greenhouse gases and of other pollutants, its consequence being the increase of the average global temperature. Although it has not been calculated exactly how much of this warming can be attributed to the greenhouse gases, there is evidence that human activity contributes to global warming. The main causes leading to the accentuation of the greenhouse effect are the burning of the fossil fuels, deforestations, cement production, waste disposal, refrigeration etc. The climatic changes triggered by the greenhouse gases will have consequences that have already made themselves visible, causing: the increase of the sea level and the possible flooding of the low areas; the melting of the icecap; the modification of the precipitations regime, with consequences like the increase of the floods and droughts frequency; changes in the occurrence of climatic extremes, especially in the occurrence of the high, extreme temperatures. All these will have a direct impact on ecosystems, health, some key economic sectors such as agriculture and on water resources.

Implementing a Modern Warfighting Supply-Chain for Information Technology Acquisitions

Science.gov (United States)

2011-03-10

enforcing information standards that help regulate inf01mation definitions; emphasizing compliance; and rationalizing performance requirements. 52...developed a prototype PISR PLAto coinmence realizing that CCE in the context of the first MCISR-E objective: "The synergistic integration of all

The association between retrospective outcome evaluations and pre-post-treatment changes in psychodynamic group-psychotherapy

DEFF Research Database (Denmark)

Jensen, Hans Henrik; Mortensen, Erik Lykke; Lotz, Martin

2008-01-01

In the present study of 203 patients in psychodynamic group psychotherapy, we explore associations between patient and therapist global retrospective outcome evaluations (ROE), and pre-post-treatment changes on the Symptom Check List 90 Revised (SCL-90-R) and non-symptomatic focus of therapy. The......, and associated with personality factors or domains not captured by standard questionnaires....

The possibilities of spiral computed tomography in evaluating of pathologic changes of the inner surface of the stomach

International Nuclear Information System (INIS)

Pomakov, P.; Mlachkova, D.; Naraliev, V.; Lyutckanova, E.

2006-01-01

Full text: The aim of the presentation is to determine the possibilities of spiral CT for evaluating pathologic changes, affecting predominantly the stomach mucosa. 20 patients with preliminary clinical diagnosis 'cancer of the stomach' were examined. The patients had different complaints. Gas CT with medical myorelaxation of the stomach was performed. The stomach cavity was inflated by swallowing of three effervescent tablets vitamin C 500 mg with a little water. After the native CT examination a contrast series was performed 20 min. after the beginning of injecting 100 ml nonionic contrast in the arterial phase. 16 patients had no pathologic changes in the stomach. In the rest were established: lymphoma of the stomach - in 1 patient, carcinoma stage I - 1, polyps - 1, erritemoerosive gastritis - 1. CT findings were compared with the histologic ones. Gas CT in arterial contrast phase has possibilities for evaluating changes, affecting predominantly the inner surface (mucosa) of the stomach

Opinion of the Consultative Committee for the EURATOM Research and Training Programme in the Field of Nuclear Energy (Fusion) - CCE-FU - on the European domestic assessment of the ITER-FEAT outline design report. Brussels, 11 July 2000

International Nuclear Information System (INIS)

2001-01-01

The CCE-FU endorses the findings of the FTC on the European Domestic Assessment of the ITER-FEAT Outline Design Review, and expresses the opinion that: The machine, ITER-FEAT, the design of which is presented in the Outline Design Report and accompanying document (Technical Basis for the ITER-FEAT Outline Design) successfully responds, in broad terms, to the requirements set by the Special Working Group, established by the ITER Council, in response to Task No. 1 and adopted by the Council; The parameters chosen represent convergence towards a coherent design, based upon preserving adequate margins within the cost target against the new objectives and yet retaining flexibility to exploit advances in physics understanding; ITER-FEAT can meet its objectives of extended burn in induction operation with power amplification Q>10 at the reference operating values of Ip=15MA, Paux=40MW, thus providing 400 MW of fusion power. The margins to achieve this objective are in the range of 15-25%. The design also has sufficient flexibility to explore hybrid scenarios with long pulse capability (> 2000 seconds), and scenarios aiming at demonstrating steady state operation with the ratio of fusion power to input power for current drive of at least 5, provided further confinement enhancement can be achieved; Although most of the components of ITER-FEAT are still in a preliminary design state, the new design appears suitable to be developed into the final design stage, the new design appears suitable to be developed into the final design of a machine capable of achieving the objectives set by the ITER Council; The target cost for the realisation of ITER-FEAT was set by the ITER Council at about half of the 1998 ITER cost estimates. The present preliminary analysis provides confidence that this target will be reached. By the end of 2000, the detailed cost estimates will be provided from the detailed design specifications and manufacturing studies in the industries of the three Parties

SWFSC/MMTD/CCE: Leatherback Use of Temperate Habitat (LUTH) 2008

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Leatherback Use of Temperate Habitat (LUTH) survey is an ecosystem assessment of temperate foraging habitats of endangered leatherback turtles off the coast of...

Evaluating the dosimetric effect of treatment-induced changes in virally mediated head and neck cancer patients

International Nuclear Information System (INIS)

Brown, Elizabeth; Owen, Rebecca; Mengersen, Kerrie; Harden, Fiona; Porceddu, Sandro

2013-01-01

Patients with virally mediated head and neck cancer (VMHNC) often present with advanced nodal disease that is highly radioresponsive as demonstrated by tumour and nodal regression during treatment. The resultant changes may impact on the planned dose distribution and so adversely affect the therapeutic ratio. The aim of this study was to evaluate the dosimetric effect of treatment-induced anatomical changes in VMHNC patients who had undergone a replan. Thirteen patients with virally mediated oropharyngeal or nasopharyngeal cancer who presented for definitive radiotherapy between 2005 and 2010 and who had a replan generated were investigated. The dosimetric effect of anatomical changes was quantified by comparing dose–volume histograms (DVH) of primary and nodal gross target volumes and organs at risk (OAR), including spinal cord and parotid glands, from the original plan and a comparison plan. Eleven three-dimensional conformal radiation therapy (3DCRT) and two intensity modulated radiation therapy (IMRT) plans were evaluated. Dose to the spinal cord and brainstem increased by 4.1% and 2.6%, respectively. Mean dose to the parotid glands also increased by 3.5%. In contrast, the dose received by 98% of the primary and nodal gross tumour volumes decreased by 0.15% and 0.3%, respectively, when comparing the initial treatment plan to the comparison plan. In this study, treatment-induced anatomical changes had the greatest impact on OAR dose with negligible effect on the dose to nodal gross tumour volumes. In the era of IMRT, accounting for treatment-induced anatomical changes is important as focus is placed on minimizing the acute and long-term side effects of treatment

Land Use Change and Global Adaptations to Climate Change

Directory of Open Access Journals (Sweden)

Roxana Juliá

2013-12-01

Full Text Available This paper uses the World Trade Model with Climate Sensitive Land (WTMCL to evaluate possible future land-use changes associated with adaptations to climate change in a globalized world. In this approach, changes in regional agricultural production, which are based on comparative advantage, define patterns of land use change in agriculture in all regions of the world. We evaluate four scenarios that combine assumptions about future increases in food demand and future changes in land endowments of different productivities associated with climatic conditions: each scenario generates distinct patterns of regional specialization in the production of agricultural commodities and associated land-use change. The analysis also projects future food availability under the simulated conditions and the direction of likely changes in prices of the major agricultural commodity groups.

Evaluating change in bruise colorimetry and the effect of subject characteristics over time.

Science.gov (United States)

Scafide, Katherine R N; Sheridan, Daniel J; Campbell, Jacquelyn; Deleon, Valerie B; Hayat, Matthew J

2013-09-01

Forensic clinicians are routinely asked to estimate the age of cutaneous bruises. Unfortunately, existing research on noninvasive methods to date bruises has been mostly limited to relatively small, homogeneous samples or cross-sectional designs. The purpose of this prospective, foundational study was to examine change in bruise colorimetry over time and evaluate the effects of bruise size, skin color, gender, and local subcutaneous fat on that change. Bruises were created by a controlled application of a paintball pellet to 103 adult, healthy volunteers. Daily colorimetry measures were obtained for four consecutive days using the Minolta Chroma-meter(®). The sample was nearly equal by gender and skin color (light, medium, dark). Analysis included general linear mixed modeling (GLMM). Change in bruise colorimetry over time was significant for all three color parameters (L*a*b*), the most notable changes being the decrease in red (a*) and increase in yellow (b*) starting at 24 h. Skin color was a significant predictor for all three colorimetry values but sex or subcutaneous fat levels were not. Bruise size was a significant predictor and moderator and may have accounted for the lack of effect of gender or subcutaneous fat. Study results demonstrated the ability to model the change in bruise colorimetry over time in a diverse sample of healthy adults. Multiple factors, including skin color and bruise size must be considered when assessing bruise color in relation to its age. This study supports the need for further research that could build the science to allow more accurate bruise age estimations.

Color changes of esthetic orthodontic ligatures evaluated by orthodontists and patients: a clinical study

Directory of Open Access Journals (Sweden)

Edilene Kawabata

Full Text Available ABSTRACT Objective: To evaluate in vivo changes in the color of esthetic elastomeric ligatures from different manufacturers. Methods: Four widely used commercial brands of elastomeric ligatures were selected and used in 20 adult patients in a split-mouth design. The ligatures were evaluated by orthodontists and patients in a double-blind manner on the day the ligatures were placed (T0 and 30 days after intraoral exposure (T1 by means of a system of staining scores. Groups were compared by Friedman test with p 0.05. Results showed that all brands underwent significant staining when exposed to the intraoral environment. Modular-crystal MorelliTM (Sorocaba, SP, Brazil showed the highest degree of staining with the median reaching the maximum value (3; while the other brands (3M UnitekTM, American OrthodonticsTM and GAC DentsplyTM showed the median equal to 1 (p < 0.001. A large individual variability in the degree of staining was also found for all brands. Conclusions: All four brands of esthetic ligatures showed significant staining, which appeared to be more pronounced for the MorelliTM brand. Changes in color of the elastomeric ligatures were perceived similarly by patients and orthodontists. The industry needs to improve the color stability of esthetic ligatures.

Interactive Two-Way mHealth Interventions for Improving Medication Adherence: An Evaluation Using The Behaviour Change Wheel Framework

Science.gov (United States)

Amico, K Rivet; Atkins, Lou; Lester, Richard T

2018-01-01

Background Medication adherence is an important but highly complex set of behaviors, which for life-threatening and infectious diseases such as HIV carry critical consequences for individual and public health. There is growing evidence that mobile phone text messaging interventions (mHealth) connecting providers with patients positively impact medication adherence, particularly two-way engagement platforms that require bidirectional communication versus one-way in which responses are not mandatory. However, mechanisms of action have not been well defined. The Behavior Change Wheel is a comprehensive framework for behavior change that includes an all-encompassing model of behavior known as Capability Opportunity Motivation-Behavior and is complemented by a taxonomy of behavior change techniques. Evaluating mHealth interventions for medication adherence using these tools could provide useful insights that may contribute to optimizing their integration into the healthcare system and successful scaling-up. Objective This study aimed to help address the current knowledge gap regarding how two-way mHealth interventions for medication adherence may work by applying the Behavior Change Wheel to characterize WelTel: an interactive digital health outreach platform with robust evidence for improving adherence to antiretroviral therapy. Methods To characterize how WelTel may promote medication adherence, we applied the Behavior Change Wheel to systematically (1) generate a behavioral diagnosis through mapping known antiretroviral therapy adherence barriers onto the Capability Opportunity Motivation-Behavior model of behavior, (2) specify the behavior change techniques that WelTel delivers, (3) link identified behavior change techniques to corresponding intervention functions of the Behavior Change Wheel, and (4) connect these behavior change techniques and intervention functions to respective Capability Opportunity Motivation-Behavior influences on behavior to determine

Evaluation of environmental change and its effects on the radiological performance of a hypothetical shallow engineered disposal facility at Elstow, Bedfordshire

International Nuclear Information System (INIS)

1988-03-01

The results of a project designed to evaluate aspects of a hypothetical facility for disposal of radioactive wastes at Elstow, Bedfordshire, are described. The project included modelling of environmental change using the TIME2 code, groundwater flow modelling, biosphere modelling and risk analysis using the SYVAC A/C code. The aims of the work were to demonstrate use of TIME2, investigate the evolution of the facility's environment and to evaluate the influence of environmental change on estimates of radiological risk. Risk analysis of several time-independent environmental system states, using data obtained from the other tasks, indicated that environmental changes significantly influence estimates of radiological risk. (author)

Evaluation of degenerative changes in articular cartilage of osteoarthritis by Raman spectroscopy

Science.gov (United States)

Oshima, Yusuke; Ishimaru, Yasumitsu; Kiyomatsu, Hiroshi; Hino, Kazunori; Miura, Hiromasa

2018-02-01

Osteoarthritis (OA) is a very common joint disease in the aging population. Main symptom of OA is accompanied by degenerative changes of articular cartilage. Cartilage contains mostly type II collagen and proteoglycans, so it is difficult to access the quality and morphology of cartilage tissue in situ by conventional diagnostic tools (X-ray, MRI and echography) directly or indirectly. Raman spectroscopy is a label-free technique which enables to analyze molecular composition in degenerative cartilage. In this proposal, we aim to develop Raman spectroscopic system for the quality assessment of articular cartilage during arthroscopic surgery. Toward this goal, we are focusing on the proteoglycan content and collagen fiber alignment in cartilage matrix which may be associated with degenerative changes in OA, and we designed an original Raman device for remote sensing during arthroscopic surgery. In this project, we define the grading system for cartilage defect based on Raman spectroscopy, and we complete the evaluation of the Raman probing system which makes it possible to detect early stage of degenerative cartilage as a novel tool for OA diagnosis using human subject.

Evaluation of Terrestrial LIDAR for Monitoring Geomorphic Change at Archeological Sites in Grand Canyon National Park, Arizona

Science.gov (United States)

Collins, Brian D.; Brown, Kristin M.; Fairley, Helen C.

2008-01-01

This report presents the results of an evaluation of terrestrial light detection and ranging (LIDAR) for monitoring geomorphic change at archeological sites located within Grand Canyon National Park, Ariz. Traditionally, topographic change-detection studies have used total station methods for the collection of data related to key measurable features of site erosion such as the location of thalwegs and knickpoints of gullies that traverse archeological sites (for example, Pederson and others, 2003). Total station methods require survey teams to walk within and on the features of interest within the archeological sites to take accurate measurements. As a result, site impacts may develop such as trailing, damage to cryptogamic crusts, and surface compaction that can exacerbate future erosion of the sites. National Park Service (NPS) resource managers have become increasingly concerned that repeated surveys for research and monitoring purposes may have a detrimental impact on the resources that researchers are trying to study and protect. Beginning in 2006, the Sociocultural Program of the U.S. Geological Survey's (USGS) Grand Canyon Monitoring and Research Center (GCMRC) initiated an evaluation of terrestrial LIDAR as a new monitoring tool that might enhance data quality and reduce site impacts. This evaluation was conducted as one part of an ongoing study to develop objective, replicable, quantifiable monitoring protocols for tracking the status and trend of variables affecting archeological site condition along the Colorado River corridor. The overall study consists of two elements: (1) an evaluation of the methodology through direct comparison to geomorphologic metrics already being collected by total station methods (this report) and (2) an evaluation of terrestrial LIDAR's ability to detect topographic change through the collection of temporally different datasets (a report on this portion of the study is anticipated early in 2009). The main goals of the first

A methodology for evaluating organizational change in community-based chronic disease interventions.

Science.gov (United States)

Hanni, Krista D; Mendoza, Elsa; Snider, John; Winkleby, Marilyn A

2007-10-01

In 2003, the Monterey County Health Department, serving Salinas, California, was awarded one of 12 grants from the Steps to a HealthierUS Program to implement a 5-year, multiple-intervention community approach to reduce diabetes, asthma, and obesity. National adult and youth surveys to assess long-term outcomes are required by all Steps sites; however, site-specific surveys to assess intermediate outcomes are not required. Salinas is a medically underserved community of primarily Mexican American residents with high obesity rates and other poor health outcomes. The health department's Steps program has partnered with traditional organizations such as schools, senior centers, clinics, and faith-based organizations as well as novel organizations such as employers of agricultural workers and owners of taquerias. The health department and the Stanford Prevention Research Center developed new site-specific, community-focused partner surveys to assess intermediate outcomes to augment the nationally mandated surveys. These site-specific surveys will evaluate changes in organizational practices, policies, or both following the socioecological model, specifically the Spectrum of Prevention. Our site-specific partner surveys helped to 1) identify promising new partners, select initial partners from neighborhoods with the greatest financial need, and identify potentially successful community approaches; and 2) provide data for evaluating intermediate outcomes matched to national long-term outcomes so that policy and organizational level changes could be assessed. These quantitative surveys also provide important context-specific qualitative data, identifying opportunities for strengthening community partnerships. Developing site-specific partner surveys in multisite intervention studies can provide important data to guide local program efforts and assess progress toward intermediate outcomes matched to long-term outcomes from nationally mandated surveys.

