WorldWideScience

Sample records for cattle bos taurus

  1. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  2. Oestrous cycles in Bos taurus cattle.

    Science.gov (United States)

    Forde, N; Beltman, M E; Lonergan, P; Diskin, M; Roche, J F; Crowe, M A

    2011-04-01

    The oestrous cycle in cattle lasts for 18-24 days. It consists of a luteal phase (14-18 days) and a follicular phase (4-6 days). During the cycle there are generally two (dairy cows) or three (heifers and beef cows) waves of ovarian follicle growth. Each wave of follicle growth consists of a period of emergence of a cohort of follicles, selection of a dominant follicle and either atresia or ovulation of the dominant follicle. These waves of follicle growth, initially established during the early pre-pubertal period of development occur throughout the entire cycle, with only the dominant follicle (DF) of the final wave coinciding with the follicular phase that undergoes final maturation and ovulation. Ovarian functions (follicle growth, ovulation, luteinisation and luteolysis) are regulated by the endocrine hormones of the hypothalamus (gonadotrophin-releasing hormone), anterior pituitary (follicle-stimulating hormone and luteinising hormone), ovaries (progesterone, oestradiol and inhibins) and the uterus (prostaglandin F2α). In postpartum cows resumption of regular oestrous cycles (in addition to uterine involution) is fundamental for re-establishment of pregnancy.

  3. Frequencies of polymorphisms associated with BSE resistance differ significantly between Bos taurus, Bos indicus, and composite cattle

    Directory of Open Access Journals (Sweden)

    Seabury Christopher M

    2008-09-01

    Full Text Available Abstract Background Transmissible spongiform encephalopathies (TSEs are neurodegenerative diseases that affect several mammalian species. At least three factors related to the host prion protein are known to modulate susceptibility or resistance to a TSE: amino acid sequence, atypical number of octapeptide repeats, and expression level. These factors have been extensively studied in breeds of Bos taurus cattle in relation to classical bovine spongiform encephalopathy (BSE. However, little is currently known about these factors in Bos indicus purebred or B. indicus × B. taurus composite cattle. The goal of our study was to establish the frequency of markers associated with enhanced susceptibility or resistance to classical BSE in B. indicus purebred and composite cattle. Results No novel or TSE-associated PRNP-encoded amino acid polymorphisms were observed for B. indicus purebred and composite cattle, and all had the typical number of octapeptide repeats. However, differences were observed in the frequencies of the 23-bp and 12-bp insertion/deletion (indel polymorphisms associated with two bovine PRNP transcription regulatory sites. Compared to B. taurus, B. indicus purebred and composite cattle had a significantly lower frequency of 23-bp insertion alleles and homozygous genotypes. Conversely, B. indicus purebred cattle had a significantly higher frequency of 12-bp insertion alleles and homozygous genotypes in relation to both B. taurus and composite cattle. The origin of these disparities can be attributed to a significantly different haplotype structure within each species. Conclusion The frequencies of the 23-bp and 12-bp indels were significantly different between B. indicus and B. taurus cattle. No other known or potential risk factors were detected for the B. indicus purebred and composite cattle. To date, no consensus exists regarding which bovine PRNP indel region is more influential with respect to classical BSE. Should one particular

  4. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  5. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  6. Differences in Beef Quality between Angus (Bos taurus taurus) and Nellore (Bos taurus indicus) Cattle through a Proteomic and Phosphoproteomic Approach

    Science.gov (United States)

    Chizzotti, Mario Luiz; Vital, Camilo Elber; Baracat-Pereira, Maria Cristina; Barros, Edvaldo; Busato, Karina Costa; Gomes, Rafael Aparecido; Ladeira, Márcio Machado; Martins, Taiane da Silva

    2017-01-01

    Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore) genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (P<0.05). Nellore had higher phosphorylation of myosin regulatory light chain-2, alpha actin-1, triosephosphate isomerase and 14-3-3 protein epsilon. However, Angus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (P<0.05). Therefore, proteins involved in contraction and muscle organization, myofilaments expressed in fast or slow-twitch fibers and heat shock proteins localized in mitochondria or sarcoplasmic reticulum and involved in cell flux of calcium and apoptosis might be associated with differences in beef quality between Angus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle contraction force

  7. Investigation of X- and Y-specific single nucleotide polymorphisms in taurine (Bos taurus) and indicine (Bos indicus) cattle.

    Science.gov (United States)

    Anderung, C; Hellborg, L; Seddon, J; Hanotte, O; Götherström, A

    2007-12-01

    Initially, domesticated African cattle were of taurine type. Today, we find both African Bos taurus and Bos indicus cattle, as well as their crossbreeds, on the continent of Africa and they all share the same set of African taurine mitochondrial DNA haplogroups. In this study, we report genetic variation as substitutions and insertions/deletions (indels) on both the X and Y chromosomes, and use the variation to assess hybridization between taurine and indicine cattle. Six African cattle breeds (four Sanga breeds, including Raya Azebu, Danakil, Caprivi, Nguni; and two Zebu breeds, including Kilimanjaro Zebu and South Kavirondo Zebu) were screened for six new X-chromosomal markers, specifically three single nucleotide polymorphisms and three indels in the DDX3X (previously DBX) and ZFX genes, and five previously identified Y-chromosomal markers in the DDX3Y (previously DBY) and ZFY genes. In total, 90 (57 bulls and 33 cows) samples from the African breeds were analysed. We identify five diagnostic haplotypes of indicine and taurine origins on both the X and Y chromosomes. For each breed, the level of indicine introgression varies; in addition to pure taurine, indicine and hybrid X-chromosome individuals, recombinant X-chromosome variants were also detected. These markers are useful molecular tools for assessing the level of indicine admixture in African cattle breeds.

  8. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus Genetic Introgression of Bos indicus (Bovidae in Colombian Creole Cattle Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.This work evidenced, using a cytogenetics approach, that Bos indicus exerted a genetic introgression of paternal origin on Creole Colombian cattle descendent from Bos taurus. Analysis of chromosome Y morphology was carried out in heparinized blood samples of 67 bulls belonging to seven Colombian breeds. We report 4 sires belonging to the Romosinuano breed (40% and 10 bulls of the Casanareño breed (100% with acrocentric Y chromosome which is characteristic of Bos taurus. This finding indicates a high degree of genetic introgression in these two breeds probably caused by the continuous input of zebu stallions in the Colombian Creole breeds. In other five Creole breeds (Blanco Orejinegro -BON-, Chino Santandereano, Costeño con Cuernos, Hartón del Valle and Sanmartinero, the bulls had a submetacentric Y chromosome characteristic of Bos taurus.

  9. Comparative microarray analysis of Rhipicephalus (Boophilus microplus expression profiles of larvae pre-attachment and feeding adult female stages on Bos indicus and Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Gondro Cedric

    2010-07-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus is an obligate blood feeder which is host specific to cattle. Existing knowledge pertaining to the host or host breed effects on tick transcript expression profiles during the tick - host interaction is poor. Results Global analysis of gene expression changes in whole R. microplus ticks during larval, pre-attachment and early adult stages feeding on Bos indicus and Bos taurus cattle were compared using gene expression microarray analysis. Among the 13,601 R. microplus transcripts from BmiGI Version 2 we identified 297 high and 17 low expressed transcripts that were significantly differentially expressed between R. microplus feeding on tick resistant cattle [Bos indicus (Brahman] compared to R. microplus feeding on tick susceptible cattle [Bos taurus (Holstein-Friesian] (p ≤ 0.001. These include genes encoding enzymes involved in primary metabolism, and genes related to stress, defence, cell wall modification, cellular signaling, receptor, and cuticle formation. Microarrays were validated by qRT-PCR analysis of selected transcripts using three housekeeping genes as normalization controls. Conclusion The analysis of all tick stages under survey suggested a coordinated regulation of defence proteins, proteases and protease inhibitors to achieve successful attachment and survival of R. microplus on different host breeds, particularly Bos indicus cattle. R. microplus ticks demonstrate different transcript expression patterns when they encounter tick resistant and susceptible breeds of cattle. In this study we provide the first transcriptome evidence demonstrating the influence of tick resistant and susceptible cattle breeds on transcript expression patterns and the molecular physiology of ticks during host attachment and feeding. The microarray data used in this analysis have been submitted to NCBI GEO database under accession number GSE20605 http://www.ncbi

  10. Ultrastructural studies of sarcocystis cruzi (Hasselmann,1926 Wenyon, 1926 infection in cattle (Bos Taurus: Philippine cases

    Directory of Open Access Journals (Sweden)

    Claveria F.G

    2001-09-01

    Full Text Available This paper documents the first report of Sarcocysli s cruzi infection in domesticated cattle (Bos taurus in the Philippines. Fusiformshaped microscopic sarcocysts (183-578 μm long and 20-98 μm wide with distinct septae were found in the skeletal, striated and heart muscle. The sarcocyst wall or parasitophorous vacuolar membrane, 1.37-2.75 μm thick consisted of closely-packed villar protrusions 80-400 nm in dm. Middle and distal segments of VP were bent approximately 90 degrees parallel to the cyst wall surface. The villar core lacked microtubules, and at some points, the distal ends of the VP collectively formed conical tufts. Primary cyst wall had numerous 70-100 nm bubble-like undulations, and the ground substance was 0.25-0.5 μm in thickness. The ultrastructure of S. cruzi cyst wall typifies the Type 7 sarcocyst wall, and bears close similarities with the Philippine and the Vietnam strain of bubaline Sarcocystis levinei.

  11. Sarcocystis heydorni, n. sp. (Apicomplexa: Sarcocystidae) with cattle (Bos taurus) and human (Homo sapiens) cycle.

    Science.gov (United States)

    Dubey, Jitender P; van Wilpe, Erna; Calero-Bernal, Rafael; Verma, Shiv Kumar; Fayer, Ronald

    2015-11-01

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, namely Sarcocystis cruzi, Sarcocystis hirsuta, Sarcocystis hominis, and Sarcocystis rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (<1 μm), whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 μm or more). Here, we describe a new species of Sarcocystis with thin-walled sarcocysts in cattle. Two newborn calves were fed with sporocysts from the feces of a human volunteer who had ingested raw beef. The calves were killed 111 and 222 days later. In addition to thick-walled sarcocysts of S. hominis, both calves were coinfected with a Sarcocystis species that had a thin-walled sarcocysts, distinct from S. cruzi. The sarcocysts were mature, microscopic, up to 80 μm wide, and up to 1060 μm long. By light microscopy, the sarcocyst wall was thin (<1 μm thick) and had minute protrusions. By transmission electron microscopy, the sarcocyst wall had short, conical villar protrusions (vp) that were up to 0.5 μm long and up to 0.5 μm wide, similar to type 29. The vp on the sarcocyst wall lacked microtubules but had six or more disc-shaped plaques. The ground substance layer was smooth, approximately 0.5 μm thick, and without microtubules. The bradyzoites were 8-11 μm long. The structure of the sarcocyst wall was distinct from any species of Sarcocystis reported from livestock. This unique species is named in honor of Dr. Alfred Otto Heydorn who provided the sporocysts.

  12. Bos taurus genome sequence reveals the assortment of immunoglobulin and surrogate light chain genes in domestic cattle

    Directory of Open Access Journals (Sweden)

    Liljavirta Jenni

    2009-04-01

    Full Text Available Abstract Background The assortment of cattle immunoglobulin and surrogate light chain genes has been extracted from the version 3.1 of Bos taurus genome sequence as a part of an international effort to sequence and annotate the bovine genome. Results 63 variable lambda chain and 22 variable kappa chain genes were identified and phylogenetically assigned to 8 and 4 subgroups, respectively. The specified phylogenetic relationships are compatible with the established ruminant light chain variable gene families or subgroups. Because of gaps and uncertainties in the assembled genome sequence, the number of genes might change in the future versions of the genome sequence. In addition, three bovine surrogate light chain genes were identified. The corresponding cDNAs were cloned and the expression of the surrogate light chain genes was demonstrated from fetal material. Conclusion The bovine kappa gene locus is compact and simple which may reflect the preferential use of the lambda chain in cattle. The relative orientation of variable and joining genes in both loci are consistent with a deletion mechanism in VJ joining. The orientation of some variable genes cannot be determined from the data available. The number of functional variable genes is moderate when compared to man or mouse. Thus, post-recombinatorial mechanisms might contribute to the generation of the bovine pre-immune antibody repertoire. The heavy chains probably contribute more to recombinational immunoglobulin repertoire diversity than the light chains but the heavy chain locus could not be annotated from the version 3.1 of Bos taurus genome.

  13. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait.

  14. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different

  15. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10,983 s...

  16. The complete mitochondrial genome of Bos taurus coreanae (Korean native cattle).

    Science.gov (United States)

    Wang, Xi; Zhang, Yuan Qing; He, Dong Chang; Yang, Xiao Ming; Li, Bo; Wang, Dong Cai; Guang, Jin; Xu, Fang; Li, Jun Ya; Gao, Xue; Gao, Hui Jiang; Zhang, Lu Pei; Zhang, Xi Zhong

    2016-01-01

    Korean native cattle is one of the famous native breeds in Korean. In the present work, we report the complete mitochondrial genome sequence of Korean native cattle for the first time. The total length of the mitogenome was 16,339 bp with the base composition of 33.4% for A, 27.2% for T, 26.0% for C, and 13.4% for G, and an A-T (60.6%)-rich feature was detected. It harbored 13 protein-coding genes, 2 ribosomal RNA genes, 22 transfer RNA genes and 1 non-coding control region (D-loop region). The arrangement of all genes was identical to the typical mitochondrial genomes of cattle. The complete mitochondrial genome sequence of Korean native cattle would serve as an important data set of the germplasm resources for further study.

  17. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus).

    Science.gov (United States)

    Leavens, Teresa L; Tell, Lisa A; Kissell, Lindsey W; Smith, Geoffrey W; Smith, David J; Wagner, Sarah A; Shelver, Weilin L; Wu, Huali; Baynes, Ronald E; Riviere, Jim E

    2014-01-01

    Frequent violation of flunixin residues in tissues from cattle has been attributed to non-compliance with the USFDA-approved route of administration and withdrawal time. However, the effect of administration route and physiological differences among animals on tissue depletion has not been determined. The objective of this work was to develop a physiologically based pharmacokinetic (PBPK) model to predict plasma, liver and milk concentrations of flunixin in cattle following intravenous (i.v.), intramuscular (i.m.) or subcutaneous (s.c.) administration for use as a tool to determine factors that may affect the withdrawal time. The PBPK model included blood flow-limited distribution in all tissues and elimination in the liver, kidney and milk. Regeneration of parent flunixin due to enterohepatic recirculation and hydrolysis of conjugated metabolites was incorporated in the liver compartment. Values for physiological parameters were obtained from the literature, and partition coefficients for all tissues but liver and kidney were derived empirically. Liver and kidney partition coefficients and elimination parameters were estimated for 14 pharmacokinetic studies (including five crossover studies) from the literature or government sources in which flunixin was administered i.v., i.m. or s.c. Model simulations compared well with data for the matrices following all routes of administration. Influential model parameters included those that may be age or disease-dependent, such as clearance and rate of milk production. Based on the model, route of administration would not affect the estimated days to reach the tolerance concentration (0.125 mg kg(-1)) in the liver of treated cattle. The majority of USDA-reported violative residues in liver were below the upper uncertainty predictions based on estimated parameters, which suggests the need to consider variability due to disease and age in establishing withdrawal intervals for drugs used in food animals. The model predicted

  18. Evidence of a major gene influencing hair length and heat tolerance in Bos taurus cattle.

    Science.gov (United States)

    Olson, T A; Lucena, C; Chase, C C; Hammond, A C

    2003-01-01

    Evidence was found that supports the existence of a major gene (designated as the slick hair gene), dominant in mode of inheritance, that is responsible for producing a very short, sleek hair coat. Cattle with slick hair were observed to maintain lower rectal temperatures (RT). The gene is found in Senepol cattle and criollo (Spanish origin) breeds in Central and South America. This gene is also found in a Venezuelan composite breed, the Carora, formed from the Brown Swiss and a Venezuelan criollo breed. Two sets of backcross matings of normal-haired sire breeds to Senepol crossbred dams assumed to be heterozygous for the slick hair gene resulted in ratios of slick to normal-haired progeny that did not significantly differ from 1:1. Data from Carora x Holstein crossbred cows in Venezuela also support the concept of a major gene that is responsible for the slick hair coat of the Carora breed. Cows that were 75% Holstein: 25% Carora in breed composition segregated with a ratio that did not differ from 1:1, as would be expected from a backcross matinginvolving a dominant gene. The effect of the slick hair gene on RT depended on the degree of heat stress and appeared to be affected by age and/or lactation status. The decreased RT observed for slick-haired crossbred calves compared to normal-haired contemporaries ranged from 0.18 to 0.4 degrees C. An even larger decrease in RT (0.61 degrees C; P heat stress. The improved thermotolerance of crossbred calves due to their slick hair coats did not result in increased weaning weights, possibly because both the slick and normal-haired calves were being nursed by slick-haired dams. There were indications that the slick-haired calves grew faster immediately following weaning and that their growth during the cooler months of the year was not compromised significantly by their reduced quantity of hair. In the Carora x Holstein crossbred cows there was a positive effect of slick hair on milk yield under dry, tropical conditions.

  19. Regional differences in the fescue toxicosis response of Bos taurus cattle

    Science.gov (United States)

    Johnson, J. S.; Bryant, J. K.; Scharf, B.; Kishore, D. K.; Coate, E. A.; Eichen, P. A.; Keisler, D. H.; Spiers, D. E.

    2015-04-01

    Cattle of the same breed from different regions of the USA may have altered responses to heat stress and fescue toxicosis. Angus steers from Missouri (MO ANG, n = 10, 513.6 ± 13.6 kg BW) and Oklahoma (OK ANG, n = 10, 552.8 ± 12.0 kg BW) were fed a diet containing either endophyte-infected (E+, 30 μg ergovaline/kg BW/day) or endophyte-uninfected (E-, 0 μg ergovaline/kg BW/day) tall fescue seed for 23 days. Diet treatment began on day 2. Animals were maintained at thermoneutrality (TN, 19-22 °C, days 1-8) and then exposed to heat stress (HS, cycling 26-36 °C, days 9-22). On day 23, ambient temperature was returned to TN and used as a recovery day. Feed intake (FI) was measured daily, with rectal and skin temperatures determined six times daily. Feed intake reduction from pretreatment levels was greater ( P < 0.01) for E + (13.9 ± 0.9 versus 11.9 ± 0.3 kg/day) compared to E - (12.6 ± 0.9 versus 12.4 ± 0.3 kg/day) steers over the entire TN period, regardless of Angus group. During HS, E + cattle had reduced FI ( P < 0.02; 6.9 ± 0.2 versus 8.4 ± 0.2 kg/day) compared to E - animals, independent of region of origin. A greater decrease in FI ( P < 0.01) was observed for OK (12.1 ± 0.3 versus 6.2 ± 0.2 kg/day) compared to MO ANG (12.2 ± 0.3 versus 7.9 ± 0.2 kg/day) when ambient temperature was increased from TN to HS. On day 13 and days 15-22, OK ANG (E+) had reduced FI ( P < 0.01, -2.21 kg) compared to OK ANG (E-), while there was no effect on MO ANG. From day 12 to day 22 of HS, daily minimum temperatures for ear, rump, and tail skin were less for E + ( P < 0.05) when compared with E-treated steers, signifying peripheral vasoconstriction in E + animals. This was supported by reduced shoulder and lower tail temperatures ( P < 0.01) for E + compared to E-treated OK ANG on the recovery day. In summary, regional differences in the response to fescue toxicosis exist, with peripheral vasomotor effects becoming most evident when animals are subjected to rapid

  20. The Agersoe cattle: the last remnants of the Danish island cattle (Bos taurus)?

    DEFF Research Database (Denmark)

    Withen, K B; Brüniche-Olsen, A; Pedersen, B.V.

    2011-01-01

    A phenotypically interesting strain of cattle existed on the small island of Agersoe, on the west coast of Zealand, Denmark, in the beginning of the last decade. The cattle share a great resemblance to the extinct Danish breed, the Island cattle. The objective of this study was to genetically...

  1. Molecular characterization of Trypanosoma (Megatrypanum) spp. infecting cattle (Bos taurus), white-tailed deer (Odocoileus virginianus), and elk (Cervus elaphus canadensis) in the United States.

    Science.gov (United States)

    Fisher, Amanda C; Schuster, Greta; Cobb, W Jacob; James, Andrea M; Cooper, Susan M; Peréz de León, Adalberto A; Holman, Patricia J

    2013-10-18

    In the United States, the generally non-pathogenic trypanosome of cattle is designated Trypanosoma (Megatrypanum) theileri and is distinguished morphologically from Trypanosoma (M.) cervi, a trypanosome originally described in mule deer and elk. Phylogenetic studies of the Megatrypanum trypanosomes using various molecular markers reveal two lineages, designated TthI and TthII, with several genotypes within each. However, to date there is very limited genetic data for T. theileri, and none for the Megatrypanum trypanosomes found in wild ungulates, in the U.S. In this study U.S. isolates from cattle (Bos taurus), white-tailed deer (Odocoileus virginianus) (WTD), and elk (Cervus elaphus canadensis) were compared by ribosomal DNA (rDNA) sequence analysis and their incidence in cattle and WTD in south Texas counties was investigated. Phylogenetic analyses showed clear separation of the bovine and cervine trypanosomes. Both lineages I and II were represented in the U.S. cattle and WTD parasites. Lineage I cattle isolates were of a previously described genotype, whereas WTD and elk isolates were of two new genotypes distinct from the cattle trypanosomes. The cattle isolate of lineage II was of a previously reported genotype and was divergent from the WTD isolate, which was of a new genotype. In La Salle, Starr, Webb, and Zapata counties in south Texas a total of 51.8% of white-tailed deer were positive for trypanosomes by 18S rDNA PCR. Of the cattle screened in Webb County, 35.4% were positive. Drought conditions prevailing in south Texas when the animals were screened suggest the possibility of a vector for Trypanosoma other than the ked (Lipoptena mazamae) and tabanid flies (Tabanus spp. and Haematopota spp.).

  2. Estudio anatomopatológico, citogenético y molecular del síndrome freemartin en el bovino doméstico (Bos taurus) - (anatomopathologic, cytogenetic and molecular studies of the freemartin syndrome in cattle (bos taurus))

    OpenAIRE

    Ayala-Valdovinos, Miguel Angel; Villagómez, Daniel; Galindo-García, Jorge; Sánchez-Chiprés, David; Avila-Figueroa,David; Taylor-Preciado, Juan de Jesús; Merlos-Barajas, Miguel; Guerrero-Quiroz Luis

    2007-01-01

    ResumenA través del análisis citogenético utilizando la presencia de los cromosomas sexuales como marcadores y mediante el análisis molecular (PCR-RFLP), utilizando oligonucleótidos iniciadores para los genes Zfx y Zfy del bovino, se diagnosticaron con la condición intersexual, síndrome freemartin, 19 individuos (Bos taurus) procedentes de partos múltiples heterosexuales; asimismo, se estudiaron anatomopatológicamente cuatro de estos animales, enfatizando en las características del tejido gon...

  3. An interpretive review of selective sweep studies in Bos taurus cattle populations: identification of unique and shared selection signals across breeds.

    Directory of Open Access Journals (Sweden)

    Beatriz eGutiérrez-Gil

    2015-05-01

    Full Text Available This review compiles the results of 21 genomic studies of European Bos taurus breeds and thus provides a general picture of the selection signatures in taurine cattle identified by genome-wide selection-mapping scans. By performing a comprehensive summary of the results reported in the literature, we compiled a list of 1,049 selection sweeps described across 37 cattle breeds (17 beef breeds, 14 dairy breeds and 6 dual-purpose breeds, and four different beef-vs-dairy comparisons, which we subsequently grouped into core selective sweep (CSS regions, defined as consecutive signals within 1 Mb of each other. We defined a total of 409 CSSs across the 29 bovine autosomes, 232 (57% of which were associated with a single-breed (Single-breed CSSs, 134 CSSs (33% were associated with a limited number of breeds (Two-to-four-breed CSSs and 39 CSSs (9% were associated with five or more breeds (Multi-breed CSSs. For each CSS, we performed a candidate gene survey that identified 291 genes within the CSS intervals (from the total list of 5,183 BioMart-extracted genes linked to dairy and meat production, stature and coat colour traits. A complementary functional enrichment analysis of the CSS positional candidates highlighted other genes related to pathways underlying behaviour, immune response and reproductive traits. The Single-breed CSSs revealed an over-representation of genes related to dairy and beef production, this was further supported by over-representation of production-related pathway terms in these regions based on a functional enrichment analysis. Overall, this review provides a comparative map of the selection sweeps reported in European cattle breeds and presents for the first time a characterization of the selection sweeps that are found in individual breeds. Based on their uniqueness, these breed-specific signals could be considered as divergence signals, which may be useful in characterising and protecting livestock genetic diversity.

  4. Estudio anatomopatológico, citogenético y molecular del síndrome freemartin en el bovino doméstico (Bos taurus - (anatomopathologic, cytogenetic and molecular studies of the freemartin syndrome in cattle (bos taurus

    Directory of Open Access Journals (Sweden)

    Ayala-Valdovinos, Miguel Angel

    2007-09-01

    Full Text Available ResumenA través del análisis citogenético utilizando la presencia de los cromosomas sexuales como marcadores y mediante el análisis molecular (PCR-RFLP, utilizando oligonucleótidos iniciadores para los genes Zfx y Zfy del bovino, se diagnosticaron con la condición intersexual, síndrome freemartin, 19 individuos (Bos taurus procedentes de partos múltiples heterosexuales; asimismo, se estudiaron anatomopatológicamente cuatro de estos animales, enfatizando en las características del tejido gonadal (ovárico y/o testicular presente, procediendo a la identificación molecular (PCR-RFLP de células masculinas en este tejido. El quimerismo cromosómico hematopoyético (60,XX/60,XY caracterizó a los animales estudiados, excepcionalmente un individuo mostró complemento cromosómico 60,XY. Mediante la técnica de PCR, se amplificó un fragmento de 447 pb, del cual después de ser digerido con la enzima de restricción Pst I, se obtuvieron los RFLP de los animales estudiados, hembras normales (447 pb así como machos normales y animales freemartins (447, 344 y 103 pb. Los hallazgos anatomopatológicos de dos de los cuatro freemartins estudiados hasta su sacrificio mostraron pseudohermafroditismo masculino, de estos dos intersexos además se obtuvo ADN de tejido gonadal, del cual se identificó a nivel molecular (PCR la presencia de un patrón de RFLP específicos de freemartin. Los dos freemartins restantes presentaron una marcada hipoplasia del tracto reproductor sin gónadas diferenciadas como tales. AbstractBy means of the cytogenetic analysis using the presence of the sexual chromosomes as markers and through the molecular analysis (pcr-rflp, using primers for the zfx and zfy genes of the bovine, 19 individuals (bos taurus coming from heterosexual multiple parturitions, were diagnosed as syndrome freemartin intersexes; likewise, there were studied anatomopathologically four of these animals, emphasizing the characteristics of the gonadal

  5. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  6. Individual recognition in domestic cattle (Bos taurus: evidence from 2D-images of heads from different breeds.

    Directory of Open Access Journals (Sweden)

    Marjorie Coulon

    Full Text Available BACKGROUND: In order to maintain cohesion of groups, social animals need to process social information efficiently. Visual individual recognition, which is distinguished from mere visual discrimination, has been studied in only few mammalian species. In addition, most previous studies used either a small number of subjects or a few various views as test stimuli. Dairy cattle, as a domestic species allow the testing of a good sample size and provide a large variety of test stimuli due to the morphological diversity of breeds. Hence cattle are a suitable model for studying individual visual recognition. This study demonstrates that cattle display visual individual recognition and shows the effect of both familiarity and coat diversity in discrimination. METHODOLOGY/PRINCIPAL FINDINGS: We tested whether 8 Prim'Holstein heifers could recognize 2D-images of heads of one cow (face, profiles, (3/4 views from those of other cows. Experiments were based on a simultaneous discrimination paradigm through instrumental conditioning using food rewards. In Experiment 1, all images represented familiar cows (belonging to the same social group from the Prim'Holstein breed. In Experiments 2, 3 and 4, images were from unfamiliar (unknown individuals either from the same breed or other breeds. All heifers displayed individual recognition of familiar and unfamiliar individuals from their own breed. Subjects reached criterion sooner when recognizing a familiar individual than when recognizing an unfamiliar one (Exp 1: 3.1+/-0.7 vs. Exp 2: 5.2+/-1.2 sessions; Z = 1.99, N = 8, P = 0.046. In addition almost all subjects recognized unknown individuals from different breeds, however with greater difficulty. CONCLUSIONS/SIGNIFICANCE: Our results demonstrated that cattle have efficient individual recognition based on categorization capacities. Social familiarity improved their performance. The recognition of individuals with very different coat characteristics from the

  7. The polymorphisms of bovine cocaine- and amphetamine-regulated transcripts and their associations with cattle (Bos taurus) growth traits

    Indian Academy of Sciences (India)

    Chun Lei Zhang; Hong Chen; Yan Hong Wang; Xian Yong Lan; Chu Zhao Lei; Xing Tang Fang

    2008-09-01

    We investigated the polymorphisms of bovine cocaine- and amphetamine-regulated transcripts (CART). The coding and regulating regions of CART were screened in 7 cattle breeds by the single-stranded conformation polymorphism (SSCP) technique. The four loci (C1, C2, C3 and C4) studied were all polymorphic. Polymerase chain reaction (PCR) products representing different SSCP variants were sequenced and a total of 9 single-nucleotide polymorphisms (SNPs) were found. The associations between polymorphic loci and the growth traits of Nanyang cattle were analysed. The results indicated that genotype A1A1 of the C1 locus was associated with a higher body weight ( < 0.05) than heterozygous A1B1. Genotype A2A2 of the C2 locus was associated with lower body weight and average daily weight gain ( ≤ 0.001) than heterozygous A2B2. C3 and C4 loci had no significant effect on Nanyang cattle growth traits (P > 0.05).

  8. Perfluorooctane Sulfonate Plasma Half-Life Determination and Long-Term Tissue Distribution in Beef Cattle (Bos taurus).

    Science.gov (United States)

    Lupton, Sara J; Dearfield, Kerry L; Johnston, John J; Wagner, Sarah; Huwe, Janice K

    2015-12-30

    Perfluorooctane sulfonate (PFOS) is used in consumer products as a surfactant and is found in industrial and consumer waste, which ends up in wastewater treatment plants (WWTPs). PFOS does not breakdown during WWTP processes and accumulates in the biosolids. Common practices include application of biosolids to pastures and croplands used for feed, and as a result, animals such as beef cattle are exposed to PFOS. To determine plasma and tissue depletion kinetics in cattle, 2 steers and 4 heifers were dosed with PFOS at 0.098 mg/kg body weight and 9.1 mg/kg, respectively. Plasma depletion half-lives for steers and heifers were 120 ± 4.1 and 106 ± 23.1 days, respectively. Specific tissue depletion half-lives ranged from 36 to 385 days for intraperitoneal fat, back fat, muscle, liver, bone, and kidney. These data indicate that PFOS in beef cattle has a sufficiently long depletion half-life to permit accumulation in edible tissues.

  9. Abundant sequence divergence in the native Japanese cattle Mishima-Ushi (Bos taurus) detected using whole-genome sequencing.

    Science.gov (United States)

    Tsuda, Kaoru; Kawahara-Miki, Ryouka; Sano, Satoshi; Imai, Misaki; Noguchi, Tatsuo; Inayoshi, Yousuke; Kono, Tomohiro

    2013-10-01

    The native Japanese cattle Mishima-Ushi, a designated national natural treasure, are bred on a remote island, which has resulted in the conservation of their genealogy. We examined the genetic characteristics of 8 Mishima-Ushi individuals by using single nucleotide polymorphisms (SNPs), insertions, and deletions obtained by whole-genome sequencing. Mapping analysis with various criteria showed that predicted heterozygous SNPs were more prevalent than predicted homozygous SNPs in the exonic region, especially non-synonymous SNPs. From the identified 6.54 million polymorphisms, we found 400 non-synonymous SNPs in 313 genes specific to each of the 8 Mishima-Ushi individuals. Additionally, 3,170,833 polymorphisms were found between the 8 Mishima-Ushi individuals. Phylogenetic analysis confirmed that the Mishima-Ushi population diverged from another strain of Japanese cattle. This study provides a framework for further genetic studies of Mishima-Ushi and research on the function of SNP-containing genes as well as understanding the genetic relationship between the domestic and native Japanese cattle breeds.

  10. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  11. Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

    Directory of Open Access Journals (Sweden)

    Reinsch Norbert

    2009-09-01

    Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

  12. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    Directory of Open Access Journals (Sweden)

    Pablo Corva

    2007-01-01

    Full Text Available The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G and the CAST gene 3' untranslated region (SNP2870, alleles A/G. We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from crosses between Angus, Hereford and Limousin cattle. Minor allele frequencies for the markers were 0.27 to 0.46 (C, 0.02 to 0.18 (A, and 0.24 to 0.53 (A, respectively. The presence of CAPN1 markers had significant effects on meat shear force but no detectable effects were demonstrated for the CAST marker. The shear force of meat from steers with the SNP316 CC genotype was 11% lower than for the SNP316 CG genotype and 17% lower than for the SNP316 GG genotype. There were very few steers with the SNP530 AA genotype and, contrary to previous studies, meat from steers with the SNP530 GG genotype showed an 11.5% higher shear force than that from steers with the SNP530 GA genotype. Final body weight, carcass weight and rib eye area were not affected by any of the markers. These results support the concept that CAPN1 variants are associated with tenderness across a wide range of beef production systems.

  13. Effect of different levels and sources of zinc supplementation on quantitative and qualitative semen attributes and serum testosterone level in crossbred cattle (Bos indicus x Bos taurus) bulls.