Transcriptomic and phylogenetic analysis of Culex pipiens quinquefasciatus for three detoxification gene families

Directory of Open Access Journals (Sweden)

Yan Liangzhen

2012-11-01

Full Text Available Abstract Background The genomes of three major mosquito vectors of human diseases, Anopheles gambiae, Aedes aegypti, and Culex pipiens quinquefasciatus, have been previously sequenced. C. p. quinquefasciatus has the largest number of predicted protein-coding genes, which partially results from the expansion of three detoxification gene families: cytochrome P450 monooxygenases (P450, glutathione S-transferases (GST, and carboxyl/cholinesterases (CCE. However, unlike An. gambiae and Ae. aegypti, which have large amounts of gene expression data, C. p. quinquefasciatus has limited transcriptomic resources. Knowledge of complete gene expression information is very important for the exploration of the functions of genes involved in specific biological processes. In the present study, the three detoxification gene families of C. p. quinquefasciatus were analyzed for phylogenetic classification and compared with those of three other dipteran insects. Gene expression during various developmental stages and the differential expression responsible for parathion resistance were profiled using the digital gene expression (DGE technique. Results A total of 302 detoxification genes were found in C. p. quinquefasciatus, including 71 CCE, 196 P450, and 35 cytosolic GST genes. Compared with three other dipteran species, gene expansion in Culex mainly occurred in the CCE and P450 families, where the genes of α-esterases, juvenile hormone esterases, and CYP325 of the CYP4 subfamily showed the most pronounced expansion on the genome. For the five DGE libraries, 3.5-3.8 million raw tags were generated and mapped to 13314 reference genes. Among 302 detoxification genes, 225 (75% were detected for expression in at least one DGE library. One fourth of the CCE and P450 genes were detected uniquely in one stage, indicating potential developmentally regulated expression. A total of 1511 genes showed different expression levels between a parathion-resistant and a

Eddy Mediated Nutrient Pattern in the North Eastern Arabian Sea

Science.gov (United States)

Thachaparambil, M.; Moolakkal Antony, R.; B R, S.; V N, S.; N, C.; M, S.

2016-02-01

A Cold Core Eddy (CCE) mediated nutrient pattern in the North Eastern Arabian Sea (NEAS) is explained based on in situ measurments during March 2013 onboard FORV Sagar Sampada which was not reported earlier in the area. Samples for physical, chemical and biological parameters were collected in 5 stations along the diameter of the eddy and following standard protocols. The core of the CCE is identified at 21°20.38'N; 66°30.68'E with a diameter of 120Km. Earlier studies explaining the process and the forcing mechanism of the particular eddy records that, the eddy is short term (1-3 months) and is regular during the season. Surface waters were well oxygenated (>4.8 ml L-1) in the core. Surface value of nutrients viz., Nitrate, Nitrite, Silicate and phosphate in the core regions was 0.9µM, 0.01 µM, 0.5 µM and 0.7 µM respectively indicating upwelling in the core. Spring intermonsoon (SIM) is generally termed as a transition period between the active winter and summer seasons and as per earlier studies, high biological production and the regularly occurring Noctilica bloom is supported by the nutrient loading due to convective mixing during winter as well as regenerated production. However, present observations shows that, nutrient pumping due to the upwelling associated with the CCE also contributes for sustaining high biological production and are evident in the Chl a and mesozooplankton biovolume which records values of 4.35mg/m3 and 1.09ml/m3 respectively in the core. An intense Noctiluca blooms observed in the western flank of the eddy (Chl a 13.25 mg/m3; cell density 5.8×106 cells/litre), where Nitrate concentration records 1.04µM explains the role of such mesoscale processes in the sustenance of the HAB events. While eastern flank of the CCE showed typical open ocean condition of the season showing Nitrate 0.08µM; Chl a 0.23mg/m3; and phytoplankton cell density as 421 cells/litre. Keywords: Cold core eddy, nutrients, NEAS, SIM, biological production

Identification of subpopulations in mesenchymal stem cell-like cultures from human umbilical cord

Directory of Open Access Journals (Sweden)

Majore Ingrida

2009-03-01

Full Text Available Abstract Background A variety of cell types can be identified in the adherent fraction of bone marrow mononuclear cells including more primitive and embryonic-like stem cells, mesenchymal stem cells (MSC, lineage-committed progenitors as well as mature cells such as osteoblasts and fibroblasts. Different methods are described for the isolation of single bone marrow stem cell subpopulations – beginning from ordinary size sieving, long term cultivation under specific conditions to FACS-based approaches. Besides bone marrow-derived subpopulations, also other tissues including human umbilical cord (UC have been recently suggested to provide a potential source for MSC. Although of clinical importance, these UC-derived MSC populations remain to be characterized. It was thus the aim of the present study to identify possible subpopulations in cultures of MSC-like cells obtained from UC. We used counterflow centrifugal elutriation (CCE as a novel strategy to successfully address this question. Results UC-derived primary cells were separated by CCE and revealed differentially-sized populations in the fractions. Thus, a subpopulation with an average diameter of about 11 μm and a small flat cell body was compared to a large sized subpopulation of about 19 μm average diameter. Flow cytometric analysis revealed the expression of certain MSC stem cell markers including CD44, CD73, CD90 and CD105, respectively, although these markers were expressed at higher levels in the small-sized population. Moreover, this small-sized subpopulation exhibited a higher proliferative capacity as compared to the total UC-derived primary cultures and the large-sized cells and demonstrated a reduced amount of aging cells. Conclusion Using the CCE technique, we were the first to demonstrate a subpopulation of small-sized UC-derived primary cells carrying MSC-like characteristics according to the presence of various mesenchymal stem cell markers. This is also supported by the

Ecological risk Evaluation and Green Infrastructure planning for coping with global climate change, a case study of Shanghai, China

Science.gov (United States)

Li, Pengyao; Xiao, He; Li, Xiang; Hu, Wenhao; Gu, Shoubai; Yu, Zhenrong

2018-01-01

Coping with various ecological risks caused by extreme weather events of global climate change has become an important issue in regional planning, and storm water management for sustainable development. In this paper, taking Shanghai, China as a case study, four potential ecological risks were identified including flood disaster, sea-source disaster, urban heat island effect, and land subsidence. Based on spatial database, the spatial variation of these four ecological risks was evaluated, and the planning area was divided into seven responding regions with different green infrastructure strategy. The methodology developed in this study combining ecological risk evaluation with spatial regionalization planning could contribute to coping with global climate change.

Evaluating the effectiveness of behavior change techniques in health-related behavior: a scoping review of methods used.

Science.gov (United States)

Michie, Susan; West, Robert; Sheals, Kate; Godinho, Cristina A

2018-03-01

Behavior change interventions typically contain multiple potentially active components: behavior change techniques (BCTs). Identifying which specific BCTs or BCT combinations have the potential to be effective for a given behavior in a given context presents a major challenge. The aim of this study was to review the methods that have been used to identify effective BCTs for given behaviors in given contexts and evaluate their strengths and limitations. A scoping review was conducted of studies that had sought to identify effective BCTs. Articles referring to "behavio(u)r change technique(s)" in the abstract/text were located, and ones that involved identification of effective BCTs were selected. The methods reported were coded. The methods were analyzed in general terms using "PASS" criteria: Practicability (facility to apply the method appropriately), Applicability (facility to generalize from findings to contexts and populations of interest), Sensitivity (facility to identify effective BCTs), and Specificity (facility to rule out ineffective BCTs). A sample of 10% of the studies reviewed was then evaluated using these criteria to assess how far the strengths and limitations identified in principle were borne out in practice. One hundred and thirty-five studies were identified. The methods used in those studies were experimental manipulation of BCTs, observational studies comparing outcomes in the presence or absence of BCTs, meta-analyses of BCT comparisons, meta-regressions evaluating effect sizes with and without specific BCTs, reviews of BCTs found in effective interventions, and meta-classification and regression trees. The limitations of each method meant that only weak conclusions could be drawn regarding the effectiveness of specific BCTs or BCT combinations. Methods for identifying effective BCTs linked to target behavior and context all have important inherent limitations. A strategy needs to be developed that can systematically combine the strengths of

Quantitative evaluation of emphysematous changes in the lung by computed tomography (CT)

International Nuclear Information System (INIS)

Kitahara, Yoshinari; Hirayama, Takanobu; Hiratsuka, Toshihiko; Tanaka, Yasushi; Takamoto, Masahiro; Ishibashi, Tsuneo; Shinoda, Atsushi

1987-01-01

The present studies were undertaken to quantitatively evaluate emphysematous changes in the lung by CT scan. CT scans were made at inspiration and expiration at three levels (base, mid thorax and apex). Low density lesion ratio (LL %) was measured as the proportion of the area under -950 Housfield Unit in each lung field at expiration. Each value of LL % was determined in 6 lung fields (both lung fields at three levels). The LL % was calculated from the mean of these six values. The results suggest that LL % of the emphysematous lungs shows significant elevation of the values compared with those of normal lungs and lungs with bronchial asthma. (author)

A Study of Changes in the Library and Information Science Curriculum with Evaluation of Its Practicality

Science.gov (United States)

Noh, Younghee; Ahn, In-Ja; Choi, Sang-Ki

2012-01-01

Purpose: This study analyzed the process of changes in Korean Library and Information Science curriculum and evaluated the courses currently available by using a perception survey of librarians in the field. It also explored a possible demand for new courses, while suggesting compulsory, core, and optional courses for Bachelor's degree curriculum…

Evidence for plasma effect on charge collection efficiency in proton irradiated GaAs detectors

CERN Document Server

Nava, F; Canali, C; Vittone, E; Polesello, P; Biggeri, U; Leroy, C

1999-01-01

The radiation damage in 100 mu m thick Schottky diodes made on semi-insulating undoped GaAs materials, were studied using alpha-, beta-, proton- and gamma-spectroscopy as well as I-V measurements. The results have been analysed within the framework of the Hecht model to investigate the influence of the plasma produced by short-range strongly ionising particles on the detector performance after 24 GeV proton irradiation. It has been found that with the mean free drift lengths for electrons and holes determined from alpha-spectra in overdepleted detectors, the charge collection efficiency for beta-particles, cce subbeta, is well predicted in the unirradiated detectors, while in the most irradiated ones, the cce subbeta is underestimated by more than 40%. The observed disagreement can be explained by assuming that the charge carrier recombination in the plasma region of such detectors, becomes significant.

A new quantitative evaluation method for age-related changes of individual pigmented spots in facial skin.

Science.gov (United States)

Kikuchi, K; Masuda, Y; Yamashita, T; Sato, K; Katagiri, C; Hirao, T; Mizokami, Y; Yaguchi, H

2016-08-01

Facial skin pigmentation is one of the most prominent visible features of skin aging and often affects perception of health and beauty. To date, facial pigmentation has been evaluated using various image analysis methods developed for the cosmetic and esthetic fields. However, existing methods cannot provide precise information on pigmented spots, such as variations in size, color shade, and distribution pattern. The purpose of this study is the development of image evaluation methods to analyze individual pigmented spots and acquire detailed information on their age-related changes. To characterize the individual pigmented spots within a cheek image, we established a simple object-counting algorithm. First, we captured cheek images using an original imaging system equipped with an illumination unit and a high-resolution digital camera. The acquired images were converted into melanin concentration images using compensation formulae. Next, the melanin images were converted into binary images. The binary images were then subjected to noise reduction. Finally, we calculated parameters such as the melanin concentration, quantity, and size of individual pigmented spots using a connected-components labeling algorithm, which assigns a unique label to each separate group of connected pixels. The cheek image analysis was evaluated on 643 female Japanese subjects. We confirmed that the proposed method was sufficiently sensitive to measure the melanin concentration, and the numbers and sizes of individual pigmented spots through manual evaluation of the cheek images. The image analysis results for the 643 Japanese women indicated clear relationships between age and the changes in the pigmented spots. We developed a new quantitative evaluation method for individual pigmented spots in facial skin. This method facilitates the analysis of the characteristics of various pigmented facial spots and is directly applicable to the fields of dermatology, pharmacology, and esthetic

Structural changes evaluation with Raman spectroscopy in meat batters prepared by different processes.

Science.gov (United States)

Kang, Zhuang-Li; Li, Xiang; He, Hong-Ju; Ma, Han-Jun; Song, Zhao-Jun

2017-08-01

A comprehensive study was conducted to evaluate the structural changes of meat and protein of pork batters produced by chopping or beating process through the phase-contrast micrograph, laser light scattering analyzer, scanning electronic microscopy and Raman spectrometer. The results showed that the shattered myofibrilla fragments were shorter and particle-sizes were smaller in the raw batter produced by beating process than those in the chopping process. Compared with the raw and cooked batters produced by chopping process, modifications in amide I and amide III bands revealed a significant decrease of α -helix content and an increase of β -sheet, β -turn and random coils content in the beating process. The changes in secondary structure of protein in the batter produced by beating process was thermally stable. Moreover, more tyrosine residues were buried, and more gauche-gauche-trans disulfide bonds conformations and hydrophobic interactions were formed in the batter produced by beating process.

Challenges in Evaluating Relationships Between Quantitative Data (Carbon Dioxide) and Qualitative Data (Self-Reported Visual Changes)

Science.gov (United States)

Mendez, C. M.; Foy, M.; Mason, S.; Wear, M. L.; Meyers, V.; Law, J.; Alexander, D.; Van Baalen, M.

2014-01-01

Understanding the nuances in clinical data is critical in developing a successful data analysis plan. Carbon dioxide (CO2) data are collected on board the International Space Station (ISS) in a continuous stream. Clinical data on ISS are primarily collected via conversations between individual crewmembers and NASA Flight Surgeons during weekly Private Medical Conferences (PMC). Law, et.al, 20141 demonstrated a statistically significant association between weekly average CO2 levels on ISS and self-reported headaches over the reporting period from March 14, 2001 to May 31, 2012. The purpose of this analysis is to describe the evaluation of a possible association between visual changes and CO2 levels on ISS and to discuss challenges in developing an appropriate analysis plan. METHODS & PRELIMINARY RESULTS: A first analysis was conducted following the same study design as the published work on CO2 and self-reported headaches1; substituting self-reported changes in visual acuity in place of self-reported headaches. The analysis demonstrated no statistically significant association between visual impairment characterized by vision symptoms self-reported during PMCs and ISS average CO2 levels over ISS missions. Closer review of the PMC records showed that vision outcomes are not well-documented in terms of clinical severity, timing of onset, or timing of resolution, perhaps due to the incipient nature of vision changes. Vision has been monitored in ISS crewmembers, pre- and post-flight, using standard optometry evaluations. In-flight visual assessments were limited early in the ISS program, primarily consisting of self-perceived changes reported by crewmembers. Recently, on-orbit capabilities have greatly improved. Vision data ranges from self-reported post-flight changes in visual acuity, pre- to postflight changes identified during fundoscopic examination, and in-flight progression measured by advanced on-orbit clinical imaging capabilities at predetermined testing

Interactive Two-Way mHealth Interventions for Improving Medication Adherence: An Evaluation Using The Behaviour Change Wheel Framework.

Science.gov (United States)

Chiang, Nicole; Guo, Michael; Amico, K Rivet; Atkins, Lou; Lester, Richard T

2018-04-12

Medication adherence is an important but highly complex set of behaviors, which for life-threatening and infectious diseases such as HIV carry critical consequences for individual and public health. There is growing evidence that mobile phone text messaging interventions (mHealth) connecting providers with patients positively impact medication adherence, particularly two-way engagement platforms that require bidirectional communication versus one-way in which responses are not mandatory. However, mechanisms of action have not been well defined. The Behavior Change Wheel is a comprehensive framework for behavior change that includes an all-encompassing model of behavior known as Capability Opportunity Motivation-Behavior and is complemented by a taxonomy of behavior change techniques. Evaluating mHealth interventions for medication adherence using these tools could provide useful insights that may contribute to optimizing their integration into the healthcare system and successful scaling-up. This study aimed to help address the current knowledge gap regarding how two-way mHealth interventions for medication adherence may work by applying the Behavior Change Wheel to characterize WelTel: an interactive digital health outreach platform with robust evidence for improving adherence to antiretroviral therapy. To characterize how WelTel may promote medication adherence, we applied the Behavior Change Wheel to systematically (1) generate a behavioral diagnosis through mapping known antiretroviral therapy adherence barriers onto the Capability Opportunity Motivation-Behavior model of behavior, (2) specify the behavior change techniques that WelTel delivers, (3) link identified behavior change techniques to corresponding intervention functions of the Behavior Change Wheel, and (4) connect these behavior change techniques and intervention functions to respective Capability Opportunity Motivation-Behavior influences on behavior to determine potential mechanisms of action. Our

Evaluating FDG uptake changes between pre and post therapy respiratory gated PET scans

International Nuclear Information System (INIS)

Aristophanous, Michalis; Yong, Yue; Yap, Jeffrey T.; Killoran, Joseph H.; Allen, Aaron M.; Berbeco, Ross I.; Chen, Aileen B.