    Science.gov (United States)

    Kumar, Nishant; Verma, Ramesh Prashad; Singh, Lallan Prasad; Varshney, Vijay Prakash; Dass, Ram Sharan

    2006-01-01

    An experiment was conducted on 16 crossbred bulls (about 2 years of age, 316.2+/-0.77 kg average body weight), divided into groups I, II, III and IV to study the effect of different levels of Zn supplementation from inorganic and organic sources on semen quality. The animals in the first 3 groups were supplemented with 0, 35 and 70 ppm Zn from Zn sulfate, respectively and the animals in-group IV were supplemented with 35 ppm Zn as Zn propionate. Semen collection and evaluation was done in the first month (to assess semen quality at the start of the experiment) and 7th, 8th and 9th month of experimental feeding to evaluate the effect of supplemental Zn on semen attributes. We gave 6 months for Zn feeding, so that 3 sperm cycles of spermatogenesis had passed and the collected semen reflected the complete effect of Zn supplementation. Six ejaculates from each bull were collected and evaluated for semen quantitative (ejaculate volume, sperm concentration and sperm number per ejaculate) and qualitative characteristics (semen pH, mass motility, individual motility, sperm livability percent and abnormal sperm percent, percent intact acrosome, bovine cervical mucus penetration test, hypo-osmotic sperm swelling test) and activity of seminal plasma enzymes i.e., alkaline phosphatase, acid phosphatase, GOT and GPT. Testosterone level in the blood serum of crossbred bulls was also estimated. Mean values of semen quantitative and qualitative characteristics at the start of the experiment were statistically non significant (P > 0.05) in all the crossbred cattle bulls, however, there were statistically significant differences among the bulls of different groups after 6 months of zinc supplementation. Mean ejaculate volume (mL) was 2.37, 4.70, 5.86 and 6.38, respectively in groups I to IV, indicating a statistically significant (P bulls. Similarly, sperm concentration (million.mL(-1)), live sperm (%) and motility (%) were significantly (P bulls improved the qualitative and

  14. Epizootic hemorrhagic disease outbreak in a captive facility housing white-tailed deer (Odocoileus virginianus), bison (Bison bison), elk (Cervus elaphus), cattle (Bos taurus), and goats (Capra hircus) in Colorado, U.S.A.

    Science.gov (United States)

    Nol, Pauline; Kato, Cecilia; Reeves, Will K; Rhyan, Jack; Spraker, Terry; Gidlewski, Thomas; VerCauteren, Kurt; Salman, Mo

    2010-09-01

    An ungulate research facility in Fort Collins, Colorado, U.S.A., experienced mortality in white-tailed deer (Odocoileus virginianus) because of epizootic hemorrhagic disease virus (EHDV) infection from 20 August 2007 through 26 September 2007. Epizootic hemorrhagic disease virus (EHDV) was detected by reverse transcriptase polymerase chain reaction and virus isolation from the spleen and lung tissues of two white-tailed deer. Virus neutralization tests were performed on pre- and postoutbreak sera from other species maintained in the same facility, including bison (Bison bison), elk (Cervus elaphus), domestic cattle (Bos taurus), and domestic goats (Capra hircus), as well as postoutbreak sera from the surviving white-tailed deer. Serum samples that represented all species in the facility neutralized EHDV-1 and EHDV-2 either before or after the outbreak. The animals that neutralized EHDV-1 did not neutralize EHDV-2. No clinical signs attributable to EHDV infection were noted in any of the species other than the deer during the outbreak. Although experimental EHDV infections have been reported in bison and elk, natural exposures have not been previously documented in these species in North America. The roles that elk, bison, cattle, and goats might play in the epidemiology of EHDV in a close-contact multispecies situation remain unknown.

  15. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated.

  16. Expression of genes related to quality of Longissimus dorsi muscle meat in Nellore (Bos indicus) and Canchim (5/8 Bos taurus × 3/8 Bos indicus) cattle.

    Science.gov (United States)

    Giusti, Juliana; Castan, Eduardo; Dal Pai, Maeli; Arrigoni, Mário De Beni; Rodrigues Baldin, Samira; De Oliveira, Henrique Nunes

    2013-06-01

    This study was performed to compare CAPN1, CAPN2, CAST, TG, DGAT1 and LEP gene expressions and correlate them with meat quality traits in two genetic groups (Nellore and Canchim) in order to assess their expression profile and use their expression profile as genetic markers. We analyzed 30 young bulls (1year old), 15 of each genetic group. Samples of the Longissimus dorsi muscle were collected for analysis of: total lipids (TL) and meat tenderness measured as Warner-Bratzler shear force (SF) and myofibrillar fragmentation (MFI) at day of slaughter and 7days of aging. Gene expression profiles were obtained via RT-qPCR. TL and MFI showed differences between breeds, higher MFI in Canchim and higher TL in Nellore. Calpains showed no differential expression between groups, as did DGAT1, TG, and LEP. CAST was expressed more in the Nellore cattle. The only significant within-breed correlation (0.79) between gene expression and meat traits was found for DGAT1 and MFI in Canchim breed. Although the number of animals used in this study was small, the results indicate that the increased expression of CAST in Nellore may reflect tougher meat, but the lack of correlations with the meat traits indicates it is not a promising genetic marker.

  17. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    Directory of Open Access Journals (Sweden)

    J. A. Ujan

    2011-12-01

    Full Text Available In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142. Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population breeds were determined and evaluated by the χ2 test. Results showed that the polymorphism distribution was not similar in all of the three Bos taurus breeds, the genotype distributions of two cattle breeds Jia xian red and Nanyang did not agree with Hardy–Weinberg equilibrium (P 0.05. The A/G allelic frequencies in these breeds were 0.797/0.202, 0.770/0.229, 0.863/0.136 respectively. The genotype frequencies in Jia xian red and Nanyang cattle breeds showed moderate diversity (0.25< polymorphism information content <0.5. Furthermore, least squares analysis revealed significant effects of genotype on intramuscular fat, rib area and water holding capacity in 510 individuals (P < 0.05. Our result suggests that A1142G SNP can be used as an efficacious genetic marker for meat quality traits in native Chinese cattle breeds (Bos taurus but a much large number of animals are required for Marker assisted selection.

  18. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment.

  19. The effect of size and density on the mean retention time of particles in the reticulorumen of cattle ( Bos primigenius f. taurus), muskoxen ( Ovibos moschatus) and moose ( Alces alces).

    Science.gov (United States)

    Clauss, Marcus; Lechner, Isabel; Barboza, Perry; Collins, William; Tervoort, Theo A; Südekum, Karl-Heinz; Codron, Daryl; Hummel, Jürgen

    2011-02-01

    Particle passage from the reticulorumen (RR) depends on particle density and size. Forage particle density and size are related and change over time in the RR. Particle density mainly influences sorting in the reticulum, whereas particle size influences particle retention in the fibre mat of stratified rumen contents ('filter-bed' effect). We investigated these effects independently, by inserting plastic particles of different sizes (1, 10 and 20 mm) and densities (1·03, 1·20 and 1·44 mg/ml) in the RR of cattle (Bos primigenius f. taurus) as a pilot study, and of muskoxen (Ovibos moschatus; n 4) and moose (Alces alces; n 2) both fed two diets (browse and grass). Faeces were analysed for plastic residues for 13 d after dosing to calculate mean retention times (MRT). The results confirmed previous findings of differences in absolute MRT between species. Comparing muskoxen with moose, there was no difference in the effect of particle density on the MRT between species but particle size had a more pronounced effect on the MRT in muskoxen than in moose. This indicated a stronger 'filter-bed effect' in muskoxen, in accord with the reports of stratified RR contents in this species v. the absence of RR content stratification in moose. Low-density particles were retained longer in both species fed on grass diets, indicating a contribution of forage type to the 'filter-bed effect'. The results indicate that retention based on particle size may differ between ruminant species, depending on the presence of a fibre mat in the RR, whereas the density-dependent mechanism of sedimentation in the RR is rather constant across species.

  20. The first identification of a blood-sucking abomasal nematode Ashworthius sidemi in cattle (Bos taurus) using simple polymerase chain reaction (PCR).

    Science.gov (United States)

    Moskwa, Bożena; Bień, Justyna; Cybulska, Aleksandra; Kornacka, Aleksandra; Krzysiak, Michał; Cencek, Tomasz; Cabaj, Władysław

    2015-06-30

    A simple polymerase chain reaction (PCR) test was used to identify Ashworthius sidemi, a blood-sucking gastrointestinal nematode that commonly infects bison, red and roe deer, and moose in Poland. The present study uses this technique to confirm the possibility of transmission of A. sidemi infection from wildlife to domestic animals, such as cattle and sheep, grazing on the same natural pastures. A 406 bp fragment of genomic A. sidemi DNA was actually detected in DNA isolated from larval cultures derived from feces from cattle. A. sidemi DNA has been detected in cattle which represent a new host for this parasite. This is the first evidence of A. sidemi in cattle. The results reveal that a PCR test based on DNA from L3 larvae can be used for in vivo detection of A. sidemi invasions in breeding animals. In conclusion, the transfer of A. sidemi infection from wildlife to the farm animals sharing the same pastures appears possible.

  1. Molecular Characterization of Bovine SMO Gene and Effects of Its Genetic Variations on Body Size Traits in Qinchuan Cattle (Bos taurus).

    Science.gov (United States)

    Zhang, Ya-Ran; Gui, Lin-Sheng; Li, Yao-Kun; Jiang, Bi-Jie; Wang, Hong-Cheng; Zhang, Ying-Ying; Zan, Lin-Sen

    2015-07-27

    Smoothened (Smo)-mediated Hedgehog (Hh) signaling pathway governs the patterning, morphogenesis and growth of many different regions within animal body plans. This study evaluated the effects of genetic variations of the bovine SMO gene on economically important body size traits in Chinese Qinchuan cattle. Altogether, eight single nucleotide polymorphisms (SNPs: 1-8) were identified and genotyped via direct sequencing covering most of the coding region and 3'UTR of the bovine SMO gene. Both the p.698Ser.>Ser. synonymous mutation resulted from SNP1 and the p.700Ser.>Pro. non-synonymous mutation caused by SNP2 mapped to the intracellular C-terminal tail of bovine Smo protein; the other six SNPs were non-coding variants located in the 3'UTR. The linkage disequilibrium was analyzed, and five haplotypes were discovered in 520 Qinchuan cattle. Association analyses showed that SNP2, SNP3/5, SNP4 and SNP6/7 were significantly associated with some body size traits (p 0.05). Meanwhile, cattle with wild-type combined haplotype Hap1/Hap1 had significantly (p cattle, and the wild-type haplotype Hap1 together with the wild-type alleles of these detected SNPs in the SMO gene could be used to breed cattle with superior body size traits. Therefore, our results could be helpful for marker-assisted selection in beef cattle breeding programs.

  2. Superovulation and embryo production in tropical adapted Bos taurus (Caracu and Bos indicus (Nelore cows

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2011-01-01

    Full Text Available The aim of this study was to compare ovarian response and embryo production of superovulated Bos indicus and Bos taurus cows adapted to the environmental conditions from São Paulo State, Brazil. Ninety non-lactating cows from Caracu ( Bos taurus, n=40 and Nelore (Bos indicus, n=50 were treated with an intravaginal device containing progesterone (1.38 mg; CIDRB ®, Pfizer Animal Health, Montreal, Québec, Canada and 2.5 mg, intramuscularly (IM, of estradiol benzoate (Estrogin®, Farmavet, São Paulo, Brazil. Four days later, all animals were treated with multiple IM injections of 400 IU of FSH (Pluset®, Calier, Spain in decreasing doses (75–75; 75–50; 50–25, and 25–25 IU at 12-h intervals over 4 days. On the seventh day, CIDR-B device was removed and cows received, IM, 150 ìg of cloprostenol (Veteglan®, Calier, Spain. Cows were then inseminated 48 and 62 h after cloprostenol treatment and embryos were recovered non-surgically seven days after first insemination. Differences in the number of corpora lutea (CL number, total number of structures (ova/embryos, and number of transferable embryos were analyzed by Student t test. There was no difference (P > 0.05 in the average number of CL, total ova/embryos and transferable embryos of Caracu (11.4 ± 3.3; 8.6 ± 2.6 e 6.0 ± 2.4 and Nelore (12.0 ± 4.1; 9.0 ± 4.3 e 5.1 ± 2.9 cows, respectively. These results suggest that Caracu and Nelore cows superovulated in tropical climate had similar ovarian responses and embryo production.

  3. The prey pathway: a regional history of cattle (Bos taurus) and pig (Sus scrofa) domestication in the northern Jordan Valley, Israel.

    Science.gov (United States)

    Marom, Nimrod; Bar-Oz, Guy

    2013-01-01

    The faunal assemblage from the 9(th)-8(th) millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th) millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  4. Comparison of the diurnal pattern and magnitude of velocities of goats (Capra Hircus), sheep (Ovis Aries), horses (Equus Caballus) and cattle (Bos Taurus)

    Science.gov (United States)

    Domestic ungulates were bred over the last four thousand years to provide man with food, fiber and motive power. Cattle, horses, sheep and goats arose from different animal ancestors and serve different purposes based upon their unique characteristics. We hypothesized that each species would have ...

  5. Molecular characterization of Trypanosoma spp. infecting cattle (Bos taurus), white-tailed deer (Odocoileus virginianus), and elk (Cervus elaphus canadensis) in the United States

    Science.gov (United States)

    The benign trypanosomes of cattle and wild ungulates in the United States are designated Trypanosoma theileri and Trypanosoma cervi, respectively. Historically these parasites have been identified based on morphology, host, and vector, if known. No molecular characterization has been reported for T....

  6. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  7. Ganancia diaria y peso al destete en terneros de cruces Bos taurus con Bos indicus en trópico húmedo

    OpenAIRE

    Córdova, Alejandro; Rodriguez, Gustavo; Córdova, Mary; Córdova, Cristian; Pérez., José

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatro meses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para lo cual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgian blue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Los resultados se analizaron mediante estadística descri...

  8. Ganancia diaria y peso al destete en becerros de cruzas Bos taurus con Bos indicus en trópico húmedo.

    OpenAIRE

    Alejandro Córdova; Gustavo Rodríguez; Mary Córdova; Cristian Córdova; José Pérez

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatromeses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para locual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgianblue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Losresultados se analizaron mediante estadística descriptiv...

  9. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.;

    2012-01-01

    Background: Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified...... recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results: Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic...... correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive...

  10. 杂交牛(大额牛×云南黄牛)朊蛋白基因的分子克隆及其序列分析%Molecular Cloning and Sequences Characteristics Analysis of the Prion Protein Gene from the Hybrids between Gayal (Bos frontalis)and Yunnan Yellow Cattle (Bos taurus)

    Institute of Scientific and Technical Information of China (English)

    刘情; 席冬梅; 陈学礼; 李继中; 杨舒黎; 邓卫东

    2012-01-01

    朊蛋白(prion protein,PRNP)基因编码朊蛋白,是引起疯牛病的主效基因.本研究利用PCR方法首次从杂交牛(大额牛×云南黄牛)基因组中扩增了PRNP基因,GenBank登录号为HQ875337.PCR产物直接双向测序表明,该序列包含杂交牛PRNP基因795 bp的开放阅读框(ORF),编码264个氨基酸前体蛋白.生物信息学分析结果发现,该蛋白包含1个信号肽、3个α螺旋、2个β折叠、6个八肽重复序列、1个疏水区域、1个二硫键和1个糖基磷脂酰肌醇锚定位点.与已报道的其他牛PRNP基因进行序列比对分析,核苷酸和氨基酸的同源性均在97%以上.%The priori protein was encoded by the prion protein (PRNP) gene which was the major gene for affecting mad cow disease or BSE. In the present study, the PCR method was used to amplify the PRNP gene from the hybrids between Gay-al (Bos frontalis) and Yunnan Yellow cattle (Bos taurus). The sequence was deposited in the GenBank under accession number HQ875337. The PCR products were sequenced bi-directly. By sequence analysis,the length of open read frame (ORF) of the PRNP gene was 795 bp, which encodes a protein of 264 amino acids,including a signal region,a octapeptide repeat,three α-heli-ces.two β-sheets,a hydrophobic region,a disulfide bridge, a glycosyl phosphatidyl inositol (GPI) anchor site. The homology of both nucleotide and amino acid sequences with other cattle was more than 97%. All this will provide the molecular basal data for breakthrough of transmissible spongiform encephalopathy among different animal species.

  11. Imputation of Microsatellite Alleles from Dense SNP Genotypes for Parentage Verification Across Multiple Bos taurus and Bos indicus breeds

    Directory of Open Access Journals (Sweden)

    Matthew Charles Mcclure

    2013-09-01

    Full Text Available To assist cattle producers transition from microsatellite (MS to single nucleotide polymorphism (SNP genotyping for parental verification we previously devised an effective and inexpensive method to impute MS alleles from SNP haplotypes. While the reported method was verified with only a limited data set (N=479 from Brown Swiss, Guernsey, Holstein, and Jersey cattle, some of the MS-SNP haplotype associations were concordant across these phylogenetically diverse breeds. This implied that some haplotypes predate modern breed formation and remain in strong linkage disequilibrium. To expand the utility of MS allele imputation across breeds, MS and SNP data from more than 8,000 animals representing 39 breeds (Bos taurus and B. indicus were used to predict 9,410 SNP haplotypes, incorporating an average of 73 SNPs per haplotype, for which alleles for 12 MS markers could be accurately be imputed. Approximately 25% of the MS-SNP haplotypes were present in multiple breeds (N=2 to 36 breeds. These shared haplotypes allowed for MS imputation in breeds that were not represented in the reference population with only a small increase in Mendelian inheritance inconsistancies. Our reported reference haplotypes can be used for any cattle breed and the reported methods can be applied to any species to aid the transition from MS to SNP genetic markers. While ~91% of the animals with imputed alleles for 12 MS markers had <1 Mendelian inheritance conflicts with their parents’ reported MS genotypes, this figure was 96% for our reference animals, indicating potential errors in the reported MS genotypes. The workflow we suggest autocorrects for genotyping errors and rare haplotypes, by MS genotyping animals whose imputed MS alleles fail parentage verification, and then incorporating those animals into the reference dataset.

  12. Imputation of microsatellite alleles from dense SNP genotypes for parentage verification across multiple Bos taurus and Bos indicus breeds

    Science.gov (United States)

    McClure, Matthew C.; Sonstegard, Tad S.; Wiggans, George R.; Van Eenennaam, Alison L.; Weber, Kristina L.; Penedo, Cecilia T.; Berry, Donagh P.; Flynn, John; Garcia, Jose F.; Carmo, Adriana S.; Regitano, Luciana C. A.; Albuquerque, Milla; Silva, Marcos V. G. B.; Machado, Marco A.; Coffey, Mike; Moore, Kirsty; Boscher, Marie-Yvonne; Genestout, Lucie; Mazza, Raffaele; Taylor, Jeremy F.; Schnabel, Robert D.; Simpson, Barry; Marques, Elisa; McEwan, John C.; Cromie, Andrew; Coutinho, Luiz L.; Kuehn, Larry A.; Keele, John W.; Piper, Emily K.; Cook, Jim; Williams, Robert; Van Tassell, Curtis P.

    2013-01-01

    To assist cattle producers transition from microsatellite (MS) to single nucleotide polymorphism (SNP) genotyping for parental verification we previously devised an effective and inexpensive method to impute MS alleles from SNP haplotypes. While the reported method was verified with only a limited data set (N = 479) from Brown Swiss, Guernsey, Holstein, and Jersey cattle, some of the MS-SNP haplotype associations were concordant across these phylogenetically diverse breeds. This implied that some haplotypes predate modern breed formation and remain in strong linkage disequilibrium. To expand the utility of MS allele imputation across breeds, MS and SNP data from more than 8000 animals representing 39 breeds (Bos taurus and B. indicus) were used to predict 9410 SNP haplotypes, incorporating an average of 73 SNPs per haplotype, for which alleles from 12 MS markers could be accurately be imputed. Approximately 25% of the MS-SNP haplotypes were present in multiple breeds (N = 2 to 36 breeds). These shared haplotypes allowed for MS imputation in breeds that were not represented in the reference population with only a small increase in Mendelian inheritance inconsistancies. Our reported reference haplotypes can be used for any cattle breed and the reported methods can be applied to any species to aid the transition from MS to SNP genetic markers. While ~91% of the animals with imputed alleles for 12 MS markers had ≤1 Mendelian inheritance conflicts with their parents' reported MS genotypes, this figure was 96% for our reference animals, indicating potential errors in the reported MS genotypes. The workflow we suggest autocorrects for genotyping errors and rare haplotypes, by MS genotyping animals whose imputed MS alleles fail parentage verification, and then incorporating those animals into the reference dataset. PMID:24065982

  13. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  14. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    JIMÉNEZ ROBAYO LIGIA MERCEDES

    2008-04-01

    Full Text Available

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  15. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    2008-01-01

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión gené- tica, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus . Para este estudio se realizó el análisis cariológico de la morfología del cromo- soma Y a partir de muestras de sangre heparinizada de 67 bovinos machos perte- necientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejem- plares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus , lo cual esta- ría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemen- te originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santan- dereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  16. Comparison of antral and preantral ovarian follicle populations between Bos indicus and Bos indicus-taurus cows with high or low antral follicles counts.

    Science.gov (United States)

    Silva-Santos, K C; Siloto, L S; Santos, G M G; Morotti, F; Marcantonio, T N; Seneda, M M

    2014-02-01

    The objective was to compare populations of antral and pre-antral ovarian follicles in Bos indicus and Bos indicus-taurus cows with high and low antral follicle counts. Nelore (Bos indicus, n = 20) and Nelore X Angus (1/2 Bos indicus-taurus, n = 20) cows were subjected to follicular aspiration without regard to the stage of their oestrous cycle (day of aspiration = D0) to remove all follicles ≥3 mm and induce growth of a new follicular wave. Ovaries were examined by ultrasonography on D4, D19, D34, D49 and D64, and antral follicles ≥3 mm were counted. Thereafter, cows were assigned to one of two groups: high or low antral follicular count (AFC, ≥30 and ≤15 antral follicles, respectively). After D64, ovaries were collected after slaughter and processed for histological evaluation. There was high repeatability in the numbers of antral follicles for all groups (range 0.77-0.96). The mean (±SD) numbers of antral follicles were 35 ± 9 (Bos indicus) and 38 ± 6 (Bos indicus-taurus) for the high AFC group and 10 ± 3 (Bos indicus) and 12 ± 2 (Bos indicus-taurus) follicles for the low AFC. The mean number of preantral follicles in the ovaries of Bos indicus-taurus cows with high AFC (116 226 ± 83 156 follicles) was greater (p < 0.05) than that of Bos indicus cows (63 032 ± 58 705 follicles) with high AFC. However, there was no significant correlation between numbers of antral and preantral follicles.

  17. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds.

  18. Screening of biotechnical parameters for production of bovine inter-subspecies embryonic chimeras by the aggregation of tetraploid Bos indicus and diploid crossbred Bos taurus embryos.

    Science.gov (United States)

    Razza, Eduardo M; Satrapa, Rafael A; Emanuelli, Isabele P; Barros, Ciro M; Nogueira, Marcelo F G

    2016-03-01

    The aggregation of a tetraploid zebu embryo (Bos indicus, a thermotolerant breed) with a diploid taurine embryo (Bos taurus, a thermosensitive breed) should create a complete taurine fetus, whose extra-embryonic components, e.g., the chorion, is derived mainly from the zebu embryo. These zebu-derived extra-embryonic components may interact positively with the taurine embryo/fetus during pregnancy in a tropical environment. We tested different parameters for the production of tetraploid Nelore (Bos indicus) embryos to be combined via aggregation with crossbred Bos taurus (diploid) embryos in order to produce viable chimeric blastocysts. Bovine (Bos indicus or crossbred Bos taurus) embryos were produced in vitro according to standard procedures. Two-cell Bos indicus embryos were submitted to electrofusion with varying numbers of pulses (1 or 2), voltages (0.4, 0.5, 0.75, 1.0, 1.4 and 5.0 kV/cm) and time (20, 25, 50 and 60 μs) to produce tetraploid embryos. Electrofused embryos were cultured with crossbred non-fused embryos to form chimeras that developed until the blastocyst stage. The best fusion parameter was 0.75 kV/cm for 60 μs. Four chimeric blastocysts (tetraploid Nelore with diploid crossbred Holstein) were formed after 31 attempts in 4 replicates (13%). We established an optimal procedure for the production of tetraploid Bos indicus (4n) embryos and embryonic chimeras by aggregation of crossbred Bos taurus (2n) with Bos indicus (4n) embryos. This technique would be valid in applied research, by producing exclusively taurine calves, but with placental elements from the Bos indicus breed, following transfer of these chimeras into recipient cows.

  19. Expression variants of the lipogenic AGPAT6 gene affect diverse milk composition phenotypes in Bos taurus.

    Directory of Open Access Journals (Sweden)

    Mathew D Littlejohn

    Full Text Available Milk is composed of a complex mixture of lipids, proteins, carbohydrates and various vitamins and minerals as a source of nutrition for young mammals. The composition of milk varies between individuals, with lipid composition in particular being highly heritable. Recent reports have highlighted a region of bovine chromosome 27 harbouring variants affecting milk fat percentage and fatty acid content. We aimed to further investigate this locus in two independent cattle populations, consisting of a Holstein-Friesian x Jersey crossbreed pedigree of 711 F2 cows, and a collection of 32,530 mixed ancestry Bos taurus cows. Bayesian genome-wide association mapping using markers imputed from the Illumina BovineHD chip revealed a large quantitative trait locus (QTL for milk fat percentage on chromosome 27, present in both populations. We also investigated a range of other milk composition phenotypes, and report additional associations at this locus for fat yield, protein percentage and yield, lactose percentage and yield, milk volume, and the proportions of numerous milk fatty acids. We then used mammary RNA sequence data from 212 lactating cows to assess the transcript abundance of genes located in the milk fat percentage QTL interval. This analysis revealed a strong eQTL for AGPAT6, demonstrating that high milk fat percentage genotype is also additively associated with increased expression of the AGPAT6 gene. Finally, we used whole genome sequence data from six F1 sires to target a panel of novel AGPAT6 locus variants for genotyping in the F2 crossbreed population. Association analysis of 58 of these variants revealed highly significant association for polymorphisms mapping to the 5'UTR exons and intron 1 of AGPAT6. Taken together, these data suggest that variants affecting the expression of AGPAT6 are causally involved in differential milk fat synthesis, with pleiotropic consequences for a diverse range of other milk components.

  20. SNPs Detection of Transmembrane Protein 18 Gene (TMEM18) and Its Asscoation with Growth Traits in Jiaxian Red Cattle(Bos taurus)%郏县红牛跨膜蛋白18基因(TMEM18)SNPs检测及其与生长性状的关联分析

    Institute of Scientific and Technical Information of China (English)

    马伟; 马云; 刘栋; 高远; 王居强; 陈宏

    2013-01-01

    跨膜蛋白18基因(Transmembrane protein 18,TMEM18)在神经系统表达.全基因组关联分析(GWAS)表明,该基因的突变会影响人类肥胖和Body Mass Index(BMI)值变化.本研究采用DNA池测序技术检测了郏县红牛(Bos taurus) TMEM18基因5个外显子和部分内含子区单核苷酸多态(single nucleotide polymorphism,SNP)位点,通过PCR-RFLP技术对所发现的SNP位点进行分型验证,然后分析不同基因型与郏县红牛生长性状的关联性.结果表明,在郏县红牛TMEM18基因上共发现了3处新的SNPs:NW_003099175.1∶g.2303G>A、g.3835 G>A和g.3865 A>G(aa.Gly>Ser).关联分析结果表明,郏县红牛TMEM18基因g.2303G>A位点AA型个体体高、体长、胸围和体重显著大于GG型(P<0.05),郏县红牛TMEM18基因g.3835 G>A位点AG型个体胸围和体重显著大于AA型(P<0.05).研究结果提示,这两个位点可作为郏县红牛品种体尺和体重生长性状选择的分子育种候选标记.%Transmembrane protein 18 gene(TAEM18) is expressed in the central nervous system that has recently been linked to human obesity and body mass index (BMI) in genome wide association studies (GWAS). In this study, direct DNA pool sequencing and polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) methods were used to genotype novel SNPs in TMEM18 gene, and then analyzed associations between different genotypes and growth traits in Jiaxian Red cattle (Bos taurus). Three novel SNPs were detected in Jiaxian Red cattle TMEM18 gene: NW_003099175.1: g. 2303G>A, g. 3835 G>A and g. 3865 A>G (aa. Gly>Ser). Significant association analysis revealed that the individuals with genotype AA had a larger body height, body length, heart girth and body weight than that of the individuals with genotypes GG at g.2303 A>G locus (P>0.05), The result also suggested that the individuals with genotype AG had a larger body weight and heart girth than that of the individuals with genotype AA at g

  1. Chemical compositions, free amino acid contents and antioxidant activities of Hanwoo (Bos taurus coreanae) beef by cut

    Science.gov (United States)

    The objective of this study was to evaluate chemical compositions, free amino acid contents, and antioxidant activities of different cuts of Hanwoo (Bos taurus coreanae) beef. Beef preferences and prices in the Korean market depend on cut. Therefore, comparisons were made between high-preference (gr...

  2. Profiling of sperm gene transcripts in crossbred (Bos taurus x Bos indicus) bulls.

    Science.gov (United States)

    H M, Yathish; Kumar, Subodh; Dubey, Prem P; Modi, Rajendra P; Chaudhary, Rajni; A, Siva Kumar; Ghosh, Subrata K; Sarkar, Mihir; B, Sivamani

    2017-02-01

    Crossbred cattle in some sectors of the world have a significant role in enhancing milk production thereby enhancing the per capita milk availability as a human food source. However, there are certain constraints associated with crossbred animals, such as disease susceptibility, increased reproductive problems, repeat breeding and poor seminal quality. The semen of crossbred bulls has a poor freezing capacity, increased cryo-damage, poor mass cell motility, greater percentages of dead/abnormal sperm and poor initial and post-freeze cell motility. The rejection rate of crossbred bulls for cryostorage of semen has been reported to be as great as 50% as a result of unacceptable semen quality. The identification of superior bulls using molecular technologies is needed which necessitates identification of the genes having a role in sperm function. The present study was, therefore, conducted to gain information on identification and expression of genes having a role in sperm motility in crossbred bulls. The gene transcripts in bulls with sperm of superior and inferior quality were profiled in Vrindavani crossbred cattle by microarray analyses and the results were verified by real time-quantitative PCR. Microarray analyses revealed 19,454 genes which were differentially expressed. At a two-fold cut off, 305 genes were differentially (Pbulls with superior motility.

  3. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  4. Hormonal induction of estrous cycles in anestrous Bos taurus beef cows.

    Science.gov (United States)

    Day, M L

    2004-07-01

    A significant proportion of postpartum beef cows are anestrus at the onset of the breeding season. Much progress has been made in understanding anestrus and the changes that lead to spontaneous resumption of reproductive function. Likewise, knowledge regarding the impact of hormonal interventions on the endocrine and ovarian changes normally associated with spontaneous resumption of estrous cycles continue to accumulate. A wide range of hormonal treatment programs designed to induce estrous cycles in anestrous cows to coincide with the start of the breeding season have been developed. Programs structured to provide for increased progesterone, estradiol and LH concentrations at the appropriate times during the period leading to the first ovulation, and an induced preovulatory gonadotropin surge when the dominant ovarian follicle is of appropriate maturity have been demonstrated to induce estrous cycles of normal duration and acceptable fertility in a majority of anestrous, Bos taurus beef cows.

  5. Acquisition and expression of resistance by Bos indicus and Bos indicus X Bos taurus calves to Amblyomma americanum infestation.

    Science.gov (United States)

    George, J E; Osburn, R L; Wikel, S K

    1985-04-01

    Purebred and crossbred Bos indicus calves were infested 1, 2, or 3 times with 10 female and 5 male Amblyomma americanum. Resistance was acquired by both the purebred and the crossbred calves after 1 infestation and resulted in statistically significant decreases in the percentages of females that engorged, the mean weights of engorged females, and the mean weights of egg masses. Comparisons between breeds of the percent of female ticks that engorged during the first and second infestations indicate that purebred B. indicus expressed a stronger acquired resistance to A. americanum more readily than did crossbred animals. However, calves of both genetic compositions displayed similar levels of resistance during a third exposure. All tick-exposed and control animals were skin tested with salivary gland extracts of A. americanum, A. cajennense and Dermacentor andersoni. Control, uninfested calves, did not display significant cutaneous reactivity to these extracts. All calves that had been infested had immediate, 30-min, 5-hr and delayed, 24-hr, skin reactions to Amblyomma species antigens. Reactions to D. andersoni salivary antigens in tests of both purebred and crossbred calves with acquired resistance to A. americanum suggest that Amblyomma species salivary gland antigens might have cross reactive moieties with a salivary extract prepared from D. andersoni. Peripheral blood lymphocyte in vitro responsiveness to Amblyomma species antigens was detected in purebred calves after a first, second, and third infestation, indicating the presence of cells of the immune system capable of recognizing and undergoing blast transformation in response to tick salivary components.(ABSTRACT TRUNCATED AT 250 WORDS)

  6. 腺病毒介导的秦川牛固醇调节元件结合蛋白2基因(SREBP2)过表达载体的构建与鉴定%Construction and Identification of Recombinant Adenovirus Vector Specific to Qinchuan Cattle(Bos taurus) Derived Sterol Regulatory Element Binding Protein 2 Gene (SREBP2)

    Institute of Scientific and Technical Information of China (English)

    付常振; 刘扬; 昝林森; 王虹; 成功; 王嘉力

    2013-01-01

    Sterol regulatory element binding protein 2(SERBP2) is a basic-helix-loop-helix-luecine zipper factor which regulates the metabolization process of cholesterol.We cloned the SREBP2 gene from Qinchuan cattle (Bos taurus) and constructed the overexpression adenoviral vector,and packed and amplified the virus for a high titer,as a antecedent work for the further study of cellular level function of SERBP2 gene.Total RNA was extracted from the adipose tissue of Qinchuan cattle and then reversely transcripted to cDNA.A pair of exclusive primers were designed according to the GenBank sequence information of SREBP2 gene(Accession No.NM_001205600) to amplify the complete coding sequence(CDS) area of SREBP2 gene by polymerase chain reaction (PCR).The fragments containing CDS area of SREBP2 gene were inserted into the shuttle vector to construct the pAdTrack-CMV-SREBP2 plasmid.The recombinant plasmid and the blank control pAdTrack-CMV were linearized by digesting with restriction endonuclease Pine Ⅰ and subsequently transformed into Escherichia coli B J5183 containing pAdEasy-1 to homologous recombine and obtain the recombinant adenovirus plasmid pAd-SREBP2 and pAd-CMV.And then,the confirmed recombinant adenovirus plasmid pAd-SREBP2 was digested with Pac Ⅰ and transfected into 293A cell line to package and amplify the recombinant adenovirus Ad-SREBP2 and Ad-CMV,and to collect virus of high titer.The viral titer of AdSREBP2 and Ad-CMV was 7 × 108 and 1.3 × 109 GFU/mL respectively,measured by green fluorescent protein (GFP) labelled method.Qinchuan cattle derived preadipocyte was infected by Ad-SREBP2 and Ad-CMV to verify the availability of the virues.The expression of SREBP2 increased by 102.3 times after infected with the recombinant adenovirus for 48 h,determined by quantitative Real-time PCR.The cloning of SERBP2 gene of Qinchuan cattle obtaining of recombinant adenoviru and virus of high titer are set as foundation for the studies of the gene function on cellular

  7. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Directory of Open Access Journals (Sweden)

    Cristina Ballarin

    Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  8. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  9. Resposta imunológica contra gonadotrofina coriônica equina (eCG) em novilhas Bos taurus e Bos indicus

    OpenAIRE

    Ana Paula Mantovani

    2010-01-01

    O presente trabalho foi realizado em duas etapas experimentais. O objetivo do Experimento 1 foi avaliar o perfil de produção de anticorpos anti-eCG em novilhas Bos taurus e Bos indicus tratadas uma, duas ou três vezes, com 400 e com 2000UI de eCG. O experimento foi realizado em duas réplicas com o mesmo desenho experimental, porém com padrões raciais distintos. Os animais foram divididos em 6 grupos: os grupos eCG2000UI_1x (n = 5), eCG2000UI_2x (n = 5) e eCG2000UI_3x (n = 5) receberam, respe...

  10. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  11. A cytoarchitectonic and myeloarchitectonic study of the insular cortex of the bull, Bos taurus.

    Science.gov (United States)

    Russo, Domenico; Paparcone, Rosa; Genovese, Angelo

    2008-01-01

    The mammalian Insula is characterised by considerable morphologic variability, however, it shows a cytoarchitectonic homogeneity within the species so far studied. Three cytoarchitectonic areas are generally recognisable in the Insula: an "agranular", a "dysgranular" and a "granular" area. The numerous functions attributed to the Insula (visceral sensory, visceral motor, somatosensorial, supplementary motor area, area speech and/or language related, etc.) have recently attracted renewed interest. Considering the involvement of the Insula in the control of gastroenteric motility and the structural and functional complexity of this region in ruminants, it seemed interesting to analyse the cyto- and myelo-architectonic arrangement of the Insula of the bull, Bos taurus. Unlike that of the other species described, all the insular Neocortex of the bull, is of the "agranular" type. The latter includes at least four variants that differ according to the organisation of the cortical layer pattern. Considering the available evidence in laboratory animals and primates of a role played by the agranular insular cortex in gastroenteric motility control, the trademark presence of a very much extended insular agranular cortex in the Insula of the bull may be related to the necessity of motor activity control of a gastroenteric complex that is extensively more developed than in the monogastric species.

  12. Bovine Genome Database: new tools for gleaning function from the Bos taurus genome.

    Science.gov (United States)

    Elsik, Christine G; Unni, Deepak R; Diesh, Colin M; Tayal, Aditi; Emery, Marianne L; Nguyen, Hung N; Hagen, Darren E

    2016-01-01

    We report an update of the Bovine Genome Database (BGD) (http://BovineGenome.org). The goal of BGD is to support bovine genomics research by providing genome annotation and data mining tools. We have developed new genome and annotation browsers using JBrowse and WebApollo for two Bos taurus genome assemblies, the reference genome assembly (UMD3.1.1) and the alternate genome assembly (Btau_4.6.1). Annotation tools have been customized to highlight priority genes for annotation, and to aid annotators in selecting gene evidence tracks from 91 tissue specific RNAseq datasets. We have also developed BovineMine, based on the InterMine data warehousing system, to integrate the bovine genome, annotation, QTL, SNP and expression data with external sources of orthology, gene ontology, gene interaction and pathway information. BovineMine provides powerful query building tools, as well as customized query templates, and allows users to analyze and download genome-wide datasets. With BovineMine, bovine researchers can use orthology to leverage the curated gene pathways of model organisms, such as human, mouse and rat. BovineMine will be especially useful for gene ontology and pathway analyses in conjunction with GWAS and QTL studies.

  13. Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

    Science.gov (United States)

    Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

    2012-10-01

    Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P temperament. Cows with aggressive temperament had reduced (P ≤ 0.05) pregnancy and calving rate and tended to have reduced (P = 0.09) weaning rate compared with cows with adequate temperament. Hence, kilogram of calf born per cow was reduced (P = 0.05) and kilogram of calf weaned per cow tended to be reduced (P = 0.08) in aggressive cows. In Exp. 2, 88 Angus × Hereford heifers (initial age = 206 ± 2 d) were weighed (d 0 and 10) and evaluated for temperament score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0

  14. Sequenciamento e análise dos genes das subunidades alfa e beta do hormônio folículo estimulante de bovino (Bos taurus indicus Sequencing and analysis of subunits alpha and beta of the follicle stimulating hormone from bovine (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Luci Sayori Murata

    2008-07-01

    Full Text Available

    Este trabalho relata uma clonagem e seqüenciamento das subunidades alfa e beta do hormônio folículo estimulante de Bos taurus indicus. Também apresenta os resultados de comparação realizada das seqüências gênicas dessas cadeias com as seqüências das cadeias alfa e beta do FSH de suínos e da cadeia beta de bovinos Bos taurus taurus já presentes no GenBank. Na comparação das seqüências de nucleotídeos e de aminoácidos predita da cadeia αFSH de Bos taurus indicus com as cadeias αFSH de outras espécies como suínos e búfalo (Bubalis bubalis, observou-se que as seqüências são bastante similares. A comparação da seqüência da subunidade αFSH de Bos taurus indicus com a de suíno demonstrou diferenças em três resíduos de aminoácidos. Na comparação com ßFSH, registrou-se modificação na primeira base do codon que levou à alteração no resíduo do aminóacido 83, que, em Bos taurus indicus, é uma glicina, ao invés da serina presente em Bos taurus taurus. Confirmaram-se essa modificação e todas as outras identificadas na seqüência dos cDNA das cadeias αFSH e βFSH em outra clonagem. A modificação Ser para Gly na posição 83 foi a única que alterou a identidade do resíduo de aminoácido na comparação entre as subunidades beta do FSH de Bos taurus indicus e Bos taurus taurus. Contudo, ela não deve alterar significativamente as propriedades fisiológicas do FSH, uma vez que o resíduo de glicina encontrado nessa posição também é encontrado na cadeia βFSH suína. Trata-se, portanto, de uma modificação particular que distingue as cadeias βFSH de B. taurus taurus e B. taurus indicus.

     

    PALAVRAS-CHAVES: Bovino, clonagem, FSH, hormônio.

    The aim this work was to promove the cloning and analysis sequencing

  15. Rendimiento de la canal en búfalos de río (Bubalus bubalis y Bovinos mestizos (Bos indicus x Bos taurus en el Municipio Bayazo - Canal performance in river buffaloes (Bubalus bubalis and mixed racial bovines (Bos indicus x Bos taurus in the Bayamo Municipality

    Directory of Open Access Journals (Sweden)

    Ramírez Reyes, B

    2010-07-01

    Full Text Available ResumenCon el objetivo de determinar algunas características de rendimientoen canales bufalinas (Bubalus bubalis de animales procedentes delCentro de Ceba El Progreso y compararlas con canales vacunas (Bosindicus x Bos taurus comercializadas, se desarrolló esta investigación en el matadero Jucaibama. Se trabajaron 60 animales enteros de cada especie con edades entre 24 y 32 meses, a los cuales se les determinaron los siguientes parámetros: peso de embarque (Kg.(PE, peso vivo reposo (PV (Kg. peso de la canal en kg. (PC,rendimiento en carne en kg. (RC, rendimiento en carne de primera enKg. (RC1 y rendimiento en carne de segunda en Kg. (RC2. Losresultados fueron para (PE 543,43 y 489,92 arrojando el análisisdiferencias altamente significativas, al igual que para las (PV y (PC que fueron de 527,12 y 474,15; 271,52 y 244,83 para búfalos yvacunos respectivamente. Las variables (RC, (RC1 y (RC2 nomostraron diferencias significativas, sus valores fueron 167,37 y171,93; 88,7 y 91,12; 76,66 y 78,74 para canales bubalinas yvacunas. Se concluye que los búfalos presentaron pesos mayores alsacrificio y de canal que los vacunos evaluados. El búfalo presentómayores rendimientos en carne, parámetros que indican que tiene laposibilidad de desarrollar mayor masa muscular que sus competidoresvacunos.SummaryThis research was carried out in the drudgery Jucaibama of determining some quality characteristics in the buffaloes meat(Bubalus bubalis of animal that belong to the feeding place ElProgreso. These characteristics are compare with the ones of the beefcattle (Bos indicus x taurus that are commercialized. 60 whole maleanimals of each species were taken as sample. They were about 24and 32 months old and they were determine the following parameters:Shipment weight (Kg., weight after twelve hours, meat weight, meatservility and servility of the best showed highly significant differences, just as the ones for (PV and (PC whose results were 527,12 and 474

  16. Assessment of the genetic relationship between Dictyocaulus species from Bos taurus and Cervus elaphus using complete mitochondrial genomic datasets

    Directory of Open Access Journals (Sweden)

    Gasser Robin B

    2012-10-01

    Full Text Available Abstract Background Dictyocaulus species are strongylid nematodes of major veterinary significance in ruminants, such as cattle and cervids, and cause serious bronchitis or pneumonia (dictyocaulosis or “husk”. There has been ongoing controversy surrounding the validity of some Dictyocaulus species and their host specificity. Here, we sequenced and characterized the mitochondrial (mt genomes of Dictyocaulus viviparus (from Bos taurus with Dictyocaulus sp. cf. eckerti from red deer (Cervus elaphus, used mt datasets to assess the genetic relationship between these and related parasites, and predicted markers for future population genetic or molecular epidemiological studies. Methods The mt genomes were amplified from single adult males of D. viviparus and Dictyocaulus sp. cf. eckerti (from red deer by long-PCR, sequenced using 454-technology and annotated using bioinformatic tools. Amino acid sequences inferred from individual genes of each of the two mt genomes were compared, concatenated and subjected to phylogenetic analysis using Bayesian inference (BI, also employing data for other strongylids for comparative purposes. Results The circular mt genomes were 13,310 bp (D. viviparus and 13,296 bp (Dictyocaulus sp. cf. eckerti in size, and each contained 12 protein-encoding, 22 transfer RNA and 2 ribosomal RNA genes, consistent with other strongylid nematodes sequenced to date. Sliding window analysis identified genes with high or low levels of nucleotide diversity between the mt genomes. At the predicted mt proteomic level, there was an overall sequence difference of 34.5% between D. viviparus and Dictyocaulus sp. cf. eckerti, and amino acid sequence variation within each species was usually much lower than differences between species. Phylogenetic analysis of the concatenated amino acid sequence data for all 12 mt proteins showed that both D. viviparus and Dictyocaulus sp. cf. eckerti were closely related, and grouped to the exclusion of

  17. A novel application of ecological analyses to assess transposable element distributions in the genome of the domestic cow, Bos taurus.

    Science.gov (United States)

    Saylor, Brent; Elliott, Tyler A; Linquist, Stefan; Kremer, Stefan C; Gregory, T Ryan; Cottenie, Karl

    2013-09-01

    Transposable elements (TEs) are among the most abundant components of many eukaryotic genomes. Efforts to explain TE abundance, as well as TE diversity among genomes, have led some researchers to draw an analogy between genomic and ecological processes. Adopting this perspective, we conducted an analysis of the cow (Bos taurus) genome using techniques developed by community ecologists to determine whether environmental factors influence community composition. Specifically, each chromosome within the Bos taurus genome was treated as a "linear transect", and a multivariate redundancy analysis (RDA) was used to identify large-scale spatial patterns in TE communities associated with 10 TE families. The position of each TE community on the chromosome accounted for ∼50% of the variation along the chromosome "transect". Multivariate analysis further revealed an effect of gene density on TE communities that is influenced by several other factors in the (genomic) environment, including chromosome length and TE density. The results of this analysis demonstrate that ecological methods can be applied successfully to help answer genomic questions.

  18. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers.

  19. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: I. Birth and weaning traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) and Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves, belonging to 28 full-sib families, were evaluated for differences in birth weight, gestation length, and weaning weight. Two methods were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished between the 2 types of F(1) parents (AB vs. BA corresponding to A x B vs. B x A, respectively). Bos indicus backcross calves had a 4.3 d longer (P gestation length but did not differ in their average birth weight from A backcrosses. Among B backcrosses, B x F(1) calves had a 5.2 d longer (P = 0.01) gestation length than F(1) x B calves (290.5 vs. 285.3, respectively). Under method II analysis, there was a consistent trend for gestation length, in which BA F(1) parents produced calves that ranked greater than calves from AB F(1) parents, as sires and dams. Crosses with a greater proportion of B in the sire in relation to the amount in the dam had a heavier (P 0.10) in birth weight between males and females (1.5 and 1.1 kg, respectively). Further examination within each sex showed a difference between male reciprocals that was generally much larger than that between female reciprocals. Calves with a greater percentage of B in the sire compared with the proportion in the dam ranked heavier for weaning weight as for birth weight, though these differences were not significant. In breeding systems involving B x Bos taurus crosses, even when using embryo transfer, not only does the breed composition of the calves affect their preweaning performance, but the particular cross that produces the calves also should be considered in making breeding decisions.

  20. Clínica e hematologia de Bos indicus, Bos taurus e Bubalus bubalis inoculados com oocistos de Toxoplasma gondii (Apicomplexa: Toxoplasmatinae

    Directory of Open Access Journals (Sweden)

    Oliveira Francisco Carlos Rodrigues de

    2001-01-01

    Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2,0 x 10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. As alterações clínicas surgidas a partir do 3º dia após inoculação (DAI foram: hipertermia, taquicardia, taquipnéia, anorexia, prostração, corrimento nasal e lacrimejamento. Estes sinais foram mais evidentes nos taurinos, espécie que apresentou, ainda, diarréia, fotofobia e conjuntivite. Foi possível isolar T. gondii da corrente sangüínea em todas as espécies. Nos taurinos, a partir do 5º DAI até o final do experimento, o parasito foi isolado de todas as amostras de sangue colhidas semanalmente, com exceção do 14º, 35º e 63º DAI. Os bubalinos apresentaram parasitemia no 7º, 14º, 35º e 70º DAI e os zebuínos apenas no 7º e 28º DAI, correspondendo aos picos de temperatura, em todas as espécies, sendo mais evidente em taurinos. Os parâmetros clínico-laboratoriais demonstraram que os taurinos foram mais sensíveis ao T. gondii do que os zebuínos e estes não diferiram significativamente dos bubalinos, que tiveram aparente normalidade clínico-laboratorial.

  1. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  2. Eficácia do tratamento Ovsynch associado à inseminação artificial prefixada em rebanhos Bos taurus e Bos indicus Efficacy of the Ovsynch treatment associated to fixed-time artificial insemination in Bos taurus and Bos indicus herds

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2003-02-01

    Full Text Available O presente trabalho objetivou avaliar a eficácia do tratamento Ovsynch associado à inseminação artificial em tempo prefixado em vacas Bos taurus e Bos indicus. Foram utilizados rebanhos das raças Holandesa, Caracu, Nelore e Mantiqueira. Também foi incluído um rebanho de vacas Gir, com problemas de fertilidade. Cada rebanho foi dividido em três grupos. O grupo 1 recebeu o tratamento Ovsynch e foi inseminado em tempo prefixado. O grupo 2 foi inseminado no cio induzido com cloprostenol. O grupo 3 foi inseminado no cio natural. As taxas de concepção e de prenhez foram determinadas por ultra-sonografia. Não existiu interação significativa das variáveis reprodutivas analisadas para rebanho, idade, período pós-parto, número de parição e presença do bezerro. A taxa de concepção não diferiu (P>0,05 entre os grupos, ao passo que a taxa de prenhez foi superior (PThe present study aimed to evaluate the efficiency of Ovsynch treatment associated with prefixed-time artificial insemination on Bos taurus and Bos indicus cows. Herds of Holstein, Caracu, Nelore and Mantiqueira breeds were used. A herd of Gir cows with poor reproductive performance was also included. Each breed was divided in tree groups. Group 1 received Ovsynch treatment and was inseminated at prefixed time. Group 2 was induced to estrus with cloprostenol and inseminated thereafter. Group 3 was inseminated at natural heat. Conception and pregnancy rates were determined by ultra-sound. No significant interactions were detected among breeds, age, parity, postpartum period and lactating cows with or without their calves. Conception rates did not differ (P>0.05 among groups while pregnancy rate was higher (P<0.05 for group 1 and 2 comparing to group 3. In the Gir herd Ovsynch treatment did not enhance conception nor pregnancy rates. Independently of breed, conception rate is similar after Ovsynch, cloprostenol and control treatments, and pregnancy rate can be improved with

  3. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  4. Gestation length, birth weight and offspring gender ratio of in vitro-produced Gyr (Bos indicus) cattle embryos.

    Science.gov (United States)

    Camargo, Luiz Sergio Almeida; Freitas, Celio; de Sa, Wanderlei Ferreira; de Moraes Ferreira, Ademir; Serapiao, Raquel Varela; Viana, João Henrique Moreira

    2010-07-01

    In vitro embryo production (IVP) has been suggested to result in a greater proportion of male calves, longer gestation and heavier offspring than artificial insemination in Bos taurus cattle. Despite the increasing use of IVP in tropical countries, its effects upon these traits in Bos indicus have not been conclusively investigated. Gyr is a B. indicus dairy breed with known physiological differences from B. taurus, such as a longer gestation period and lighter offspring. The aim of this study was to evaluate the effect of IVP on gestation length, birth weight and gender ratio in Gyr offspring. Oocytes were recovered from Gyr cows by ovum pick-up and were matured and fertilized with thawed Gyr semen in vitro. Embryos were cultured in CR2aa medium with cumulus cells and 10% fetal calf serum under 5% CO(2) at 38.5 degrees C in air. Seven- to eight-day blastocysts were transferred to synchronized recipients. Data on gestation length and birth weight of calves from in vitro-produced embryos were compared to data obtained from Gyr calves produced by artificial insemination (AI) and natural breeding (NB) during the same period using analysis of variance, and the gender ratio was compared to the expected 1:1 ratio using a chi-square test. IVP increased (P0.05) was observed in the AI and NB groups. Gestation length was similar (P>0.05) between the IVP and AI groups, but IVP-derived offspring were heavier (P<0.05) than AI- and NB-derived ones, mainly for male calves (P<0.05). These data show that in vitro production affects the subsequent development of Gyr embryos, resulting in a skewed sex ratio and increased birth weight.

  5. Sperm DNA assays and their relationship to sperm motility and morphology in bulls (Bos Taurus).

    Science.gov (United States)

    Serafini, Rosanna; Romano, Juan E; Varner, Dickson D; Di Palo, Rossella; Love, Charles C

    2015-08-01

    The relationship among sperm DNA assays in bulls with different sperm motility and morphology measures has not been reported. The objectives of the present study were to (1) describe Comet assay measures and examine their repeatability (inter- and intra-assay); (2) compare sperm DNA quality assays (i.e., Sperm Chromatin Structure Assay-SCSA; alkaline and neutral Comet assays and Sperm Bos Halomax assay-SBH) in two groups of bulls selected on either greater and lesser sperm motility and morphology (greater compared with lesser); (3) determine the relationship among DNA assays and sperm motility and morphology values. Inter-assay repeatability was greater for the neutral Comet assay as compared to the alkaline Comet assay. Intra-assay repeatability was greater than inter-assay repeatability for both Comet assays. Comet assay dimension measures and percentage tail DNA were the most repeatable for both Comet assays. Among sperm DNA quality assays, only SCSA measures and neutral Comet assay Ghosts (% Ghosts), head diameter and area, and comet area were different between greater and lesser sperm quality groups (P<0.05). The SCSA measures were inversely correlated with neutral Comet head measures (diameter, area, and intensity) and positively with percentage Ghosts (P<0.05). The % Ghosts and COMP-αt were correlated with some measures of sperm morphology and sperm motility. The neutral Comet assay was more appropriate for sperm evaluation than the alkaline Comet assay for distinguishing among groups with different sperm quality.

  6. Hábitos de amamantamiento del ganado bovino Chinampo (Bos taurus de México

    Directory of Open Access Journals (Sweden)

    José Espinoza V.

    2011-12-01

    Full Text Available Objetivo. Conocer los hábitos de amamantamiento de becerros Chinampos (Bos taurusen diferentes etapas de su lactancia. Materiales y métodos. Se utilizaron 20 vacas con su cría. A partir de los 30 hasta los 180 días de la lactancia los animales fueron observados durante 24 horas continuas cada mes registrando la frecuencia con la que los becerros mamaron y la duración de cada amamantamiento. Resultados. Los becerros mamaron con mayor frecuencia entre las 06:00 y las 07:00 hr, se observaron otros picos a las 10:00 y a las 19:00 hr. La frecuencia promedio de amamantamiento en 24 horas fue de 4.9±0.21utilizando un total de 66.9 ± 3.1 minutos. Los becerros de 180 días de edad mamaron menos veces comparados con los de edades inferiores a los 150 días; la duración del amamantamiento disminuyó a los 180 días de edad (p0.05. Conclusiones. La frecuencia de amamantamientos es mayor durante las primeras horas de la mañana y al final de la tarde. Hasta los 5 meses de edad la frecuencia y el tiempo de amamantamiento no variaron pero se redujeron a los180 días y las hembras mamaron con más periodicidad que los machos.

  7. Respiratory Complex I in Bos taurus and Paracoccus denitrificans Pumps Four Protons across the Membrane for Every NADH Oxidized.

    Science.gov (United States)

    Jones, Andrew J Y; Blaza, James N; Varghese, Febin; Hirst, Judy

    2017-03-24

    Respiratory complex I couples electron transfer between NADH and ubiquinone to proton translocation across an energy-transducing membrane to support the proton-motive force that drives ATP synthesis. The proton-pumping stoichiometry of complex I (i.e. the number of protons pumped for each two electrons transferred) underpins all mechanistic proposals. However, it remains controversial and has not been determined for any of the bacterial enzymes that are exploited as model systems for the mammalian enzyme. Here, we describe a simple method for determining the proton-pumping stoichiometry of complex I in inverted membrane vesicles under steady-state ADP-phosphorylating conditions. Our method exploits the rate of ATP synthesis, driven by oxidation of NADH or succinate with different sections of the respiratory chain engaged in catalysis as a proxy for the rate of proton translocation and determines the stoichiometry of complex I by reference to the known stoichiometries of complexes III and IV. Using vesicles prepared from mammalian mitochondria (from Bos taurus) and from the bacterium Paracoccus denitrificans, we show that four protons are pumped for every two electrons transferred in both cases. By confirming the four-proton stoichiometry for mammalian complex I and, for the first time, demonstrating the same value for a bacterial complex, we establish the utility of P. denitrificans complex I as a model system for the mammalian enzyme. P. denitrificans is the first system described in which mutagenesis in any complex I core subunit may be combined with quantitative proton-pumping measurements for mechanistic studies.

  8. Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

    OpenAIRE

    Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

    2016-01-01

    En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

  9. Ecología del lobo (Canis lupus), del poni salvaje (Equus ferus atlanticus) y del ganado vacuno semiextensivo (Bos taurus) en Galicia: interacciones depredador - presa

    OpenAIRE

    2013-01-01

    La población de lobo (Canis lupus) de Galicia constituye aproximadamente un tercio de la población española. En gran parte del oeste y centro de Galicia, los lobos coexisten con ponis salvajes (Equus ferus atlanticus) y el ganado vacuno semiextensivo (Bos taurus) es otro de los principales recursos tróficos disponibles. En estas zonas se presume un importante nivel de depredación de lobo sobre ponis salvajes y ganado vacuno semiextensivo, pero estas interacciones depredador-presa no habían si...

  10. Genomic structure, organisation, and promoter analysis of the bovine (Bos taurus) Mx1 gene.

    Science.gov (United States)

    Gérardin, Joël A; Baise, Etienne A; Pire, Grégory A; Leroy, Michaël P-P; Desmecht, Daniel J-M

    2004-02-04

    Some MX proteins are known to confer a specific resistance against a panel of single-stranded RNA viruses. Many diseases due to such viruses are known to affect cattle worldwide, raising the possibility that the identification of an antiviral isoform of a bovine MX protein would allow the implementation of genetic selection programs aimed at improving innate resistance of cattle. With this potential application in mind, the present study was designed to isolate the bovine Mx1 gene including its promoter region and to investigate its genomic organisation and promoter reactivity. The bovine Mx1 gene is made up of 15 exons. All exon-intron boundaries conformed to the consensus sequences. A PCR product that contained a approximately 1-kb, 5'-flanking region upstream from the putative transcription start site was sequenced. Unexpectedly, this DNA region did not contain TATA or CCAAT motifs. A computer scan of the region disclosed a series of putative binding sites for known cytokines and transcription factors. There was a GAAAN(1-2)GAAA(C/G) motif, typical of an interferon-sensitive responsive element, between -118 and -107 from the putative transcription start site. There were also a NF-kappaB, two interleukin-6 binding sites, two Sp1 sites and five GC-rich boxes. The region also contained 12 stretches of the GAAA type, as described in all IFN-inducible genes. Bovine Mx1 expression was assessed by Northern blotting and immunofluorescence in the Madin Darby bovine kidney cells (MDBK) cell line treated with several stimuli. In conclusion, the bovine Mx1 gene and promoter region share the major structural and functional characteristics displayed by their homologs described in the rainbow trout, chicken, mouse and man.

  11. Expansion of the preimmune antibody repertoire by junctional diversity in Bos taurus.

    Directory of Open Access Journals (Sweden)

    Jenni Liljavirta

    Full Text Available Cattle have a limited range of immunoglobulin genes which are further diversified by antigen independent somatic hypermutation in fetuses. Junctional diversity generated during somatic recombination contributes to antibody diversity but its relative significance has not been comprehensively studied. We have investigated the importance of terminal deoxynucleotidyl transferase (TdT -mediated junctional diversity to the bovine immunoglobulin repertoire. We also searched for new bovine heavy chain diversity (IGHD genes as the information of the germline sequences is essential to define the junctional boundaries between gene segments. New heavy chain variable genes (IGHV were explored to address the gene usage in the fetal recombinations. Our bioinformatics search revealed five new IGHD genes, which included the longest IGHD reported so far, 154 bp. By genomic sequencing we found 26 new IGHV sequences that represent potentially new IGHV genes or allelic variants. Sequence analysis of immunoglobulin heavy chain cDNA libraries of fetal bone marrow, ileum and spleen showed 0 to 36 nontemplated N-nucleotide additions between variable, diversity and joining genes. A maximum of 8 N nucleotides were also identified in the light chains. The junctional base profile was biased towards A and T nucleotide additions (64% in heavy chain VD, 52% in heavy chain DJ and 61% in light chain VJ junctions in contrast to the high G/C content which is usually observed in mice. Sequence analysis also revealed extensive exonuclease activity, providing additional diversity. B-lymphocyte specific TdT expression was detected in bovine fetal bone marrow by reverse transcription-qPCR and immunofluorescence. These results suggest that TdT-mediated junctional diversity and exonuclease activity contribute significantly to the size of the cattle preimmune antibody repertoire already in the fetal period.

  12. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    Directory of Open Access Journals (Sweden)

    Schreiber Mark

    2006-11-01

    Full Text Available Abstract Background Single nucleotide polymorphisms (SNPs are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence tagged (EST sequences were used to search for coding SNPs (cSNPs. A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P Conclusion We have identified 15,353 putative SNPs in or close to bovine genes and 2,868 of these SNPs were predicted to be non-synonymous. Approximately 29% of the non-synonymous SNPs were polymorphic and common with a minor allele frequency >10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  13. Distribution of BoLA-DRB3 allelic frequencies and identification of a new allele in the iranian cattle breed sistani (Bos indicus).

    Science.gov (United States)

    Mohammadi, A; Nassiry, M R; Mosafer, J; Mohammadabadi, M R; Sulimova, G E

    2009-02-01

    The distribution of the frequencies of BoLA-DRB3 gene alleles in the Iranian cattle breed Sistani was studied by the PCR-RFLP ("hemi-nested") assay using restriction endonucleases RsaI, HaeIII and BstYI. In the examined cattle breed (65 animals) 32 alleles have been identified one of which being described for the first time (6.15% frequency). The nucleotide sequence of the polymorphic region of exon 2 of this allele has been determined and submitted in the GeneBank database under accession number DQ486519. The submitted sequence has maximum homology (92%) with the previously described sequence DRB3-mRNA from Bos indicus (AccN X79346) and differs from it by 24 nucleotide substitutions which result in 16 amino acid substitutions. The peptide (on the basis of the reconstructed amino acid sequence) has 89% identity to the sequence encoded by the BIDRBF 188 locus (Bos indicus). The results obtained permit the sequence described by us to be considered as a new allele of the BoLA-DRB3 gene (DRB3.2**X). The total frequency of the main six alleles (DRB3.2*X, *10, *11, *20, *34 and *X) occurring with a frequency of over 5% is about 60% in Iranian Sistani cattle. Fifteen alleles have DRB3.2*8 allele (21.54%) like in other previously described breeds of Bos indicus (up to 23.07%). The Iranian breed Sistani has a high level of similarity by the spectrum of BoLA-DRB3 alleles and their frequencies to other Bos indicus breeds and significantly differs by these criteria from the Bos taurus breeds. The Iranian Sistani herd under study includes alleles associated with to resistance to leukemia (DRB3.2*ll and *23) and to different forms of mastitis (DRB3.2*2, *7, *11, *23 and *24) although their frequencies are low (from 0.77 to 5.37%). On the whole, a high level of diversity of BoLA-DRB3 gene alleles and the availability of alleles associated with resistance to different diseases makes this breed of interest for breeding practice.

  14. Genetic diversity and population genetic analysis of bovine MHC class II DRB3.2 locus in three Bos indicus cattle breeds of Southern India.

    Science.gov (United States)

    Das, D N; Sri Hari, V G; Hatkar, D N; Rengarajan, K; Saravanan, R; Suryanarayana, V V S; Murthy, L K

    2012-12-01

    The present study was performed to evaluate the genetic polymorphism of BoLA-DRB3.2 locus in Malnad Gidda, Hallikar and Ongole South Indian Bos indicus cattle breeds, employing the PCR-RFLP technique. In Malnad Gidda population, 37 BoLA-DRB3.2 alleles were detected, including one novel allele DRB3*2503 (GenBank: HM031389) that was observed in the frequency of 1.87%. In Hallikar and Ongole populations, 29 and 21 BoLA-DRB3.2 alleles were identified, respectively. The frequencies of the most common BoLA-DRB3.2 alleles (with allele frequency > 5%), in Malnad Gidda population, were DRB3.2*15 (10.30%), DRB3*5702 (9.35%), DRB3.2*16 (8.41%), DRB3.2*23 (7.01%) and DRB3.2*09 (5.61%). In Hallikar population, the most common alleles were DRB3.2*11 (13.00%), DRB3.2*44 (11.60%), DRB3.2*31 (10.30%), DRB3.2*28 (5.48%) and DRB3.2*51 (5.48%). The most common alleles in Ongole population were DRB3.2*15 (22.50%), DRB3.2*06 (20.00%), DRB3.2*13 (13.30%), DRB3.2*12 (9.17%) and DRB3.2*23 (7.50%). A high degree of heterozygosity observed in Malnad Gidda (H(O) = 0.934, H(E) = 0.955), Hallikar (H(O) = 0.931, H(E) = 0.943) and Ongole (H(O) = 0.800, H(E) = 0.878) populations, along with F(IS) values close to F(IS) zero (Malnad Gidda: F(IS) = 0.0221, Hallikar: F(IS) = 0.0127 and Ongole: F(IS) = 0.0903), yielded nonsignificant P-values with respect to Hardy-Weinberg equilibrium probabilities revealing, no perceptible inbreeding, greater genetic diversity and characteristic population structure being preserved in the three studied cattle populations. The phylogenetic tree constructed based on the frequencies of BoLA-DRB3.2 alleles observed in 10 Bos indicus and Bos taurus cattle breeds revealed distinct clustering of specific Bos indicus cattle breeds, along with unique genetic differentiation observed among them. The results of this study demonstrated that the BoLA-DRB3.2 is a highly polymorphic locus, with significant breed-specific genetic diversities being present amongst the three studied

  15. Kappa-casein gene study in Iranian Sistani cattle breed (Bos indicus) using PCR-RFLP.

    Science.gov (United States)

    Rohallah, Alinaghizadeh; Mohammadreza, Mohammad Abadi; Shahin, Moradnasab Badrabadi

    2007-12-01

    In cattle, caseins are subdivided into four main groups: alphaS1-, alphaaS2-, beta- and kappa-caseins. kappa-caseins (CSN2) considerably differ from other caseins in structure and other properties. Testing the A and B alleles is of practical importance, because the milk of cows that carry the B allele of CSN3 has a better thermal resistance and shorter coagulation time, better curdles and contains micelles of different sizes. Iranian Sistani cattle (Bos indicus) are a heavy built breed and used as dual-purpose cattle breed in Eastern Iran. This breed is a genetic resource that shows special features of adaptation to rustic environments. One of the most distinctive features of Sistani cattle is its great capability to resist diseases which makes it a potential reservoir of germplasm useful for future crosses. Our main goal was to study DNA-polymorphism of the CSN3 gene in the Iranian Sistani native cattle (Bos indicus) and analyze the information value of CSN3 gene polymorphism as a genetic marker. We genotyped and analyzed 65 animals of this breed using PCR-RFLP. The frequencies of A and B alleles were 0.6385 and 0.3615 and those of AA, AB and BB genotypes were 0.4000, 0.4769 and 0.1231, respectively. In the Sistani Zebu breed, frequency of B allele is higher than other Zebu breeds, indicating that intensive selection for dairy production have been done and indirectly influenced CSN3 allele frequencies.