2012-01-01

Purpose: Whole body (3D) and respiratory gated (4D) FDG-PET/CT scans performed pre-radiotherapy (pre-RT) and post-radiotherapy (post-RT) were analyzed to investigate the impact of 4D PET in evaluating 18F-fluorodeoxyglucose (FDG) uptake changes due to therapy, relative to traditional 3D PET. Methods and materials: 3D and 4D sequential FDG-PET/CT scans were acquired pre-RT and approximately one month post-RT for patients with non-small cell lung cancer (NSCLC). The lesions of high uptake targeted with radiotherapy were identified on the pre-RT scan of each patient. Each lesion on the 3D and each of the five phases of the 4D scan were analyzed using a region of interest (ROI). For each patient the ROIs of the pre-RT scans were used to locate the areas of initial FDG uptake on the post-RT scans following rigid registration. Post-RT ROIs were drawn and the FDG uptake was compared with that of the pre-RT scans. Results: Sixteen distinct lesions from 12 patients were identified and analyzed. Standardized uptake value (SUV) maxima were significantly higher (p-value <0.005) for the lesions as measured on the 4D compared to 3D PET. Comparison of serial pre and post-RT scans showed a mean 62% decrease in SUV with the 3D PET scan (range 36–89%), and a 67% decrease with the 4D PET scan (range 30–89%). The mean absolute difference in SUV change on 3D versus 4D scans was 4.9%, with a range 0–15% (p-value = 0.07). Conclusions: Signal recovery with 4D PET results in higher SUVs when compared to standard 3D PET. Consequently, differences in the evaluation of SUV changes between pre and post-RT plans were observed. Such difference can have a significant impact in PET-based response assessment.

Evaluating Impacts of Land Use/Land Cover Change on Water Resources in Semiarid Regions

Science.gov (United States)

Scanlon, B. R.; Faunt, C. C.; Pool, D. R.; Reedy, R. C.

2017-12-01

Land use/land cover (LU/LC) changes play an integral role in water resources by controlling the partitioning of water at the land surface. Here we evaluate impacts of changing LU/LC on water resources in response to climate variation and change and land use change related to agriculture using data from semiarid regions in the southwestern U.S. Land cover changes in response to climate can amplify or dampen climate impacts on water resources. Changes from wet Pleistocene to much drier Holocene climate resulted in expansion of perennial vegetation, amplifying climate change impacts on water resources by reducing groundwater recharge as shown in soil profiles in the southwestern U.S.. In contrast, vegetation response to climate extremes, including droughts and floods, dampen impacts of these extremes on water resources, as shown by water budget monitoring in the Mojave Desert. Agriculture often involves changes from native perennial vegetation to annual crops increasing groundwater recharge in many semiarid regions. Irrigation based on conjunctive use of surface water and groundwater increases water resource availability, as shown in the Central Valley of California and in southern Arizona. Surface water irrigation in these regions is enhanced by water transported from more humid settings through extensive pipelines. These projects have reversed long-term declining groundwater trends in some regions. While irrigation design has often focused on increased efficiency, "more crop per drop", optimal water resource management may benefit more from inefficient (e.g. flood irrigation) surface-water irrigation combined with efficient (e.g. subsurface drip) irrigation to maximize groundwater recharge, as seen in parts of the Central Valley. Flood irrigation of perennial crops, such as almonds and vineyards, during winter is being considered in the Central Valley to enhance groundwater recharge. Managed aquifer recharge can be considered a special case of conjunctive use of

Evaluation of the Changes in the Regulation of Secondary Education Institutions According to Teachers' Viewpoints (Turkey)

Science.gov (United States)

Coskun, Mucahit; Sozen, Erol

2017-01-01

The purpose of this study is to evaluate teachers' viewpoints about the changes made in the regulation of passing lesson at schools, which became active in 2013 to 2014 academic year. The pass grade applied depends on this regulation, common exams, shortening of the absenteeism durations, and assigning students with performance tasks according to…

Dicty_cDB: Contig-U12867-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0.018 CP000581_85( CP000581 |pid:none) Ostreococcus lucimarinus CCE9901 ... 42 0.018 EU020406_1( EU020406 |pid:none) Thulinius steph...aniae clone Thul25f... 42 0.023 AE005673_3627( AE005673 |pid:none) Caulobacter cres

Irreversible social change

NARCIS (Netherlands)

Pols, A.J.K.; Romijn, H.A.; Collste, G.; Reuter, L.

2014-01-01

In this paper we evaluate how irreversible social change should be evaluated from an ethical perspective. First; we analyse the notion of irreversibility in general terms. We define a general notion of what makes a change irreversible; drawing on discussions in ecology and economics. This notion is

Evaluation of pump pulsation in respirable size-selective sampling: part II. Changes in sampling efficiency.

Science.gov (United States)

Lee, Eun Gyung; Lee, Taekhee; Kim, Seung Won; Lee, Larry; Flemmer, Michael M; Harper, Martin

2014-01-01

This second, and concluding, part of this study evaluated changes in sampling efficiency of respirable size-selective samplers due to air pulsations generated by the selected personal sampling pumps characterized in Part I (Lee E, Lee L, Möhlmann C et al. Evaluation of pump pulsation in respirable size-selective sampling: Part I. Pulsation measurements. Ann Occup Hyg 2013). Nine particle sizes of monodisperse ammonium fluorescein (from 1 to 9 μm mass median aerodynamic diameter) were generated individually by a vibrating orifice aerosol generator from dilute solutions of fluorescein in aqueous ammonia and then injected into an environmental chamber. To collect these particles, 10-mm nylon cyclones, also known as Dorr-Oliver (DO) cyclones, were used with five medium volumetric flow rate pumps. Those were the Apex IS, HFS513, GilAir5, Elite5, and Basic5 pumps, which were found in Part I to generate pulsations of 5% (the lowest), 25%, 30%, 56%, and 70% (the highest), respectively. GK2.69 cyclones were used with the Legacy [pump pulsation (PP) = 15%] and Elite12 (PP = 41%) pumps for collection at high flows. The DO cyclone was also used to evaluate changes in sampling efficiency due to pulse shape. The HFS513 pump, which generates a more complex pulse shape, was compared to a single sine wave fluctuation generated by a piston. The luminescent intensity of the fluorescein extracted from each sample was measured with a luminescence spectrometer. Sampling efficiencies were obtained by dividing the intensity of the fluorescein extracted from the filter placed in a cyclone with the intensity obtained from the filter used with a sharp-edged reference sampler. Then, sampling efficiency curves were generated using a sigmoid function with three parameters and each sampling efficiency curve was compared to that of the reference cyclone by constructing bias maps. In general, no change in sampling efficiency (bias under ±10%) was observed until pulsations exceeded 25% for the

Photometric Evaluation of Soft Tissue Changes in CLP Patients: Le Fort I Advancement Osteotomy (ALO) Versus Anterior Maxillary Distraction (AMD).

Science.gov (United States)

Paulose, Joby; Markose, Eldho

2014-12-01

This paper is a comparative photometric evaluation of soft tissue changes in patients with CLP associated with maxillary deficiency treated with conventional Le Fort I advancement osteotomy (ALO) and anterior maxillary distraction (AMD). Twenty patients with maxillary hypoplasia associated with cleft lip and palate who had undergone either LeFort I osteotomy or distraction osteogenesis with maxillary advancement were included in this study. Frontal and profile photographs were used to ascertain the changes post-surgically. Photographs were obtained before treatment and 1 year after surgical correction in both groups. Vertical as well as horizontal changes in pronasale was well observed in both groups. A substantial increase in nasal parameters was noted in case of AMD group in comparison to ALO group. Though maxillary advancement was quite evident in AMD and ALO groups, a significant and consistent change was observed in AMD group. Significant vertical and horizontal changes were seen with respect to subnasale and labrale superius in AMD group. The hard and soft tissue changes produced by AMD by intra oral distractors were being evaluated so far. The results of the above studies have proved the excellence of AMD over conventional osteotomies. The present study goes hand in hand with the research outcomes till date.

Evaluating social and ecological vulnerability of coral reef fisheries to climate change.

Directory of Open Access Journals (Sweden)

Joshua E Cinner

Full Text Available There is an increasing need to evaluate the links between the social and ecological dimensions of human vulnerability to climate change. We use an empirical case study of 12 coastal communities and associated coral reefs in Kenya to assess and compare five key ecological and social components of the vulnerability of coastal social-ecological systems to temperature induced coral mortality [specifically: 1 environmental exposure; 2 ecological sensitivity; 3 ecological recovery potential; 4 social sensitivity; and 5 social adaptive capacity]. We examined whether ecological components of vulnerability varied between government operated no-take marine reserves, community-based reserves, and openly fished areas. Overall, fished sites were marginally more vulnerable than community-based and government marine reserves. Social sensitivity was indicated by the occupational composition of each community, including the importance of fishing relative to other occupations, as well as the susceptibility of different fishing gears to the effects of coral bleaching on target fish species. Key components of social adaptive capacity varied considerably between the communities. Together, these results show that different communities have relative strengths and weaknesses in terms of social-ecological vulnerability to climate change.

Evaluation of long-term geological and climatic changes in the Spanish programme

International Nuclear Information System (INIS)

Torres, T.; Ortiz, J.E.; Cortes, A.; Delgado, A.

2004-01-01

The Bio-molecular Stratigraphy Laboratory of the Madrid School of Mines has been largely involved in the analysis of long-term paleo-environmental changes in the Iberian Peninsula during the Quaternary. Some of the research projects were UE funded: Paleo-climatological Revision of Climate Evolution in Western Mediterranean Region. Evaluation of Altered Scenarios, Evidence from Quaternary Infill Paleo-hydrogeology, Sequential Biosphere modelling function of Climate evolution models; Paleo-hydrogeological Data Analysis and Model Testing. Other projects were funded by the National Company for Radioactive Waste Management (ENRESA) and the Spanish Nuclear Safety Council (CSN): 'Paleo-climate reconstruction from Middle Pleistocene times through dating and isotopic analysis of tufa deposits'; 'Paleo-environmental evolution of the southern part of the Iberian Peninsula'; 'Paleo-climate'. On a minor scale the laboratory was also involved in the study of some argillaceous media: 'Organic Geochemistry of some deep Spanish argillaceous formations' and 'Effects of climatic change on the argillaceous series of the Duero and Ebro basins'. Here we will present some of the results obtained from tufa deposits analysis and paleo-environmental information from the Guadix-Baza Basin composite-stratigraphical-type-section study. (authors)

Evaluation of uncertainties in regional climate change simulations

DEFF Research Database (Denmark)

Pan, Z.; Christensen, J. H.; Arritt, R. W.

2001-01-01

, an atmosphere-ocean coupled general circulation model (GCM) current climate, and a future scenario of transient climate change. Common precipitation climatology features simulated by both models included realistic orographic precipitation, east-west transcontinental gradients, and reasonable annual cycles over...... to different subgrid scale processes in individual models. The ratio of climate change to biases, which we use as one measure of confidence in projected climate changes, is substantially larger than 1 in several seasons and regions while the ratios are always less than 1 in summer. The largest ratios among all...... regions are in California. Spatial correlation coefficients of precipitation were computed between simulation pairs in the 2x3 set. The climate change correlation is highest and the RCM performance correlation is lowest while boundary forcing and intermodel correlations are intermediate. The high spatial...

Evaluation of the effect of prostate volume change on tumor control probability in LDR brachytherapy.

Science.gov (United States)

Knaup, Courtney; Mavroidis, Panayiotis; Stathakis, Sotirios; Smith, Mark; Swanson, Gregory; Papanikolaou, Niko

2011-09-01

This study evaluates low dose-rate brachytherapy (LDR) prostate plans to determine the biological effect of dose degradation due to prostate volume changes. In this study, 39 patients were evaluated. Pre-implant prostate volume was determined using ultrasound. These images were used with the treatment planning system (Nucletron Spot Pro 3.1(®)) to create treatment plans using (103)Pd seeds. Following the implant, patients were imaged using CT for post-implant dosimetry. From the pre and post-implant DVHs, the biologically equivalent dose and the tumor control probability (TCP) were determined using the biologically effective uniform dose. The model used RBE = 1.75 and α/β = 2 Gy. The prostate volume changed between pre and post implant image sets ranged from -8% to 110%. TCP and the mean dose were reduced up to 21% and 56%, respectively. TCP is observed to decrease as the mean dose decreases to the prostate. The post-implant tumor dose was generally observed to decrease, compared to the planned dose. A critical uniform dose of 130 Gy was established. Below this dose, TCP begins to fall-off. It was also determined that patients with a small prostates were more likely to suffer TCP decrease. The biological effect of post operative prostate growth due to operative trauma in LDR was evaluated using the concept. The post-implant dose was lower than the planned dose due to an increase of prostate volume post-implant. A critical uniform dose of 130 Gy was determined, below which TCP begun to decline.

A simple integrated assessment approach to global change simulation and evaluation

Science.gov (United States)

Ogutu, Keroboto; D'Andrea, Fabio; Ghil, Michael

2016-04-01

We formulate and study the Coupled Climate-Economy-Biosphere (CoCEB) model, which constitutes the basis of our idealized integrated assessment approach to simulating and evaluating global change. CoCEB is composed of a physical climate module, based on Earth's energy balance, and an economy module that uses endogenous economic growth with physical and human capital accumulation. A biosphere model is likewise under study and will be coupled to the existing two modules. We concentrate on the interactions between the two subsystems: the effect of climate on the economy, via damage functions, and the effect of the economy on climate, via a control of the greenhouse gas emissions. Simple functional forms of the relation between the two subsystems permit simple interpretations of the coupled effects. The CoCEB model is used to make hypotheses on the long-term effect of investment in emission abatement, and on the comparative efficacy of different approaches to abatement, in particular by investing in low carbon technology, in deforestation reduction or in carbon capture and storage (CCS). The CoCEB model is very flexible and transparent, and it allows one to easily formulate and compare different functional representations of climate change mitigation policies. Using different mitigation measures and their cost estimates, as found in the literature, one is able to compare these measures in a coherent way.

Evaluation of historical land cover, land use, and land-use change emissions in the GCAM integrated assessment model

Science.gov (United States)

Calvin, K. V.; Wise, M.; Kyle, P.; Janetos, A. C.; Zhou, Y.

2012-12-01

Integrated Assessment Models (IAMs) are often used as science-based decision-support tools for evaluating the consequences of climate and energy policies, and their use in this framework is likely to increase in the future. However, quantitative evaluation of these models has been somewhat limited for a variety of reasons, including data availability, data quality, and the inherent challenges in projections of societal values and decision-making. In this analysis, we identify and confront methodological challenges involved in evaluating the agriculture and land use component of the Global Change Assessment Model (GCAM). GCAM is a global integrated assessment model, linking submodules of the regionally disaggregated global economy, energy system, agriculture and land-use, terrestrial carbon cycle, oceans and climate. GCAM simulates supply, demand, and prices for energy and agricultural goods from 2005 to 2100 in 5-year increments. In each time period, the model computes the allocation of land across a variety of land cover types in 151 different regions, assuming that farmers maximize profits and that food demand is relatively inelastic. GCAM then calculates both emissions from land-use practices, and long-term changes in carbon stocks in different land uses, thus providing simulation information that can be compared to observed historical data. In this work, we compare GCAM results, both in recent historic and future time periods, to historical data sets. We focus on land use, land cover, land-use change emissions, and albedo.

Hydrospatial Analysis of Inundation Patterns for a Restored Floodplain to Evaluate Potential Climate Change Impacts

Science.gov (United States)

Whipple, A. A.; Viers, J. H.