  16. Influência do pH final na bioquímica e qualidade do músculo Longissimus dorsi de animais Bos taurus indicus machos inteiros

    OpenAIRE

    Clara Lucía Contreras Baron

    2016-01-01

    O pH final (pHf) no músculo post mortem é amplamente utilizado como um indicador potencial de maciez e é um fator importante associado à qualidade de carne. O Brasil é líder mundial nas exportações de carne bovina, porém não são conhecidos os valores de pHf do músculo pós-abate e seu impacto na qualidade da carne de animais machos inteiros Bos taurus indicus. Baseado no exposto, objetivou-se com este trabalho identificar o atual \\"status\\" dos valores de pHf 24 h post mortem apresentados no f...

  17. Reproducción y producción de leche de vacas con distinta proporción de genes Bos taurus

    OpenAIRE

    2009-01-01

    El objetivo del presente estudio fue evaluar los factores ambientales y la proporción óptima de genes Bos taurus (BT) y su influencia en la producción de leche (PL) y el comportamiento reproductivo de bovinos cruzados ¾ Holstein (H) x ¼ Cebú (C); 3H1C, ¾ Suizo (S) x ¼ C; 3S1C, 1/ 2H x 1/2C; HC y 1/2S x 1/2C; SC. La información analizada se obtuvo de 276 lactancias de 69 vacas de los grupos raciales de tres hatos en Veracruz, México. Las variables estudiadas incluyeron la PL por lactancia (PTL...

  18. Influence of gender and breed type on basal and induced secretion of cortisol in cattle

    Science.gov (United States)

    To test the hypothesis that gender and breed type affect cortisol secretion, Angus (Bos taurus) and Brahman (Bos indicus) bulls (intact males), steers (castrate males), and heifers (intact females) were studied. Jugular venipuncture samples were taken from 900 cattle at: 28 days before weaning; wean...

  19. Differential passage of fluids and different-sized particles in fistulated oxen (Bos primigenius f. taurus), muskoxen (Ovibos moschatus), reindeer (Rangifer tarandus) and moose (Alces alces): rumen particle size discrimination is independent from contents stratification.

    Science.gov (United States)

    Lechner, Isabel; Barboza, Perry; Collins, William; Fritz, Julia; Günther, Detlef; Hattendorf, Bodo; Hummel, Jürgen; Südekum, Karl-Heinz; Clauss, Marcus

    2010-02-01

    Ruminant species differ in the degree that their rumen contents are stratified but are similar insofar that only very fine particles are passed from the forestomach to the lower digestive tract. We investigated the passage kinetics of fluid and particle markers (2, 10 and 20 mm) in fistulated cattle (Bos primigenius f. taurus), muskoxen (Ovibos moschatus), reindeer (Rangifer tarandus) and moose (Alces alces) on different diets. The distribution of dry matter in the rumen and the viscosity of rumen fluids suggested that the rumen contents were more stratified in muskoxen than moose. Correspondingly, as in previous studies, the species differed in the ratio of mean retention times of small particles to fluids in the reticulorumen, which was highest in cattle (2.03) and muskoxen (1.97-1.98), intermediate in reindeer (1.70) and lowest in moose (0.98-1.29). However, the ratio of large to small particle retention did not differ between the species, indicating similarity in the efficiency of the particle sorting mechanism. Passage kinetics of the two largest particle classes did not differ, indicating that particle retention is not a continuous function of particle size but rather threshold-dependent. Overall, the results suggest that fluid flow through the forestomach differs between ruminant species. A lower relative fluid passage, such as in moose, might limit species to a browse-based dietary niche, whereas a higher relative fluid passage broadens the dietary niche options and facilitates the inclusion of, or specialization on, grass. The function of fluid flow in the ruminant forestomach should be further investigated.

  20. Antibody titers to vaccination are not predictive of level of protection against a BVDV type 1b challenge in Bos indicus - Bos taurus steers

    Science.gov (United States)

    Subclinical illness associated with infection is thought to reduce performance and increase production costs in feedlot cattle, but underlying components remain largely unidentified. Vaccination is frequently used in feedlot settings but producers lack metrics that evaluate the effectiveness of vacc...

  1. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  2. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  3. Different doses of equine chorionic gonadotropin on ovarian follicular growth and pregnancy rate of suckled Bos taurus beef cows subjected to timed artificial insemination protocol.

    Science.gov (United States)

    Pessoa, G A; Martini, A P; Carloto, G W; Rodrigues, M C C; Claro Júnior, I; Baruselli, P S; Brauner, C C; Rubin, M I B; Corrêa, M N; Leivas, F G; Sá Filho, M F

    2016-03-15

    This study evaluated the effect of different doses of eCG (control, 300 or 400 IU) administered at progesterone (P4) device removal in suckled Bos taurus beef cows undergoing a timed artificial insemination (TAI) protocol. A total of 966 cows received a P4 insert and 2.0 mg intramuscular estradiol benzoate at the onset of the synchronization. After 9 days, P4 insert was removed, and 12.5 mg of dinoprost tromethamine and 1 mg of estradiol cypionate were administered, followed by TAI 48 hours later. Then, the cows received one of three treatments as follows: control (n = 323), 300 (n = 326), or 400 IU of eCG (n = 317). A subset (n = 435) of cows in anestrus had their ovaries evaluated using ultrasound at the time of P4 removal and at TAI. Data were analyzed by orthogonal contrasts (C): C1 (eCG effect) and C2 (eCG dose effect). Estrous occurrence (control = 53.7%, 300 IU = 70.6%, and 400 IU = 77.0%) and pregnancy per artificial insemination (control = 29.7%, 300 IU = 44.8%, and 400 IU = 47.6%) were improved by eCG treatment (C1; P = 0.0004 and P 0.15). In conclusion, the eCG treatment administered at the time of P4 removal increased the occurrence of estrus, the larger follicles at TAI, and pregnancy per artificial insemination of suckled B taurus beef cows. Despite the greater occurrence of estrus in noncyclic cows receiving 400 IU of eCG, both eCG doses (300 and 400 IU) were equally efficient to improve pregnancy to artificial insemination.

  4. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P carcass (P < 0.001), and had larger LM area (P < 0.05) with less adjusted fat (P < 0.001). No difference existed between the sexes for Warner-Bratzler shear force or marbling. No interactions involving sex, sire type, and dam type were observed for any of these traits. The results were similar under methods I and II analyses, with the exception that a significant sire type x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf.

  5. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits.

  6. Immunization of Bos taurus steers with Babesia bovis recombinant antigens MSA-1, MSA-2c and 12D3.

    Science.gov (United States)

    Antonio Alvarez, J; Lopez, U; Rojas, C; Borgonio, V M; Sanchez, V; Castañeda, R; Vargas, P; Figueroa, J V

    2010-04-01

    The purpose of this research was to evaluate the recombinant proteins MSA-1, MSA-2c and 12D3 as a combined immunogen for cattle. Fifteen steers were randomly assigned into three groups of five animals each (I, II and III). On day 0, cattle in group I were injected with 50 microg each of rMSA-1, rMSA-2c and r12D3 with the adjuvant Montanide 75; cattle in Group II received adjuvant-PBS, and Group III were untreated controls. On day 14, cattle in Group I received a second injection of the three recombinant proteins in adjuvant and cattle in Group II again received adjuvant alone. On day 28, all groups of cattle were challenged with a field strain of Babesia bovis. After challenge, the experimental cattle were clinically and serologically monitored. Three of the five steers immunized with the combined recombinant B. bovis proteins seroconverted on day 14 post-immunization (P.I.) and the maximum titre was 1 : 1600. All five immunized steers presented strong seropositivity to B. bovis antigens at day 21 P.I. The prepatent periods of vaccinated cattle were delayed until day 10 post-challenge exposure versus 8 and 7 days in Groups II and III, respectively. Cattle in all groups had fever above 41 degrees C; the reduction in packed cell volume was not significantly different (P > 0.05) in vaccinated group I compared with Groups II and III (29% versus 26% and 31%, respectively). Treatment was required for one steer in the control group. During the period of the study, the weight of cattle in Groups I and II increased an average of 9 and 7 kg, whereas the weight of the control cattle was reduced on average 4 kg. Immunization with rMSA-1-rMSA-2c-r12D3 proteins was not sufficient to prevent clinical symptoms against challenge, but the immunologic response was sufficient to protect steers against a mild virulent strain of B. bovis.

  7. In Vivo modulation of the innate response to pneumovirus by type-I and -III interferon-induced Bos taurus Mx1.

    Science.gov (United States)

    Dermine, Martin; Desmecht, Daniel

    2012-07-01

    The respiratory syncytial virus (RSV) is a major pathogen of the human species. This pneumovirus is a prominent cause of airway morbidity in children and maintains an excessive hospitalization rate despite decades of research. As involvement of a genetic vulnerability is a possibility supported by recent data, we addressed the question of whether the Mx gene products, the typical target of which consists in single-stranded negative-polarity RNA viruses, could alter the course of pneumovirus-associated disease in vivo. Wild-type and Bos taurus Mx1-expressing transgenic FVB/J mice were inoculated with the mouse counterpart and closest phylogenetic relative of RSV, pneumonia virus of mice. Survival data and follow-up of body weight, histological scores, lung virus spread, and lung viral load unequivocally showed that the viral infection was severely repressed in Mx-transgenic mice, thus suggesting that pneumoviruses belong to the antiviral spectrum of mammalian Mx GTPases. Elucidating the underlying mechanisms at the molecular level could reveal critical information for the development of new anti-RSV molecules.

  8. Two dimensional SDS PAGE analysis of epididymal tissue proteins of normal and castrated bulls (Bos taurus) and identification of an androgen dependant protein

    Institute of Scientific and Technical Information of China (English)

    Gurunathgouda patil; V Girish Kumar; SG Ramachandra; AJ Rao; S Nandi

    2012-01-01

    A study was undertaken with an objective of two dimensionalSDS-PAGE analysis of protein profile in tissues of all caput, corpus and cauda of epididymis in both castrated and normal bulls and identification of androgen dependent protein/s in the epididymal tissues of bull(Bos taurus). Two dimensionalSDS-PAGE analysis for protein spots of different molecular weight(MW) with pI3.5 to7.35 and pI >7.35 to9.3 between the three regions in the normal and castrated bull as well as between normal and castrated bull of a particular region revealed significant differences. Similarly, comparison between the three regions of the normal and castrated bull epididymis for the number of protein spots irrespective of theMW in pI range of3.5 to7.35 and pI range >7.35 to 9.3 revealed significant differences.The number of protein spots found to be significantly higher in caput, corpus and cauda epididymis of the normal bull when compared to similar region of the castrated bull epididymis.Most of the proteins, which are secreted, are havingMW between 20 and85 kDa.Six proteins, which are known to be highly dependent on androgens, are also of acidic in nature except for one protein havingbasic pH.A protein spot(pI:6.55-6.85, andMW: <20 kDa) which appeared at the same site in all the three regions of the epididymis in the normal bull but was absent at the same site in all the three regions of the castrated bull was subjected for identification of the protein byMALDI-MS.The results revealed that this protein is an interferon-stimulated protein and it could beISG15/UCRP.

  9. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

    Directory of Open Access Journals (Sweden)

    Anirene G T Pereira

    Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

  10. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore) Cattle Are Modulators of Growth

    Science.gov (United States)

    Milanesi, Marco; Torrecilha, Rafaela B. P.; Carmo, Adriana S.; Neves, Haroldo H. R.; Carvalheiro, Roberto; Ajmone-Marsan, Paolo; Sonstegard, Tad S.; Sölkner, Johann; Contreras-Castillo, Carmen J.; Garcia, José F.

    2016-01-01

    Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS), were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore) cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV) for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1) as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1), IGF2 (insulin like growth factor 2), GH1 (growth hormone 1), IGF1R (insulin like growth factor 1 receptor) and GHR (growth hormone receptor), suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway. PMID:27410030

  11. Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

    Directory of Open Access Journals (Sweden)

    Aparecida Carla de Moura

    1999-01-01

    Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

  12. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  13. REVIEW: The Characteristics of Genetic Resource of Bali Cattle (Bos-bibos banteng and the Alternative of It's Conservation Methods

    Directory of Open Access Journals (Sweden)

    ACHMAD NUR CHAMDI

    2005-01-01

    Full Text Available Bali cattle is an Indonesian native beef cattle, the result of domestication of Banteng (Bos-bibos banteng. The main problem faced in the development of Bali cattle is the low quality of breed, which is predicted as the effect of inbreeding or raising management. The affects of genetic and cross breeding which usually inflict a loss are the decreasing of cattle’s endurance, fertility and birth weight. Seeing the fact, the government effort to introduce a quality bull to the breed source areas, the determination of cattle release including the controll on the cutting of productive female cattle, and to exactly count the number of Bali cattle which can be released in order to do not disturb its population balance, so it is necessary to do conservation attempt by in-situ and ex-situ. The result of this study shows that the characteristics on genetic resource of Bali cattle which comprises documentation, evaluation on reproduction and production, and attempt in increasing Bali cattle’s genetic quality in Indonesia have been done, eventhough those are still limited.

  14. Genomic characterisation of the feline sarcoid-associated papillomavirus and proposed classification as Bos taurus papillomavirus type 14.

    Science.gov (United States)

    Munday, John S; Thomson, Neroli; Dunowska, Magda; Knight, Cameron G; Laurie, Rebecca E; Hills, Simon

    2015-06-12

    Feline sarcoids are rare mesenchymal neoplasms of domestic and exotic cats. Previous studies have consistently detected short DNA sequences from a papillomavirus (PV), designated feline sarcoid-associated papillomavirus (FeSarPV), in these neoplasms. The FeSarPV sequence has never been detected in any non-sarcoid sample from cats but has been amplified from the skin of cattle suggesting that feline sarcoids are caused by cross-species infection by a bovine papillomavirus (BPV). The aim of the present study was to determine the genome of the PV that contains the FeSarPV sequence. Using the circular nature of PV DNA, four specifically designed 'outward facing' primers were used to amplify two approximately 4,000 bp DNA segments from a feline sarcoid. The two PCR products were sequenced using next generation sequencing and the full genome of the PV, consisting 7,966 bp, was assembled and analysed. Phylogenetic analysis revealed the PV was closely related to the species 4 delta BPVs-1, -2, and -13, but distantly related to any carnivoran PV genus. These results are consistent with feline sarcoids being caused by a BPV type and we propose a classification of BPV-14 for this novel PV. Initial analysis suggests that, like other delta BPVs, the BPV-14 E5 protein could cause mesenchymal proliferation by binding to the platelet derived growth factor beta receptor. Interestingly BPV-14 has not been detected in any equine sarcoid suggesting that BPV-14 has a host range that is limited to bovids and felids.

  15. Study on the Interspecies Crossbreeding Between Mithun (Bos frontalis) and Zebu (Bos indicus) Cattle%大额牛(Bos frontalis)与瘤牛(Bos indicus)的种间杂交研究

    Institute of Scientific and Technical Information of China (English)

    和占星; 涂先云; 袁希平; 黄必志; 张继才; 亐开兴; 金显栋; 王喆; 王安奎; 黄梅芬; 赵刚; 杨国荣

    2011-01-01

    [Objective] The potential of interspecies crossbreeding utilization and its foreground between Mithun (Bos frontalis) and Zebu (Bos indicus) cattle were studied. [Method] Firstly, after treated by CUE-MATE? (progesterone-releasing intravaginal device) and PG for synchronization estrous, Brahman cows were inseminated artificially with Mithun's frozen semen. And gestation length and calving time of cows and calf sex ratio were investigated. Besides, the body weight of Mithun and Brahman crossbreed at birth, 6 months, 12 months and 18 months of age were measured and karyotype and reproductive performance of hybrids F) (MithunxBrahman) and so on were analyzed and investigated. [Result] The rates of synchronization estrous, pregnancy and calving of Brahman cow were 83.87%, 60.56% and 45.07%, respectively. The average gestation length was (290.83±5.26) d (n=24). The percentage of female calf in crossbred F1 (Mithun×Brahman) was 71.88%, higher than those of Mithun and Brahman (P0.05), 13.12% (P0.05) of Brahman. The chromosome numbers of Mithun, Brahman and their crossbred F1 (Mithun×Brahman) were 2n=58,2n=60 and 2n=59, respectively. The average age and body weight of crossbred F1 (MithunxBrahman) at first pregnancy and their primiparous age were (16.00±2.83) months, (342.50±30.41) kg and (26.00±2.83) months, respectively, which gave one calf per year. The semen collection of 5 crossbred F1 (Mithun×Brahman) at 15-24 months of age was failed by electro-ejaculation treatment. [Conclusion]Interspecies crossbreeding of Mithun×Zebu performed better in rapid growth, wide adaptation and significant heterosis. And the crossbred female F1 was of better reproductive capacity, precocity and high reproductive efficiency. However, the fertility of male crossbred F1 will remain to be studied in future.%[目的]探讨大额牛(Bos frontalis)与瘤牛(Bos indicus)杂交利用潜能及杂交育种前景.[方法]选用婆罗门( Brahman)母牛,以CUE-MATETM(孕酮阴道栓)+ PG(氯

  16. Respuesta estral y porcentaje de concepción en vacas Bos taurus-Bos indicus posparto, tratadas con la hormona bovina del crecimiento en un programa de inducción de la ovulación con progestágenos y eCG

    OpenAIRE

    Linda Esther Velázquez Rosas; Carlos Fregoso Aguayo; Reyes López Ordaz; Joel Hernández Cerón

    2011-01-01

    Se probó si la inyección de la somatotropina bovina (bST) al inicio de la inducción de la ovulación con progestágenos y eCG, y una segunda inyección en la inseminación, aumentan la respuesta estral y el porcentaje de concepción (PC) en vacas de carne posparto. Se utilizaron 174 vacas (Bos taurus-Bos indicus) de 60 a 100 días posparto, con cría y condición corporal de 2 a 2.5. Todas las hembras tuvieron un dispositivo intravaginal liberador de progesterona (CIDR) durante nueve días y al retira...

  17. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  18. Estudo sobre a migração transuterina e a razão sexual de conceptos em bovinos da raça Nelore (Bos taurus indicus)

    OpenAIRE

    Borges,Gabriel Batista Oliveira

    2016-01-01

    A bovinocultura de corte é uma das atividades do agronegócio brasileiro que mais movimentam capitais, bens e serviços, sendo que, segundo dados das associações de criadores e exportadores, cerca de 80% dos bovinos criados no país são oriundos de raças zebuínas (Bos taurus indicus), e destes, a maioria é pertencente à raça Nelore ou seus cruzamentos. Os trabalhos conduzidos com a utilização de dados obtidos em frigoríficos podem ser considerados bastante fiéis e valorosos, já que representam u...

  19. The Genetic Diversity and Phylogenetic Status of Luxi Cattle

    Institute of Scientific and Technical Information of China (English)

    MAO Yong-jiang; CHANG Hong; YANG Zhang-ping; XU Ming; ZHANG Liu; CHANG Guo-bin; SONG Wei-tao; WANG Dong-lei

    2006-01-01

    A total of 87 individuals of Luxi cattle from Juanchen and Liangshan counties, Shangdong Province, China, were sampled by simple random sampling in typical colony. Twenty-one blood proteins and enzymes loci were detected by polyacrylamide gel electrophoresis (PAGE) and starch gel electrophoresis (SGE). In the meantime, the data of 7 loci of 13 cattle populations in China and other countries were collected and phylogeny relationships were studied. The results indicated that 9 out of 21 loci showed polymorphism (42.86%); the level of genetic variation in Luxi cattle population was relatively high, the mean heterozygosity was 0.1416. The Luxi cattle have a close phylogenetic relationship with the cattle populations of east and south of Asia, and this further confirmed the fact that Luxi cattle were the cross-breed between the Bos taurus and Bos indicus in China, but it is impossible that yellow cattle contained the blood of of Bali.

  20. Fluorescent in-situ hybridization of cattle and sheep chromosomes with cloned human fragile-X DNA

    DEFF Research Database (Denmark)

    Ali, Ahmd; Thomsen, Preben Dybdahl; Babar, M.E.

    2009-01-01

    An extensive study on spontaneous and 5-Fluorodeoxyuridine induced fragile sites identified Xq31 in cattle (Bos taurus) and (Xq24, Xq26) in sheep (Ovis aries) in addition to several autosomal fragile sites (under publication). A ZOO-FISH study using three cloned human fragile-X probes with CCG/CG...

  1. Genomic conservation of cattle microsatellite loci in wild gaur (Bos gaurus and current genetic status of this species in Vietnam

    Directory of Open Access Journals (Sweden)

    Renard Jean-Paul

    2007-11-01

    Full Text Available Abstract Background The wild gaur (Bos gaurus is an endangered wild cattle species. In Vietnam, the total number of wild gaurs is estimated at a maximum of 500 individuals. Inbreeding and genetic drift are current relevant threats to this small population size. Therefore, information about the genetic status of the Vietnamese wild gaur population is essential to develop strategies for conservation and effective long-term management for this species. In the present study, we performed cross-species amplification of 130 bovine microsatellite markers, in order to evaluate the applicability and conservation of cattle microsatellite loci in the wild gaur genome. The genetic diversity of Vietnamese wild gaur was also investigated, based on data collected from the 117 successfully amplified loci. Results One hundred-thirty cattle microsatellite markers were tested on a panel of 11 animals. Efficient amplifications were observed for 117 markers (90% with a total of 264 alleles, and of these, 68 (58.1% gave polymorphic band patterns. The number of alleles per locus among the polymorphic markers ranged from two to six. Thirteen loci (BM1314, BM2304, BM6017, BMC2228, BMS332, BMS911, CSSM023, ETH123, HAUT14, HEL11, HEL5, ILSTS005 and INRA189 distributed on nine different cattle chromosomes failed to amplify wild gaur genomic DNA. Three cattle Y-chromosome specific microsatellite markers (INRA124, INRA126 and BM861 were also highly specific in wild gaur, only displaying an amplification product in the males. Genotype data collected from the 117 successfully amplified microsatellites were used to assess the genetic diversity of this species in Vietnam. Polymorphic Information Content (PIC values varied between 0.083 and 0.767 with a mean of 0.252 while observed heterozygosities (Ho ranged from 0.091 to 0.909 (mean of 0.269. Nei's unbiased mean heterozygosity and the mean allele number across loci were 0.298 and 2.2, respectively. Conclusion Extensive

  2. Nellore cattle (Bos indicus) and ticks within the Brazilian Pantanal: ecological relationships.

    Science.gov (United States)

    Ramos, Vanessa N; Piovezan, Ubiratan; Franco, Ana Helena A; Rodrigues, Vinicius S; Nava, Santiago; Szabó, Matias P J

    2016-02-01

    Pantanal is a huge floodplain mostly in Brazil, and its main economic activity is extensive cattle raising, in farms characterized by an extremely wildlife-rich environment. We herein describe tick infestations of cattle and of the natural environment in Pantanal of Nhecolândia in Brazil, at areas with and without cattle during both dry and wet seasons. Environmental sampling resulted in three tick species: Amblyomma sculptum (423 nymphs and 518 adults), Amblyomma parvum (7 nymphs and 129 adults), Amblyomma ovale (3 adults) as well as three clusters and two individuals of Amblyomma sp. larvae. A significantly higher number of adult A. sculptum ticks was found in areas with cattle in the wet season. From 106 examinations of bovines 1710 ticks from three species were collected: Rhipicephalus microplus (55.7% of the total), A. sculptum (38%) and A. parvum (4.1%), as well as 32 Amblyomma sp. larvae. A significant similarity was found between Amblyomma tick fauna from environment and on cattle during both seasons. All A. sculptum females on bovines were flat whereas many of A. parvum females and A. sculptum nymphs were engorging. Although R. microplus was the most abundant tick species on cattle, overall highest tick prevalence on bovines in the dry season was of A. sculptum nymphs. Lack of R. microplus in environmental sampling, relationship between cattle and increase in adult A. sculptum numbers in the environment as well as suitability of bovine for the various tick species are discussed.

  3. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds.

  4. Perfil de ácidos grasos en leche de vacas Chinampas (Bos taurus alimentadas con forraje fresco de matorral sarcocaulescente o heno de alfalfa Fatty acids profile in milk of Chinampo cows (Bos taurus fed fresh forage from sarcocaulescent shrubs or alfalfa hay

    Directory of Open Access Journals (Sweden)

    R Ortega-Pérez

    2013-01-01

    Full Text Available El objetivo del estudio fue determinar la concentración de ácidos grasos (AG en la leche de vacas Chinampas, con énfasis en los ácidos grasos conjugados (CLA. Se colectó una muestra manual de leche (10 ml de 32 vacas entre los 60 y 120 días de lactación. Un grupo (FV; n = 25 se alimentó en pastoreo con forraje verde durante la estación de lluvias de septiembre a octubre de 2009 en una zona semiárida de matorral sarcocaulescente (Municipio La Paz, B.C.S.. Otro grupo (HA; n = 7 se mantuvo en corral y se alimentó con heno de alfalfa. El análisis cromatográfico revela que la concentración de AG saturados fue menor (P The objective of the present study was to determine the concentration of fatty acids (FA in the milk of Chinampo cows (Bos taurus, with emphasis on conjugated fatty acids (CLA. A sample of 10 ml was collected from 32 cows that had been lactating at least 60 days, but not longer than 120 days. A group (FV, n = 25 was free-ranged grazed on green fresh pasture (sarcocaulescent shrub semiarid area, La Paz, B.C.S. during the wet season (September-October 2009. The second group (HA, n = 7 was penned and fed fodder of alfalfa hay. The FA analysis revealed that there were less saturated FA in the FV group (P < 0.05. This difference was basically explained by the lesser content of 14:0, 15:0, and 16:0. The concentration of total monounsaturated FA was higher in FV (P < 0.05, given by the higher concentration of 18:1 n-9 and 18:1 n-7 trans-11. The total concentration of polyunsaturated FA was similar for both groups, but there was a higher concentration of 18:2 n-6 and 18:2 n-7 cis-9 trans-11 in the FV group (P < 0.01. The proportion of omega-3 FA was similar for both groups, but the concentration of omega-6 FA was higher in FV (P < 0.01, resulting in an increased omega-6:omega-3 ratios in the FV group compared to HA. It is concluded that Chinampo cows left to free-range on fresh green pasture reduced the total saturated FA of

  5. Amino acid profile of salivary proteins and plasmatic trace mineral response to dietary condensed tannins in free-ranging zebu cattle (Bos indicus) as a marker of habitat degradation

    NARCIS (Netherlands)

    Yisehak, K.; Becker, A.; Rothman, J.M.; Dierenfeld, E.S.; Marescau, B.; Bosch, G.; Hendriks, W.H.; Janssens, G.P.J.

    2012-01-01

    In the southern hemisphere, foraging areas of cattle are affected by overgrazing and soil erosion resulting in decreased availability of grasses and increased amounts of browse plants high in condensed tannins (CT). This study aimed to identify biomarkers in free-ranging zebu cattle (Bos indicus) fo

  6. DNA-based authentication method for detection of yak (Bos grunniens) in meat products.

    Science.gov (United States)

    Wang, Ping; Hu, Yue; Yang, Hairong; Han, Jiangxun; Zhao, Yongsheng; Chen, Ying

    2013-01-01

    A TaqMan probe real-time PCR method was developed for rapid detection of yak component in raw and cooked meat products. Specific primers and TaqMan probes of yak (Bos grunniens) were designed in the cytochrome b gene. The specificity of the method was evaluated using pure meat of eight yak breeds (Jiulong, Qinghai plateau, Maiwa, Gannan, Bazhou, Sibu, Zhongdian, and Jiali) samples and nine non-Bos grunniens animals (sheep, goat, pig, chicken, cattle, water buffalo, donkey, horse, and rabbit). DNA showed no cross-reaction with non-Bos grunniens animal DNA. This method proved to be sensitive in detecting the presence of low levels of target DNA obtained from 0.001% (w/w) component in a mixed meat sample. The method also successfully identified commercial yak meat products. The results showed that some yak meat might be involved in business fraud by using cattle meat (in this paper, cattle meat means meat of Bos taurus) instead of yak meat. In conclusion, real-time PCR assay used in this study was shown to be a rapid and sensitive method for detection of yak DNA in fresh meat and cooked meat products.

  7. Solid beef cattle manure application impacts on soil properties and 17β-estradiol fate in a clay loam soil.

    Science.gov (United States)

    Caron, Emmanuelle; Farenhorst, Annemieke; Hao, Xiying; Sheedy, Claudia

    2012-01-01

    Livestock manure applied to agricultural land is one of the ways natural steroid estrogens enter soils. To examine the impact of long-term solid beef cattle (Bos Taurus) manure on soil properties and 17β-estradiol sorption and mineralization, this study utilized a soil that had received beef cattle manure over 35 years. The 17β-estradiol was strongly sorbed and sorption significantly increased (P applied.

  8. Efficiency of utilization of dietary energy for milk production in lactating crossbred cattle (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Debashis Saha

    2012-09-01

    Full Text Available The present study was conducted on efficiency of utilization of dietary energy for milk production in lactating crossbred cattle. 18 lactating crossbred cattle of early to mid-lactation, approximate body weight (375.39±23.43 kg, milk yield, parity and stage of lactation were divided into three groups of six animals each and were fed 0, 50 and 100% diammonium phosphate (DAP in the mineral mixture of concentrates for 120 days. The chaffed mixed roughage (berseem + wheat straw and concentrate mixture was fed to supply about nearly 18:82 concentrate to roughage ratio on dry matter basis. Tap water was available to the animals twice daily. A metabolism trial of seven days was conducted at the end of experiment to study digestibility of organic nutrients and balances of energy. DAP did not affect the nutrient intake, body weight changes, digestibility of Dry matter (DM, Crude protein (CP, Ether extract (EE, Crude fiber (CF, Nitrogen free extract (NFE and daily milk yield. It was concluded that the at 46.07 Mcal Gross energy intake level the losses in feces, urine, methane and heat production was 45.82%, 5.40%, 4.31% and 33.01%, respectively, and net energy retention for milk production was 11.43%. The gross efficiency of conversion of metabolic energy ME for milk production was 35.69% and the net efficiency of conversion of ME for milk production was 39.56%.

  9. Reproductive physiology and ovarian folliculogenesis examined via 1H-NMR metabolomics signatures: a comparative study of large and small follicles in three mammalian species (Bos taurus, Sus scrofa domesticus and Equus ferus caballus).

    Science.gov (United States)

    Gérard, Nadine; Fahiminiya, Somayyeh; Grupen, Christopher G; Nadal-Desbarats, Lydie

    2015-01-01

    The aim of this study was to characterize the composition of follicular fluid (FF) collected from the small and large follicles of three mammalian species, Bos taurus, Sus scrofa domesticus, and Equus ferus caballus, that display distinct ovulatory properties. For each species, five large FF samples and five small FF samples were analyzed using 1H-NMR spectroscopy. The FF metabolic profiles of the three species were very distinct. In cows and mares, the metabolic profiles of large FF and small FF were also very distinct. The concentrations of seventeen identified metabolites differed significantly between the sample groups. In mares, fourteen metabolites were found at much greater concentrations in large FF than in small FF (p<0.05). In cows, four metabolites differed in concentration between the large FF and small FF samples (p<0.05). A common feature of the monovulatory species was that the concentrations of α- and β-glucose were much greater in large FF compared with small FF (p<0.05). Sow FF was characterized by the apparent absence of citrate (detected in cow and mare FF), and the presence of succinate (not detected in cow and mare FF). Another obvious difference between species was the concentration of lactate, which was minimal in mare FF compared with cow and sow FF (p<0.05). The findings provide valuable insights into reproductive physiology broadly, and indicate that the activities of central metabolic enzymes differ enormously between these species. Future investigations into species-specific differences in follicle metabolism would increase our understanding of the processes critical to folliculogenesis and the acquisition of oocyte developmental competence.

  10. Prevalence and genetic characterization of Anaplasma marginale in zebu cattle (Bos indicus) and their ticks (Amblyomma variegatum, Rhipicephalus microplus) from Madagascar.

    Science.gov (United States)

    Pothmann, Daniela; Poppert, Sven; Rakotozandrindrainy, Raphael; Hogan, Benedikt; Mastropaolo, Mariano; Thiel, Claudia; Silaghi, Cornelia

    2016-10-01

    Tick-borne bovine anaplasmosis, caused by the obligate intracellular pathogen Anaplasma marginale (Rickettsiales: Anaplasmataceae), is a major constraint to cattle production in tropical and subtropical regions. From Madagascar, clinical cases were published but data based on molecular methods regarding the prevalence and genetic diversity of this pathogen on the island are lacking. The aims of this study were to investigate (1) the prevalence of A. marginale in Malagasy zebu cattle (Bos indicus) and their ticks with a species-specific real-time PCR, (2) the genetic diversity of A. marginale based on tandem repeats and microsatellites of the msp1α gene, and (3) the phylogenetic relationship between A. marginale isolates from Madagascar and strains found worldwide. Two hundred fourteen blood samples and 1822 ticks from 214 zebu cattle were collected. Rhipicephalus (R) microplus (40.2%) and Amblyomma (A) variegatum (59.8%) were identified on the cattle. A. marginale DNA was found in 89.7% of the examined zebu cattle and in 62.3% of the examined ticks. The tandem repeat and microsatellite analyses of the mspa1 gene showed high genetic diversity among the isolates between and within the different regions and high infection potential. Eighteen of the 25 tandem repeats identified have not been described before. Phylogenetic analysis revealed clustering of A. marginale strains from Madagascar with South Africa, America and Israel. A common ancestor may originate from South Africa and may have evolved due to phylogeographic characteristics or by a history of cattle movement. Its high prevalence in cattle and ticks, together with a low number of clinical manifestations and a high genetic heterogeneity among the investigated strains, confirms endemic stability of A. marginale in cattle from Madagascar.

  11. Infrared thermography as a tool to evaluate body surface temperature and its relationship with feed efficiency in Bos indicus cattle in tropical conditions

    Science.gov (United States)

    Martello, Luciane Silva; da Luz e Silva, Saulo; da Costa Gomes, Rodrigo; da Silva Corte, Rosana Ruegger Pereira; Leme, Paulo Roberto

    2016-01-01

    The aims of this study were to evaluate the use of infrared thermography (IRT) images as a tool for monitoring body surface temperature and to study its relationship with residual feed intake (RFI) in Nellore cattle. We also evaluated IRT as an indicator of feed efficiency in Bos indicus cattle. In this study, 144 Nellore steers were fed high-concentrate diets for 70 days to evaluate feedlot performance. We examined nine animals classified as high RFI and nine animals classified as low RFI by measuring rectal temperature (RT), respiratory frequency (RF), and IRT in the front, eye, ocular area, cheek, flank, ribs, rump, and front feet. The measurements were taken at 0700, 1200, and 1600 hours. The IRT temperatures measured at the eye, cheek, flank, ribs, rump, and front feet were positively associated with RF and RT. These results indicate that increases in the temperatures are associated with increased RF and RT. There was an effect in the RFI group in the front region where IRT correlates with RT. The front IRT for high-RFI cattle was lower ( P cattle. The higher skin temperature measured by IRT for animals in the RFI group may be related to improved efficiency of thermoregulatory mechanisms because the RT remained lower in the low-RFI group. IRT can be used in the head for studies related to RFI in beef cattle.

  12. Nucleotide polymorphisms in the bovine lymphotoxin A gene and their distribution among Bos indicus zebu cattle breeds.

    Science.gov (United States)

    Behl, Jyotsna Dhingra; Mishra, Priyanka; Verma, N K; Niranjan, S K; Dangi, P S; Sharma, Rekha; Behl, Rahul

    2016-03-15

    The present study was undertaken to characterize the genetic variation present in lymphoxin A gene (LTA gene) encoding for the lymphotoxin A protein also known as tumor necrosis factor beta, a cytokine produced by lymphocytes, known to be cytotoxic for a wide range of tumor cells both in vitro and in vivo, and, which is essential for normal immunological development; in 40 animals of 5 diverse Bos indicus Indian zebu cattle breeds. These breeds survive under the harsh and tough tropical climatic conditions of various parts of the Indian subcontinent. The LTA gene in the present study was observed to contain 33 SNPs and 3 small insertion/deletion polymorphisms. Four SNPs occurred in the coding regions of the gene viz. g.1327A>G and g.1400C>T in exon 2 and g.1840C>T and g.1942C>T in exon 3, of which the SNP g.1327A>G in exon 2 resulted in a non-synonymous amino acid change G38D. This amino acid change was however predicted not be affecting the protein function in any manner. The gene contained putative transcription factor binding sites for the c-Re1 and for Pax-4 transcription factors. A putative promoter region was also predicted on the reverse DNA strand from position 894 to 644. Several repeat elements and microsatellite repeats were detected to be occurring across the 3.2kb LTA gene sequence. The study showed the occurrence of 40 genotypes and 48 most probable haplotypes. The genotypes at the observed SNP positions in the LTA gene were in near Hardy-Weinberg equilibrium. A negative Tajima's D value that was not significant statistically at P>0.10 indicated that the neutral mutation hypothesis could not be excluded. The genetic variations observed in the LTA gene in the present study have not been reported earlier and these could possibly be used as molecular markers for further studies involving association of the gene variability with disease resistance/tolerance traits.

  13. GENERAL ASPECTS OF BODY MEASURES, WEIGHT AND SCORE CONDITION FEMALE NELORE BREED (Bos taurus indicus ON THE PERIOD OF 12 MONTHS ESTUDIO DE MEDIDAS CORPORALES, PESO VIVO Y CONDICIÓN CORPORAL DE BOVINOS HEMBRAS DE LA RAZA NELORE (Bos taurus indicus POR 12 MESES ESTUDO DE MEDIDAS CORPORAIS, PESO VIVO E CONDIÇÃO CORPORAL DE FÊMEAS DA RAÇA NELORE (Bos taurus indicus AO LONGO DE 12 MESES

    Directory of Open Access Journals (Sweden)

    Arcádio de Los Reys Borjas

    2008-04-01

    Full Text Available Four hundred and eighty cattle were used to verify alterations and correlations among corporal measures in Nelore zebu herd with cows and heifers. Body weight and length, corporal condition, heart girth, withers height and hip measures were evaluated. Eight collections were accomplished along the months of October of 2002 and October of 2003. In heifers there was increase of the averages of corporal measures with significant difference (p <0,05 among collections only the heart girth was different (p <0,05 in cows. The relationship between the body weight and body condition with the time were quadratic parallel curves (p <0,001. There were correlations among lineal measures body with hip measures (p<0,001 except for heart girth with hip length. The correlations of body weight and body condition among body measures were significant (p<0,001 except body condition with hip length in cows. It could be concluded that there was a growing variation of the body measures in heifers in the experimental period. The body weight, the body condition and heart girth were related with different periods of the year that the evaluation was accomplished. In cows the variations along the year were of 14,79%, 31,53% and 6,74%, respectively. The isquiun – iliun external measures, as height and width were correlated with size measures and weight. The body weight and body condition in heifers behave in way similar to cows. Further researches in relationship among body measures, body weight and body condition with productive and reproductive aspect are necessary. Con el objetivo de verificar alteraciones y correlaciones entre medidas corporales en un rebaño bovino de vaquillonas y vacas de la raza Nelore. Evaluaron-se 487 hembras en peso vivo, condición corporal, perímetro toráxico, largura corporal, altura de la cruz y medidas da anca. Fueron realizadas ocho coletas a lo largo de los meses de octubre de 2002 y octubre de 2003. En las vaquillonas hubo un aumento de

  14. Characterization of promoter sequence of toll-like receptor genes in Vechur cattle

    Directory of Open Access Journals (Sweden)

    R. Lakshmi

    2016-06-01

    Full Text Available Aim: To analyze the promoter sequence of toll-like receptor (TLR genes in Vechur cattle, an indigenous breed of Kerala with the sequence of Bos taurus and access the differences that could be attributed to innate immune responses against bovine mastitis. Materials and Methods: Blood samples were collected from Jugular vein of Vechur cattle, maintained at Vechur cattle conservation center of Kerala Veterinary and Animal Sciences University, using an acid-citrate-dextrose anticoagulant. The genomic DNA was extracted, and polymerase chain reaction was carried out to amplify the promoter region of TLRs. The amplified product of TLR2, 4, and 9 promoter regions was sequenced by Sanger enzymatic DNA sequencing technique. Results: The sequence of promoter region of TLR2 of Vechur cattle with the B. taurus sequence present in GenBank showed 98% similarity and revealed variants for four sequence motifs. The sequence of the promoter region of TLR4 of Vechur cattle revealed 99% similarity with that of B. taurus sequence but not reveals significant variant in motifregions. However, two heterozygous loci were observed from the chromatogram. Promoter sequence of TLR9 gene also showed 99% similarity to B. taurus sequence and revealed variants for four sequence motifs. Conclusion: The results of this study indicate that significant variation in the promoter of TLR2 and 9 genes in Vechur cattle breed and may potentially link the influence the innate immunity response against mastitis diseases.

  15. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus) and buffalo (Bubalus bubalis) using next generation sequencing technology.

    Science.gov (United States)

    Patel, Shreya M; Koringa, Prakash G; Nathani, Neelam M; Patel, Namrata V; Shah, Tejash M; Joshi, Chaitanya G

    2015-02-01

    Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV) and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK). Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  16. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus and buffalo (Bubalus bubalis using next generation sequencing technology

    Directory of Open Access Journals (Sweden)

    Shreya M. Patel

    2015-02-01

    Full Text Available Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK. Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  17. Association of single nucleotide polymorphisms in CAPN1, CAST and MB genes with meat color of Brahman and crossbreed cattle.

    Science.gov (United States)

    Castro, Susan; Ríos, Marcela; Ortiz, Yurany; Manrique, Carlos; Jiménez, Ariel; Ariza, Fernando

    2016-07-01

    The objective of this research was to determine the association of SNPs in the candidate genes Calpain (CAPN1), Calpastatin (CAST) and Myoglobin (MB) with colorimetric parameters (L *, a *, b *, C *, hue) in a F1 population (n = 164) obtained from crossing Bos taurus × Bos indicus and Bos indicus × Bos indicus. SNPs were analyzed using PCR-RFLP and SSCP. Colorimetric measurements were performed in the muscles Longissimus thoracis et lumborum (LTL) and Semitendinosus (ST) at 7, 14 and 21 days postmortem applying the methodology CIE L* a* b*. The CAST gene showed a significant effect on the b* and hue* parameters in both muscles. MB gene showed significant association with all colorimetric parameters in both LTL and ST muscles, except with b* parameter. The CAPN1 gene did not show any significant association. These results suggest an important role of genetics in meat color variation for cattle raised under the tropic conditions.

  18. Microsatellite DNA typing for assessment of genetic variability in Tharparkar breed of Indian zebu (Bos indicus) cattle, a major breed of Rajasthan

    Indian Academy of Sciences (India)

    M. Sodhi; M. Mukesh; B. Prakash; S. P. S. Ahlawat; R. C. Sobti

    2006-12-01

    The present study estimates genetic variability with a set of 25 microsatellite markers in a random sample of 50 animals of Tharparkar breed of Indian zebu (Bos indicus) cattle. Tharparkar is a dual-purpose breed, valued for its milk as well as draught utility, and is adapted to the inhospitable Thar desert conditions of Rajasthan typified by summer temperature hovering above 50°C, sparse rainfall and vegetation, and scarcity of even drinking water. The observed number of alleles ranged from 4 (ETH3, ILSTS030, INRA5, INRA63 and MM8) to 11 (HEL9 and ILSTS034), with allelic diversity (average number of observed alleles per locus) of 6.20. Observed and expected heterozygosity ranged from 0.25 (INRA63) to 0.77 (ETH10), and from 0.51 (HEL5 and HAUT27) to 0.88 (HEL9) respectively. Wide range of genetic variability supported the utility of these microsatellite loci in measurement of genetic diversity indices in other Indian cattle breeds too. Various average genetic variability measures, namely allele diversity (6.20), observed heterozygosity (0.57), expected heterozygosity (0.67) and mean polymorphism information content (0.60) values showed substantial within-breed genetic variability in this major breed of Rajasthan, despite accumulated inbreeding as reflected by high average inbreeding coefficient $(F_{\\text{IS}} = 0.39)$. The Tharparkar population has not experienced a bottleneck in the recent past.

  19. Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2009-09-01

    Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

  20. Genotyping BoLA-DRB3 alleles in Brazilian Dairy Gir cattle (Bos indicus) by temperature-gradient gel electrophoresis (TGGE) and direct sequencing.

    Science.gov (United States)

    Da Mota, A F; Martinez, M L; Coutinho, L L

    2004-02-01

    BoLA-DRB3 is a gene of the major histocompatibility complex (MHC) in cattle. The product of the BoLA-DRB3 gene is a beta chain of an MHC class II molecule, a glycoprotein expressed on the surface of antigen-presenting cells (APCs). Responses of CD4+ T lymphocytes to peptides are dependent on the presentation of peptide ligands bound to class II molecules on APCs. Genotyping of the BoLA-DRB3 gene is relatively complex due to the extensive polymorphism of this locus. Current techniques for assignment of genotypes are polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP), direct sequencing of PCR products, cloning-sequencing, polymerase chain reaction using sequence-specific oligonucleotide probes (PCR-SSOP), and denaturant-gradient gel electrophoresis. These techniques are time-consuming, do not discriminate all possible alleles, or are not readily reproducible. The objective of this study was to genotype BoLA-DRB3 using temperature-gradient gel electrophoresis (TGGE) to separate alleles before sequencing. PCRs using 28 DNA samples from Gir Dairy cattle (a Brazilian breed of Bos indicus) were submitted to TGGE. New PCR products were generated from separated alleles, purified, and sequenced. Allele separation was possible in 21 out of 26 heterozygote samples (81%). Results indicate that two sequence reads (forward and reverse) were sufficient for accurate genotyping of BoLA-DRB3 alleles. Separation of alleles by TGGE provides high-throughput, reliable typing of BoLA-DRB3, which is critical in disease association studies in cattle.

  1. Morphological adaptations of yak (Bos grunniens) tongue to the foraging environment of the Qinghai-Tibetan Plateau.

    Science.gov (United States)

    Shao, B; Long, R; Ding, Y; Wang, J; Ding, L; Wang, H

    2010-08-01

    Using light and scanning electron microscopy, the morphological adaptations of the yak (Bos grunniens) tongue to its foraging environment in the Qinghai-Tibetan Plateau were studied. The tongue of the yak was compared with that of cattle (Bos taurus). Compared with cattle, yak tongues are on average 4 cm shorter (P tongue into the harsh environment. The lingual prominence of yak is greater (P tongue and the upper palate. Filiform, conical, lenticular, fungiform, and vallate papillae were observed on the dorsal surface of the tongues studied; no foliate papillae were observed. The papillae were covered by keratinized epithelium, which was thicker (P epithelium, whereas they are multilayered (2 to 4) in those papillae in cattle. The number of taste buds in each vallate papillae was less (P < 0.001) in the yak than in cattle. Therefore, the gustatory function of the yak was weaker than in cattle. Yaks graze throughout the year on diverse natural grasslands and have evolved morphological characteristics enabling them to consume a wide variety of plant species, thereby better adapting them to the typically harsh characteristics of their pastures.

  2. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle.

  3. Restriction fragment length polymorphism in calpain (CAPN2 gene in crossbred cattle

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Cassiano Lara

    2012-12-01

    Full Text Available With advances in molecular genetics have been possible to predict the genetic value of the animal, in particular its potential to transmit desired characters to their offspring, including characters difficult to evaluate or with low heritability, as is the case of the meat tenderization. It is known that Bos taurus indicus features differences in meat tenderization, being assigned this variability to their lowest proteolysis post-mortem, as result of high activity of calpastatin. This inhibitor decreases the activity of calpain, which are the enzymes responsible for the degradation of muscle fibers during the maturation of the meat. Moreover, there were previously observed differences in the frequencies of allele A of calpain among European breeds (Hereford, Aberdeen Angus and Holstein and Bos taurus indicus (Gir, Guzerá and Nelore. This variability has been related to tenderness of meat, as cattle with Bos taurus taurus origin have more tender meat than Bos taurus indicus, showing small values of shear force. One explanation is that the Capn2A product could confer greater proteolytic activity than the encoded by the allele Capn2B. If allele A is associated with tender meat, it will be possible the early identification of the animals that have the potential to produce meat with qualities that attend the needs of the consumer market, in order to add economic value to the final product of the animal production chain. For this reason, biochemical and genetic studies related to calpain and calpastatin systems have been considered promising for the clarification of the physiological changes that occur in muscle structure during the period post-mortem, whose results have contributed to the improvement of meat quality. The objectives of this study were to investigate the RFLP in calpain (Capn2 gene and its relation with meat tenderization in 252 crossbred (Bos taurus taurus x Bos taurus indicus. The analyses were carried through by PCR-RFLP technique

  4. Variations in the Regulatory Region of Alpha S1-Casein Milk Protein Gene among Tropically Adapted Indian Native (Bos Indicus) Cattle

    Science.gov (United States)

    Kishore, Amit; Mukesh, Manishi; Sobti, Ranbir C.; Mishra, Bishnu P.; Sodhi, Monika

    2013-01-01

    Regulatory region of milk protein alpha S1-casein (αS1-CN) gene was sequenced, characterized, and analyzed to detect variations among 13 Indian cattle (Bos indicus) breeds. Comparative analysis of 1,587 bp region comprising promoter (1,418 bp), exon-I (53 bp), and partial intron-I (116 bp) revealed 35 nucleotide substitutions (32 within promoter region, 1 in exon-I, and 2 in partial intron-I region) and 4 Indels. Within promoter, 15 variations at positions −1399 (A > G), −1288 (G > A), −1259 (T > C), −1158 (T > C), −1016 (A > T), −941 (T > G), −778 (C > T), −610 (G > A), −536 (A > G), −521 (A > G), −330 (A > C), −214 (A > G), −205 (A > T), −206 (C > A), and −175 (A > G) were located within the potential transcription factor binding sites (TFBSs), namely, NF-κE1/c-Myc, GATA-1, GATA-1/NF-E, Oct-1/POU3F2, MEF-2/YY1, GATA-1, AP-1, POU1F1a/GR, TMF, GAL4, YY1/Oct-1, HNF-1, GRalpha/AR, GRalpha/AR, and AP-1, respectively. Seventy-four percent (26/35) of the observed SNPs were novel to Indian cattle and 11 of these novel SNPs were located within one or more TFBSs. Collectively, these might influence the binding affinity towards their respective nuclear TFs thus modulating the level of transcripts in milk and affecting overall protein composition. The study provides information on several distinct variations across indicine and taurine αS1-CN regulatory domains. PMID:25937984

  5. An attempt to correlate cattle breed origins and diseases associated with or transmitted by the tick Amblyomma variegatum in the French West Indies.

    Science.gov (United States)

    Maillard, J C; Kemp, S J; Naves, M; Palin, C; Demangel, C; Accipe, A; Maillard, N; Bensaid, A

    1993-01-01

    By using biological data and historical research, we have tried to explain the difference between resistance and susceptibility to the diseases transmitted (cowdriosis) or associated (dermatophilosis) with the tick Amblyomma variegatum, in two cattle breeds of the French West Indies: the Creole crossbred cattle of Guadeloupe and the Brahman zebu cattle of Martinique. Have been studied the polymorphisms of 5 independent genetic systems (erythrocytic haemoglobin, serum albumin and transferrin, the class I region of the BoLA complex and the gamma S crystallin gene) in different breeds comprising Bos taurus cattle of Europe and Africa, Bos indicus of West and East Africa, as well as the Brahman of Martinique and the Creole crossbred of Guadeloupe. By comparing the different allele frequencies of these 5 non related polymorphic loci and by using the two different mathematical matrices of NEI and of CAVALLI-SFORZA, have been established the genetic distances between these breeds. It appears clearly that the Creole cattle of Guadeloupe are in an intermediate position between the Bos taurus N'Dama breed of West Africa and two Bos indicus zebu breeds, namely the West African Sudan zebu and the Brahman. Thanks to studies of different archieves in the Caribbean and in Europe, historical evidence have been accumulated on the geographical origins and on the chronology of the establishment of Creole and Brahman cattle in the French West Indies. The high resistance of the Creole cattle of Guadeloupe to diseases associated with or transmitted by the "Senegalese" tick Amblyomma variegatum seems to be due to the inheritance of a pool of genes from West African cattle and more particularly from the N'Dama breed.(ABSTRACT TRUNCATED AT 250 WORDS)

  6. Identification of Candidate Genes for Reactivity in Guzerat (Bos indicus) Cattle: A Genome-Wide Association Study

    Science.gov (United States)

    Fonseca, Pablo Augusto de Souza; Pires, Maria de Fátima Ávila; Ventura, Ricardo Vieira; Rosse, Izinara da Cruz.; Bruneli, Frank Angelo Tomita; Machado, Marco Antonio; Carvalho, Maria Raquel Santos

    2017-01-01

    Temperament is fundamental to animal production due to its direct influence on the animal-herdsman relationship. When compared to calm animals, the aggressive, anxious or fearful ones exhibit less weight gain, lower reproductive efficiency, decreased milk production and higher herd maintenance costs, all of which contribute to reduced profits. However, temperament is a trait that is complex and difficult to assess. Recently, a new quantitative system, REATEST®, for assessing reactivity, a phenotype of temperament, was developed. Herein, we describe the results of a Genome-wide association study for reactivity, assessed using REATEST® with a sample of 754 females from five dual-purpose (milk and meat production) Guzerat (Bos indicus) herds. Genotyping was performed using a 50k SNP chip and a two-step mixed model approach (Grammar-Gamma) with a one-by-one marker regression was used to identify QTLs. QTLs for reactivity were identified on chromosomes BTA1, BTA5, BTA14, and BTA25. Five intronic and two intergenic markers were significantly associated with reactivity. POU1F1, DRD3, VWA3A, ZBTB20, EPHA6, SNRPF and NTN4 were identified as candidate genes. Previous QTL reports for temperament traits, covering areas surrounding the SNPs/genes identified here, further corroborate these associations. The seven genes identified in the present study explain 20.5% of reactivity variance and give a better understanding of temperament biology. PMID:28125592

  7. Bos indicus cattle possess greater basal concentrations of HSP27, alpha B-crystallin, and HSP70 in skeletal muscle in vivo compared with cattle.

    Science.gov (United States)

    Mullins, C R; Zerby, H N; Fitzpatrick, L A; Parker, A J

    2016-01-01

    The objectives of the present study were to evaluate the basal concentrations of heat shock proteins (HSP) between and cattle and to determine if HSP basal concentrations change as an animal matures. A total of 40 cattle were used in a 2 × 2 factorial design to evaluate the effects of genotype and age (heifers and mature cows) on basal concentrations of heat shock protein 27 (HSP27), α B-crystallin (Cryab), and heat shock protein 70 (HSP70). Each experimental group of 10 animals was sampled on a separate day over a period of 4 wk during July 2014. A muscle sample was collected from the longissimus thoracis (LT) and concentrations of HSP were quantified using ELISA. There were no significant differences in HSP concentration for the interaction between age and genotype or for age alone. cattle had greater ( cattle. The results of this study show that basal in vivo HSP concentrations differ between and cattle. However, further studies are needed to investigate the relationship between HSP concentrations and meat tenderness with respect to genotypes to see if HSP concentrations account for at least some variability in tenderness differences.

  8. Assessment of adaptability of zebu cattle ( Bos indicus) breeds in two different climatic conditions: using cytogenetic techniques on genome integrity

    Science.gov (United States)

    Kumar, Anil; Waiz, Syma Ashraf; Sridhar Goud, T.; Tonk, R. K.; Grewal, Anita; Singh, S. V.; Yadav, B. R.; Upadhyay, R. C.

    2016-06-01

    The aim of this study was to evaluate the genome integrity so as to assess the adaptability of three breeds of indigenous cattle reared under arid and semi-arid regions of Rajasthan (Bikaner) and Haryana (Karnal) India. The cattle were of homogenous group (same age and sex) of indigenous breeds viz. Sahiwal, Tharparkar and Kankrej. A total of 100 animals were selected for this study from both climatic conditions. The sister chromatid exchanges (SCE's), chromosomal gaps and chromatid breaks were observed in metaphase plates of chromosome preparations obtained from in vitro culture of peripheral blood lymphocytes. The mean number of breaks and gaps in Sahiwal and Tharparkar of semi-arid zone were 8.56 ± 3.16, 6.4 ± 3.39 and 8.72 ± 2.04, 3.52 ± 6.29, respectively. Similarly, the mean number of breaks and gaps in Tharparkar and Kankrej cattle of arid zone were 5.26 ± 1.76, 2.74 ± 1.76 and 5.24 ± 1.84, 2.5 ± 1.26, respectively. The frequency of SCEs in chromosomes was found significantly higher ( P 0.05) was observed in the same zone. The analysis of frequency of CAs and SCEs revealed significant effects of environmental conditions on the genome integrity of animals, thereby indicating an association with their adaptability.

  9. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions

    DEFF Research Database (Denmark)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie;

    2016-01-01

    There is strong evidence that the immunity induced by live vaccination for control of the protozoan parasite Theileria parva is mediated by class I MHC-restricted CD8+ T cells directed against the schizont stage of the parasite that infects bovine lymphocytes. The functional competency of class I...

  10. Characterization of genetic polymorphism of the bovine lymphocyte antigen DRB3.2 locus in Kankrej cattle (Bos indicus).

    Science.gov (United States)

    Behl, J D; Verma, N K; Behl, R; Mukesh, M; Ahlawat, S P S

    2007-06-01

    Bovine lymphocyte antigen DRB 3.2 (BoLA-DRB3.2) gene encodes for the beta chain of the major histocompatibility complex (MHC) class II molecule in cattle, which is a glycoprotein present on the surface of antigen-presenting cells. This locus shows extensive polymorphism in it. The objective of the present study was to genotype the BoLA-DRB3.2 locus in Kankrej cattle (n = 50) by PCR-RFLP. Bovine DNA was isolated from aliquots of whole blood. Primers specific for exon 2 of the bovine lymphocyte antigen (BoLA)-DRB3 gene were used to amplify the region. The 304-bp amplified product of the DRB3 gene was separately digested with restriction endonucleases RsaI, BstYI, and Hae III. Twenty-four BoLA-DRB 3.2 alleles were identified with frequencies ranging from 1 to 22.0%. Twenty-one alleles of the total 24 alleles were similar to those reported earlier; 3 alleles were new and had not been reported previously. The allele BoLA-DRB3.2*34 occurred at the highest frequency of 22% (approx.) in the Kankrej animals studied. Six alleles (BoLA-DRB3.2 *34, *15, *06, *20, *37, and *20) accounted for almost 71% of the total alleles observed to be present in the Kankrej animals. All the new alleles observed were present at frequencies of 1%. The results obtained in the present study demonstrated that the BoLA DRB3.2 locus is highly polymorphic in the Kankrej cattle.

  11. 猪羊牛蹄甲中氨基已糖定量分析%Content Determination of Aminohexose in Toenails of Susscrofa domestica, Bos taurus Capra hirus and domesticus

    Institute of Scientific and Technical Information of China (English)

    李文林; 武露凌; 李熔

    2000-01-01

    用 Elson-Morgan 法测定了蹄甲类药材猪科(Suid ae)动物猪 Susscrofa domestica、牛科(Boridae)动物山羊 Capra hirus 及黄牛 Bos taur us domesticus 中的酸性粘多糖含量.结果提示氨基已糖含量:牛蹄甲>羊蹄甲>猪蹄甲.

  12. The efficacy of a vitamin D(3) metabolite for improving the myofibrillar tenderness of meat from Bos indicus cattle.

    Science.gov (United States)

    Lawrence, R W; Doyle, J; Elliott, R; Loxton, I; McMeniman, J P; Norton, B W; Reid, D J; Tume, R W

    2006-01-01

    The influence of a once only administration of a metabolite of vitamin D(3) (HY·D(®)-25-hydroxy vitamin D(3)) on myofibrillar meat tenderness in Australian Brahman cattle was studied. Ninety-six Brahman steers of three phenotypes (Indo-Brazil, US and US/European) and with two previous hormonal growth promotant (HGP) histories (implanted or not implanted with Compudose(®)) were fed a standard feedlot ration for 70d. Treatment groups of 24 steers were offered daily 10g/head HY·D(®) (125mg 25-hydroxyvitamin D(3)) for 6, 4, or 2d before slaughter. One other group of 24 steers was given the basal diet without HY·D(®). Feed lot performance, blood and muscle samples and carcass quality data were collected at slaughter. Calcium, magnesium, potassium, sodium, iron and Vitamin D(3) metabolites were measured in plasma and longissimus dorsi muscle. Warner-Bratzler (WB) shear force (peak force, initial yield) and other objective meat quality measurements were made on the longissimus dorsi muscle of each steer after ageing for 1, 7 and 14d post-mortem at 0-2°C. There were no significant effects of HY·D(®) supplements on average daily gain (ADG, 1.28-1.45kg/d) over the experimental period. HY·D(®) supplements given 6d prior to slaughter resulted in significantly higher (P<0.05) initial yield values compared to supplements given 2d prior to slaughter. Supplementation had no significant effect on meat colour, ultimate pH, sarcomere length, cooking loss, instron compression or peak force. There was a significant treatment (HY·D(®)) by phenotype/HGP interaction for peak force (P=0.028), in which Indo-Brazil steers without previous HGP treatment responded positively (increased tenderness) to HY·D(®) supplements at 2d when compared with Indo-Brazil steers previously given HGP. There were no significant effects of treatment on other phenotypes. HY·D(®) supplements did not affect muscle or plasma concentrations of calcium, potassium or sodium, but did significantly

  13. Ovariectomy effect in heifers Nelore x Angus, Bos taurus indicus x Bos taurus taurus on the weight gains /Efeito da ovariectomia em novilhas Nelore x Angus, Bos taurus indicus x Bos taurus taurus sobre os ganhos de peso

    Directory of Open Access Journals (Sweden)

    Sérgio do Nascimento Kronka

    2007-10-01

    Full Text Available This study aimed to evaluate the weight gain in cross breed heifers Nelore X Angus, spayed and nonspayed, kept on pasture and confinement. The animals were allotted in two groups as follows: group 1 consisted of 30 nonspayed heifers with 18 months old. Group 2 was composed of 30 spayed heifers with 18 months old. The animals were allotted in pasture of Brachiaria decumbens and weighted at 39and 75 days. Significant difference was observed between the average daily gain of the two groups – G1 and G2 (75th day, respectively (0.51 kg and 0.65 kg; PEsse estudo teve o objetivo de avaliar o ganho de peso em novilhas mestiças Nelore x Angus, castradas e não castradas, mantidas em pastagem e confinamento. Os animais foram alocados em dois grupos assim constituídos: grupo 1 formado por 30 novilhas não castradas com 18 meses de idade. Grupo 2 composto por 30 novilhas castradas com 18 meses de idade. Os animais foram mantidos em pastagem de Brachiaria decumbens e pesados aos 39 e 75 dias. Diferença significativa foi observada entre o ganho médio diário dos dois grupos – G1 e G2 (75ºdia, respectivamente (0,51 kg e 0,65 kg; P < 0,01. No dia seguinte (76ºdia, todos os animais foram transferidos e mantidos por 144 dias no confinamento. Diferença significativa foi observada entre o ganho médio diário dos dois grupos – G1 e G2 (144ºdia, respectivamente (0,73 kg e 0,58 kg; P < 0,01. Os resultados desse experimento mostraram que novilhas castradas apresentaram um maior ganho diário em pastagem.

  14. Ovariectomy effect in heifers Nelore x Angus, Bos taurus indicus x Bos taurus taurus on the weight gains

    OpenAIRE

    Sérgio do Nascimento Kronka; Eunice Oba; Maurício de Faria Marin; Marcelo George Mungai Chacur

    2007-01-01

    Esse estudo teve o objetivo de avaliar o ganho de peso em novilhas mestiças Nelore x Angus, castradas e não castradas, mantidas em pastagem e confinamento. Os animais foram alocados em dois grupos assim constituídos: grupo 1 formado por 30 novilhas não castradas com 18 meses de idade. Grupo 2 composto por 30 novilhas castradas com 18 meses de idade. Os animais foram mantidos em pastagem de Brachiaria decumbens e pesados aos 39 e 75 dias. Diferença significativa foi observada entre o ganho méd...

  15. A comparison of the metabolism of the abortifacient compounds from Ponderosa pine needles in conditioned versus naive cattle.

    Science.gov (United States)

    Welch, K D; Gardner, D R; Pfister, J A; Panter, K E; Zieglar, J; Hall, J O

    2012-12-01

    Isocupressic acid (ICA) is the abortifacient compound in ponderosa pine (Pinus ponderosa L.) needles, which can cause late-term abortions in cattle (Bos taurus). However, cattle rapidly metabolize ICA to agathic acid (AGA) and subsequent metabolites. When pine needles are dosed orally to cattle, no ICA is detected in their serum, whereas AGA is readily detected. Recent research has demonstrated that AGA is also an abortifacient compound in cattle. The observation has been made that when cattle are dosed with labdane acids for an extended time, the concentration of AGA in serum increases for 1 to 2 d but then decreases to baseline after 5 to 6 d even though they are still being dosed twice daily. Therefore, in this study we investigated whether cattle conditioned to pine needles metabolize ICA, and its metabolites, faster than naïve cattle. Agathic acid was readily detected in the serum of naïve cattle fed ponderosa pine needles, whereas very little AGA was detected in the serum of cattle conditioned to pine needles. We also compared the metabolism of ICA in vitro using rumen cultures from pine-needle-conditioned and naïve cattle. In the rumen cultures from conditioned cattle, AGA concentrations were dramatically less than rumen cultures from naïve cattle. Thus, an adaptation occurs to cattle conditioned to pine needles such that the metabolism AGA by the rumen microflora is altered.

  16. Some comparative aspects of the pharmacokinetics of tylosin in buffaloes and cattle.

    Science.gov (United States)

    Saurit, A R; Rubio, M; Baroni, E; San, Andrés M; Sánchez, S; Boggio, J C

    2002-01-01

    The pharmacokinetics of tylosin were compared in cattle (Bos taurus) and buffaloes (Bubalus bubalis). Six animals received each a single dose of 10 mg/kg of tylosin tartrate by the intramuscular route. The serum concentration (Cmax) and the volume of distribution (Vd) presented significant differences between the two species. Cmax was 0.40 +/- 0.046 microg/ml for buffaloes and 0.64 +/- 0.068 microg/ml for cattle. Vd was 1.91 +/- 0.12 L/kg and 1.33 +/- 0.09 L/kg for buffaloes and cattle, respectively. However, as the present study did not show considerable differences in the pharmacokinetics of tylosin in buffaloes and cattle, similar dosage regimes of this drug can be recommended for both species.

  17. Treatments to Optimize the Use of Artificial Insemination and Reproductive Efficiency in Beef Cattle under Tropical Environments

    Directory of Open Access Journals (Sweden)

    Ocilon Gomes de Sá Filho

    2011-01-01

    Full Text Available Bos indicus cattle, the preferred genetic group in tropical climates, are characterized by having a lower reproductive efficiency than Bos taurus. The reasons for the poorer reproductive efficiency of the Bos indicus cows include longer lengths of gestation and postpartum anestrus, a short length of estrous behavior with a high incidence of estrus occurring during the dark hours, and puberty at older age and at a higher percentage of body weight relative to mature body weight. Moreover, geography, environment, economics, and social traditions are factors contributing for a lower use of reproductive biotechnologies in tropical environments. Hormonal protocols have been developed to resolve some of the reproductive challenges of the Bos indicus cattle and allow artificial insemination, which is the main strategy to hasten genetic improvement in commercial beef ranches. Most of these treatments use exogenous sources of progesterone associated with strategies to improve the final maturation of the dominant follicle, such as temporary weaning and exogenous gonadotropins. These treatments have caused large impacts on reproductive performance of beef cattle reared under tropical areas.

  18. GENETIC VARIABILITY OF THE ZEBU CATTLE BREED (Bos indicus IN THE DEPARTAMENT OF HUILA, COLOMBIA USING MICROSATELLITE MOLECULAR MARKERS Variabilidad genética de Zebú (Bos indicus en el departamento del Huila, Colombia, usando marcadores moleculares por microsatélites

    Directory of Open Access Journals (Sweden)

    CARLOS HERNÁNDEZ ESCOBAR

    Full Text Available The polymorphism of 11 microsatellites from zebu cattle (Bos indicus was studied using a commercial multiplex system to estimate genetic variability. Allele frequencies polymorphism information content and heterozygosis were calculated. Allele frequencies revealed that in the analyzed sample the markers were not equally polymorphic. The average allele was 14.2 with the highest values for the TGLA122 microsatellites. The mean heterozygocity was 0.7056 and the polymorphism information content was 0.668. This multiplex analysis could be used for pedigree information and for adequate genetic improvements in breeding programs and paternity test.Para estimar la variabilidad genética, el polimosfismo de 11 microsatélites de vacunos zebú (Bos indicus fue estudiado mediante el sistema comercial multiplex system. Se calcularon frecuencias alélicas, contenido de información polimórfica y heterocigosis. Las frecuencias alélicas de la muestra analizada revelan que los marcadores no fueron equitativamente polimórficos. El alelo promedio fue 14,2 con el mayor valor para los microsatélites TGLA122. El promedio de heterocigosidad fue 0,7056 y el contenido de información polimórfica de 0,668. Este tipo de análisis puede ser usado para información de pedigrí y mejoramiento genético en programas de cría y pruebas de paternidad.