2017-12-01

Interaction between rivers and their floodplains create dynamic physical conditions supporting freshwater ecosystems. The natural flood regimes to which native species are adapted are often profoundly altered by interacting factors including water management, land use change, and climate change. Reintroducing dynamic flood regimes through enhancing river-floodplain connectivity is a common floodplain restoration objective. However, it is often difficult to determine how various actions (or a combination of actions), such as levee setbacks or environmental flow releases, will impact physical conditions relevant to ecological functions, such as depth, velocity, duration, timing, and connectivity, and how these might change in the future. Understanding changes to these dynamic conditions requires improved quantification of spatiotemporal variability of floodplain inundation patterns, in essence a floodplain's hydrospatial regime. The research presented here develops this concept by quantifying the hydrospatial regime of a floodplain along the lower Cosumnes River, California, both before and after levee-removal restoration, and uses this to evaluate how effects of restoration may be altered with changing hydrology due to climate change. This approach uses spatial analysis in R to summarize metrics based on estimated spatially-distributed depth and velocity, derived from 2D hydrodynamic modeling output for pre- and post-restoration conditions. This is performed for an historical and two future periods of daily flow of the largely unregulated Cosumnes River, driven by a subset of global climate models. We show that responses to restoration vary across the hydrospatial domain and further consider these differences in floodplain dynamics in relation to hydroclimatic change. This research refines expectations for restoration and overall provides readily applied methods to inform planning and management of floodplain ecosystems within the context of climate change

Forecasting Brassica rapa: Merging climate models with genotype specific process models for evaluation whole species response to climate change.

Science.gov (United States)

Pleban, J. R.; Mackay, D. S.; Ewers, B. E.; Weinig, C.; Guadagno, C. L.

2016-12-01

Human society has modified agriculture management practices and utilized a variety of breeding approaches to adapt to changing environments. Presently a dual pronged challenge has emerged as environmental change is occurring more rapidly while the demand of population growth on food supply is rising. Knowledge of how current agricultural practices will respond to these challenges can be informed through crafted prognostic modeling approaches. Amongst the uncertainties associated with forecasting agricultural production in a changing environment is evaluation of the responses across the existing genotypic diversity of crop species. Mechanistic models of plant productivity provide a means of genotype level parameterization allowing for a prognostic evaluation of varietal performance under changing climate. Brassica rapa represents an excellent species for this type of investigation because of its wide cultivation as well as large morphological and physiological diversity. We incorporated genotypic parameterization of B. rapa genotypes based on unique CO2 assimilation strategies, vulnerabilities to cavitation, and root to leaf area relationships into the TREES model. Three climate drivers, following the "business-as-usual" greenhouse gas emissions scenario (RCP 8.5) from Coupled Model Intercomparison Project, Phase 5 (CMIP5) were considered: temperature (T) along with associated changes in vapor pressure deficit (VPD), increasing CO2, as well as alternatives in irrigation regime across a temporal scale of present day to 2100. Genotypic responses to these drivers were evaluated using net primary productivity (NPP) and percent loss hydraulic conductance (PLC) as a measure of tolerance for a particular watering regime. Genotypic responses to T were witnessed as water demand driven by increases in VPD at 2050 and 2100 drove some genotypes to greater PLC and in a subset of these saw periodic decreases in NPP during a growing season. Genotypes able to withstand the greater

Evaluation of functional changes in the evolutionary stages of Parkinson's disease: a case series

Directory of Open Access Journals (Sweden)

Natália Feitoza do Nascimento

Full Text Available Abstract Introduction : Parkinson's disease is one of the fastest growing neurological disorders in the world and is considered to be predominantly a motor disorder, classified as neurodegenerative, chronic and extrapyramidal, characterized by tremors, muscular rigidity, postural balance deficit and bradykinesia. Objective : To analyze the functional changes presented by Parkinson's disease patients in the different evolutionary stages of the disease. Methods : The sample included 30 patients of both genders, aged between 51 and 75 years, with clinical diagnoses of Parkinson's disease in different evolutionary stages, undergoing physiotherapy in the Pernambuco Parkinson Association. The patients were evaluated through the Hoehn and Yahr Staging Scale and the Unified Parkinson's Disease Rating Scale (UPDRS. Results : The results highlighted an increase in the presence and severity of the changes presented by the Parkinson's disease patients, according to the evolution of the stages of the disease, especially considering aspects relating to motor activity and activities of daily living, including changes related to speech, swallowing, the ability to get dressed, personal hygiene, turning in bed and arising from a chair, occurrence of falls, posture, gait, postural stability and the presence of bradykinesia/hypokinesia. Conclusion : It is believed that the classification of the evolutionary stage of patients through the Hoehn and Yahr Scale and the registration of functional change through the UPDRS are useful for the development of the physiotherapy treatment plan.

Background-Oriented Schlieren used in a hypersonic inlet test at NASA GRC

Science.gov (United States)

Clem, Michelle; Woike, Mark; Saunders, John

2016-01-01

Background Oriented Schlieren (BOS) is a derivative of the classical schlieren technology, which is used to visualize density gradients, such as shock wave structures in a wind tunnel. Changes in refractive index resulting from density gradients cause light rays to bend, resulting in apparent motion of a random background pattern. The apparent motion of the pattern is determined using cross-correlation algorithms (between no-flow and with-flow image pairs) producing a schlieren-like image. One advantage of BOS is its simplified setup which enables a larger field-of-view (FOV) than traditional schlieren systems. In the present study, BOS was implemented into the Combined Cycle Engine Large-Scale Inlet Mode Transition Experiment (CCE LIMX) in the 10x10 Supersonic Wind Tunnel at NASA Glenn Research Center. The model hardware for the CCE LIMX accommodates a fully integrated turbine based combined cycle propulsion system. To date, inlet mode transition between turbine and ramjet operation has been successfully demonstrated. High-speed BOS was used to visualize the behavior of the flow structures shock waves during unsteady inlet unstarts, a phenomenon known as buzz. Transient video images of inlet buzz were recorded for both the ramjet flow path (high speed inlet) and turbine flow path (low speed inlet). To understand the stability limits of the inlet, operation was pushed to the point of unstart and buzz. BOS was implemented in order to view both inlets simultaneously, since the required FOV was beyond the capability of the current traditional schlieren system. An example of BOS data (Images 1-6) capturing inlet buzz are presented.

Post-Occupancy Evaluation of Facilities Change

NARCIS (Netherlands)

van der Voordt, Theo; de Been, I.; Maarleveld, M.; Finch, E

2012-01-01

This chapter discusses possible aims, tools and deliverables of Post-Occupancy Evaluations (POE) (otherwise known as building-in-use studies), with a focus on interventions in supporting facilities. POE has a long tradition and has been applied in different fields (e.g. offices, educational

FairTrade's theory of change: an evaluation based on the cooperative life cycle framework and mixed methods

NARCIS (Netherlands)

Francesconi, G.N.; Ruben, R.

2014-01-01

This study presents a quasi-experimental analysis of the impact of FairTrade certification on the commercial performance of coffee farmers in Tanzania. In doing so the study emphasises the importance of a well-contextualised theory of change as a basis for evaluation design. It also stresses the

Calibration, uncertainties and use of soybean crop simulation models for evaluating strategies to mitigate the effects of climate change in Southern Brazil

OpenAIRE

Rafael Battisti

2016-01-01

The water deficit is a major factor responsible for the soybean yield gap in Southern Brazil and tends to increase under climate change. Crop models are a tool that differ on levels of complexity and performance and can be used to evaluate strategies to manage crops, according the climate conditions. Based on that, the aims of this study were: to assess five soybean crop models and their ensemble; to evaluate the sensitivity of these models to systematic changes in climate; to assess soybean ...

The contribution of behavioural science to primary care research: development and evaluation of behaviour change interventions.

Science.gov (United States)

Sutton, Stephen

2011-10-01

Behavioural science is concerned with predicting, explaining and changing behaviour. Taking a personal perspective, this article aims to show how behavioural science can contribute to primary care research, specifically in relation to the development and evaluation of interventions to change behaviour. After discussing the definition and measurement of behaviour, the principle of compatibility and theories of behaviour change, the article outlines two examples of behaviour change trials (one on medication adherence and the other on physical activity), which were part of a research programme on prevention of chronic disease and its consequences. The examples demonstrate how, in a multidisciplinary context, behavioural science can contribute to primary care research in several important ways, including posing relevant research questions, defining the target behaviour, understanding the psychological determinants of behaviour, developing behaviour change interventions and selection or development of measures. The article concludes with a number of recommendations: (i) whether the aim is prediction, explanation or change, defining the target behaviour is a crucial first step; (ii) interventions should be explicitly based on theories that specify the factors that need to be changed in order to produce the desired change in behaviour; (iii) intervention developers need to be aware of the differences between different theories and select a theory only after careful consideration of the alternatives assessed against relevant criteria; and (iv) developers need to be aware that interventions can never be entirely theory based.

Optimal changes in the prepress process: a model for evaluation of state and direction of productivity and quality improvements

Science.gov (United States)

Kihlberg, Henrik; Lindgren, Mats

1998-09-01

The demands changes with the customers marketplace which makes it crucial for prepress companies of today and those of tomorrow to be able to change their services. The production tools are becoming more standardized and similar through out the industry. Intelligent tools are developed at a rapid pace which results in possibilities to automate these processes. Key success factors of today and tomorrow are the ability to change and understand the customers' market. The market demands shorter delivery times and lower costs. The total number of printed editions are decreasing while each edition contains an increased numbers of pages and images. The customers requires higher quality with the ability to control and predict the end result. Case studies, interviews and workshops have been carried out at commercial printing companies, prepress houses, image bureau's, advertising agencies and digital photographers in Sweden. A major part of the research focus on the digital image process at eleven companies in the graphic arts industry, all of which have prepress. The analysis has resulted in the thorough knowledge of both the production process and the parameters to measure productivity and quality. A model for the evaluation of changes is presented, with measurable values for productivity and quality. The model can be used to map and compare the states prepress are in, and/or be used to evaluate if changes are needed.

The earlier the better: An evaluation of changes to teaching year 1 Nuclear Medicine

International Nuclear Information System (INIS)

Adams, E.J.; Kilburn-Watt, E.; Cowell, S.F.

1998-01-01

Full text: Changes were made to the content and mode of delivery of the Year 1 Nuclear Medicine degree program at The University of Sydney in 1996. Changes included increased study of skeletal, respiratory and cardiac Nuclear Medicine and the use of problem based learning to increase independent learning and clinical reasoning skills. Learning outcomes were qualitatively assessed to determine the educational value of the changes. The project aimed to evaluate whether changes made to the Year 1 program in 1996 raised clinical abilities of students entering their first clinical placement in Year 2. Retrospective surveys were conducted on both the 1995 and 1996 Year 1 students after completion of their first Year 2 clinical placement. Surveys were designed to assess the students perception of how well Year 1 had prepared them for both understanding and application of content studied in Year 1. Clinical Supervisors who assessed both cohorts of students were surveyed to determine if 1996 students presented with any appreciable difference in understanding and application to areas studied in Year 1. Results of the student survey indicated the 1996 students were more positive than the 1995 students about their clinical readiness. Clinical Supervisor survey results showed a positive response to the level of understanding and application of skills by the 1996 students. In conclusion, the 1996 Year 1 students were perceived to have a higher level of clinical abilities at the commencement of their Year 2 clinical placement. This result demonstrated worthwhile learning outcomes for the changes to content and mode of delivery in the Year 1 Nuclear Medicine degree program

Selecting a change and evaluating its impact on the performance of a complex adaptive health care delivery system

Directory of Open Access Journals (Sweden)

Malaz A Boustani

2010-05-01

Full Text Available Malaz A Boustani1,2,3,4, Stephanie Munger1,2, Rajesh Gulati3,4, Mickey Vogel4, Robin A Beck3,4, Christopher M Callahan1,2,3,41Indiana University Center for Aging Research, 2Regenstrief Institute Inc., 3Indiana University School of Medicine, Department of Medicine, Division of General Internal Medicine and Geriatrics, 4Indiana University Medical Group-Primary Care; Indianapolis, IN USAAbstract: Complexity science suggests that our current health care delivery system acts as a complex adaptive system (CAS. Such systems represent a dynamic and flexible network of individuals who can coevolve with their ever changing environment. The CAS performance fluctuates and its members’ interactions continuously change over time in response to the stress generated by its surrounding environment. This paper will review the challenges of intervening and introducing a planned change into a complex adaptive health care delivery system. We explore the role of the “reflective adaptive process” in developing delivery interventions and suggest different evaluation methodologies to study the impact of such interventions on the performance of the entire system. We finally describe the implementation of a new program, the Aging Brain Care Medical Home as a case study of our proposed evaluation process.Keywords: complexity, aging brain, implementation, complex adaptive system, sustained change, care delivery

Ciclo de convesrión de efectivo en las grandes empresas de comercio al detal en Colombia (1998-2002

Directory of Open Access Journals (Sweden)

Néstor Moreno Meza

2004-01-01

Full Text Available El presente artículo estudia las magnitudes y las implicaciones financieras del ciclo de conversión de efectivo (CCE, concepto desarrollado por Richards y Laughlin (1980 para integrar tres indicadores fundamentales del capital de trabajo y de la gestión del circulante en la empresa comercial, como son los días de inventario, los días de cartera y los días de crédito de proveedores. Estimado a partir de los estados financieros de una muestra de cinco grandes empresas del comercio minorista en Colombia (Almacenes Éxito-Cadenalco, Carulla- Vivero, Supertiendas y Droguerías Olímpica, Cacharrería La 14 y Carrefour, las cifras del CCE correspondientes al período 1998-2002 revelan la importancia del apalancamiento financiero basado en la cuenta de proveedores, así como sus implicaciones para el capital de trabajo y el equilibrio financiero de estas cadenas comerciales.

Exposure history determines pteropod vulnerability to ocean acidification along the US West Coast.

Science.gov (United States)

Bednaršek, N; Feely, R A; Tolimieri, N; Hermann, A J; Siedlecki, S A; Waldbusser, G G; McElhany, P; Alin, S R; Klinger, T; Moore-Maley, B; Pörtner, H O

2017-07-03

The pteropod Limacina helicina frequently experiences seasonal exposure to corrosive conditions (Ω ar   US West Coast and is recognized as one of the species most susceptible to ocean acidification (OA). Yet, little is known about their capacity to acclimatize to such conditions. We collected pteropods in the California Current Ecosystem (CCE) that differed in the severity of exposure to Ω ar conditions in the natural environment. Combining field observations, high-CO 2 perturbation experiment results, and retrospective ocean transport simulations, we investigated biological responses based on histories of magnitude and duration of exposure to Ω ar  history of exposure to corrosive conditions. Pteropods from the coastal CCE appear to be at or near the limit of their physiological capacity, and consequently, are already at extinction risk under projected acceleration of OA over the next 30 years. Our results demonstrate that Ω ar exposure history largely determines pteropod response to experimental conditions and is essential to the interpretation of biological observations and experimental results.

Eco-Environment Status Evaluation and Change Analysis of Qinghai Based on National Geographic Conditions Census Data

Science.gov (United States)

Zheng, M.; Zhu, M.; Wang, Y.; Xu, C.; Yang, H.

2018-04-01

As the headstream of the Yellow River, the Yangtze River and the Lantsang River, located in the hinterland of Qinghai-Tibet Plateau, Qinghai province is hugely significant for ecosystem as well as for ecological security and sustainable development in China. With the accomplishment of the first national geographic condition census, the frequent monitoring has begun. The classification indicators of the census and monitoring data are highly correlated with Technical Criterion for Ecosystem Status Evaluation released by Ministry of Environmental Protection in 2015. Based on three years' geographic conditions data (2014-2016), Landsat-8 images and thematic data (water resource, pollution emissions, meteorological data, soil erosion, etc.), a multi-years and high-precision eco-environment status evaluation and spatiotemporal change analysis of Qinghai province has been researched on the basis of Technical Criterion for Ecosystem Status Evaluation in this paper. Unlike the evaluation implemented by environmental protection department, the evaluation unit in this paper is town rather than county. The evaluation result shows that the eco-environment status in Qinghai is generally in a fine condition, and has significant regional differences. The eco-environment status evaluation based on national geographic conditions census and monitoring data can improve both the time and space precision. The eco-environment status with high space precise and multi-indices is a key basis for environment protection decision-making.

Impact on house staff evaluation scores when changing from a Dreyfus- to a Milestone-based evaluation model: one internal medicine residency program's findings

Directory of Open Access Journals (Sweden)

Karen A. Friedman

2014-11-01

Full Text Available Purpose: As graduate medical education (GME moves into the Next Accreditation System (NAS, programs must take a critical look at their current models of evaluation and assess how well they align with reporting outcomes. Our objective was to assess the impact on house staff evaluation scores when transitioning from a Dreyfus-based model of evaluation to a Milestone-based model of evaluation. Milestones are a key component of the NAS. Method: We analyzed all end of rotation evaluations of house staff completed by faculty for academic years 2010–2011 (pre-Dreyfus model and 2011–2012 (post-Milestone model in one large university-based internal medicine residency training program. Main measures included change in PGY-level average score; slope, range, and separation of average scores across all six Accreditation Council for Graduate Medical Education (ACGME competencies. Results: Transitioning from a Dreyfus-based model to a Milestone-based model resulted in a larger separation in the scores between our three post-graduate year classes, a steeper progression of scores in the PGY-1 class, a wider use of the 5-point scale on our global end of rotation evaluation form, and a downward shift in the PGY-1 scores and an upward shift in the PGY-3 scores. Conclusions: For faculty trained in both models of assessment, the Milestone-based model had greater discriminatory ability as evidenced by the larger separation in the scores for all the classes, in particular the PGY-1 class.

Impact on house staff evaluation scores when changing from a Dreyfus- to a Milestone-based evaluation model: one internal medicine residency program's findings.

Science.gov (United States)

Friedman, Karen A; Balwan, Sandy; Cacace, Frank; Katona, Kyle; Sunday, Suzanne; Chaudhry, Saima

2014-01-01

As graduate medical education (GME) moves into the Next Accreditation System (NAS), programs must take a critical look at their current models of evaluation and assess how well they align with reporting outcomes. Our objective was to assess the impact on house staff evaluation scores when transitioning from a Dreyfus-based model of evaluation to a Milestone-based model of evaluation. Milestones are a key component of the NAS. We analyzed all end of rotation evaluations of house staff completed by faculty for academic years 2010-2011 (pre-Dreyfus model) and 2011-2012 (post-Milestone model) in one large university-based internal medicine residency training program. Main measures included change in PGY-level average score; slope, range, and separation of average scores across all six Accreditation Council for Graduate Medical Education (ACGME) competencies. Transitioning from a Dreyfus-based model to a Milestone-based model resulted in a larger separation in the scores between our three post-graduate year classes, a steeper progression of scores in the PGY-1 class, a wider use of the 5-point scale on our global end of rotation evaluation form, and a downward shift in the PGY-1 scores and an upward shift in the PGY-3 scores. For faculty trained in both models of assessment, the Milestone-based model had greater discriminatory ability as evidenced by the larger separation in the scores for all the classes, in particular the PGY-1 class.

Evaluation of geometric changes of parotid glands during head and neck cancer radiotherapy using daily MVCT and automatic deformable registration

International Nuclear Information System (INIS)

Lee, Choonik; Langen, Katja M.; Lu, Weiguo; Haimerl, Jason; Schnarr, Eric; Ruchala, Kenneth J.; Olivera, Gustavo H.; Meeks, Sanford L.; Kupelian, Patrick A.; Shellenberger, Thomas D.; Manon, Rafael R.

2008-01-01

Background and purpose: To assess and evaluate geometrical changes in parotid glands using deformable image registration and megavoltage CT (MVCT) images. Methods: A deformable registration algorithm was applied to 330 daily MVCT images (10 patients) to create deformed parotid contours. The accuracy and robustness of the algorithm was evaluated through visual review, comparison with manual contours, and precision analysis. Temporal changes in the parotid gland geometry were observed. Results: The deformed parotid contours were qualitatively judged to be acceptable. Compared with manual contours, the uncertainties of automatically deformed contours were similar with regard to geometry and dosimetric endpoint. The day-to-day variations (1 standard deviation of errors) in the center-of-mass distance and volume were 1.61 mm and 4.36%, respectively. The volumes tended to decrease with a median total loss of 21.3% (6.7-31.5%) and a median change rate of 0.7%/day (0.4-1.3%/day). Parotids migrated toward the patient center with a median total distance change of -5.26 mm (0.00 to -16.35 mm) and a median change rate of -0.22 mm/day (0.02 to -0.56 mm/day). Conclusion: The deformable image registration and daily MVCT images provide an efficient and reliable assessment of parotid changes over the course of a radiation therapy

Environmental education evaluation: time to reflect, time for change.

Science.gov (United States)

Crohn, Kara; Birnbaum, Matthew

2010-05-01

Evaluation in environmental education is fairly nascent despite decades-long attention to its importance. In setting the context for future chapters appearing in this special issue of the Journal of Evaluation and Program Planning, attention is devoted to the political circumstances associated with retrenchment in the public sector and increased involvement of citizens in environmental issues in their regions. It further is nested in the context of potential political reforms in a stable market democracy where education is but one strategy that can be bundled with regulations and taxes/subsidies. Additional attention is directed to explaining many of the key evaluation theories--utilization-focused evaluation, evaluative capacity building, and program-theory driven evaluation. The final section of this chapter situates the subsequent chapters of this volume based on the demographic target (youth or adult) as well as connection to a particular evaluation theory. Copyright 2009 Elsevier Ltd. All rights reserved.

Study on driver`s stress in lane-change maneuver. Evaluation and analysis of heat rate change; Shasen henkoji no untensha no kinchodo kaiseki. Shinpaku hendo no gen`in bunrui to sono hyoka

Energy Technology Data Exchange (ETDEWEB)

Sumida, K [Mitsubishi Motors Corp., Tokyo (Japan); Chikamori, S; Shimizu, Y [Seikei University, Tokyo (Japan)

1997-10-01

We measured the changes of heart rate in order to analyze the drivers` stress while they tried high speed lane-change on the stationary driving simulator. We concluded that the reasons of the chances were mainly dependent on the following two items. (1) mental pressure caused by the coming task of lane-change, (2) mental disturbance by the task to keep the vehicle inside the lane. By using the mental pressure and disturbance, we could evaluate the stability of the vehicles in lane-change maneuver. 3 refs., 11 figs.

Association of Trans-theoretical Model (TTM based Exercise Behavior Change with Body Image Evaluation among Female Iranian Students

Directory of Open Access Journals (Sweden)

Sahar Rostami

2017-03-01

Full Text Available BackgroundBody image is a determinant of individual attractiveness and physical activity among the young people. This study was aimed to assess the association of Trans-theoretical model based exercise behavior change with body image evaluation among the female Iranian students.Materials and MethodsThis cross-sectional study was conducted in Sanandaj city, Iran in 2016. Using multistage sampling method, a total of 816 high school female students were included in the study. They completed a three-section questionnaire, including demographic information, Trans-theoretical model constructs and body image evaluation. The obtained data were fed into SPSS version 21.0.  ResultsThe results showed more than 60% of participants were in the pre-contemplation and contemplation stages of exercise behavior. The means of perceived self-efficacy, barriers and benefits were found to have a statistically significant difference during the stages of exercise behavior change (P

Prospective Evaluation of Changes in Tumor Size and Tumor Metabolism in Patients with Advanced Gastric Cancer Undergoing Chemotherapy: Association and Clinical Implication.

Science.gov (United States)

Park, Seongyeol; Ha, Seunggyun; Kwon, Hyun Woo; Kim, Woo Hyoung; Kim, Tae-Yong; Oh, Do-Youn; Cheon, Gi Jeong; Bang, Yung-Jue

2017-06-01

A change in tumor size is a well-validated and commonly used value for evaluating response to chemotherapy in cancer. Metabolic changes induced by chemotherapy are related to prognosis in several tumor types. However, the clinical implication of metabolic changes in patients with advanced gastric cancer (AGC) undergoing chemotherapy remains unclear. We aimed to evaluate response of tumor size and metabolism in AGC during chemotherapy and to reveal the relationship between them in view of their impact on patient survival. Methods: We prospectively enrolled patients with AGC before the initiation of first-line palliative chemotherapy. Using baseline and follow-up contrast-enhanced CT and 18 F-FDG PET, we assessed the tumor diameter, SUV max , and total lesion glycolysis in each lesion and their changes during chemotherapy at the same time. We included all lesions with the maximal longest diameters over 1 cm on CT, and each lesion was evaluated by matched 18 F-FDG PET. We analyzed the association between changes in tumor metabolism and tumor size and performed outcome analysis on overall survival (OS) and progression-free survival (PFS). Results: Seventy-four patients were enrolled, and the number of all lesions included in this study was 620. Compared with adenocarcinomas, poorly cohesive carcinomas demonstrated lower SUV max irrespective of tumor size ( P chemotherapy had a linear correlation with the changes in tumor size of each lesion, and a 30% tumor size reduction was associated with a 50% SUV max reduction ( P chemotherapy correlated with changes in tumor size in AGC. Considering both changes in metabolism and size could help predict a more accurate prognosis for AGC patients undergoing chemotherapy. © 2017 by the Society of Nuclear Medicine and Molecular Imaging.

Evaluating short-term hydro-meteorological fluxes using GRACE-derived water storage changes

Science.gov (United States)

Eicker, A.; Jensen, L.; Springer, A.; Kusche, J.

2017-12-01

Atmospheric and terrestrial water budgets, which represent important boundary conditions for both climate modeling and hydrological studies, are linked by evapotranspiration (E) and precipitation (P). These fields are provided by numerical weather prediction models and atmospheric reanalyses such as ERA-Interim and MERRA-Land; yet, in particular the quality of E is still not well evaluated. Via the terrestrial water budget equation, water storage changes derived from products of the Gravity Recovery and Climate Experiment (GRACE) mission, combined with runoff (R) data can be used to assess the realism of atmospheric models. In this contribution we will investigate the closure of the water balance for short-term fluxes, i.e. the agreement of GRACE water storage changes with P-E-R flux time series from different (global and regional) atmospheric reanalyses, land surface models, as well as observation-based data sets. Missing river runoff observations will be extrapolated using the calibrated rainfall-runoff model GR2M. We will perform a global analysis and will additionally focus on selected river basins in West Africa. The investigations will be carried out for various temporal scales, focusing on short-term fluxes down to daily variations to be detected in daily GRACE time series.

Evaluation of Ice sheet evolution and coastline changes from 1960s in Amery Ice Shelf using multi-source remote sensing images

Science.gov (United States)

Qiao, G.; Ye, W.; Scaioni, M.; Liu, S.; Feng, T.; Liu, Y.; Tong, X.; Li, R.

2013-12-01

Global change is one of the major challenges that all the nations are commonly facing, and the Antarctica ice sheet changes have been playing a critical role in the global change research field during the past years. Long time-series of ice sheet observations in Antarctica would contribute to the quantitative evaluation and precise prediction of the effects on global change induced by the ice sheet, of which the remote sensing technology would make critical contributions. As the biggest ice shelf and one of the dominant drainage systems in East Antarctic, the Amery Ice Shelf has been making significant contributions to the mass balance of the Antarctic. Study of Amery Ice shelf changes would advance the understanding of Antarctic ice shelf evolution as well as the overall mass balance. At the same time, as one of the important indicators of Antarctica ice sheet characteristics, coastlines that can be detected from remote sensing imagery can help reveal the nature of the changes of ice sheet evolution. Most of the scientific research on Antarctica with satellite remote sensing dated from 1970s after LANDSAT satellite was brought into operation. It was the declassification of the cold war satellite reconnaissance photographs in 1995, known as Declassified Intelligence Satellite Photograph (DISP) that provided a direct overall view of the Antarctica ice-sheet's configuration in 1960s, greatly extending the time span of Antarctica surface observations. This paper will present the evaluation of ice-sheet evolution and coastline changes in Amery Ice Shelf from 1960s, by using multi-source remote sensing images including the DISP images and the modern optical satellite images. The DISP images scanned from negatives were first interior-oriented with the associated parameters, and then bundle block adjustment technology was employed based on the tie points and control points, to derive the mosaic image of the research region. Experimental results of coastlines generated

Collaboration for Transformation: Community-Campus Engagement for Just and Sustainable Food Systems

Science.gov (United States)

Levkoe, Charles Z.; Andrée, Peter; Bhatt, Vikram; Brynne, Abra; Davison, Karen M.; Kneen, Cathleen; Nelson, Erin

2016-01-01

This article focuses on the collaborations between academics and community-based organizations seeking to fundamentally reorganize the way food is produced, distributed, and consumed as well as valued. The central research question investigates whether and how the growth of community--campus engagement (CCE) can strengthen food movements. Drawing…

Evaluation of anthocynin changes in blueberries and in blueberry jam after the processing and storage

OpenAIRE

Peter Czako; Ľubomír Mendel; Martina Fikselová; Andrea Mendelová

2013-01-01

Blueberry (Vaccinium corymbosum L.) is worldwide famous as the healthy and desirable fruit. The most valuable nutritional components of fruits are polyphenols, which include anthocyanins. The aim of the study was to assess the content of anthocyanin dyes in selected varieties of blueberry fruit. We evaluated the changes in the content of colorants that occur after treatment for fruit jam and its subsequent storage at 21°C under the light. Varieties Ramcocas, Record, Iranka, Nelson, Pemberton,...

EVALUATION OF EARLY ISCHEMIC CHANGES IN STROKE PATIENTS TREATED WITH THROMBOLYTIC THERAPY

Directory of Open Access Journals (Sweden)

Kolevski Goran

2016-07-01

Full Text Available Introduction:The aim of this study is to evaluate early brain ischemic changes on CT scan in stroke patients in correlation with the clinical outcome, as well as to evaluate if there is prognostic and predictive features that can be used. Patients and methods: We examined 20 patients with acute ischemic stroke, from which 12 were male and 8 were female, at the age from 47 to 76 years. Results: The hyperdense medial artery (HMA sign was present in 10 (50% patients. Concerning the ASPECTS score, 5 patients (25% had normal score of 10 points, while 7 patients (35% had score of 7 points. 12 patients (60% had unfavorable outcome, while 8 patients (40% had favorable outcome. Our statistical analysis shows that age of more than 65 years, presence of 2 or more risk-factors, ASPECTS score of 7 and presence of HMA sign were all statistically significant predictors of unfavorable outcome in examined patients (p<0.05 each. The presence of the hyperdense medial artery sign was the most significant single predictor for unfavorable clinical outcome (p=0.0042, p<0.05. Conclusion:The presence of HMA sign is the most significant single predictor for unfavorable clinical outcome.

Mid-term evaluation of the Climate Change Action Fund : foundation analysis block

International Nuclear Information System (INIS)

2001-11-01

From September 2000 to January 20, 2001, an evaluation was conducted into the Climate Change Action Fund (CCAF). Established in February 1998 by the Government of Canada, the CCAF was intended to help Canada meet its commitments under the Kyoto Protocol for the reduction of greenhouse gas (GHG) emissions. Over three years, the CCAF Program provided 150 million dollars, and the Foundation Block received 34 million dollars from these funds. In order to lay the groundwork for a National Implementation Strategy along with the provinces, industry and shareholders, the Foundation Analysis Block supported several initiatives such as the Issue Tables process, the development of analysis and modelling tools to be used for options, examination of cross-cutting options, and the required mechanisms within the department and with other stakeholders. The performance to date was evaluated and the results described in this report. It was concluded that the objectives were met, that progress was made and was well managed overall. Funding was deemed sufficient. Some of the recommendations made included: setting realistic time targets that take into account the complexity of deriving common sectoral/cross-sectoral modelling results, performance targets and ways for monitoring the progress must be established in the case of all major activities. 4 tabs., 1 fig

Methodological principles for the evaluation of impact of the variability and the climatic change in the human health, a statistical focus

International Nuclear Information System (INIS)

Ortiz Bulto, Paulo Lazaro; Vladimir Guevara, Antonio; Ulloa, Jacqueline; Aparicio, Marilyn

2001-01-01

Signal detection of climate variability or change and the evaluation of its specific effects, requires an understanding of the variations in the observed data, which describe the natural climate variability and change signals. It is also necessary to understand the complex interactions that make up the climate system. In the present work, an unusual methodological approach is taken to evaluate the effects and impacts of climate variability and change on the behaviour of different diseases, on the basis of practical experience of its application in four countries of the Caribbean, Central and South America: Cuba, Panama, Bolivia and Paraguay. For the determination of the climate signal change multivariate analysis techniques (empirical orthogonal functions) were used, combined with robust methods of time series decomposition (decomposition by median). They allowed us to describe the changes observed in the seasonal patterns of climate and epidemiological diseases for the period 1991-1999, with respect to the period 1961-1990. These results were used to build an autoregressive model with non-constant variance, with a climate index based on the signals obtained from the decompositions, which enters the model as an exogenous variable in order to make projections of the diseases

Use of most significant change (MSC) technique to evaluate health promotion training of maternal community health workers in Cianjur district, Indonesia.