  19. Allelic Diversity of Major Histocompatibility Complex Class II DRB Gene in Indian Cattle and Buffalo

    Directory of Open Access Journals (Sweden)

    Sachinandan De

    2011-01-01

    Full Text Available The present study was conducted to study the diversity of MHC-DRB3 alleles in Indian cattle and buffalo breeds. Previously reported BoLA-DRB exon 2 alleles of Indian Zebu cattle, Bos taurus cattle, buffalo, sheep, and goats were analyzed for the identities and divergence among various allele sequences. Comparison of predicted amino acid residues of DRB3 exon 2 alleles with similar alleles from other ruminants revealed considerable congruence in amino acid substitution pattern. These alleles showed a high degree of nucleotide and amino acid polymorphism at positions forming peptide-binding regions. A higher rate of nonsynonymous substitution was detected at the peptide-binding regions, indicating that BoLA-DRB3 allelic sequence evolution was driven by positive selection.

  20. Adipose tissue partitioning of limit-fed beef cattle and beef cattle with ad libitum access to feed differing in adaptation to heat.

    Science.gov (United States)

    Sprinkle, J E; Ferrell, C L; Holloway, J W; Warrington, B G; Greene, L W; Wu, G; Stuth, J W

    1998-03-01

    We compared fat distribution and lipoprotein lipase (LPL) activity in steers differing in adaptability to the subtropics. Steers were fed a grain diet (3.13 Mcal ME/kg DM) at limited (150 kcal ME x kg[-.75] x d[-1]; .23 kg ADG) or ad libitum levels for 140 d, then slaughtered. Sixteen British- (8 Angus, 8 Hereford; S), 16 Boran- (R), 16 Brahman- (B), and 16 Tuli- (T) cross steers from MARC III composite cows were used. Adipose tissue samples from perirenal, omental, and subcutaneous depots were analyzed for LPL activity. Carcass measurements including omental, external, and seam fat trim from 1/ 2 of the carcass were measured. Subcutaneous fat had greater (P .05) in fat distribution for steers fed at limited levels. Means for ADG, slaughter weights, carcass weights, yield grades, and carcass lipid weights for S and B fed for ad libitum intake were greater (P .05) for the other breeds with ad libitum intake. Factor analysis of fat depots for animals with ad libitum intake indicated that Bos taurus cattle differing in adaptation to heat deposited fat differently; S deposited greater (P carcass fat and T deposited greater (P < .05) proportions of internal fat. It seems that accumulation of internal fat is detrimental for ADG for Bos taurus cattle.

  1. Incorporation of aurochs into a cattle herd in Neolithic Europe: single event or breeding?

    Science.gov (United States)

    Schibler, Jörg; Elsner, Julia; Schlumbaum, Angela

    2014-07-01

    Domestication is an ongoing process continuously changing the lives of animals and humans and the environment. For the majority of European cattle (Bos taurus) genetic and archaeozoological evidence support initial domestication ca. 11'000 BP in the Near East from few founder aurochs (Bos primigenius) belonging to the mitochondrial DNA T macro-haplogroup. Gene flow between wild European aurochs of P haplogroup and domestic cattle of T haplogroup, coexisting over thousands of years, appears to have been sporadic. We report archaeozoological and ancient DNA evidence for the incorporation of wild stock into a domestic cattle herd from a Neolithic lake-dwelling in Switzerland. A complete metacarpus of a small and compact adult bovid is morphologically and genetically a female. With withers height of ca. 112 cm, it is comparable in size with small domestic cattle from contemporaneous sites in the area. The bone is directly dated to 3360-3090 cal BC and associated to the Horgen culture, a period of the secondary products revolution. The cow possessed a novel mtDNA P haplotype variant of the European aurochs. We argue this is either a single event or, based on osteological characteristics of the Horgen cattle, a rare instance of intentional breeding with female aurochs.

  2. Worldwide patterns of ancestry, divergence, and admixture in domesticated cattle.

    Directory of Open Access Journals (Sweden)

    Jared E Decker

    2014-03-01

    Full Text Available The domestication and development of cattle has considerably impacted human societies, but the histories of cattle breeds and populations have been poorly understood especially for African, Asian, and American breeds. Using genotypes from 43,043 autosomal single nucleotide polymorphism markers scored in 1,543 animals, we evaluate the population structure of 134 domesticated bovid breeds. Regardless of the analytical method or sample subset, the three major groups of Asian indicine, Eurasian taurine, and African taurine were consistently observed. Patterns of geographic dispersal resulting from co-migration with humans and exportation are recognizable in phylogenetic networks. All analytical methods reveal patterns of hybridization which occurred after divergence. Using 19 breeds, we map the cline of indicine introgression into Africa. We infer that African taurine possess a large portion of wild African auroch ancestry, causing their divergence from Eurasian taurine. We detect exportation patterns in Asia and identify a cline of Eurasian taurine/indicine hybridization in Asia. We also identify the influence of species other than Bos taurus taurus and B. t. indicus in the formation of Asian breeds. We detect the pronounced influence of Shorthorn cattle in the formation of European breeds. Iberian and Italian cattle possess introgression from African taurine. American Criollo cattle originate from Iberia, and not directly from Africa with African ancestry inherited via Iberian ancestors. Indicine introgression into American cattle occurred in the Americas, and not Europe. We argue that cattle migration, movement and trading followed by admixture have been important forces in shaping modern bovine genomic variation.

  3. Prevalence of infection and molecular confirmation by using ITS-2 region of Fasciola gigantica found in domestic cattle from Chiang Mai province, Thailand

    Institute of Scientific and Technical Information of China (English)

    Anawat Phalee; Chalobol Wongsawad

    2014-01-01

    Objective:To investigate the infection ofFasciola gigantica(F. gigantica) in domestic cattle from ChiangMai province and molecular confirmation usingITS-2 region.Methods:The liver and gall bladder ofBubalus bubalis(B. bubalis) andBos taurus(B. taurus) from slaughterhouses were examined adult worms and prevalence investigation.The species confirmation with phylogenetic analysis usingITS-2 sequences was performed by maximum likelihood andUPGMA methods. Results:The total prevalences of infection inB. bubalis andBubalus taurus(B. taurus) were 67.27% and52.94% respectively.The respective prevalence in bothB. bubalis andB. taurus were acquired fromDoi-Saket,Muang, andSanpatong districts, with81.25%,62.50% and60.00% for B. bubalis and62.50%,50.00% and47.06% forBos taurus respectively.The species confirmation ofF. gigantica and some related species by basing on maximum likelihood andUPGMA methods used,4 groups of trematodes weregenerated, firstF. gigantica group including specimen ofChiang Mai, second2 samples of F. hepatica, third group of3 rumen flukes;Orthocoelium streptocoelium, F. elongatus andParamphistomum epliclitum and fourth group of3 minute intestinal flukes;Haplorchis taichui, Stellantchasmu falcatus,Haplorchoides sp. and liver fluke;Opisthorchis viverrini respectively.Conclusions:These results can be confirmed theGiant liver fluke which mainly caused fascioliasis inChiangMai was identified asF. gigantica and specimens were the same as those ofF. gigantica recorded in other different countries.Nucleotide sequence of ITS-2 region has been proven as effective diagnostic tool for the identification ofF. gigantica.

  4. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  5. Genome-Wide microRNA Binding Site Variation between Extinct Wild Aurochs and Modern Cattle Identifies Candidate microRNA-Regulated Domestication Genes

    Science.gov (United States)

    Braud, Martin; Magee, David A.; Park, Stephen D. E.; Sonstegard, Tad S.; Waters, Sinead M.; MacHugh, David E.; Spillane, Charles

    2017-01-01

    The domestication of cattle from the now-extinct wild aurochs (Bos primigenius) involved selection for physiological and behavioral traits, with underlying genetic factors that remain largely unknown. Non-coding microRNAs have emerged as key regulators of the spatio-temporal expression of target genes controlling mammalian growth and development, including in livestock species. During the domestication process, selection of mutational changes in miRNAs and/or miRNA binding sites could have provided a mechanism to generate some of the traits that differentiate domesticated cattle from wild aurochs. To investigate this, we analyzed the open reading frame DNA sequence of 19,994 orthologous protein-coding gene pairs from extant Bos taurus genomes and a single extinct B. primigenius genome. We identified miRNA binding site polymorphisms in the 3′ UTRs of 1,620 of these orthologous genes. These 1,620 genes with altered miRNA binding sites between the B. taurus and B. primigenius lineages represent candidate domestication genes. Using a novel Score Site ratio metric we have ranked these miRNA-regulated genes according to the extent of divergence between miRNA binding site presence, frequency and copy number between the orthologous genes from B. taurus and B. primigenius. This provides an unbiased approach to identify cattle genes that have undergone the most changes in miRNA binding (i.e., regulation) between the wild aurochs and modern-day cattle breeds. In addition, we demonstrate that these 1,620 candidate domestication genes are enriched for roles in pigmentation, fertility, neurobiology, metabolism, immunity and production traits (including milk quality and feed efficiency). Our findings suggest that directional selection of miRNA regulatory variants was important in the domestication and subsequent artificial selection that gave rise to modern taurine cattle. PMID:28197171

  6. Genome-wide association analysis of milk yield traits in Nordic Red Cattle using imputed whole genome sequence variants

    DEFF Research Database (Denmark)

    Iso-Touru, T; Sahana, G; Guldbrandtsen, B;

    2016-01-01

    variants behind them. In this study, we used whole genome sequence level data from 4280 progeny tested Nordic Red Cattle bulls to scan the genome for loci affecting milk, fat and protein yields. RESULTS: Using a genome-wise significance threshold, regions on Bos taurus chromosomes 5, 14, 23, 25 and 26 were...... traits via biological networks. CONCLUSION: This is the first time when whole genome sequence data is utilized to study genomic regions affecting milk production in the Nordic Red Cattle population. Sequence level data offers the possibility to study quantitative traits in detail but still cannot......BACKGROUND: The Nordic Red Cattle consisting of three different populations from Finland, Sweden and Denmark are under a joint breeding value estimation system. The long history of recording of production and health traits offers a great opportunity to study production traits and identify causal...

  7. Infestation by Haematopinus quadripertusus on cattle in São Domingos do Capim, state of Pará, Brazil Infestação por Haematopinus quadripertusus em bovinos de São Domingos do Capim, Estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Alessandra Scofield

    2012-09-01

    Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23

  8. Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

    Directory of Open Access Journals (Sweden)

    Leslie Scarpelli

    2009-01-01

    Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

  9. Chemical classification of cattle. 2. Phylogenetic tree and specific status of the Zebu.

    Science.gov (United States)

    Manwell, C; Baker, C M

    1980-01-01

    Phylogenetic trees for the ten major breed groups of cattle were constructed by Farris's (1972) maximum parsimony method, or Fitch & Margoliash's (1967) method, which averages ou the deviation over the entire assemblage. Both techniques yield essentially identical trees. The phylogenetic tree for the ten major cattle breed groups can be superimposed on a map of Europe and western Asia, the root of the tree being close to the 'fertile crescent' in Asia Minor, believed to be a primary centre of bovine domestication. For some but not all protein variants there is a cline of gene frequencies as one proceeds from the British Isles and northwest Europe towards southeast Europe and Asia Minor, with the most extreme gene frequencies in the Zebu breeds of India. It is not clear to what extent the observed clines are primary or secondary, i.e., consequent to the initial migrations of cattle towards the end of the Pleistocene or consequent to the many migrations of man with his domesticated cattle. Such clines as exist are not in themselves sufficient to prove either selection versus genetic drift or to establish taxonomic ranking. Contrary to some suggestions in the literature, the biochemical evidence supports Linnaeus's original conclusions: Bos taurus and Bos indicus are distinct species.

  10. Some preliminary observations on the susceptibility and resistance of different cattle breeds to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available Theileria parva-naïve Friesian (Bos taurus, Boran (Bos indicus and Maasai Zebu steers (B. indicus were infected with a T. parva sporozoite stabilate dose which had previously been shown to induce an estimated 50 % mortality rate in Boran cattle. All the cattle developed patent infections with no significant differences in the length of the prepatent period to development of macroschizonts (P > 0.05 between the three groups. Clinical theileriosis occurred in all eight the Friesians (100 %, five out of nine Borans (55.6 % and two out of five Zebus (40 %. Three of the Friesians (37.5 %, and two of the Borans (22.2 % died of theileriosis. The different cattle types were equally susceptible to the infective dose used as indicated by the length of the prepatent periods, but there was a marked difference in their development of clinical theileriosis. The gradation in resistance to disease confirms the findings of earlier less critical studies and identifies these cattle breeds as suitable for investigations into the mechanisms of resistance to theileriosis.

  11. Association of the bovine major histocompatibility complex (BoLA BoLA-DRB3 gene with fat and protein production and somatic cell score in Brazilian Gyr dairy cattle (Bos indicus

    Directory of Open Access Journals (Sweden)

    Carlos Souza do Nascimento

    2006-01-01

    Full Text Available The effect of the bovine major histocompatibility complex (BoLA locus on animal health may be due to a direct action of its alleles on immune functions, whereas its indirect effect on production traits might be explained by the better general health conditions of more productive animals. In the present study, the BoLA-DRB3 gene was investigated in 1058 cows belonging to seven Brazilian Gyr Dairy herds (Bos indicus, Zebu cattle. A total of 37 alleles were identified, 15 of them described for the first time in a Zebu breed. A highly significant association (p < 0.02 was observed between allele *54 and a decrease (-26.1 kg in milk protein yield and there was a significant association (p < 0.05 between this allele and lower (-26.07 kg milk fat yield. There was also a significant association (p < 0.05 between allele *6 and decreased (-12.47 kg milk protein and allele *7 and increased (12.72 kg milk protein. There were also indications of association (p < 0.10 between somatic cell score (SCS and alleles *3 (SCS increased by 0.54 units and *31 (SCS increased by 0.46 units. The highly significant association of allele *54 with lower protein yield suggests the possible use of this allele in marker-assisted selection programs.

  12. BIOACTIVE PEPTIDES OF THE COW MILK WHEY PROTEINS (Bos taurus

    Directory of Open Access Journals (Sweden)

    A. V. Iukalo

    2013-10-01

    Full Text Available Data on the biological functions of milk whey proteins, which are implemented at the level of their proteolytic degradation products — bioactive peptides have been reviewed. The main functions of these proteins is to provide the amino acid nutrition of mammals in the early stages of development, as well as the transport of fatty acids, retinol, involved in the synthesis of lactose, ions of calcium and iron, immune protection, antimicrobial action, etc. However, in recent years, it has been found that milk proteins like casein are precursors of biologically active peptides. Аngiotensin — converting enzyme, opioid peptides which are opiate receptor agonists, anti–microbial peptides, peptides with immunomodulatory and hypocholesterolemic action, and peptides affecting motility have been found among the products of proteolytic degradation of ?-lactoglobulin, ?-laktoalbumin, lactoferrin and milk whey albumin. Also data on the possible participation of peptides from milk whey proteins in the implementation of the biological functions of both the assimilation of calcium, antioxidant effect, the regulation of appetite, anticarcinogenic are provided. The authors assume that the phenomenon of bioactive peptides formation could be considered as an additional function of natural food proteins, which gives advantages to the mammals and has a positive effect on their development in the postnatal period. Ways of bioactive peptides formation, their resistance to action of proteolytic enzymes, the ability to cross into the bloodstream and have biological effects have been also discussed. Up to date, only a few products with bioactive peptides from milk whey proteins are obtained. Further studies of their structure, mechanism of action, ways of formation and methods of isolation are required for their wider use. Formation of functional products based on bioactive peptides from milk whey proteins will allow efficient use of milk whey, which is often a byproduct of the dairy industry.

  13. 反义RNA干扰MSTN对牛肌肉卫星细胞脂肪生成相关基因的影响%Effect of MSTN Knockdown by Antisense RNA on Expression of Genes Associated with Fat Deposition in Bovine (Bos taurus) Muscle Satellite Cells

    Institute of Scientific and Technical Information of China (English)

    高丽; 胡思敏; 谷明娟; 王丽荣; 扈廷茂; 李光鹏

    2016-01-01

    肌肉生长抑制素(myostatin,MSTN)属于转化生长因子β(transforming growth factor β,TGF-β)超家族成员,在骨骼肌中高表达;敲除MSTN后,肌肉质量增加、脂肪含量变少,但抑制MSTN表达后,如何影响脂肪沉积,尚未研究清楚.为了探究抑制MSTN表达后对脂肪相关基因表达的影响,本研究利用反义RNA技术,成功构建了双向表达载体pMSTN-CMV-CAG-antiMSTN,并通过Western blot筛选出抑制效果最佳的MSTN的反义载体.利用最佳反义MSTN载体在牛(Bos taurus)肌肉卫星细胞中有效干扰MSTN表达后,检测了脂肪合成相关基因(脂肪酸合酶(fatty acid synthase,FASN),乙酰CoA羧化酶(acetyl-CoA carboxylase,ACC)和硬脂酰辅酶A去饱和酶1(stearoyl-CoA desaturase-1,SCD-1))、脂肪酸氧化分解相关基因(肉毒碱棕榈酰转移酶ⅠB(carnitine palmitoyltransferase 1b,CPT-ⅠB),乙酰辅酶A氧化酶(acyl-CoAoxidase,ACOX1)和烯酰辅酶A水合酶(enoyl-CoA hydratase 1,ECHDC1))以及脂肪转运蛋白(fatty acidtransport proteins,FATP)表达的变化.结果显示,在MSTN基因被干扰后,肌肉卫星细胞中脂肪酸合成相关基因表达量上调,脂肪氧化分解相关基因中ACOX1和CPT-1B表达量上调,而ECHDC1基因表达量下调,另外,FATP表达基本没有变化.MSTN功能缺失后,脂肪合成和脂肪氧化分解过程都得到了加强,所以MSTN敲除所导致的脂肪减少并不是由于抑制了脂肪合成,而是由于脂肪分解加强,为肌肉提供更多的能量.MSTN下调后,CPT-1B的表达上调最为显著,而CPT-1B是脂肪酸β氧化的关键基因,所以研究结果提示MSTN对于脂肪的影响主要是通过影响β氧化过程实现的.研究结果为MSTN下调所导致的脂肪含量下降提供了理论依据,为MSTN作用于脂肪沉积的机制做出了初步探讨.

  14. Promoter region of the bovine growth hormone receptor gene: single nucleotide polymorphism discovery in cattle and association with performance in Brangus bulls.

    Science.gov (United States)

    Garrett, A J; Rincon, G; Medrano, J F; Elzo, M A; Silver, G A; Thomas, M G

    2008-12-01

    Expression of the GH receptor (GHR) gene and its binding with GH is essential for growth and fat metabolism. A GT microsatellite exists in the promoter of bovine GHR segregating short (11 bp) and long (16 to 20 bp) allele sequences. To detect SNP and complete an association study of genotype to phenotype, we resequenced a 1,195-bp fragment of DNA including the GT microsatellite and exon 1A. Resequencing was completed in 48 familialy unrelated Holstein, Jersey, Brown Swiss, Simmental, Angus, Brahman, and Brangus cattle. Nine SNP were identified. Phylogeny analyses revealed minor distance (i.e., Brahman cattle averaged 27.4 +/- 0.07% divergence from the Bos taurus breeds, whereas divergence of Brangus was intermediate. An association study of genotype to phenotype was completed with data from growing Brangus bulls (n = 553 from 96 sires) and data from 4 of the SNP flanking the GT microsatellite. These SNP were found to be in Hardy-Weinberg equilibrium and in phase based on linkage disequilibrium analyses (r(2) = 0.84 and D'= 0.92). An A/G tag SNP was identified (ss86273136) and was located in exon 1A, which began 88 bp downstream from the GT microsatellite. Minor allele frequency of the tag SNP was greater than 10%, and Mendelian segregation was verified in 3 generation pedigrees. The A allele was derived from Brahman, and the G allele was derived from Angus. This tag SNP genotype was a significant effect in analyses of rib fat data collected with ultrasound when bulls were ~365 d of age. Specifically, bulls of the GG genotype had 6.1% more (P = 0.0204) rib fat than bulls of the AA and AG genotypes, respectively. Tag SNP (ss86273136), located in the promoter of GHR, appears to be associated with a measure of corporal fat in Bos taurus x Bos indicus composite cattle.

  15. PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds

    Science.gov (United States)

    Kolte, Sunil W.; Larcombe, Stephen D.; Jadhao, Suresh G.; Magar, Swapnil P.; Warthi, Ganesh; Kurkure, Nitin V.; Glass, Elizabeth J.; Shiels, Brian R.

    2017-01-01

    Tick-borne pathogens (TBP) are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD), most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey) with native Bos indicus (numerous) breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type). The model showed significant association between infection with TBP (particularly apicomplexan parasites) and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic benefit. PMID

  16. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Pbrucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial.

  17. Comparison of SNP variation and distribution in indigenous ethiopian and korean cattle (hanwoo) populations.

    Science.gov (United States)

    Edea, Zewdu; Dadi, Hailu; Kim, Sang Wook; Dessie, Tadelle; Kim, Kwan-Suk

    2012-09-01

    Although a large number of single nucleotide polymorphisms (SNPs) have been identified from the bovine genome-sequencing project, few of these have been validated at large in Bos indicus breeds. We have genotyped 192 animals, representing 5 cattle populations of Ethiopia, with the Illumina Bovine 8K SNP BeadChip. These include 1 Sanga (Danakil), 3 zebu (Borana, Arsi and Ambo), and 1 zebu × Sanga intermediate (Horro) breeds. The Hanwoo (Bos taurus) was included for comparison purposes. Analysis of 7,045 SNP markers revealed that the mean minor allele frequency (MAF) was 0.23, 0.22, 0.21, 0.21, 0.23, and 0.29 for Ambo, Arsi, Borana, Danakil, Horro, and Hanwoo, respectively. Significant differences of MAF were observed between the indigenous Ethiopian cattle populations and Hanwoo breed (p < 0.001). Across the Ethiopian cattle populations, a common variant MAF (≥0.10 and ≤0.5) accounted for an overall estimated 73.79% of the 7,045 SNPs. The Hanwoo displayed a higher proportion of common variant SNPs (90%). Investigation within Ethiopian cattle populations showed that on average, 16.64% of the markers were monomorphic, but in the Hanwoo breed, only 6% of the markers were monomorphic. Across the sampled Ethiopian cattle populations, the mean observed and expected heterozygosities were 0.314 and 0.313, respectively. The level of SNP variation identified in this particular study highlights that these markers can be potentially used for genetic studies in African cattle breeds.

  18. Mitochondrial DNA of Nellore and European x Nellore crossing cattle of high performance DNA mitocondrial de bovinos Nelore e cruzados Europeu x Nelore de alto desempenho

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2007-08-01

    Full Text Available The objective of this work was to evaluate, through a polymorphism in the ND5 gene of the bovine mitochondrial DNA, the frequency of Bos taurus indicus mtDNA individuals in a sample of Nellore purebred origin animals (n = 69 and crossbred animals originated from crosses of European sires and Nellore purebred origin females (n = 275. Only 2.26% (8/354 of the animals presented Bos taurus indicus mtDNA. The high frequency of Bos taurus taurus mtDNA in these animals can be a consequence of selection, once the animals studied are originated from selected lineages of high performance for meat production.O objetivo deste trabalho foi avaliar, por meio de um polimorfismo no gene ND5 do DNA mitocondrial de bovinos, a porcentagem de indivíduos portadores de mtDNA Bos taurus indicus em animais Nelore PO (n = 69 e em animais provenientes do cruzamento entre machos europeus e fêmeas Nelore PO (n = 275. Apenas 2,26% (8/354 dos animais apresentaram mtDNA Bos taurus indicus. A alta freqüência de mtDNA Bos taurus taurus nesses animais pode ser reflexo de seleção, uma vez que os animais estudados se originam de linhagens selecionadas para alto desempenho de produção de carne.

  19. Production and economic potentials of cattle in pasture-based systems of the western Amazon region of Brazil.

    Science.gov (United States)

    Rueda, B L; Blake, R W; Nicholson, C F; Fox, D G; Tedeschi, L O; Pell, A N; Fernandes, E C M; Valentim, J F; Carneiro, J C

    2003-12-01

    Our objectives were to evaluate strategies to improve productivity and economic returns from beef and dual-purpose cattle systems based on data collected on one dual-purpose (Bos taurus x Bos indicus) and two beef (Nellore) cattle farms in the western Amazon region of Brazil. Forage chemical composition and digestion rates of carbohydrate fractions of grazed Brachiaria decumbens and Brachiaria brizantha cv. Marandu grasses and Pueraria phaseoloides (tropical kudzu) legume were measured monthly during a 9-mo period from the end of one dry season to the end of the subsequent rainy season. Measurements of milk and growth responses to grazing these forages were used to predict animal productivity responses to dietary nutrient availability throughout an annual cycle. The ME available for gain in our simulations was always more limiting than metabolizable protein. The predicted ME available for gain was 0.50 kg/d for steers grazing B. brizantha and 0.40 kg/d for finishing steers grazing B. decumbens. Grasses contained more NDF and neutral detergent insoluble protein and less ME (P grass-legume pastures and greater stocking density is the preferable strategy for owners of these cattle systems to improve economic returns under current conditions. It also might help decrease the motivation for additional forest clearing.

  20. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS)

  1. 中国荷斯坦牛和鲁西黄牛mtDNA D-loop序列多态性分析%Sequence Diversity of Mitochondrial DNA D-loop Region in the Population of Chinese Holstein Cattle and Luxi Cattle

    Institute of Scientific and Technical Information of China (English)

    郝荣超; 王国华; 常玉霞; 杨国忠; 昝林森

    2011-01-01

    为了从母系遗传角度深入阐明中国荷斯坦牛和鲁西黄牛的群体遗传多样性以及起源进化,本研究采用PCR测序法测定了9头中国荷斯坦牛和11头鲁西黄牛的线粒体DNAD-loop区的部分序列,并经剪切后进行生物信息学软件分析。结果表明,20个个体D-loop区共711bp,共检测到19种单倍型和50个多态位点。核苷酸多样性(Pi)为0.02133±0.00454,单倍型多样性(Hd)为0.994±0.019,平均核苷酸差异数(k)为15.14620。构建的NJ网络进化树共分为两大支系,其中部分鲁西黄牛与瘤牛聚为一支,而中国荷斯坦牛和部分鲁西黄牛与普通黄牛聚为一支。说明中国荷斯坦牛和鲁西黄牛群体遗传多样性均较高;鲁西黄牛同时含有瘤牛和普通黄牛的血统,而中国荷斯坦牛只含有普通黄牛的血统。%In order to illustrate population genetic polymorphism and origin of Chinese Holstein cattle and Luxi cattle from the perspective of maternal inheritance,partial sequences of mitochondrial DNA D-loop of 9 Chinese Holsein cattles and 11 Luxi cattles were detected by PCR sequencing technology,and analyzed after cut by bioinformatics software.The results revealed that D-loop sequences were 711 bp in 20 individuals and there were 19 different haplotypes and 50 polymorphic sites.The mean nucleotide diversity(Pi) was 0.021 33±0.004 54,the haplotype diversity(Hd) was 0.994±0.019,and the average number of nucleotide differences(k) was 15.146 20.The neighbor joining(NJ) tree showed that there were two main branches in those 2 cattle breeds,in which,some Luxi cattles were clustered with Bos taurus lineage,and the others were in Bos indicus lineage which also included all Chinese Holsein cattles.The results indicated abundant genetic diversity in both two groups,and there were two marternal origins in Luxi cattle which were Bos taurus and Bos indicus,but in Chinese Holstein cattle only one origin of Bos taurus.

  2. Ovarian, hormonal, and reproductive events associated with synchronization of ovulation and timed appointment breeding of Bos indicus-influenced cattle using intravaginal progesterone, gonadotropin-releasing hormone, and prostaglandin F2alpha.

    Science.gov (United States)

    Saldarriaga, J P; Cooper, D A; Cartmill, J A; Zuluaga, J F; Stanko, R L; Williams, G L

    2007-01-01

    The objectives of this study were to 1) compare cumulative pregnancy rates in a traditional management (TM) scheme with those using a synchronization of ovulation protocol (CO-Synch + CIDR) for timed AI (TAI) in Bos indicus-influenced cattle; 2) evaluate ovarian and hormonal events associated with CO-Synch + CIDR and CO-Synch without CIDR; and 3) determine estrual and ovulatory distributions in cattle synchronized with Select-Synch + CIDR. The CO-Synch + CIDR regimen included insertion of a controlled internal drug-releasing device (CIDR) and an injection of GnRH (GnRH-1) on d 0, removal of the CIDR and injection of PGF2alpha (PGF) on d 7, and injection of GnRH (GnRH-2) and TAI 48 h later. For Exp. 1, predominantly Brahman x Hereford (F1) and Brangus females (n = 335) were stratified by BCS, parity, and day postpartum (parous females) before random assignment to CO-Synch + CIDR or TM. To maximize the number of observations related to TAI conception rate (n = 266), an additional 96 females in which TM controls were not available for comparison also received CO-Synch + CIDR. Conception rates to TAI averaged 39 +/- 3% and were not affected by location, year, parity, AI sire, or AI technician. Cumulative pregnancy rates were greater (P breeding season in CO-Synch + CIDR (74.1 and 95.9%) compared with TM (61.8 and 89.7%). In Exp. 2, postpartum Brahman x Hereford (F1) cows (n = 100) were stratified as in Exp. 1 and divided into 4 replicates of 25. Within each replicate, approximately one-half (12 to 13) received CO-Synch + CIDR, and the other half received CO-Synch only (no CIDR). No differences were observed between treatments, and the data were pooled. Percentages of cows ovulating to GnRH-1, developing a synchronized follicular wave, exhibiting luteal regression to PGF, and ovulating to GnRH-2 were 40 +/- 5, 60 +/- 5, 93 +/- 2, and 72 +/- 4%, respectively. In Exp. 3, primiparous Brahman x Hereford, (F1) heifers (n = 32) and pluriparous cows (n = 18) received the

  3. Epizootic Hemorrhagic Disease Outbreak in a Captive Facility Housing White-tailed Deer (Odocoileus Virginianus), Bison (Bison Bison), Elk (Cervus Elaphus), Cattle (Bos Taurus) and Goats (Capra Hircus) in Colorado

    Science.gov (United States)

    A captive wildlife research facility in Fort Collins, Colorado experienced mortality in white-tailed deer (Odocoileus virginianus) due to epizootic hemorrhagic disease virus (EHDV) infection in late summer and early fall of 2007. RNA from EHDV was amplified by RT-PCR from the spleen and lung tissues...

  4. Cattle grazing and conservation of a meadow-dependent amphibian species in the Sierra Nevada.

    Directory of Open Access Journals (Sweden)

    Leslie M Roche

    Full Text Available World-wide population declines have sharpened concern for amphibian conservation on working landscapes. Across the Sierra Nevada's national forest lands, where almost half of native amphibian species are considered at risk, permitted livestock grazing is a notably controversial agricultural activity. Cattle (Bos taurus grazing is thought to degrade the quality, and thus reduce occupancy, of meadow breeding habitat for amphibian species of concern such as the endemic Yosemite toad (Anaxyrus [ = Bufo] canorus. However, there is currently little quantitative information correlating cattle grazing intensity, meadow breeding habitat quality, and toad use of meadow habitat. We surveyed biotic and abiotic factors influencing cattle utilization and toad occupancy across 24 Sierra Nevada meadows to establish these correlations and inform conservation planning efforts. We utilized both traditional regression models and Bayesian structural equation modeling to investigate potential drivers of meadow habitat use by cattle and Yosemite toads. Cattle use was negatively related to meadow wetness, while toad occupancy was positively related. In mid and late season (mid July-mid September grazing periods, cattle selected for higher forage quality diets associated with vegetation in relatively drier meadows, whereas toads were more prevalent in wetter meadows. Because cattle and toads largely occupied divergent zones along the moisture gradient, the potential for indirect or direct negative effects is likely minimized via a partitioning of the meadow habitat. During the early season, when habitat use overlap was highest, overall low grazing levels resulted in no detectable impacts on toad occupancy. Bayesian structural equation analyses supported the hypothesis that meadow hydrology influenced toad meadow occupancy, while cattle grazing intensity did not. These findings suggest cattle production and amphibian conservation can be compatible goals within this

  5. Nature conservation and grazing management. Free-ranging cattle as a driving force for cyclic vegetation seccession

    NARCIS (Netherlands)

    Bokdam, J.

    2003-01-01

    Key-words : biodiversity, herbivory, wilderness, non-linear dynamics, mosaic cycling, grassland, wood encroachment, forest, Bos taurus , Calluna vulgaris , Deschampsia flexuosa.This thesis examines the suitability of controlled and wilderness grazing as conservation management tool for open, nutrien

  6. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  7. Development of methane emission factors for enteric fermentation in cattle from Benin using IPCC Tier 2 methodology.

    Science.gov (United States)

    Kouazounde, J B; Gbenou, J D; Babatounde, S; Srivastava, N; Eggleston, S H; Antwi, C; Baah, J; McAllister, T A

    2015-03-01

    The objective of this study was to develop emission factors (EF) for methane (CH4) emissions from enteric fermentation in cattle native to Benin. Information on livestock characteristics and diet practices specific to the Benin cattle population were gathered from a variety of sources and used to estimate EF according to Tier 2 methodology of the 2006 Intergovernmental Panel on Climate Change (IPCC) Guidelines for National Greenhouse Gas Inventories. Most cattle from Benin are Bos taurus represented by Borgou, Somba and Lagune breeds. They are mainly multi-purpose, being used for production of meat, milk, hides and draft power and grazed in open pastures and crop lands comprising tropical forages and crops. Estimated enteric CH4 EFs varied among cattle breeds and subcategory owing to differences in proportions of gross energy intake expended to meet maintenance, production and activity. EFs ranged from 15.0 to 43.6, 16.9 to 46.3 and 24.7 to 64.9 kg CH4/head per year for subcategories of Lagune, Somba and Borgou cattle, respectively. Average EFs for cattle breeds were 24.8, 29.5 and 40.2 kg CH4/head per year for Lagune, Somba and Borgou cattle, respectively. The national EF for cattle from Benin was 39.5 kg CH4/head per year. This estimated EF was 27.4% higher than the default EF suggested by IPCC for African cattle with the exception of dairy cattle. The outcome of the study underscores the importance of obtaining country-specific EF to estimate global enteric CH4 emissions.