Science.gov (United States)

Limato, Ralalicia; Ahmed, Rukhsana; Magdalena, Amelia; Nasir, Sudirman; Kotvojs, Fiona

2018-02-01

Maternal health promotion is a defined activity in the community integrated posts (Posyandu) in Indonesia. However, it is often neglected due to limited knowledge and skills of the community health workers (kader). We conducted health promotion training for the kader and village midwives in four villages in Cianjur district. This study describes the use of "most significant change" (MSC) technique to evaluate impact of health promotion to the beneficiaries and community at large. The MSC uses stories as raw data. Through interviews focused on perception of change, stories were collected from four pregnant women, eight kader and three village midwives. A Panel consisting of policy and programme managers and implementers read all the stories. The story by a pregnant woman who routinely attended Posyandu was selected as the story with most significant change. Her story highlighted changes in kader's knowledge and communication of health messages and attitude towards pregnant women. She expressed these changes impacted community awareness about health and to seek help from kader.The MSC technique enabled stakeholders to view raw data and evaluate the impact of health promotion from the beneficiary's perspective. At the same time, recipients of health promotion contributed to the decision process of evaluation through their stories. The different perspectives on the MSC reflected individual's objectives of the health promotion. The application of this technique is limited in maternal health promotion programme in Indonesia, and none have been published in peer reviewed journals. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Multipoint observations of a small substorm

International Nuclear Information System (INIS)

Lopez, R.E.; Luehr, H.; Anderson, B.J.; Newell, P.T.; McEntire, R.W.

1990-01-01

In this paper the authors present multipoint observations of a small substorm which occurred just after 0110 UT on April 25, 1985. The observations were made by spacecraft (AMPTE CCE, AMPTE IRM, DMSP F6, and DMSP F7), ground auroral stations (EISCAT magnetometer cross, Syowa, Narssarssuaq, Great Whale River, and Fort Churchill), and mid-latitude stations (Furstenfeldbruck, Toledo, and Argentine Island). These data provide them with a broad range of observations, including the latitudinal extent of the polar cap, visual identification of substorm aurorae and the magnetic perturbations produced directly beneath them, in situ magnetic field and energetic particle observations of the disruption of the cross-tail current sheet, and observations concerning the spatial expansion of the current disruption region from two radially aligned spacecraft. The DMSP data indicate that the event took place during a period when the polar cap was relatively contracted, yet the disruption of the current sheet was observed by CCE at 8.56 R E . They have been able to infer a considerable amount of detail concerning the structure and westward expansion of the auroral features associated with the event, and they show that those auroral surges were located more than 10 degree equatorward of the boundary between open and closed field lines. Moreover, they present evidence that the current sheet disruption observed by CCE in the neutral sheet was located on field lines which mapped to the westward traveling surge observed directly overhead of the ground station at Syowa. Furthermore, the observations strongly imply that disruption of the cross-tail current began in the near-Earth region and that it had a component of expansion which was radially antisunward

Charge collection efficiency degradation induced by MeV ions in semiconductor devices: Model and experiment

Energy Technology Data Exchange (ETDEWEB)

Vittone, E., E-mail: ettore.vittone@unito.it [Department of Physics, NIS Research Centre and CNISM, University of Torino, via P. Giuria 1, 10125 Torino (Italy); Pastuovic, Z. [Centre for Accelerator Science (ANSTO), Locked bag 2001, Kirrawee DC, NSW 2234 (Australia); Breese, M.B.H. [Centre for Ion Beam Applications (CIBA), Department of Physics, National University of Singapore, Singapore 117542 (Singapore); Garcia Lopez, J. [Centro Nacional de Aceleradores (CNA), Sevilla University, J. Andalucia, CSIC, Av. Thomas A. Edison 7, 41092 Sevilla (Spain); Jaksic, M. [Department for Experimental Physics, Ruder Boškovic Institute (RBI), P.O. Box 180, 10002 Zagreb (Croatia); Raisanen, J. [Department of Physics, University of Helsinki, Helsinki 00014 (Finland); Siegele, R. [Centre for Accelerator Science (ANSTO), Locked bag 2001, Kirrawee DC, NSW 2234 (Australia); Simon, A. [International Atomic Energy Agency (IAEA), Vienna International Centre, P.O. Box 100, 1400 Vienna (Austria); Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Vizkelethy, G. [Sandia National Laboratories (SNL), PO Box 5800, Albuquerque, NM (United States)

2016-04-01

Highlights: • We study the electronic degradation of semiconductors induced by ion irradiation. • The experimental protocol is based on MeV ion microbeam irradiation. • The radiation induced damage is measured by IBIC. • The general model fits the experimental data in the low level damage regime. • Key parameters relevant to the intrinsic radiation hardness are extracted. - Abstract: This paper investigates both theoretically and experimentally the charge collection efficiency (CCE) degradation in silicon diodes induced by energetic ions. Ion Beam Induced Charge (IBIC) measurements carried out on n- and p-type silicon diodes which were previously irradiated with MeV He ions show evidence that the CCE degradation does not only depend on the mass, energy and fluence of the damaging ion, but also depends on the ion probe species and on the polarization state of the device. A general one-dimensional model is derived, which accounts for the ion-induced defect distribution, the ionization profile of the probing ion and the charge induction mechanism. Using the ionizing and non-ionizing energy loss profiles resulting from simulations based on the binary collision approximation and on the electrostatic/transport parameters of the diode under study as input, the model is able to accurately reproduce the experimental CCE degradation curves without introducing any phenomenological additional term or formula. Although limited to low level of damage, the model is quite general, including the displacement damage approach as a special case and can be applied to any semiconductor device. It provides a method to measure the capture coefficients of the radiation induced recombination centres. They can be considered indexes, which can contribute to assessing the relative radiation hardness of semiconductor materials.

Evaluation of Stiffness Changes in a High-Rise Building by Measurements of Lateral Displacements Using GPS Technology

Science.gov (United States)

Choi, Se Woon; Kim, Ill Soo; Park, Jae Hwan; Kim, Yousok; Sohn, Hong Gyoo; Park, Hyo Seon

2013-01-01

The outrigger truss system is one of the most frequently used lateral load resisting structural systems. However, little research has been reported on the effect of installation of outrigger trusses on improvement of lateral stiffness of a high-rise building through full-scale measurements. In this paper, stiffness changes of a high-rise building due to installation of outrigger trusses have been evaluated by measuring lateral displacements using a global positioning system (GPS). To confirm the error range of the GPS measurement system used in the full-scale measurement tests, the GPS displacement monitoring system is investigated through a free vibration test of the experimental model. Then, for the evaluation of lateral stiffness of a high-rise building under construction, the GPS displacement monitoring system is applied to measurements of lateral displacements of a 66-story high-rise building before and after installation of outrigger truss. The stiffness improvement of the building before and after the installation is confirmed through the changes of the natural frequencies and the ratios of the base shear forces to the roof displacements. PMID:24233025

In vitro evaluation of the chemical and morphological changes of the enamel surface using different bleaching techniques

International Nuclear Information System (INIS)

Mattos, Alessandra de Siervi

2003-01-01

'In vitro' evaluation through MEV and EDS of the morphological and chemical changes, respectively, of the bovine enamel, submitted to different bleaching techniques. For the MEV evaluation eighteen apical thirds were pigmented and divided into two parts. One half of each sample was the control and the other half was bleached according to the protocol of each test group (n= 6). Group I - home bleaching with a 10% carbamide peroxide; group II bleaching with 35% hydrogen peroxide and LED; group III - bleaching with 35% hydrogen peroxide with diode laser bleaching. The same procedure was done with the eighteen samples which were analyzed through EDS and which had their buccal surface grinded and polished before the bleaching procedure in order to obtain more precise values of the fraction of calcium and phosphorus. The results showed no morphological changes among the analyzed control halves and the bleached halves. There was not a statistical significant difference about Ca and P values, among the control halves and the bleached halves regarding the chemical components (p< 0,05). (author)

Evaluation of Stiffness Changes in a High-Rise Building by Measurements of Lateral Displacements Using GPS Technology

Directory of Open Access Journals (Sweden)

Se Woon Choi

2013-11-01

Full Text Available The outrigger truss system is one of the most frequently used lateral load resisting structural systems. However, little research has been reported on the effect of installation of outrigger trusses on improvement of lateral stiffness of a high-rise building through full-scale measurements. In this paper, stiffness changes of a high-rise building due to installation of outrigger trusses have been evaluated by measuring lateral displacements using a global positioning system (GPS. To confirm the error range of the GPS measurement system used in the full-scale measurement tests, the GPS displacement monitoring system is investigated through a free vibration test of the experimental model. Then, for the evaluation of lateral stiffness of a high-rise building under construction, the GPS displacement monitoring system is applied to measurements of lateral displacements of a 66-story high-rise building before and after installation of outrigger truss. The stiffness improvement of the building before and after the installation is confirmed through the changes of the natural frequencies and the ratios of the base shear forces to the roof displacements.

Evaluating the accuracy of climate change pattern emulation for low warming targets

Science.gov (United States)

Tebaldi, Claudia; Knutti, Reto

2018-05-01

Global climate policy is increasingly debating the value of very low warming targets, yet not many experiments conducted with global climate models in their fully coupled versions are currently available to help inform studies of the corresponding impacts. This raises the question whether a map of warming or precipitation change in a world 1.5 °C warmer than preindustrial can be emulated from existing simulations that reach higher warming targets, or whether entirely new simulations are required. Here we show that also for this type of low warming in strong mitigation scenarios, climate change signals are quite linear as a function of global temperature. Therefore, emulation techniques amounting to linear rescaling on the basis of global temperature change ratios (like simple pattern scaling) provide a viable way forward. The errors introduced are small relative to the spread in the forced response to a given scenario that we can assess from a multi-model ensemble. They are also small relative to the noise introduced into the estimates of the forced response by internal variability within a single model, which we can assess from either control simulations or initial condition ensembles. Challenges arise when scaling inadvertently reduces the inter-model spread or suppresses the internal variability, both important sources of uncertainty for impact assessment, or when the scenarios have very different characteristics in the composition of the forcings. Taking advantage of an available suite of coupled model simulations under low-warming and intermediate scenarios, we evaluate the accuracy of these emulation techniques and show that they are unlikely to represent a substantial contribution to the total uncertainty.

Evaluation of Pressure Changes in HANARO Reactor Hall after a Reactor Shutdown

International Nuclear Information System (INIS)

Han, Geeyang; Han, Jaesam; Ahn, Gukhoon; Jung, Hoansung

2013-01-01

The major objective of this work is intended to evaluate the characteristics of the thermal behavior regarding how the decay heat will be affected by the reactor hall pressure change and the increase of pool water temperature induced in the primary coolant after a reactor shutdown. The particular reactor pool water temperature at the surface where it is evaporated owing to the decay heat resulting in the local heat transfer rate is related to the pressure change response in the reactor hall associated with the primary cooling system because of the reduction of the heat exchanger to remove the heat. The increase in the pool water temperature is proportional to the heat transfer rate in the reactor pool. Consequently, any limit on the reactor pool water temperature imposes a corresponding limit on the reactor hall pressure. At HANARO, the decay heat after a reactor shutdown is mainly removed by the natural circulation cooling in the reactor pool. This paper is written for the safety feature of the pressure change related leakage rate from the reactor hall. The calculation results show that the increase of pressure in the reactor hall will not cause any serious problems to the safety limits although the reactor hall pressure is slightly increased. Therefore, it was concluded that the pool water temperature increase is not so rapid as to cause the pressure to vary significantly in the reactor hall. Furthermore, the mathematical model developed in this work can be a useful analytical tool for scoping and parametric studies in the area of thermal transient analysis, with its proper representation of the interaction between the temperature and pressure in the reactor hall

Evaluation of behavioral change after adenotonsillectomy for obstructive sleep apnea in children with autism spectrum disorder.

Science.gov (United States)

Murata, Emi; Mohri, Ikuko; Kato-Nishimura, Kumi; Iimura, Jiro; Ogawa, Makoto; Tachibana, Masaya; Ohno, Yuko; Taniike, Masako

2017-06-01

Obstructive sleep apnea (OSA) may affect daily cognitive functioning in children. The aims of our study were two-fold. The first aim was to detect, using the Child Behavior Checklist (CBCL), whether adenotonsillectomy (AT) for the treatment of OSA improved the behavior of children with autism spectrum disorder (ASD). The second aim was to identify characteristics for behavioral improvement following the treatment of OSA in these children with ASD. The behaviors of ASD children aged 5-14 years diagnosed as having OSA (n=30) were evaluated using CBCL before and after AT. CBCL evaluation of ASD children without OSA at two time points with the same interval served as a control (n=24). We statistically examined the two groups. In addition, we conducted a paired t-test to assess changes in CBCL Tscores between the improved group and unchanged/deteriorated group to identify characteristics that may affect behavioral changes following OSA treatment. After AT, T-scores of the CBCL scales were significantly improved in the OSA group, but no change was observed in the control. A paired t-test revealed that the improved group had significantly higher scores on the CBCL pre-AT than the unchanged/deteriorated group in ASD children with OSA after OSA treatment. Behavioral problems were significantly improved following AT in ASD children with OSA. Early detection and treatment of children with OSA is essential to prevent behavioral problems and to support mental development. Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.

It's just the right thing to do: Conceptualizing a theory of change for a school food and beverage sales environment intervention and implications for implementation evaluation.

Science.gov (United States)

Levay, Adrienne V; Chapman, Gwen E; Seed, Barbara; Wittman, Hannah

2018-04-30

School food environments are the target of nutrition interventions and evaluations across the globe. Yet little work to-date has articulated the importance of developing a theory of change upon which to base evaluation of both implementation and outcomes. This paper undertakes an interpretive approach to develop a retrospective theory of change for an implementation evaluation of British Columbia's school food and beverage sales Guidelines. This study contributes broadly to a nuanced conceptualization of this type of public health intervention and provides a methodological contribution on how to develop a retrospective theory of change with implications for effective evaluation. Data collection strategies included document analysis, semi-structured interviews with key stakeholders, and participant observation. Developing the logic model revealed that, despite the broad population health aims of the intervention, the main focus of implementation is to change behaviors of adults who create school food environments. Derived from the analysis and interpretation of the data, the emergent program theory focuses on the assumption that if adults are responsibilized through information and education campaigns and provided implementation tools, they will be 'convinced' to implement changes to school food environments to foster broader public health goals. These findings highlight the importance of assessing individual-level implementation indicators as well as the more often evaluated measures of food and beverage availability. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

Serial cerebral hemodynamic change after extracranial-intracranial (EC-IC) bypass surgery: evaluated by acetazolamide stress brain perfusion SPECT(acz-SPECT)

Energy Technology Data Exchange (ETDEWEB)

Hong, Il Ki; Kim, Jae Seung; Ahn, Jae Sung; Im, Ki Chun; Kim, Euy Nyong; Mun, Dae Hyeog [Asan Medical Center, Seoul (Korea, Republic of)

2005-07-01

We evaluated serial cerebral hemodynamic changes after EC-IC bypass surgery in symptomatic pts with atherosclerotic occlusion of internal carotid (lCA) or mid-cerebral artery (MCA) using Acz-SPECT. 25 symptomatic pts (M/F 19/6, 53{+-}10 y) with ICA and MCA occlusion (16 uni - and 9 bilateral) prospectively underwent Acz-SPECT using Tc-99m ECD before and 1 week after EC-IC bypass surgery. Of these, 16 underwent additional f/u Acz-SPECT 5 mo later. Cerebral perfusion and perfusion reserve of MCA territory were evaluated visually and SPECT findings were classified into 4 groups: N/N; R/N; N/R; and R/R (perfusion/perfusion reserve: N = normal, R = reduced). For semiquantitative analysis, all SPECT images were normalized to MNI template and mean counts of MCA territory and cerebellum were obtained by AAL. Cerebral perfusion index (PI =C{sub region}/C{sub cere}) and perfusion reserve index (RI = (PI{sub Acz} - PI{sub basal}) /Pl{sub basal}) were calculated. Preop SPECT findings of ipsilateral MCA in 25 pts were R/N (4%), N/R (12%), and R/R (84% ). Early postop SPECT showed improvement of perfusion (26%) and/or reserve (68%) in ipsilateral MCA. Of 16 pts with 5mo f/u SPECT, 6 (38%) showed further improvement of perfusion or reserve. However, 4 (25%) showed aggravation of perfusion and one of these underwent revision surgery. Preop PI (1.1{+-}0.1) and RI (0.11{+-}0.07) of ipsilateral MCA were significantly lower than those of contralateral hemispheres (p<0.05). After surgery, PIs of bilateral MCA did not change at early postop period but improved in ipsilateral MCA at 5mo. Rls of ipsilateral MCA increased significantly (68%) at early postop period (P<0.001) and then did not changed. Cerebral perfusion and perfusion reserve changed with different manner during 5 mo after bypass surgery and perfusion reserve changed more dramatically than perfusion. Acz-SPECT is a feasible method for evaluating cerebral hemodynamic change after EC-IC bypass surgery.

Correlation of orbital muscle changes evaluated by magnetic resonance imaging and thyroid-stimulating antibody in patients with Graves' ophthalmopathy

International Nuclear Information System (INIS)

Nishikawa, M.; Yoshimura, M.; Inada, M.

1993-01-01

To evaluate the relationship between eye changes and autoantibody to the thyrotropin receptor in patients with Graves' disease, the authors evaluated the eye changes using magnetic resonance imaging and the results were correlated with thyroid-stimulating antibody, thyrotropin binding inhibitor immunoglobulin and thyroid growth activity. Subjects were 15 patients with Graves' disease who had Graves' ophthalmopathy, including exophthalmos and other signs and symptoms, and 9 patients without ophthalmopathy; all were maintained in a euthyroid state by antithyroid drugs. The thyrotropin-binding inhibitor imunoglobulin was measured by a kit, and thyroid-stimulating antibody and thyroid growth activity were evaluated by cyclic adenosine 3', 5'-monophosphate production and [ 3 H]thymidine incorporation, respectively, by cultured functional rat thyroid lined cells. The sum of the swelling ratios of the four extraocular muscles correlated well with the degree of exophthalmos. The thyrotropin-binding inhibitor immunoglobulin was positive in 9 out of 15 patients with ophthalmopathy; however, no correlation was observed between the activity and exophthalmos or muscle swelling. No significant correlation was observed between muscle changes and thyroid growth activity either. On the other hand, thyroid-stimulating antibody in Graves' patients with ophthalmopathy was significantly higher than that in patients without ophthalmopathy. Moreover, the level of the stimulating activity in Graves' patients with ophthalmopathy showed a significant positive correlation with the sum of the swelling ratios of the individual eight eye muscles. These results suggest that thyroid-stimulating antibody has a close relation to Graves' ophthalmopathy. 23 refs., 4 figs

Lung tumor motion change during stereotactic body radiotherapy (SBRT): an evaluation using MRI

Science.gov (United States)

Olivier, Kenneth R.; Li, Jonathan G.; Liu, Chihray; Newlin, Heather E.; Schmalfuss, Ilona; Kyogoku, Shinsuke; Dempsey, James F.

2014-01-01

The purpose of this study is to investigate changes in lung tumor internal target volume during stereotactic body radiotherapy treatment (SBRT) using magnetic resonance imaging (MRI). Ten lung cancer patients (13 tumors) undergoing SBRT (48 Gy over four consecutive days) were evaluated. Each patient underwent three lung MRI evaluations: before SBRT (MRI‐1), after fraction 3 of SBRT (MRI‐3), and three months after completion of SBRT (MRI‐3m). Each MRI consisted of T1‐weighted images in axial plane through the entire lung. A cone‐beam CT (CBCT) was taken before each fraction. On MRI and CBCT taken before fractions 1 and 3, gross tumor volume (GTV) was contoured and differences between the two volumes were compared. Median tumor size on CBCT before fractions 1 (CBCT‐1) and 3 (CBCT‐3) was 8.68 and 11.10 cm3, respectively. In 12 tumors, the GTV was larger on CBCT‐3 compared to CBCT‐1 (median enlargement, 1.56 cm3). Median tumor size on MRI‐1, MRI‐3, and MRI‐3m was 7.91, 11.60, and 3.33 cm3, respectively. In all patients, the GTV was larger on MRI‐3 compared to MRI‐1 (median enlargement, 1.54 cm3). In all patients, GTV was smaller on MRI‐3m compared to MRI‐1 (median shrinkage, 5.44 cm3). On CBCT and MRI, all patients showed enlargement of the GTV during the treatment week of SBRT, except for one patient who showed minimal shrinkage (0.86 cm3). Changes in tumor volume are unpredictable; therefore, motion and breathing must be taken into account during treatment planning, and image‐guided methods should be used, when treating with large fraction sizes. PACS number: 87.53.Ly PMID:24892328

Evaluation of atmospheric-pressure change in tornado using Fujita model

International Nuclear Information System (INIS)

Shimizu, Juntaro; Ohtsubo, Shunsuke

2017-01-01

Evaluation of the atmospheric-pressure change (APC) in a tornado is necessary to assess the integrity of nuclear-related facilities. The Rankine model has been most frequently used to theoretically calculate the APC in a tornado. The result, however, is considered to be overly conservative because the Rankine model wind speed at the ground is larger than that in reality. On the other hand, the wind speed of the Fujita model is closer to that of actual tornadoes but is expressed by more complicated algebraic equations than that in the Rankine model. Also, because it is impossible to analytically derive the APC equation using the Fujita model, numerical computation is required. A previous study employed the finite element method (FEM) for such a purpose. However, a general-purpose FEM code often requires complicated input parameters. In order to conduct parametric studies to evaluate the integrity of facilities in various cases of tornadoes, the finite-difference method code “TORPEC”, which is specialized to analyze the APC, was developed as a convenient design tool. TORPEC is based on Poisson’s equation derived from the Navier-Stokes equation. It also runs on widely available technical calculation software such as Microsoft"® Excel VBA or MATLAB"®. Taking advantage of such convenience, various calculations have been conducted to reveal the characteristics of APC as functions of the maximum tangential wind speed, axial position and tornado radius. TORPEC is used as a benchmark in the existing paper. The case study results obtained by TORPEC show a constant ratio of the pressure drop of the Fujita model against the Rankine model. This factor can be used to derive the Fujita model result from the Rankine model result without FEM analysis. (author)

Reliability of change in lumbar MRI findings over time in patients with and without disc prosthesis - comparing two different image evaluation methods

International Nuclear Information System (INIS)

Berg, Linda; Espeland, Ansgar; Gjertsen, Oeivind; Hellum, Christian; Neckelmann, Gesche; Johnsen, Lars G.; Eide, Geir E.

2012-01-01

To assess the reliability of change in lumbar magnetic resonance imaging (MRI) findings evaluated retrospectively by direct comparison of images and by non-comparison. Pre-treatment and 2-year follow-up MRI was performed in 126 patients randomized to disc prosthesis surgery or non-surgical treatment. Two experienced radiologists independently evaluated progress and regress for Modic changes, disc findings, and facet arthropathy (FA) at L3/L4, L4/L5, and L5/S1, both by non-comparison and by comparison of initial and follow-up images. FA was evaluated at all levels, and other findings at non-operated levels. We calculated prevalence- and bias-adjusted kappa (PABAK) values for interobserver agreement. The impact of an adjacent prosthesis (which causes artefacts) and image evaluation method on PABAK was assessed using generalized estimating equations. Image comparison indicated good interobserver agreement on progress and regress (PABAK 0.63-1.00) for Modic changes, posterior high-intensity zone, disc height, and disc contour at L3-S1 and for nucleus pulposus signal and FA at L3/L4; and moderate interobserver agreement (PABAK 0.46-0.59) on decreasing nucleus signal and increasing FA at L4-S1. Image comparison indicated lower (but fair) interobserver agreement (PABAK 0.29) only for increasing FA at L5/S1 in patients with prosthesis in L4/L5 and/or L5/S1. An adjacent prosthesis had no overall impact on PABAK values (p ≥ 0.22). Comparison yielded higher PABAK values than non-comparison (p < 0.001). Regarding changes in lumbar MRI findings over time, comparison of images can provide moderate or good interobserver agreement, and better agreement than non-comparison. An adjacent prosthesis may not reduce agreement on change for most findings. (orig.)

Relationship between fermentation index and other biochemical changes evaluated during the fermentation of Mexican cocoa (Theobroma cacao) beans.

Science.gov (United States)

Romero-Cortes, Teresa; Salgado-Cervantes, Marco Antonio; García-Alamilla, Pedro; García-Alvarado, Miguel Angel; Rodríguez-Jimenes, Guadalupe del C; Hidalgo-Morales, Madeleine; Robles-Olvera, Víctor

2013-08-15

During traditional cocoa processing, the end of fermentation is empirically determined by the workers; consequently, a high variability on the quality of fermented cocoa beans is observed. Some physicochemical properties (such as fermentation index) have been used to measure the degree of fermentation and changes in quality, but only after the fermentation process has concluded, using dried cocoa beans. This would suggest that it is necessary to establish a relationship between the chemical changes inside the cocoa bean and the fermentation conditions during the fermentation in order to standardize the process. Cocoa beans were traditionally fermented inside wooden boxes, sampled every 24 h and analyzed to evaluate fermentation changes in complete bean, cotyledon and dried beans. The value of the fermentation index suggested as the minimal adequate (≥1) was observed at 72 h in all bean parts analyzed. At this time, values of pH, spectral absorption, total protein hydrolysis and vicilin-class globulins of fermented beans suggested that they were well fermented. Since no difference was found between the types of samples, the pH value could be used as a first indicator of the end of the fermentation and confirmed by evaluation of the fermentation index using undried samples, during the process. © 2013 Society of Chemical Industry.

Evaluation of Different Normalization and Analysis Procedures for Illumina Gene Expression Microarray Data Involving Small Changes

Science.gov (United States)

Johnstone, Daniel M.; Riveros, Carlos; Heidari, Moones; Graham, Ross M.; Trinder, Debbie; Berretta, Regina; Olynyk, John K.; Scott, Rodney J.; Moscato, Pablo; Milward, Elizabeth A.

2013-01-01

While Illumina microarrays can be used successfully for detecting small gene expression changes due to their high degree of technical replicability, there is little information on how different normalization and differential expression analysis strategies affect outcomes. To evaluate this, we assessed concordance across gene lists generated by applying different combinations of normalization strategy and analytical approach to two Illumina datasets with modest expression changes. In addition to using traditional statistical approaches, we also tested an approach based on combinatorial optimization. We found that the choice of both normalization strategy and analytical approach considerably affected outcomes, in some cases leading to substantial differences in gene lists and subsequent pathway analysis results. Our findings suggest that important biological phenomena may be overlooked when there is a routine practice of using only one approach to investigate all microarray datasets. Analytical artefacts of this kind are likely to be especially relevant for datasets involving small fold changes, where inherent technical variation—if not adequately minimized by effective normalization—may overshadow true biological variation. This report provides some basic guidelines for optimizing outcomes when working with Illumina datasets involving small expression changes. PMID:27605185

78 FR 21115 - Magnuson-Stevens Act Provisions; General Provisions for Domestic Fisheries; Application for...

Science.gov (United States)

2013-04-09

... monkfish for sale, but the sampling locations are determined by CCE. To conduct compensation fishing in... as to how the waiver could influence fishing behavior, and if it could increase the likelihood of an... white hake and witch flounder, which would be landed for commercial sale. All catch of Northeast...

To widen the action tools against the climatic change by domestic projects. Evaluation report

International Nuclear Information System (INIS)

Arnaud, E.; Dominicis, A. de; Leguet, B.; Leseur, A.; Perthuis, Ch. de

2005-11-01

In the framework of the climatic change fight, each country aims to implement tools of emissions reduction. In France, the european system of CO 2 quotas exchange, applied on the more emitted installations, covers less than 30% of the national carbon emissions. The other 70% are free of taxes. The 'climate mission' realized an evaluation of the emission reduction in the case of a new policy aiming to develop domestic projects of emission control. This report presents the study and its conclusions: the domestic projects, the possibilities of these projects in the transportation agriculture and forests and building sectors, the implementing conditions

Evaluation of morphological changes of the biliary tree by magnetic resonance cholangiography in patients with schistosomiasis mansoni: interobserver agreement

Energy Technology Data Exchange (ETDEWEB)

Sales, Danilo Moulin; Leao, Alberto Ribeiro de Souza; Santos, Jose Eduardo Mourao dos; Shigueoka, David Carlos; Colleoni Neto, Ramiro [Universidade Federal de Sao Paulo (Unifesp/EPM), Sao Paulo, SP (Brazil)], e-mail: daniloevaleria@uol.com.br; Borges, Durval Rosa; D' Ippolito, Giuseppe; Szejnfeld, Jacob [Universidade Federal de Sao Paulo (Unifesp/EPM), Sao Paulo, SP (Brazil). Dept. of Medicine

2009-09-15

Objective: To describe changes of the biliary tree demonstrated by magnetic resonance cholangiography (MRC) in patients with the hepatosplenic presentation of schistosomiasis mansoni, and evaluating the interobserver agreement in the detection of schistosomal cholangiopathy. Results: prospective, cross-sectional study involving 24 patients with hepatosplenic schistosomiasis and 6 healthy patients (control group) submitted to biliary tree evaluation by MRC. The following changes of the biliary tree were considered: distortion, thinning, stenosis, dilation and irregularity. The interobserver agreement in the detection of biliary tree changes was calculated with the McNemar's test and the kappa index of agreement ({kappa}). Results: the interobserver agreement in the detection of distortion and thinning of the biliary tree was almost perfect ({kappa} = 0.867; confidence interval [CI] 95% [0.512-1.0] and {kappa} = 0.865; CI 95% [0.51-1.0], respectively). There was a substantial agreement for stenosis ({kappa} = 0.78; CI 95% [0.424-1.0]), moderate agreement for dilation ({kappa} = 0.595; CI 95% [0.247-0.942]) and mild agreement for thinning ({kappa} = 0.229; CI 95% [0.095-0.552]). Conclusion: in a decreasing order of frequency, the changes of the biliary tree were observed: distortion, thinning, stenosis, dilation and irregularity. The interobserver agreement for signs of schistosomal cholangiopathy was almost perfect for distortion and thinning, and substantial for stenosis. (author)

Evaluation of geriatric changes in dogs

OpenAIRE

Pati, Soumyaranjan; Panda, S. K.; Acharya, A. P.; Senapati, S.; Behera, M.; Behera, S. S.

2015-01-01

Aim: The present study has been envisaged to ascertain the old age for critical management of geriatric dogs considering the parameters of externally visible changes, haemato-biochemical alterations and urine analysis in geriatric dogs approaching senility. Materials and Methods: The study was undertaken in the Department of Veterinary Pathology in collaboration with Teaching Veterinary Clinic complex spanning a period of 1 year. For screening of geriatric dogs, standard geriatric age chart o...

Scale interactions in economics: application to the evaluation of the economic damages of climatic change and of extreme events; Interactions d'echelles en economie: application a l'evaluation des dommages economiques du changement climatique et des evenements extremes

Energy Technology Data Exchange (ETDEWEB)

Hallegatte, S

2005-06-15

Growth models, which neglect economic disequilibria, considered as temporary, are in general used to evaluate the damaging effects generated by climatic change. This work shows, through a series of modeling experiences, the importance of disequilibria and of endogenous variability of economy in the evaluation of damages due to extreme events and climatic change. It demonstrates the impossibility to separate the evaluation of damages from the representation of growth and of economic dynamics: the comfort losses will depend on both the nature and intensity of impacts and on the dynamics and situation of the economy to which they will apply. Thus, the uncertainties about the damaging effects of future climatic changes come from both scientific uncertainties and from uncertainties about the future organization of our economies. (J.S.)

Signalling changes to individuals who show resistance to change can reduce challenging behaviour.

Science.gov (United States)

Bull, Leah E; Oliver, Chris; Woodcock, Kate A

2017-03-01

Several neurodevelopmental disorders are associated with resistance to change and challenging behaviours - including temper outbursts - that ensue following changes to routines, plans or expectations (here, collectively: expectations). Here, a change signalling intervention was tested for proof of concept and potential practical effectiveness. Twelve individuals with Prader-Willi syndrome participated in researcher- and caregiver-led pairing of a distinctive visual-verbal signal with subsequent changes to expectations. Specific expectations for a planned subset of five participants were systematically observed in minimally manipulated natural environments. Nine caregivers completed a temper outburst diary during a four week baseline period and a two week signalling evaluation period. Participants demonstrated consistently less temper outburst behaviour in the systematic observations when changes imposed to expectations were signalled, compared to when changes were not signalled. Four of the nine participants whose caregivers completed the behaviour diary demonstrated reliable reductions in temper outbursts between baseline and signalling evaluation. An active control group for the present initial evaluation of the signalling strategy using evidence from caregiver behaviour diaries was outside the scope of the present pilot study. Thus, findings cannot support the clinical efficacy of the present signalling approach. Proof of concept evidence that reliable pairing of a distinctive cue with a subsequent change to expectation can reduce associated challenging behaviour is provided. Data provide additional support for the importance of specific practical steps in further evaluations of the change signalling approach. Copyright © 2016 Elsevier Ltd. All rights reserved.