  8. Genome-Wide Detection of CNVs and Their Association with Meat Tenderness in Nelore Cattle

    Science.gov (United States)

    da Silva, Vinicius Henrique; Regitano, Luciana Correia de Almeida; Geistlinger, Ludwig; Pértille, Fábio; Morosini, Natália Silva; Zimmer, Ralf; Coutinho, Luiz Lehmann

    2016-01-01

    Brazil is one of the largest beef producers and exporters in the world with the Nelore breed representing the vast majority of Brazilian cattle (Bos taurus indicus). Despite the great adaptability of the Nelore breed to tropical climate, meat tenderness (MT) remains to be improved. Several factors including genetic composition can influence MT. In this article, we report a genome-wide analysis of copy number variation (CNV) inferred from Illumina® High Density SNP-chip data for a Nelore population of 723 males. We detected >2,600 CNV regions (CNVRs) representing ≈6.5% of the genome. Comparing our results with previous studies revealed an overlap in ≈1400 CNVRs (>50%). A total of 1,155 CNVRs (43.6%) overlapped 2,750 genes. They were enriched for processes involving guanosine triphosphate (GTP), previously reported to influence skeletal muscle physiology and morphology. Nelore CNVRs also overlapped QTLs for MT reported in other breeds (8.9%, 236 CNVRs) and from a previous study with this population (4.1%, 109 CNVRs). Two CNVRs were also proximal to glutathione metabolism genes that were previously associated with MT. Genome-wide association study of CN state with estimated breeding values derived from meat shear force identified 6 regions, including a region on BTA3 that contains genes of the cAMP and cGMP pathway. Ten CNVRs that overlapped regions associated with MT were successfully validated by qPCR. Our results represent the first comprehensive CNV study in Bos taurus indicus cattle and identify regions in which copy number changes are potentially of importance for the MT phenotype. PMID:27348523

  9. 中国荷斯坦牛和鲁西黄牛mtDNAD-loop序列多态性分析%Sequence Diversity of Mitochondrial DNA D-loop Region in the Population of Chinese Holstein Cattle and Luxi Cattle

    Institute of Scientific and Technical Information of China (English)

    郝荣超; 王国华; 常玉霞; 杨国忠; 昝林森

    2011-01-01

    为了从母系遗传角度深入阐明中国荷斯坦牛和鲁西黄牛的群体遗传多样性以及起源进化,本研究采用PCR测序法测定了9头中国荷斯坦牛和11头鲁西黄牛的线粒体DNA D-loop区的部分序列,并经剪切后进行生物信息学软件分析.结果表明,20个个体D-loop区共711 bp,共检测到19种单倍型和50个多态位点.核苷酸多样性(Pi)为0.021 33±0.004 54,单倍型多样性(Hd)为0.994±0.019,平均核苷酸差异数(k)为15.146 20.构建的NJ网络进化树共分为两大支系,其中部分鲁西黄牛与瘤牛聚为一支,而中国荷斯坦牛和部分鲁西黄牛与普通黄牛聚为一支.说明中国荷斯坦牛和鲁西黄牛群体遗传多样性均较高;鲁西黄牛同时含有瘤牛和普通黄牛的血统,而中国荷斯坦牛只含有普通黄牛的血统.%In order to illustrate population genetic polymorphism and origin of Chinese Holstein cattle and Luxi cattle from the perspective of maternal inheritance, partial sequences of mitochondrial DNA D-loop of 9 Chinese Holsein catties and 11 Luxi catties were detected by PCR sequencing technology, and analyzed after cut by bioin-formatics software. The results revealed that D-loop sequences were 711 bp in 20 individuals and there were 19 different haplotypes and 50 polymorphic sites. The mean nucleotide diversity (Pi) was 0.021 33±0.004 54, the hap-lotype diversity (Hd) was 0.994±0.019, and the average number of nucleotide differences (k) was 15.146 20. The neighbor joining (NJ) free showed that there were two main branches in those 2 cattle breeds, in which, some Luxi catties were clustered with Bos taurus lineage, and the others were in Bos indicus lineage which also included all Chinese Holsein catties. The results indicated abundant genetic diversity in both two groups, and there were two marternal origins in Luxi cattle which were Bos taurus and Bos indicus, but in Chinese Holstein cattle only one origin of Bos taurus.

  10. South-East Asia bovine populations and the Japanese cattle breeds do not harbour the E211K variant of the PRNP

    Directory of Open Access Journals (Sweden)

    George Msalya

    2014-02-01

    Full Text Available An important outcome of intensive worldwide Bovine spongiform encephalopathy (BSE obtained with the surveillance by The National Creutzfeldt-Jakob Disease Surveillance Unit (http://www.cjd.ed.ac.uk/figures. htm, has been the detection of atypical BSE in cattle. The discovery of a prion protein gene (PRNP E211K variant in an atypical BSE case is particularly remarkable because it is analogous to the most common pathogenic mutation in humans (E200K, which causes hereditary Creutzfeldt-Jakob disease (CJD. Knowledge of the distribution and frequency of PRNP E211K variants in cattle populations is critical for understanding and managing atypical BSE. This study was carried out to investigate the prevalence of the E211K variant in the South-East Asia bovine populations and in the Japanese cattle breeds. It was discovered that E211K variant was monomorphic for a G allele and the GG genotype in the 745 animals analyzed in this study. Therefore, neither the Bos indicus nor the Bos taurus animals analyzed are presently known to harbor the 211K variant predicting that the number of carriers for this variant will also be vanishingly low.

  11. Cattle are a potential reservoir of bubaline herpesvirus 1 (BuHV1)

    Science.gov (United States)

    Maidana, S. S.; Delgado, F.; Vagnoni, L.; Mauroy, A.; Thiry, E.; Romera, S.

    2016-01-01

    In the present work, controlled experimental infection and transmission studies in domestic cattle (Bos taurus) and water buffaloes (Bubalus bubalis) were carried out to study the in vivo behaviour of bubaline herpesvirus 1 (BuHV1). Two bovine and two buffalo calves were infected with BuHV1 (20287N isolate) by intranasal aerosolisation. Two sentinel cattle did not receive the virus challenge, but were housed with infected buffaloes to evaluate horizontal transmission. All experimentally inoculated animals showed viral infection and respiratory clinical signs. BuHV1 experimentally infected calves showed intermittent viral excretion between 2 days and 18 days postinfection (dpi) with a maximum titre of excretion of 106 TCID50/ml and moderate rhinitis between 2 dpi and 20 dpi. BuHV1 experimentally inoculated buffaloes showed mild respiratory signs, which consisted mainly of serous nasal secretions during the infection period. Sentinel calves showed mucosal specific IgG1 antibodies at seven days postcontact. Viral DNA was detected by PCR and sequencing in both buffaloes and sentinel calves, which could be associated with latency. In conclusion, this study showed the susceptibility of cattle to BuHV1 after both experimental infection and contact with infected buffaloes. These data increase the scarce knowledge on the pathogenesis in natural host and the susceptibility of cattle to BuHV1 experimental infection. PMID:28074144

  12. Polymorphism of growth hormone gene and its association with seminal and sexual behavioral traits in crossbred cattle.

    Science.gov (United States)

    Pal, Aruna; Chakravarty, Atish Kumar; Chatterjee, Paresh Nath

    2014-02-01

    The decline in the male reproductive ability in terms of sexual behavior and seminal traits might lead to nonavailability of required number of bulls in a progeny testing program. The present study was conducted in 493 crossbred cattle (Bos taurus × Bos indicus) bulls to study polymorphisms of growth hormone (GH) gene and its association with seminal and sexual behavioral characteristics. A 428-base pair fragment of GH gene spanning over the fourth exon, fourth intron, and fifth exon was amplified and digested with AluI restriction enzyme. Bulls were found to be polymorphic, with two variants, LL and LV, and higher genotypic frequency for LL being 0.88. Twelve nucleotide changes and a single nonsynonymous substitution of Leucine by Valine were observed from GH1 (L) to GH2 (V). Statistical analysis revealed that the genotype of the GH gene had a significant effect on libido score, reaction time, Flehmen response, requirement of mounting stimulus, sperm mass activity, number of semen doses per collection, individual fresh sperm motility, postthaw sperm motility, acrosome integrity, hypo-osmotic swelling test, live and dead count, total morphological abnormality, and head abnormality of sperm in crossbred bulls. Growth hormone gene might be considered a candidate gene for seminal and sexual behavioral traits in crossbred cattle.

  13. Performance of a dispersion model to estimate methane loss from cattle in pens.

    Science.gov (United States)

    McGinn, S M; Beauchemin, K A; Flesch, T K; Coates, T

    2009-01-01

    Accurate measurements of enteric methane (CH(4)) emissions from cattle (Bos taurus) are necessary to improve emission coefficients used in national emissions inventories, and to evaluate mitigation strategies. Our study was conducted to evaluate a novel approach that allowed near continuous CH(4) measurement from beef cattle confined in pens. The backward Lagrangian Stochastic (bLS) dispersion technique was used in conjunction with global position system (GPS) information from individual animals, to evaluate CH(4) emissions from pens of cattle. The dispersion technique was compared to estimates of CH(4) production using the SF(6) tracer technique. Sixty growing beef cattle were fed a diet containing 60% barley silage (dry matter basis) supplemented with either barley (Hordeum vulgare L.) grain or corn (Zea mays L.) distillers dried grains. The results show that daily CH(4) emissions were about 7% lower for the dispersion technique than for the tracer technique (185 vs. 199 g CH(4) animal(-1) d(-1)). The precision of the dispersion technique, relative to the SF(6) tracer technique, expressed by the Pearson coefficient was 0.76; the relative accuracy given by the concordance coefficient was 0.69. The bLS dispersion technique was able to detect differences (P emissions ranging from 161 to 279 g CH(4) animal(-1) d(-1). Configuring the cattle as point sources resulted in more accurate CH(4) emissions than assuming a uniform area release from the pen surface. The results indicate that the bLS dispersion technique using cattle as point sources can be used to accurately measure enteric CH(4) from cattle and to evaluate the impact of dietary mitigation strategies.

  14. Genetic characterization of Aberdeen Angus cattle using molecular markers

    Directory of Open Access Journals (Sweden)

    Vasconcellos Luciana Pimentel de Mello Klocker

    2003-01-01

    Full Text Available Aberdeen Angus beef cattle from the Brazilian herd were studied genetically using restriction fragment length polymorphism (RFLP of the kappa-casein - HinfI (CSN3 - HinfI, beta-lactoglobulin - HaeIII (LGB - HaeIII and growth hormone AluI (GH- AluI genes, as well as four microsatellites (TEXAN15, CSFM50, BM1224 and BM7160. The RFLP genotypes were determined using the polymerase chain reaction (PCR followed by digestion with restriction endonucleases and electrophoresis in agarose gels. With the exception of the microsatellite BM7160, which was analyzed in an automatic sequencer, the PCR products were genotyped by silver staining. The allele and genotype frequencies, heterozygosities and gene diversity were estimated. The values for these parameters of variability were comparable to other cattle breeds. The genetic relationship of the Aberdeen Angus to other breeds (Caracu, Canchim, Charolais, Guzerath, Gyr, Nelore, Santa Gertrudis and Simmental was investigated using Nei's genetic distance. Cluster analysis placed the Aberdeen Angus in an isolated group in the Bos taurus breeds branch. This fact is in agreement with the geographic origin of this breed.

  15. Candidate gene analysis of GH1 for effects on growth and carcass composition of cattle.

    Science.gov (United States)

    Taylor, J F; Coutinho, L L; Herring, K L; Gallagher, D S; Brenneman, R A; Burney, N; Sanders, J O; Turner, J W; Smith, S B; Miller, R K; Savell, J W; Davis, S K

    1998-06-01

    We present an approach to evaluate the support for candidate genes as quantitative trait loci (QTLs) within the context of genome-wide map-based cloning strategies. To establish candidacy, a bacterial artificial chromosome (BAC) clone containing a putative candidate gene is physically assigned to an anchored linkage map to localise the gene relative to an identified QTL effect. Microsatellite loci derived from BAC clones containing an established candidate gene are integrated into the linkage map facilitating the evaluation by interval analysis of the statistical support for QTL identity. Permutation analysis is employed to determine experiment-wise statistical support. The approach is illustrated for the growth hormone 1 (GH1) gene and growth and carcass phenotypes in cattle. Polymerase chain reaction (PCR) primers which amplify a 441 bp fragment of GH1 were used to systematically screen a bovine BAC library comprising 60,000 clones and with a 95% probability of containing a single copy sequence. The presence of GH1 in BAC-110R2C3 was confirmed by sequence analysis of the PCR product from this clone and by the physical assignment of BAC110R2C3 to bovine chromosome 19 (BTA19) band 22 by fluorescence in situ hybridisation (FISH). Microsatellite KHGH1 was isolated from BAC110R2C3 and scored in 529 reciprocal backcross and F2 fullsib progeny from 41 resource families derived from Angus (Bos taurus) and Brahman (Bos indicus). The microsatellite KHGH1 was incorporated into a framework genetic map of BTA19 comprising 12 microsatellite loci, the erythrocyte antigen T and a GH1-TaqI restriction fragment length polymorphism (RFLP). Interval analysis localised effects of taurus vs. indicus alleles on subcutaneous fat and the percentage of either extractable fat from the Iongissimus dorsi muscle to the region of BTA19 harbouring GH1.

  16. Bartonella chomelii is the most frequent species infecting cattle grazing in communal mountain pastures in Spain.

    Science.gov (United States)

    Antequera-Gómez, M L; Lozano-Almendral, L; Barandika, J F; González-Martín-Niño, R M; Rodríguez-Moreno, I; García-Pérez, A L; Gil, H

    2015-01-01

    The presence of Bartonella spp. was investigated in domestic ungulates grazing in communal pastures from a mountain area in northern Spain, where 18.3% (17/93) of cattle were found to be positive by PCR combined with a reverse line blot (PCR/RLB), whereas sheep (n = 133) or horses (n = 91) were found not to be infected by this pathogen. Bartonella infection was significantly associated with age, since older animals showed a higher prevalence than heifers and calves. In contrast to other studies, B. chomelii was the most frequent species found in cattle (14/17), while B. bovis was detected in only three animals. Moreover, 18 B. chomelii isolates and one B. bovis isolate were obtained from nine animals. Afterwards, B. chomelii isolates were characterized by a multilocus sequence typing (MLST) method which was adapted in this study. This method presented a high discrimination power, identifying nine different sequence types (STs). This characterization also showed the presence of different STs simultaneously in the same host and that STs had switched over time in one of the animals. In addition, B. chomelii STs seem to group phylogenetically in two different lineages. The only B. bovis isolate was characterized with a previously described MLST method. This isolate corresponded to a new ST which is located in lineage I, where the B. bovis strains infecting Bos taurus subsp. taurus are grouped. Further studies on the dynamics of Bartonella infection in cattle and the potential ectoparasites involved in the transmission of this microorganism should be performed, improving knowledge about the interaction of Bartonella spp. and domestic ungulates.

  17. Juridica; Bos, bouw en gemeenten

    NARCIS (Netherlands)

    Kistenkas, F.H.

    2011-01-01

    Bouwen in het bos van de ecologische hoofdstructuur. Geen probleem als niemand bezwaar maakt.... Uiteindelijk is de gemeente vergunningverlener aan zichzelf, is wetgever in eigen zaak en maakt voor zichzelf een lucratief bestemmingsplan. Aldus de analyse van wetskenner Fred Kistenkas

  18. Interactive Effects of Black-Tailed Prairie Dogs and Cattle on Shrub Encroachment in a Desert Grassland Ecosystem.

    Directory of Open Access Journals (Sweden)

    Eduardo Ponce-Guevara

    Full Text Available The widespread encroachment of woody plants throughout the semi-arid grasslands in North America has largely resulted from overgrazing by domestic livestock, fire suppression, and loss of native large and small mammalian herbivores. Burrowing-herbivorous mammals, such as prairie dogs (Cynomys spp., help control shrub encroachment through clipping of shrubs and consumption of their seedlings, but little is known about how this important ecological role interacts with and may be influenced by co-existing large herbivores, especially domestic livestock. Here, we established a long-term manipulative experiment using a 2 × 2 factorial design to assess the independent and interactive effects of black-tailed prairie dogs (Cynomys ludovicianus and cattle (Bos taurus on honey mesquite (Prosopis glandulosa abundance and structure. We found that, after five years, mesquite abundance was three to five times greater in plots where prairie dogs were removed compared to plots where they occurred together or alone, respectively. While both prairie dogs and cattle reduced mesquite cover, the effect of prairie dogs on reducing mesquite abundance, cover, and height was significantly greater than that by cattle. Surprisingly, cattle grazing enhanced prairie dog abundance, which, in turn, magnified the effects of prairie dogs on mesquite shrubs. Mesquite canopy cover per hectare was three to five times greater where prairie dogs and cattle were absent compared to where they occurred together or by themselves; whereas, cumulative mesquite height was two times lower on sites where prairie dog and cattle occurred together compared to where they occurred alone or where neither occurred. Data from our experimental study demonstrate that prairie dogs and moderate grazing by cattle can suppress mesquite growth, and, when their populations are properly managed, they may interact synergistically to significantly limit mesquite encroachment in desert grasslands.

  19. Genome-wide association study using high-density single nucleotide polymorphism arrays and whole-genome sequences for clinical mastitis traits in dairy cattle.

    Science.gov (United States)

    Sahana, G; Guldbrandtsen, B; Thomsen, B; Holm, L-E; Panitz, F; Brøndum, R F; Bendixen, C; Lund, M S

    2014-11-01

    Mastitis is a mammary disease that frequently affects dairy cattle. Despite considerable research on the development of effective prevention and treatment strategies, mastitis continues to be a significant issue in bovine veterinary medicine. To identify major genes that affect mastitis in dairy cattle, 6 chromosomal regions on Bos taurus autosome (BTA) 6, 13, 16, 19, and 20 were selected from a genome scan for 9 mastitis phenotypes using imputed high-density single nucleotide polymorphism arrays. Association analyses using sequence-level variants for the 6 targeted regions were carried out to map causal variants using whole-genome sequence data from 3 breeds. The quantitative trait loci (QTL) discovery population comprised 4,992 progeny-tested Holstein bulls, and QTL were confirmed in 4,442 Nordic Red and 1,126 Jersey cattle. The targeted regions were imputed to the sequence level. The highest association signal for clinical mastitis was observed on BTA 6 at 88.97 Mb in Holstein cattle and was confirmed in Nordic Red cattle. The peak association region on BTA 6 contained 2 genes: vitamin D-binding protein precursor (GC) and neuropeptide FF receptor 2 (NPFFR2), which, based on known biological functions, are good candidates for affecting mastitis. However, strong linkage disequilibrium in this region prevented conclusive determination of the causal gene. A different QTL on BTA 6 located at 88.32 Mb in Holstein cattle affected mastitis. In addition, QTL on BTA 13 and 19 were confirmed to segregate in Nordic Red cattle and QTL on BTA 16 and 20 were confirmed in Jersey cattle. Although several candidate genes were identified in these targeted regions, it was not possible to identify a gene or polymorphism as the causal factor for any of these regions.

  20. Genotyping of β-Lactoglobulin gene by PCR-RFLP in Sahiwal and Tharparkar cattle breeds

    Directory of Open Access Journals (Sweden)

    Gupta Neelam

    2006-05-01

    population. Conclusion Genotype frequencies of AA were the lowest compared to that of BB genotype in Sahiwal cattle while AB genotypes were more frequent in Tharparkar cattle. The frequency of A allele was found to be lower than that of B allele in both the breeds studied. These results further confirm that Bos indicus cattle are predominantly of β-Lactoglobulin B type than Bos taurus breeds.

  1. Comparison of Metabolic Network between Muscle and Intramuscular Adipose Tissues in Hanwoo Beef Cattle Using a Systems Biology Approach.

    Science.gov (United States)

    Lee, Hyun-Jeong; Park, Hye-Sun; Kim, Woonsu; Yoon, Duhak; Seo, Seongwon

    2014-01-01

    The interrelationship between muscle and adipose tissues plays a major role in determining the quality of carcass traits. The objective of this study was to compare metabolic differences between muscle and intramuscular adipose (IMA) tissues in the longissimus dorsi (LD) of Hanwoo (Bos taurus coreanae) using the RNA-seq technology and a systems biology approach. The LD sections between the 6th and 7th ribs were removed from nine (each of three cows, steers, and bulls) Hanwoo beef cattle (carcass weight of 430.2 ± 40.66 kg) immediately after slaughter. The total mRNA from muscle, IMA, and subcutaneous adipose and omental adipose tissues were isolated and sequenced. The reads that passed quality control were mapped onto the bovine reference genome (build bosTau6), and differentially expressed genes across tissues were identified. The KEGG pathway enrichment tests revealed the opposite direction of metabolic regulation between muscle and IMA. Metabolic gene network analysis clearly indicated that oxidative metabolism was upregulated in muscle and downregulated in IMA. Interestingly, pathways for regulating cell adhesion, structure, and integrity and chemokine signaling pathway were upregulated in IMA and downregulated in muscle. It is thus inferred that IMA may play an important role in the regulation of development and structure of the LD tissues and muscle/adipose communication.

  2. Disentangling herbivore impacts on Populus tremuloides: a comparison of native ungulates and cattle in Canada's Aspen Parkland.

    Science.gov (United States)

    Bork, Edward W; Carlyle, Cameron N; Cahill, James F; Haddow, Rae E; Hudson, Robert J

    2013-11-01

    Ungulates impact woody species' growth and abundance but little is understood about the comparative impacts of different ungulate species on forest expansion in savanna environments. Replacement of native herbivore guilds with livestock [i.e., beef cattle (Bos taurus)] has been hypothesized as a factor facilitating trembling aspen (Populus tremuloides Michx.) encroachment into grasslands of the Northern Great Plains. We used a controlled herbivory study in the Parklands of western Canada to compare the impact of native ungulates and cattle on aspen saplings. Native ungulate treatments included a mixed species guild and sequences of herbivory by different ungulates [bison (Bison bison subsp. bison), elk (Cervus elaphus) then deer (Odocoileus hemionus); or deer, elk, then bison]. Herbivory treatments were replicated in three pastures, within which sets of 40 marked aspen saplings (aspen stand. Stems were assessed for mortality and incremental damage (herbivory, leader breakage, stem abrasion and trampling). Final mortality was greater with exposure to any type of herbivore, but remained similar between ungulate treatments. However, among all treatments, the growth of aspen was highest with exposure only to cattle. Herbivory of aspen was attributed primarily to elk within the native ungulate treatments, with other forms of physical damage, and ultimately sapling mortality, associated with exposure to bison. Overall, these results indicate that native ungulates, specifically elk and bison, have more negative impacts on aspen saplings and provide evidence that native and domestic ungulates can have different functional effects on woody plant dynamics in savanna ecosystems.

  3. Giardia in mountain gorillas (Gorilla beringei beringei), forest buffalo (Syncerus caffer), and domestic cattle in Volcanoes National Park, Rwanda.

    Science.gov (United States)

    Hogan, Jennifer N; Miller, Woutrina A; Cranfield, Michael R; Ramer, Jan; Hassell, James; Noheri, Jean Bosco; Conrad, Patricia A; Gilardi, Kirsten V K

    2014-01-01

    Mountain gorillas (Gorilla beringei beringei) are critically endangered primates surviving in two isolated populations in protected areas within the Virunga Massif of Rwanda, Uganda, the Democratic Republic of Congo, and in Bwindi Impenetrable National Park in Uganda. Mountain gorillas face intense ecologic pressures due to their proximity to humans. Human communities outside the national parks, and numerous human activities within the national parks (including research, tourism, illegal hunting, and anti-poaching patrols), lead to a high degree of contact between mountain gorillas and wildlife, domestic animals, and humans. To assess the pathogen transmission potential between wildlife and livestock, feces of mountain gorillas, forest buffalo (Syncerus caffer nanus), and domestic cattle (Bos taurus) in Rwanda were examined for the parasites Giardia and Cryptosporidium. Giardia was found in 9% of mountain gorillas, 6% of cattle, and 2% of forest buffalo. Our study represents the first report of Giardia prevalence in forest buffalo. Cryptosporidium-like particles were also observed in all three species. Molecular characterization of Giardia isolates identified zoonotic genotype assemblage B in the gorilla samples and assemblage E in the cattle samples. Significant spatial clustering of Giardia-positive samples was observed in one sector of the park. Although we did not find evidence for transmission of protozoa from forest buffalo to mountain gorillas, the genotypes of Giardia samples isolated from gorillas have been reported in humans, suggesting that the importance of humans in this ecosystem should be more closely evaluated.

  4. Influence of canola and sunflower diet amendments on cattle feedlot manure.

    Science.gov (United States)

    Hao, Xiying; Mir, Priya S; Shah, Mohammad A; Travis, Greg R

    2005-01-01

    Cattle (Bos taurus) producers can replace a part of the traditional diet of barley (Hordeum vulgare L.) grain/silage with sunflower (Helianthus annus L.) seeds or canola meal (Brassica napus L.)/oil to enhance conjugated linoleic acids (CLA) content in milk and meat for its positive health benefits. The objective of this study is to investigate the effects of feeding sunflower or canola to finishing steers on cattle manure chemical properties and volatile fatty acid (VFA) content. The control diet contained 84% rolled barley and 15% barley silage, which provided only 2.6% lipid. The other six treatments had 6.6 to 8.6% lipid delivered from sources such as hay, sunflower seed (SS), canola meal/oil, and SS forage pellets. Manure samples (a mixture of cattle urine, feces, and woodchip bedding materials) were collected and analyzed after cattle had been on these diets for 113 d. The dietary source and level of lipid had no effect on organic N and nitrate N content in manure, but significantly affected ammonia N and VFA. Inclusion of SS forage pellets, hay, or canola meal/oil in cattle diets had no significant impact on manure characteristics, but SS significantly reduced the pH and increased propionic, isobutyric, and isovaleric content. In addition, N loss after excretion (mainly from urine N) increases with the pH and N levels in both feed and manure. The combination of SS with barley silage resulted in a lower VFA and NH3 content in manure and should be a more attractive option. To better manage N nutrient cycles and reduce NH3 related odor problems, feed and manure pH should be one of the factors to consider when determining feed mix rations.

  5. ALGUNOS FACTORES RELACIONADOS CON LA DINÁMICA FOLICULAR EN BOS INDICUS SOME FACTORS RELATED TO FOLLICULAR DYNAMICS IN BOS INDICUS

    Directory of Open Access Journals (Sweden)

    Guillermo Henao Restrepo

    2010-12-01

    Full Text Available El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos taurus y Bos indicus, se han encontrado diferencias en la dinámica folicular que pueden afectar el comportamiento reproductivo y la aplicación de biotecnologías reproductivas. La dinámica folicular puede variar por efectos ambientales y estados fisiológicos de hembras Bos indicus que impiden establecer un patrón específico de dinámica folicular para cada raza y etapa fisiológica. El propósito de esta revisión es analizar la función reproductiva teniendo en cuenta las diferencias de la dinámica folicular entre estados fisiológicos y condiciones ambientales de hembras bovinas con énfasis en B. indicus.The bovine follicular development during a normal estrous cycle, is characterized by a growth in wave form with presence of two to five follicular cohorts by cycle, of which only one follicle ovulate. The follicular growth in wave form also occurs during the prepubertal and pubertal periods, first quarter of the gestation, and in the postpartum anestrous period. Although there is great similarity in the fundamental pattern of the development of follicular waves between Bos taurus and Bos indicus, differences of follicular dynamics has been detected, that can affect the reproductive behavior and the application of reproductive biotechnologies. Follicular dynamics can change by environmental effects and physiological states of Bos indicus females that impede to establish a specific pattern of follicular dynamics for each breed and physiological

  6. Efecto de la progesterona natural con o sin la adición de benzoato de estradiol sobre la presentación de celo, ovulación y gestación en animales tipo Bos indicus en el trópico mexicano Effect of natural progesterone with and without estradiol benzoate on the onset signs of oestrus, ovulation and pregnancy in Bos indicus cattle raised under mexican tropical conditions

    Directory of Open Access Journals (Sweden)

    G.S. DIAZ

    2002-01-01

    Full Text Available Se evaluó el efecto de un dispositivo intravaginal que contiene 1.9 g de progesterona y una cápsula de 10 mg de benzoato de estradiol (BE (CIDR-B®, seguido o no de la aplicación intramuscular de BE, a las 24 horas de retirado el dispositivo, y se observó el porcentaje de estro, ovulación y gestación. Se utilizaron 122 vacas (experimento 1 y 30 novillas (experimento 2 tipo Bos indicus, que fueron asignadas aleatoriamente a tres grupos:Grupo ST: 20 vacas y 10 novillas sin tratamiento; Grupo CIDR-BE: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días respectivamente; y Grupo CIDRB+ E: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días, además de una inyección a las 24 horas de 1 ó 2 mg de BE. La detección de estros se realizó mediante la observación visual, haciéndose durante 96 horas después de retirar el CIDR-B, y posteriormente entre los 17 a 24 días posteriores a cada período de servicios, hasta concluir los 90 días que duró el empadre. Las que presentaron estro entre los días 0 a 47 fueron servidas por IA y las que lo presentaron del 48 al 90 por monta natural. Se tomaron muestras sanguíneas para medir niveles de progesterona para corroborar ovulación. El diagnóstico de gestación se realizó por palpación rectal y ultrasonografía. Las variables categóricas se analizaron mediante la prueba exacta de Fisher y las continuas mediante t de Student. Las condiciones reproductivas previas de las vacas se relacionaron con celos, ovulación y gestación con un modelo lineal logarítmico del Proc CATMOD, SAS. En ambos experimentos el grupo CIDR-B+E presentó un alto porcentaje de estro, 92.2 y 90.0% para vacas y novillas, siendo diferente (pThe effect of a intravaginal device containing 1.9 g of progesterone and one capsule of 10 mg of estradiol benzoate (EB (CIDR-B was evaluated in Bos indicus cattle. Upon withdrawal, calculations regarding estrous rate, ovulation and pregnancy were considered. 122 Bos

  7. Energy utilization, nitrogen balance and microbial protein supply in cattle fed Pennisetum purpureum and condensed tannins.

    Science.gov (United States)

    Piñeiro-Vázquez, A T; Canul-Solis, J R; Alayón-Gamboa, J A; Chay-Canul, A J; Ayala-Burgos, A J; Solorio-Sánchez, F J; Aguilar-Pérez, C F; Ku-Vera, J C

    2017-02-01

    The aim of the experiment was to assess the effect of condensed tannins (CT) on feed intake, dry matter digestibility, nitrogen balance, supply of microbial protein to the small intestine and energy utilization in cattle fed a basal ration of Pennisetum purpureum grass. Five heifers (Bos taurus × Bos indicus) with an average live weight of 295 ± 19 kg were allotted to five treatments consisting of increasing levels of CT (0, 1, 2, 3 and 4% CT/kg DM) in a 5 × 5 Latin square design. Dry matter intake (DMI) was similar (p > 0.05) between treatments containing 0, 1, 2 and 3% of CT/kg DM and it was reduced (p balance, purine derivatives excretion in urine, microbial protein synthesis and efficiency of synthesis of microbial nitrogen in the rumen were not affected (p ≥ 0.05) by the increase in the levels of condensed tannins in the ration. Energy loss as CH4 was on average 2.7% of the gross energy consumed daily. Metabolizable energy intake was 49.06 MJ/day in cattle fed low-quality tropical grass with a DMI of 6.27 kg/day. It is concluded that concentrations of CT between 2 and 3% of DM of ration reduced energy loss as CH4 by 31.3% and 47.6%, respectively, without affecting intakes of dry and organic matter; however, digestibilities of dry and organic matter are negatively affected.

  8. Emissions of ammonia, nitrous oxide and methane from cattle manure heaps: effect of compaction and covering

    Science.gov (United States)

    Chadwick, D. R.

    The effect of compaction and covering during storage of beef cattle ( Bos taurus) farmyard manure (FYM) on ammonia (NH 3), nitrous oxide (N 2O) and methane (CH 4) emissions was determined. Gaseous emission measurements were made over three separate storage periods of between 90 and 109 days. The effect of the different storage treatments on manure chemical composition was also determined. Compaction was carried out as the manure was put into store and the compacted manures covered with plastic sheeting. Compaction and covering significantly reduced NH 3 emissions from manure by over 90% during the first summer storage period (Ppersistent rainfall during heap establishment and the following week appeared to reduce NH 3 emissions markedly. The low ammonium-N content of the FYM in the third storage period may have reduced the risk of NH 3 emission and reduced the relative effect of the compaction/covering treatment. Compaction and covering also significantly reduced N 2O emissions from cattle FYM (Pbenefits are that N and K are retained in the manure heap for agronomic benefit.

  9. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  10. Produtividade à Desmama de Novilhas Nelore e F1 Bos taurus x Nelore e Bos indicus x Nelore

    Directory of Open Access Journals (Sweden)

    Perotto Daniel

    2001-01-01

    Full Text Available A eficiência produtiva das vacas de corte está relacionada com o tamanho do animal, a fertilidade e a produção de leite. Este trabalho avaliou a eficiência à desmama de 289 novilhas sendo 100 Nelore (N, 47 F1 Guzerá x Nelore (GN, 67 F1 Red Angus x Nelore (RN, 37 F1 Marchigiana x Nelore (MN e 38 F1 Simental x Nelore (SN da Est. Exp. Paranavaí/IAPAR. Foram analisadas a idade ao primeiro parto (IPP, a relação entre o peso do bezerro à desmama e o peso da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPV, e a relação entre o peso do bezerro à desmama e o peso metabólico da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPM. As médias por quadrados mínimos para IPP em dias, PDPV [((kg/kg/dia x 1000] e PDPM [((kg/kg0,75/dia x 100] foram: 1416, 1340, 1053, 1187 e 1117; 0,394, 0,414, 0,422, 0,379 e 0,418; e 0,169, 0,179, 0,187, 0,169 e 0,188, respectivamente para os grupos N, GN, RN, MN e SN. Para IPP, foram significativos os contrastes N- RN (362 dias, GN -- RN (287 dias e RN -- MN (-133 dias. Para PDPV, foi significativo o contraste RN - MN [-0,04287((kg/kg/dia x 1000] e para PDPM foram significativos os contrastes N -- RN [-0,01803((kg/kg0,75/dia x 100], RN -- MN [0,01841((kg/kg0,75/dia x 100] e MN -- SN [-0,01915((kg/kg0,75/dia x 100]. Conclui-se que novilhas RN e SN foram mais eficientes à primeira desmama que novilhas MN, as quais não diferiram das zebuínas N e GN.