Evaluating the sensitivity of Eurasian forest biomass to climate change using a dynamic vegetation model

International Nuclear Information System (INIS)

Shuman, J K; Shugart, H H

2009-01-01

Climate warming could strongly influence the structure and composition of the Eurasian boreal forest. Temperature related changes have occurred, including shifts in treelines and changes in regeneration. Dynamic vegetation models are well suited to the further exploration of the impacts that climate change may have on boreal forests. Using the individual-based gap model FAREAST, forest composition and biomass are simulated at over 2000 sites across Eurasia. Biomass output is compared to detailed forest data from a representative sample of Russian forests and a sensitivity analysis is performed to evaluate the impact that elevated temperatures and modified precipitation will have on forest biomass and composition in Eurasia. Correlations between model and forest inventory biomass are strong for several boreal tree species. A significant relationship is shown between altered precipitation and biomass. This analysis showed that a modest increase in temperature of 2 deg. C across 200 years had no significant effect on biomass; however further exploration with increased warming reflective of values measured within Siberia, or at an increased rate, are warranted. Overall, FAREAST accurately simulates forest biomass and composition at sites throughout a large geographic area with widely varying climatic conditions and produces reasonable biomass responses to simulated climatic shifts. These results indicate that this model is robust and useful in making predictions regarding the effect of future climate change on boreal forest structure across Eurasia.

Evaluation of probable maximum snow accumulation: Development of a methodology for climate change studies

Science.gov (United States)

Klein, Iris M.; Rousseau, Alain N.; Frigon, Anne; Freudiger, Daphné; Gagnon, Patrick

2016-06-01

Probable maximum snow accumulation (PMSA) is one of the key variables used to estimate the spring probable maximum flood (PMF). A robust methodology for evaluating the PMSA is imperative so the ensuing spring PMF is a reasonable estimation. This is of particular importance in times of climate change (CC) since it is known that solid precipitation in Nordic landscapes will in all likelihood change over the next century. In this paper, a PMSA methodology based on simulated data from regional climate models is developed. Moisture maximization represents the core concept of the proposed methodology; precipitable water being the key variable. Results of stationarity tests indicate that CC will affect the monthly maximum precipitable water and, thus, the ensuing ratio to maximize important snowfall events. Therefore, a non-stationary approach is used to describe the monthly maximum precipitable water. Outputs from three simulations produced by the Canadian Regional Climate Model were used to give first estimates of potential PMSA changes for southern Quebec, Canada. A sensitivity analysis of the computed PMSA was performed with respect to the number of time-steps used (so-called snowstorm duration) and the threshold for a snowstorm to be maximized or not. The developed methodology is robust and a powerful tool to estimate the relative change of the PMSA. Absolute results are in the same order of magnitude as those obtained with the traditional method and observed data; but are also found to depend strongly on the climate projection used and show spatial variability.

The Evaluation of Epiphyseal Plate Histological Changes in Osteopetrotic op/op Mice.

Directory of Open Access Journals (Sweden)

Aligholi Sobhani

2003-09-01

Full Text Available This study was designed for evaluation of epiphyseal plate histological changes of femur bones in osteopetrotic op/op mice.In this study 5 osteopetrotic op/op mice which were purchased from the commercial source were used.The animals were killed by overdose of chloroform and their femur bones were extracted. The bones were fixed in 10% formaldehyde and decalcified by HCl (0.6N, and routine histological processing were performed. The sections were stained by H&E methods and studied by conventional light microscopy. The results showed that, proliferative zone (PZ and especially hypertrophic zone (HZ were much thickened. In the ossification zone, trabecular bones were irregular and atypical osteoblast cells were observed. The osteoclast cells were not attached to trabecular bones. The bone marrow cavity was restricted and bone marrow cells were poor and scattered. Findings of the present investigation are similar to those reported about epiphyseal plate in osteosclerotic (OC mice in which epiphyseal plate especially hypertrophic zone was thickened and chondrocytes were not substituted for osteoblasts in calcified cartilage area. Also, osteoclast cells had been inactive or absent in OC mice. For prevention of other complication due to the epiphyseal plate changes in new borne, suitable and punctually treatment protocols such as prescription of Macrophage Colony Stimulating-Factor (MCS-F could be useful.

Evaluation of the Dutch version of the Foot and Ankle Outcome Score (FAOS): Responsiveness and Minimally Important Change

NARCIS (Netherlands)

Sierevelt, I. N.; van Eekeren, I. C. M.; Haverkamp, D.; Reilingh, M. L.; Terwee, C. B.; Kerkhoffs, G. M. M. J.

2016-01-01

The aim of this study was to evaluate the responsiveness of the Foot and Ankle Outcome Score (FAOS) and provide data on the Minimally Important Change (MIC) in patients 1 year after hindfoot and ankle surgery. Prospective pre-operative and 1 year post-operative FAOS scores were collected from 145

Evaluation of Electrocardiographic Changes after Arterial Switch Operation

Directory of Open Access Journals (Sweden)

Hamid Amoozgar

2014-09-01

Full Text Available Background: Transposition of Great Arteries (TGA is a serious congenital heart disease which can be accompanied by good outcomes with anatomic correction within the first few weeks of life. Objectives: The present study aimed to evaluate electrocardiographic changes in the children with uncomplicated Arterial Switch Operation (ASO. Patients and Methods: Twelve lead electrocardiograms were obtained from thirty-three patients with TGA after ASO. Then, the patients’ QT-dispersion and P-wave dispersion were compared to those of 33 age- and gender-matched individuals as the normal control group. Both groups were also evaluated by M-mode echocardiography. Student’s t-test and Pearson correlation were used to analyze the data. Besides, P < 0.05 was considered as statistically significant. Results: The mean age of the patients and the control group was 41 ± 3.7 and 40.12 ± 4.2 months, respectively. Comparison of P wave, T wave, QRS complex, PR interval, QT segment, and corrected QT segment showed significant differences in the frequency of inverted T wave in pericardial leads [V3, V4, V5, and V6] (P = 0.004; more in patients, P wave amplitude in lead II (P < 0.001; more in patients, R wave amplitude in V1 (P = 0.016; smaller in patients, R and S waves amplitude in V6 (P = 0.004 and P = 0.001; taller in patients, corrected QT segment (in lead V5; P < 0.0001: prolonger in patients, and PR interval (P = 0.001; prolonger in patients. However, no significant differences were found regarding the vector axis and heart rate. Right bundle branch block (18% vs. 0%, Bifascicular (3% vs. 0%, and first-degree blocks (15% vs. 0% were significantly more in the patients. Besides, the PR interval was longer in the corrected complex TGA (146 ± 24.4 vs. 127.7 ± 23.1, P = 0.001. Moreover, R/S ratio in lead V1 was significantly prolonger, among the patients (2.86 ± 3.35 vs. 0.706 ± 0.53, P = 0.002. Nonetheless, no significant was observed between the patients and

Fatigue Damage Evaluation of Short Carbon Fiber Reinforced Plastics Based on Phase Information of Thermoelastic Temperature Change.

Science.gov (United States)

Shiozawa, Daiki; Sakagami, Takahide; Nakamura, Yu; Nonaka, Shinichi; Hamada, Kenichi

2017-12-06

Carbon fiber-reinforced plastic (CFRP) is widely used for structural members of transportation vehicles such as automobile, aircraft, or spacecraft, utilizing its excellent specific strength and specific rigidity in contrast with the metal. Short carbon fiber composite materials are receiving a lot of attentions because of their excellent moldability and productivity, however they show complicated behaviors in fatigue fracture due to the random fibers orientation. In this study, thermoelastic stress analysis (TSA) using an infrared thermography was applied to evaluate fatigue damage in short carbon fiber composites. The distribution of the thermoelastic temperature change was measured during the fatigue test, as well as the phase difference between the thermoelastic temperature change and applied loading signal. Evolution of fatigue damage was detected from the distribution of thermoelastic temperature change according to the thermoelastic damage analysis (TDA) procedure. It was also found that fatigue damage evolution was more clearly detected than before by the newly developed thermoelastic phase damage analysis (TPDA) in which damaged area was emphasized in the differential phase delay images utilizing the property that carbon fiber shows opposite phase thermoelastic temperature change.

Performance Evaluation of Various Phase Change Materials for Thermal Energy Storage of A Solar Cooker via Numerical Simulation

Directory of Open Access Journals (Sweden)

Dede Tarwidi

2016-11-01

Full Text Available In this paper, thermal performance of various phase change materials (PCMs used as thermal energy storage in a solar cooker has been investigated numerically. Heat conduction equations in cylindrical domain are used to model heat transfer of the PCMs. Mathematical model of phase change problem in the PCM storage encompasses heat conduction equations in solid and liquid region separated by moving solid-liquid interface. The phase change problem is solved by reformulating heat conduction equations with emergence of moving boundary into an enthalpy equation. Numerical solution of the enthalpy equation is obtained by implementing Godunov method and verified by analytical solution of one-dimensional case. Stability condition of the numerical scheme is also discussed. Thermal performance of various PCMs is evaluated via the stored energy and temperature history. The simulation results show that phase change material with the best thermal performance during the first 2.5 hours of energy extraction is shown by erythritol. Moreover, magnesium chloride hexahydrate can maintain temperature of the PCM storage in the range of 110-116.7°C for more than 4 hours while magnesium nitrate hexahydrate is effective only for one hour with the PCM storage temperature around 121-128°C. Among the PCMs that have been tested, it is only erythritol that can cook 10 kg of the loaded water until it reaches 100°C for about 3.5 hours. Article History: Received June 22nd 2016; Received in revised form August 26th 2016; Accepted Sept 1st 2016; Available online How to Cite This Article: Tarwidi, D., Murdiansyah, D.T, Ginanja, N. (2016 Performance Evaluation of Various Phase Change Materials for Thermal Energy Storage of A Solar Cooker via Numerical Simulation. Int. Journal of Renewable Energy Development, 5(3, 199-210. http://dx.doi.org/10.14710/ijred.5.3.199-210

Disentangling the effects of a multiple behaviour change intervention for diarrhoea control in Zambia: a theory-based process evaluation.

Science.gov (United States)

Greenland, Katie; Chipungu, Jenala; Chilekwa, Joyce; Chilengi, Roma; Curtis, Val

2017-10-17

Diarrhoea is a leading cause of child death in Zambia. As elsewhere, the disease burden could be greatly reduced through caregiver uptake of existing prevention and treatment strategies. We recently reported the results of the Komboni Housewives intervention which tested a novel strategy employing motives including affiliation and disgust to improve caregiver practice of four diarrhoea control behaviours: exclusive breastfeeding; handwashing with soap; and correct preparation and use of oral rehydration salts (ORS) and zinc. The intervention was delivered via community events (women's forums and road shows), at health clinics (group session) and via radio. A cluster randomised trial revealed that the intervention resulted in a small improvement in exclusive breastfeeding practices, but was only associated with small changes in the other behaviours in areas with greater intervention exposure. This paper reports the findings of the process evaluation that was conducted alongside the trial to investigate how factors associated with intervention delivery and receipt influenced caregiver uptake of the target behaviours. Process data were collected from the eight peri-urban and rural intervention areas throughout the six-month implementation period and in all 16 clusters 4-6 weeks afterwards. Intervention implementation (fidelity, reach, dose delivered and recruitment strategies) and receipt (participant engagement and responses, and mediators) were explored through review of intervention activity logs, unannounced observation of intervention events, semi-structured interviews, focus groups with implementers and intervention recipients, and household surveys. Evaluation methods and analyses were guided by the intervention's theory of change and the evaluation framework of Linnan and Steckler. Intervention reach was lower than intended: 39% of the surveyed population reported attending one or more face-to-face intervention event, of whom only 11% attended two or more

Achieving social change on gender-based violence: a report on the impact evaluation of Soul City's fourth series.

Science.gov (United States)

Usdin, S; Scheepers, E; Goldstein, Susan; Japhet, Garth

2005-12-01

The Soul City Institute for Health and Development Communication--a South African multi-media health promotion project--together with the National Network on Violence Against Women, formulated an intervention to address domestic violence. Recognising that behavioural change interventions aimed solely at individuals have limited impact, the intervention was designed to impact at multiple mutually reinforcing levels; individual, community and socio-political environment. The intervention and its evaluation results are presented. Soul City successfully reached 86%, 25% and 65% of audiences through television, print booklets and radio, respectively. On an individual level there was a shift in knowledge around domestic violence including 41% of respondents hearing about the helpline. Attitude shifts were also associated with the intervention, with a 10% increase in respondents disagreeing that domestic violence was a private affair. There was also a 22% shift in perceptions of social norms on this issue. Qualitative data analysis suggests the intervention played a role in enhancing women's and communities' sense of efficacy, enabling women to make more effective decisions around their health and facilitating community action. The evaluation concluded that implementation of the Domestic Violence Act can largely be attributed to the intervention. While demonstrating actual reductions in levels of domestic violence was not possible, the evaluation shows a strong association between exposure to intervention components and a range of intermediary factors indicative of, and necessary to bring about social change. This paper reports on the evaluation, discusses its limitations and challenges as well as lessons learned regarding multi-level interventions on domestic violence.

Information Literacy and Digital Divide: The Case of the University of Botswana Students Studying Part-Time

Science.gov (United States)

Kgosiemang, Rose T.

2016-01-01

In Botswana, the costs and requirements to study full-time are very high. Not everyone can afford to study full-time without forfeiting their current roles, for example, in 1999 the Center for Continuing Education (CCE) in Botswana launched a Diploma in Primary Education distance education programme, to upgrade academic and professional…

Marketing Continuing Education: A Study of Price Strategies. Occasional Papers in Continuing Education, No. 11.

Science.gov (United States)

Lamoureux, Marvin E.

The objective of the study conducted at the Centre for Continuing Education (CCE) at the University of British Columbia was to determine that threshold pricing not only existed for continuing education courses, but also was applicable to an administrative decision-making structure. The first part of the three-part investigation analyzed consumer…

A Evaluation of Effects on a Ecosystem and Countermeasures in accordance with Climate Change I- Forest Ecosystem

Energy Technology Data Exchange (ETDEWEB)

Park, Yong Ha; Jeon, Seong Woo; Choi, Jae Yong; Jeong Hwi Chol; Kim, Jeong Won [Korea Environment Institute, Seoul (Korea)

2000-12-01

Climate change requests a lot of changes in the existing life style and economic developing system, which form the foundation of modern culture and economic/social development. Especially, in Korea, whose economic basis is mainly dependent on fossil energy, it is expected that the change of policies on climate change have a bigger effect on many-sided fields including ecosystem than other nations. Therefore, even though all of the Government, academic organizations, and private organizations have made efforts to estimate effects of climate change and to prepare countermeasures, the focus has been on forecast and evaluation of the mutual effect between industrial/economic activities and climate change. Forecast of ecosystem change and preservation of ecosystem according to climate change is another political field to promote. However, such a field has not been promoted systematically in Korea. The Institute recognizing such a current state, as part of the policy on ecosystem preservation according to climate change, forecasted the effect on forest ecosystem, analyzed the economic effects according to the effect of forest ecosystem, and started this study to prepare the countermeasures of the Government-level. This study collected and analyzed international trend and necessary data to develop the model, which would be executed in future, and then suggested the selection and development of the model fitted to Korea. There could be differences between Institute's view and the Government/other institutes. However, such differences are caused by the different methods in capturing the effects of various ecosystems. Such various approaching methods will be of great help to estimate the correct effects and to establish the Government's policies as base data. I hope that this study cannot only be applied to analyze the effects of forest ecosystem according to climate change but contribute to enlarging the understanding of various problems according to climate

Long-Term Changes in Refractive Error and Clinical Evaluation in Partially Accommodative Esotropia after Surgery.

Directory of Open Access Journals (Sweden)

Shin Yeop Oh

Full Text Available We investigate the changes in refractive error and clinical evaluation in partially accommodative esotropia(PAET after surgery. A total of 68 patients PAET who received at least 2 years of follow-up after surgery were enrolled in this study. We performed a retrospective study in patients who underwent unilateral or bilateral medial rectus recession for a non-accommodative component of PAET between January 2005 and March 2013. Patients were divided into groups according to the presence of dominancy (dominant, non-dominant, alternative eye, and presence of amblyopia (amblyopic, fellow, normal eye. Changes and changing pattern in SE refractive error were analyzed in all patients and compared between groups. Patients were divided into two groups, those weaned off of hyperopic glasses and those who continued using them, then factors that significantly influenced the continued use of glasses were analyzed. The changes and changing pattern in SE refractive error according to time after operation and presence of amblyopia or dominancy. The mean length of follow-up was 4.89±1.74 years after surgery and the mean change in SE refractive error rate per year was -0.284±0.411 diopters (D. The pattern of changes in the mean SE refractive error for those with dominant, non-dominant, and alternative eyes was not significantly different (p = 0.292. The pattern of changes in the mean SE refractive error for those with amblyopic, fellow, and normal eyes was significantly different (p = 0.0002. Patients were successfully weaned off of hyperopic glasses at an average age of 9.41±2.74 years. The average SE refractive error in the group weaned off of hyperopic glasses was significantly lower than that in the group maintained on hyperopic glasses (p = 0.0002. The change of SE refractive error in amblyopic eyes decreased less than that in fellow or normal eyes, which may be correlated with the presence of amblyopia. Patients with a smaller esodeviated angle without