  11. Produtividade à Desmama de Novilhas Nelore e F1 Bos taurus x Nelore e Bos indicus x Nelore

    OpenAIRE

    Perotto Daniel; Abrahão José Jorge dos Santos; Kroetz Inácio Afonso

    2001-01-01

    A eficiência produtiva das vacas de corte está relacionada com o tamanho do animal, a fertilidade e a produção de leite. Este trabalho avaliou a eficiência à desmama de 289 novilhas sendo 100 Nelore (N), 47 F1 Guzerá x Nelore (GN), 67 F1 Red Angus x Nelore (RN), 37 F1 Marchigiana x Nelore (MN) e 38 F1 Simental x Nelore (SN) da Est. Exp. Paranavaí/IAPAR. Foram analisadas a idade ao primeiro parto (IPP), a relação entre o peso do bezerro à desmama e o peso da mãe ao parto, dividida pela idade d...

  12. High-resolution haplotype block structure in the cattle genome

    Directory of Open Access Journals (Sweden)

    Choi Jungwoo

    2009-04-01

    similarities in haplotype block structure between dairy and beef breeds make them non-differentiable. Finally, our findings suggest that ~30,000 uniformly distributed SNPs would be necessary to construct a complete genome LD map in Bos taurus breeds, and ~580,000 SNPs would be necessary to characterize the haplotype block structure across the complete cattle genome.

  13. Effects of wolves on elk and cattle behaviors: implications for livestock production and wolf conservation.

    Directory of Open Access Journals (Sweden)

    Isabelle Laporte

    Full Text Available BACKGROUND: In many areas, livestock are grazed within wolf (Canis lupus range. Predation and harassment of livestock by wolves creates conflict and is a significant challenge for wolf conservation. Wild prey, such as elk (Cervus elaphus, perform anti-predator behaviors. Artificial selection of cattle (Bos taurus might have resulted in attenuation or absence of anti-predator responses, or in erratic and inconsistent responses. Regardless, such responses might have implications on stress and fitness. METHODOLOGY/PRINCIPAL FINDINGS: We compared elk and cattle anti-predator responses to wolves in southwest Alberta, Canada within home ranges and livestock pastures, respectively. We deployed satellite- and GPS-telemetry collars on wolves, elk, and cattle (n = 16, 10 and 78, respectively and measured seven prey response variables during periods of wolf presence and absence (speed, path sinuosity, time spent head-up, distance to neighboring animals, terrain ruggedness, slope and distance to forest. During independent periods of wolf presence (n = 72, individual elk increased path sinuosity (Z = -2.720, P = 0.007 and used more rugged terrain (Z = -2.856, P = 0.004 and steeper slopes (Z = -3.065, P = 0.002. For cattle, individual as well as group behavioral analyses were feasible and these indicated increased path sinuosity (Z = -2.720, P = 0.007 and decreased distance to neighbors (Z = -2.551, P = 0.011. In addition, cattle groups showed a number of behavioral changes concomitant to wolf visits, with variable direction in changes. CONCLUSIONS/SIGNIFICANCE: Our results suggest both elk and cattle modify their behavior in relation to wolf presence, with potential energetic costs. Our study does not allow evaluating the efficacy of anti-predator behaviors, but indicates that artificial selection did not result in their absence in cattle. The costs of wolf predation on livestock are often compensated considering just the market value of the animal killed

  14. Evaluation of tropically adapted straightbred and crossbred cattle: postweaning gain and feed efficiency when finished in a temperate climate.

    Science.gov (United States)

    Coleman, S W; Chase, C C; Phillips, W A; Riley, D G; Olson, T A

    2012-06-01

    Beef cows in the subtropical USA must be adapted to the stressors of the environment, typically supplied by using Brahman (Br) breeding. Calves produced in the region, however, are usually grown and finished in more temperate regions, and have a perceived reputation for poor ADG and feed efficiency during finishing. Compromised fertility and carcass quality often associated with the Br have increased interest in tropically adapted Bos taurus breed types. The objective of this study was to evaluate 3 breeds [An = Angus (Bos taurus, temperate); Br (B. indicus, tropical); and Ro = Romosinuano (B. taurus, tropical)] and all possible crosses during various segments of post-weaning growth, and for feed efficiency during the finishing phase. Steer calves (n = 473) born over 3 yr were weaned in late September, backgrounded for at least 21 d (BKG), shipped 2,025 km to El Reno, OK, in October, fed a preconditioning diet for 28 d (RCV), grazed wheat (Triticum aestivum L.) pasture from November to May (WHT), finished on a conventional feedlot diet (FIN), and serially harvested after approximately 95, 125, and 150 d on feed. Body weight and ADG during each segment were tested using a mixed model that included calf age at weaning, year (Y), breed of sire (SB), breed of dam (DB), and interactions. In addition, winter treatment (continuous wheat or reduced grazing of wheat with supplement) was included for the wheat and feedlot phases. Sire within SB × SB [and pen (barn × year) for feedlot phase] were considered random. The SB × DB interaction was significant for all traits (P < 0.01) except exit velocity taken at weaning and ADG during FIN, but both traits were affected by 3-way interactions with Y or harvest group. Tropically-adapted purebred steers had greater (P < 0.01) ADG than AnAn through weaning and BKG in FL but the reverse was true during the RCV and WHT segments. Similar, but less pronounced results were noted for F(1) steers with 100% tropical influence compared

  15. Spatial distribution of Brucella antibodies with reference to indigenous cattle populations among contrasting agro-ecological zones of Uganda.

    Science.gov (United States)

    Kabi, Fredrick; Muwanika, Vincent; Masembe, Charles

    2015-09-01

    Indigenous cattle populations exhibit various degrees of agro-ecological fitness and provide desirable opportunities for investments to improve sustainable production for better rural small-scale farmers' incomes globally. However, they could be a source of infection to their attendants and other susceptible livestock if their brucellosis status remains unknown. This study investigated the spatial distribution of Brucella antibodies among indigenous cattle populations in Uganda. Sera from a total of 925 indigenous cattle (410 Ankole Bos taurus indicus, 50 Nganda and 465 East African Shorthorn Zebu (EASZ) - B. indicus) obtained randomly from 209 herds spread throughout Uganda were sequentially analysed for Brucella antibodies using the indirect (I) and competitive (C) enzyme linked Immuno-sorbent assays (ELISA). Recent incidences of abortion within the previous 12 months and routine hygienic practices during parturition were explored for public health risks. Brucella antibodies occurred in approximately 8.64% (80/925) and 28.70% (95% CI: 22.52, 34.89) of the sampled individual cattle and herds, respectively. Findings have shown that Ankole and EASZ cattle had similar seroprevalences. Indigenous cattle from the different study agro-ecological zones (AEZs) exhibited varying seroprevalences ranging from approximately 1.78% (95% CI: 0, 5.29) to 19.67% (95% CI: 8.99, 30.35) in the Lake Victoria Crescent (LVC) and North Eastern Drylands (NED) respectively. Significantly higher odds for Brucella antibodies occurred in the NED (OR: 3.40, 95% CI: 1.34, 8.57, p=0.01) inhabited by EASZ cattle compared to the KP (reference category) AEZ. Recent incidences of abortions within the previous 12 months were significantly (p<0.001) associated with seropositive herds. These findings add critical evidence to existing information on the widespread occurrence of brucellosis among indigenous cattle populations in Uganda and could guide allocation of meagre resources for awareness creation

  16. Controle do carrapato Boophilus microplus (Acari: Ixodidae em sistemas de produção de leite da microrregião fisiográfica fluminense do grande Rio - Rio de Janeiro Control of the cattle tick Boophilus microplus (Acari: Ixodidae in dairy farm systems of the physiographic microrregion of grande Rio, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Juracy de Castro Borba Santos Júnior

    2000-04-01

    Full Text Available O objetivo do trabalho foi analisar os métodos de controle do carrapato Boophilus microplus realizados em três fazendas representativas dos sistemas de produção de leite da Microrregião Fisiográfica Fluminense do Grande Rio, Rio de Janeiro, levando-se em consideração o manejo das fazendas, o grau de sangue Bos taurus e Bos indicus dos rebanhos, os fatores climáticos e a prevalência estacional do carrapato. Para efeito de avaliação, foi utilizada a contagem periódica de fêmeas ingurgitadas medindo entre 4,5 e 8mm, no antímero direito de 20% das vacas em lactação de cada fazenda, durante um ano. A diferença no manejo das pastagens, a composição genética dos rebanhos e as condições climáticas influenciaram a prevalência estacional de B. microplus. A maior lotação animal por hectare, o elevado "stand" vegetativo das pastagens e o maior grau de sangue B. taurus contribuíram para as maiores infestações de carrapatos nas fazendas. O controle de B. microplus realizado pelos proprietários teve importância secundária em relação as outras atitudes de manejo dos rebanhos. Ficou evidenciado o uso excessivo e ineficiente de produtos químicos para o controle de B. microplus nas fazendas. Para implantação de medidas de controle estratégico do B. Microplus, fazem-se necessários esforços para a transferência e adoção dos resultados de pesquisas disponíveis aos produtores rurais.The objective of the study was to analyse the control methods of the cattle tick, Boophilus microplus. The experiment was carried out on three farms of the dairy production systems of the Fluminense Physiographic Microregion of Grande Rio, Rio de Janeiro State, Brazil. Farm management, the Bos indicus and Bos taurus composition of herds, climatic factors and seasonal variation in tick infestation level of cattle was taken into account. Counts of engorged female ticks, measuring between 4.5 and 8.0mm, in 20% of the lactating cows of each farm

  17. Profile of muscle tissue gene expression specific to water buffalo: Comparison with domestic cattle by genome array.

    Science.gov (United States)

    Zhang, Yingying; Wang, Hongbao; Gui, Linsheng; Wang, Hongcheng; Mei, Chugang; Zhang, Yaran; Xu, Huaichao; Jia, Cunlin; Zan, Linsen

    2016-02-10

    In contrast with the past, the water buffalo is now not only a draft animal, but also an important food source of milk and meat. It is increasingly apparent that the water buffalo have huge potential for meat production, but its breeding needs to be investigated. Regarding the molecular mechanisms involved in the meat quality difference between the buffalo (Bubalus bulabis) and yellow cattle (Bos taurus), 12 chemical-physical characteristics related to the meat quality of longissimus thoracis muscles (LTM) have been compared at the age of 36 months. Intramuscular lipid and b* (yellowness) were greater in cattle than the buffalo, whereas a* (redness) was greater in the buffalo. Gene expression profiles were constructed by bovine genome array. A total of 8884 and 10,960 probes were detected in buffalo and cattle, respectively, with 1580 genes being differentially expressed. Over 400 probes were upregulated and nearly 1200 were downregulated in LTM of the buffalo, most being involved in ribosomal RNA (rRNA) processing, cholesterol homeostasis, regulation of transcription, response to hypoxia, and glycolysis. Quantitative real-time PCR was used to validate the microarray data. Enriched GO analyses of highly expressed genes in LTM showed that protein biosynthesis, striated muscle contraction, iron homeostasis, iron transport, glycolysis and glucose metabolism were similar between the buffalo and cattle. High protein content, low fat content and deep meat color of buffalo LTM may be closely associated with the increased expression of genes involved in cholesterol and iron homeostasis, while also reducing the expression of genes involved in ubiquitin-mediated proteolysis and protein oxidative phosphorylation. These results establish the groundwork for further studies on buffalo meat quality and will be beneficial in improving water buffalo breeding by molecular biotechnology.

  18. Dairy cattle serum and milk factors contributing to the risk of colon and breast cancers.

    Science.gov (United States)

    zur Hausen, Harald; de Villiers, Ethel-Michele

    2015-08-15

    The analysis of published epidemiological data on colon and breast cancer reveals a remarkable concordance for most regions of the world. A low incidence for both cancers has been recorded in Mongolia and Bolivia. Discrepant data, however, have been reported for India, Japan and Korea. In India, the incidence of breast cancer is significantly higher than for colon cancer, in Japan and Korea colon cancer exceeds by far the rate of breast cancer. Here, studies are summarized pointing to a species-specific risk for colon cancer after consumption of beef originating from dairy cattle. Uptake of dairy products of Bos taurus-derived milk cattle, particularly consumed at early age, is suggested to represent one of the main risk factors for the development of breast cancer. A recent demonstration of reduced breast cancer rates in individuals with lactose intolerance (Ji et al., Br J Cancer 2014; 112:149-52) seems to be in line with this interpretation. Species-specific risk factors for these cancers are compatible with the transmission of different infectious factors transferred via meat or dairy products. Countries with discordant rates of colon and breast cancer reveal a similar discordance between meat and milk product consumption of dairy cattle. The recent isolation of a larger number of novel presumably viral DNAs from serum, meat and dairy products of healthy dairy cows, at least part of them infectious for human cells, deserves further investigation. Systemic infections early in life, resulting in latency and prevention of subsequent infections with the same agent by neutralizing antibodies, would require reconsideration of ongoing prospective studies conducted in the adult population.

  19. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  20. Resistance of paramyxoviridae to type I interferon-induced Bos taurus Mx1 dynamin.

    Science.gov (United States)

    Leroy, Michael; Baise, Etienne; Pire, Grégory; Gérardin, Joel; Desmecht, Daniel

    2005-04-01

    Typical targets of type I interferon (IFN)-induced antiviral Mx proteins known to date have been shown to share a common profile: single-stranded negative-sense RNA viruses. Among them, human MxA is known to interfere with the replication of measles, human, and bovine parainfluenza-3 viruses (BoPi3V), that is, three members of the Paramyxoviridae family. Recently, bovine Mx1 protein (BoMx1) was included in the group of Mx proteins with authenticated antiviral potential, as it dramatically represses the replication of vesicular stomatitis virus (VSV). As replication in bovine cells of Pi3, respiratory syncytial (RS), and Sendai (Se) viruses, all members of the same family, is known to be reduced on IFN-alpha incorporation into the culture medium, it was hypothesized that the BoMx1 pathway possibly was involved, its antiviral spectrum thus probably extending to Paramyxoviridae. In this study, probing of BoMx1-inhibiting effects was carried out by infecting a transgenic Vero cell line that allows tightly regulated conditional expression of BoMx1 after doxycycline treatment with a wide array of Paramyxoviridae. Expressing and nonexpressing cells displayed similar viability, cytopathic effects (CPEs), and amounts of infectious virus yields, whatever the infecting virus or the multiplicity of infection (moi) imposed. It is, therefore, concluded that BoMx1 does not interfere with Paramyxoviridae.

  1. Quantification of interferon-tau during the maternal recognition of pregnancy in Bos taurus indicus cows

    OpenAIRE

    Giassetti, Mariana Ianello; Pontes, Eduardo Oliveira; NIEMEYER, Claudia; Siqueira, Adriano Felipe Perez; Fedozzi, Filipe; de Lima, Marcelo Cardoso; Marques, Vanessa Belentani; Bertan, Claudia Maria [UNESP; Miglino,Maria Angélica; Arruda, Rubens Paes de; Papa, Paula de Carvalho; Binelli, Mario

    2008-01-01

    Durante o período crítico do reconhecimento materno, compreendido entre o 15° e 19° dias da gestação, o concepto deve sintetizar competentemente moléculas capazes de bloquear a síntese de prostaglandina F2a (pGF2a) e a luteólise. Em bovinos, a principal macromolécula protéica envolvida em tal bloqueio é o interferon-tau (IFN-r). Durante o período crítico, falhas neste reconhecimento determinam à mortalidade embrionária em até 40% das fêmeas inseminadas. Informações sobre o IFN-r em animais Bo...

  2. Occurrence and functional significance of the transcriptome in bovine (Bos taurus) spermatozoa

    Science.gov (United States)

    Selvaraju, Sellappan; Parthipan, Sivashanmugam; Somashekar, Lakshminarayana; Kolte, Atul P; Krishnan Binsila, B.; Arangasamy, Arunachalam; Ravindra, Janivara Parameshwaraiah

    2017-01-01

    Mammalian spermatozoa deliver various classes of RNAs to the oocyte during fertilization, and many of them may regulate fertility. The objective of the present study was to determine the composition and abundance of spermatozoal transcripts in fresh bull semen. The entire transcriptome of the spermatozoa from bulls (n = 3) was sequenced using two different platforms (Ion Proton and Illumina) to identify the maximum number of genes present in the spermatozoa. The bovine spermatozoa contained transcripts for 13,833 genes (transcripts per million, TPM > 10). Both intact and fragmented transcripts were found. These spermatozoal transcripts were associated with various stages of spermatogenesis, spermatozoal function, fertilization, and embryo development. The presence of intact transcripts of pregnancy-associated glycoproteins (PAGs) in the spermatozoa suggest a possible influence of sperm transcripts beyond early embryonic development. The specific regions (exon, intron, and exon-intron) of the particular spermatozoal transcripts might help regulate fertilization. This study demonstrates that the use of two different RNA-seq platforms provides a comprehensive profile of bovine spermatozoal RNA. Spermatozoal RNA profiling may be useful as a non-invasive method to delineate possible causes of male infertility and to predict fertility in a manner that is more effective than the conventional methods. PMID:28276431

  3. Loss of miRNAs during processing and storage of cow's (Bos taurus) milk.

    Science.gov (United States)

    Howard, Katherine M; Jati Kusuma, Rio; Baier, Scott R; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, Janos

    2015-01-21

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from pasteurized, store-bought bovine milk have biological activity in humans. Here, we assessed the effects of milk processing, storage, somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (milk fat content had no effect on miRNA stability during storage and microwave heating. The concentrations of miRNAs in dairy products were considerably lower than in store-bought milk. We conclude that processing of milk by dairies and handling by consumers causes a significant loss of miRNAs.

  4. Refinement of Bos taurus sequence assembly based on BAC-FISH experiments

    Directory of Open Access Journals (Sweden)

    Partipilo Giulia

    2011-12-01

    Full Text Available Abstract Background The sequencing of the cow genome was recently published (Btau_4.0 assembly. A second, alternate cow genome assembly (UMD2, based on the same raw sequence data, was also published. The two assemblies have been subsequently updated to Btau_4.2 and UMD3.1, respectively. Results We compared the Btau_4.2 and UMD3.1 alternate assemblies. Inconsistencies were grouped into three main categories: (i DNA segments showing almost coincidental chromosomal mapping but discordant orientation (inversions; (ii DNA segments showing a discordant map position along the same chromosome; and (iii sequences present in one chromosomal assembly but absent in the corresponding chromosome of the other assembly. The latter category mainly consisted of large amounts of scaffolds that were unassigned in Btau_4.2 but successfully mapped in UMD3.1. We sampled 70 inconsistencies and identified appropriate cow BACs for each of them. These clones were then utilized in FISH experiments on cow metaphase or interphase nuclei in order to disambiguate the discrepancies. In almost all instances the FISH results agreed with the UMD3.1 assembly. Occasionally, however, the mapping data of both assemblies were discordant with the FISH results. Conclusions Our work demonstrates how FISH, which is assembly independent, can be efficiently used to solve assembly problems frequently encountered using the shotgun approach.

  5. Natural autoantibodies in Bos taurus calves during the first twelve weeks of life

    NARCIS (Netherlands)

    Mayasari, N.; Knegsel, van A.T.M.; Vries Reilingh, de G.; Kemp, B.; Parmentier, H.K.

    2016-01-01

    Natural autoantibodies (NAAb) have a role in maintaining physiological homeostasis and prevention of infections, and have been found in mammalian species tested so far. Albeit NAAb levels rise with age, little is known about the origin, function, regulation and initiation of NAAb in young animals

  6. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    OpenAIRE

    Schreiber Mark; Morris Chris A; McCulloch Alan F; Dodds Ken G; Cullen Neil G; Manley Tim R; Glass Belinda C; Keane Orla M; Lee Michael A; Warren Jonathan; Zadissa Amonida; Wilson Theresa; McEwan John C

    2006-01-01

    Abstract Background Single nucleotide polymorphisms (SNPs) are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence ta...

  7. Fatores etários no leucograma de fêmeas zebuínas sadias da raça Nelore (Bos indicus Influence of age on the leukogram values for healthy Nelore (Zebu cattle

    Directory of Open Access Journals (Sweden)

    Joselito Nunes Costa

    2000-06-01

    Full Text Available Para avaliar-se a influência dos fatores etários sobre o leucograma de fêmeas zebuínas da raça Nelore, examinaram-se amostras de sangue de 158 animais, distribuídos por sete grupos etários ( até 3 meses; 3 a 6 meses; 6 a 12 meses; 12 a 24 meses; 24 a 48 meses; 48 a 72 meses e maior que 72 meses. Os resultados expressos em valores médios (± desvios padrões máximo (máx. e mínimo (mín. em milhares de células por mm³ para os diferentes componentes do leucograma foram os seguintes: leucócitos total máx. - 16992 ± 4104 ( 6 a 12 meses e min. -10353 ± 2397 (48 a 72 meses ; neutrófilos total máx. - 3931 ± 1578 (até 3 meses e min. - 2416 ± 1118 ( 6 a 12 meses ; eosinófilos máx. - 999 ± 499 (24 a 48 meses e min. - 265 ± 276 ( 3 a 6 meses ; basófilos máx. - 67 ± 88 (> 72 meses e min. - 39 ± 78 (6 a 12 meses; linfócitos típicos máx. - 12758 ± 3608 (6 a 12 meses e min. - 5906 ± 1883 (48 a 72 meses; linfócitos atípicos máx. - 1310 ± 603 (3 a 6 meses e min. - 760 ± 419 ( 48 a 72 meses ; linfócitos total máx. - 14079 ± 4027 (6 a 12 meses e min. - 6666 ± 2059 ( 48 a 72 meses ; monócitos máx. -27 ± 62 ( até 3 meses e min.- 0 ( 6 a 12 meses. A existência de diferenças (p > 0,05 entre grupos demonstrando diminuição dos neutrófilos e aumento dos linfócitos no primeiro ano de vida; a diminuição dos valores do total de leucócitos a partir de um ano de idade, como reflexo de comportamento similar dos números de linfócitos (típicos e atípicos e o aumento dos eosinófilos entre 24 e 48 meses de vida, caracterizaram a influência dos fatores etários sobre a variação dos valores dos componentes do leucograma de fêmeas zebuínas da raça Nelore criadas em São Paulo - Brasil.In order to evaluate the influence of the age on the white blood cell counts of Nelore (Zebu cattle, 158 blood samples from seven groups of different ages (group I-up to three months; group II-three to six months; group III-six to 12

  8. Methanogen community structure in the rumens of farmed sheep, cattle and red deer fed different diets.

    Science.gov (United States)

    Jeyanathan, Jeyamalar; Kirs, Marek; Ronimus, Ron S; Hoskin, Simone O; Janssen, Peter H

    2011-05-01

    Development of inhibitors and vaccines that mitigate rumen-derived methane by targeting methanogens relies on knowledge of the methanogens present. We investigated the composition of archaeal communities in the rumens of farmed sheep (Ovis aries), cattle (Bos taurus) and red deer (Cervus elaphus) using denaturing gradient gel electrophoresis (DGGE) to generate fingerprints of archaeal 16S rRNA genes. The total archaeal communities were relatively constant across species and diets, and were less variable and less diverse than bacterial communities. There were diet- and ruminant-species-based differences in archaeal community structure, but the same dominant archaea were present in all rumens. These were members of three coherent clades: species related to Methanobrevibacter ruminantium and Methanobrevibacter olleyae; species related to Methanobrevibacter gottschalkii, Methanobrevibacter thaueri and Methanobrevibacter millerae; and species of the genus Methanosphaera. Members of an archaeal group of unknown physiology, designated rumen cluster C (RCC), were also present. RCC-specific DGGE, clone library analysis and quantitative real-time PCR showed that their 16S rRNA gene sequences were very diverse and made up an average of 26.5% of the total archaea. RCC sequences were not readily detected in the DGGE patterns of total archaeal 16S rRNA genes because no single sequence type was abundant enough to form dominant bands.

  9. k-Casein, b-lactoglobulin and growth hormone allele frequencies and genetic distances in Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis cattle

    Directory of Open Access Journals (Sweden)

    Paola Augusta Kemenes

    1999-12-01

    Full Text Available The genotypes for k-casein (k-CN, b-lactoglobulin (b-LG and growth hormone (GH were determined by polymerase chain reaction (PCR and restriction enzyme digestion in seven breeds of cattle (Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis. k-Casein had two alleles with the A allele occurring at a higher frequency in Bos indicus breeds (0.93, 0.92 and 0.91% for Gyr, Guzerá and Nelore, respectively. The b-lactoglobulin locus had two alleles in all of the breeds. European breeds had a higher frequency of the b-LG A allele than Zebu breeds. The GH locus had two alleles (L and V in Bos taurus and was monomorphic (L allele only in all of the Bos indicus breeds evaluated. The highest frequency for the V allele was observed in Charolais cattle. The markers used revealed a considerable similarity among breeds, with two main groups being discernible. One group consisted of Zebu and Santa Gertrudis breeds and the other consisted of European and Canchim breeds.Os genótipos de k-caseína (k-CN, b-lactoglobulina (b-LG e hormônio de crescimento foram determinados por reação em cadeia de polimerase (PCR e digestão com enzima de restrição em sete raças de bovinos (Nelore, Gir, Guzerá, Caracu, Charolesa, Canchim and Santa Gertrudis. A k-caseína apresentou dois alelos e as freqüências mais elevadas para o alelo A foram observadas em Bos indicus (0,93, 0,92 e 0,91% para as raças Gir, Guzerá e Nelore, respectivamente. A b-lactoglobulina apresentou dois alelos em todas as raças estudadas, sendo a freqüência do alelo A mais elevada nas raças européias. O loco de hormônio de crescimento apresentou dois alelos em Bos taurus e foi monomórfico (alelo L em todas as raças zebuínas. A maior freqüência para o alelo V foi observado na raça Charolesa. Os marcadores investigados revelaram alta similaridade entre as raças, com a formação de dois grupos principais: um composto de raças zebuínas e a raça Santa Gertrudis e outro

  10. Social behaviour of cattle in tropical silvopastoral and monoculture systems.

    Science.gov (United States)

    Améndola, L; Solorio, F J; Ku-Vera, J C; Améndola-Massiotti, R D; Zarza, H; Galindo, F

    2016-05-01

    Silvopastoral systems can be a good alternative for sustainable livestock production because they can provide ecosystem services and improve animal welfare. Most farm animals live in groups and the social organization and interactions between individuals have an impact on their welfare. Therefore, the objective of this study was to describe and compare the social behaviour of cattle (Bos indicus×Bos taurus) in a silvopastoral system based on a high density of leucaena (Leucaena leucocephala) combined with guinea grass (Megathyrsus maximus), star grass (Cynodon nlemfuensis) and some trees; with a monoculture system with C. nlemfuensis, in the region of Merida, Yucatán. Eight heifers in each system were observed from 0730 to 1530 h each day for 12 consecutive days during the dry season and 12 consecutive days during the rainy season. The animals followed a rotation between three paddocks, remaining 4 days in each paddock. The vegetation was characterized in the paddocks of the silvopastoral system to estimate the average percentage of shade provided. To make a comparison between systems, we used a t test with group dispersion, and Mann-Whitney tests with the frequency of affiliative and agonistic behaviours. We assessed differences in linearity and stability of dominance hierarchies using Landau's index and Dietz R-test, respectively. The distance of cows with respect to the centroid of the group was shorter, and non-agonistic behaviours were 62% more frequent in the intensive silvopastoral system than in the monoculture one. Heifers in the silvopastoral system had a more linear and non-random dominance hierarchy in both seasons (dry season: h'=0.964; rainy season: h'=0.988), than heifers in the monoculture system (dry season: h'=0.571, rainy season: h'=0.536). The dominance hierarchy in the silvopastoral system was more stable between seasons (R-test=0.779) than in the monoculture system (R-test=0.224). Our results provide the first evidence that heifers in the

  11. Methane emissions of beef cattle on forages: efficiency of grazing management systems.

    Science.gov (United States)

    DeRamus, H Alan; Clement, Terry C; Giampola, Dean D; Dickison, Peter C

    2003-01-01

    Fermentation in the rumen of cattle produces methane (CH4). Methane may play a role in global warming scenarios. The linking of grazing management strategies to more efficient beef production while reducing the CH4 emitted by beef cattle is important. The sulfur hexafluoride (SF6) tracer technique was used to determine the effects of best management practices (BMP) grazing compared with continuous grazing on CH4 production in several Louisiana forages during 1996-1998. Cows and heifers (Bos taurus) grazed common bermudagrass [Cynodon dactylon (L.) Pers.], bahiagrass (Paspalum notatum Flugge), and ryegrass (Lolium multiflorum Lam.) pastures and were wintered on bahiagrass hay with supplements of protein molasses blocks (PMB), cottonseed meal and corn (CSMC), urea and corn (URC), or limited ryegrass grazing (LRG). Daily CH4 emissions were between 89 and 180 g d(-1) for young growing heifers and 165 to 294 g d(-1) for mature Simbrah cows. Heifers on "ad lib" ryegrass in March and April produced only one-tenth the CH4 per kg of gain as heifers on LRG of 1 h. Using BMP significantly reduced the emission of CH4 per unit of animal weight gain. Management-intensive grazing (MIG) is a BMP that offers the potential for more efficient utilization of grazed forage crops via controlled rotational grazing and more efficient conversion of forage into meat and milk. Projected CH4 annual emissions in cows reflect a 22% reduction from BMP when compared with continuous grazing in this study. With the BMP application of MIG, less methane was produced per kilogram of beef gain.

  12. Chemical and physical changes following co-composting of beef cattle feedlot manure with phosphogypsum.

    Science.gov (United States)

    Zvomuya, Francis; Larney, Francis J; Nichol, Connie K; Olson, Andrew F; Miller, Jim J; Demaere, Paul R

    2005-01-01

    Nitrogen (N) loss during beef cattle (Bos taurus) feedlot manure composting may contribute to greenhouse gas emissions and increase ammonia (NH(3)) in the atmosphere while decreasing the fertilizer value of the final compost. Phosphogypsum (PG) is an acidic by-product of phosphorus (P) fertilizer manufacture and large stockpiles currently exist in Alberta. This experiment examined co-composting of PG (at rates of 0, 40, 70, and 140 kg PG Mg(-1) manure plus PG dry weight) with manure from feedlot pens bedded with straw or wood chips. During the 99-d composting period, PG addition reduced total nitrogen (TN) loss by 0.11% for each 1 kg Mg(-1) increment in PG rate. Available N at the end of composting was significantly higher for wood chip-bedded (2180 mg kg(-1)) than straw-bedded manure treatments (1820 mg kg(-1)). Total sulfur (TS) concentration in the final compost increased by 0.19 g kg(-1) for each 1 kg Mg(-1) increment in PG rate from 5.2 g TS kg(-1) without PG addition. Phosphogypsum (1.6 g kg(-1) P) addition had no significant effect on total phosphorus (TP) concentration of the final composts. Results from this study demonstrate the potential of PG addition to reduce overall N losses during composting. The accompanying increase in TS content has implications for use of the end-product on sulfur-deficient soils. Co-composting feedlot manure with PG may provide an inexpensive and technologically straightforward solution for managing and improving the nutrient composition of composted cattle manure.

  13. Genome-Wide Association Study between Single Nucleotide Polymorphisms and Flight Speed in Nellore Cattle

    Science.gov (United States)

    Valente, Tiago Silva; Baldi, Fernando; Sant’Anna, Aline Cristina; Albuquerque, Lucia Galvão; Paranhos da Costa, Mateus José Rodrigues

    2016-01-01

    Introduction Cattle temperament is an important factor that affects the profitability of beef cattle enterprises, due to its relationship with productivity traits, animal welfare and labor safety. Temperament is a complex phenotype often assessed by measuring a series of behavioral traits, which result from the effects of multiple environmental and genetic factors, and their interactions. The aims of this study were to perform a genome-wide association study and detect genomic regions, potential candidate genes and their biological mechanisms underlying temperament, measured by flight speed (FS) test in Nellore cattle. Materials and Methods The genome-wide association study (GWAS) was performed using a single-step procedure (ssGBLUP) which combined simultaneously all 16,600 phenotypes from genotyped and non-genotyped animals, full pedigree information of 162,645 animals and 1,384 genotyped animals in one step. The animals were genotyped with High Density Bovine SNP BeadChip which contains 777,962 SNP markers. After quality control (QC) a total of 455,374 SNPs remained. Results Heritability estimated for FS was 0.21 ± 0.02. Consecutive SNPs explaining 1% or more of the total additive genetic variance were considered as windows associated with FS. Nine candidate regions located on eight different Bos taurus chromosomes (BTA) (1 at 73 Mb, 2 at 65 Mb, 5 at 22 Mb and 119 Mb, 9 at 98 Mb, 11 at 67 Mb, 15 at 16 Mb, 17 at 63 Kb, and 26 at 47 Mb) were identified. The candidate genes identified in these regions were NCKAP5 (BTA2), PARK2 (BTA9), ANTXR1 (BTA11), GUCY1A2 (BTA15), CPE (BTA17) and DOCK1 (BTA26). Among these genes PARK2, GUCY1A2, CPE and DOCK1 are related to dopaminergic system, memory formation, biosynthesis of peptide hormone and neurotransmitter and brain development, respectively. Conclusions Our findings allowed us to identify nine genomic regions (SNP windows) associated with beef cattle temperament, measured by FS test. Within these windows, six promising

  14. Genome-Wide Association Study between Single Nucleotide Polymorphisms and Flight Speed in Nellore Cattle.

    Directory of Open Access Journals (Sweden)

    Tiago Silva Valente

    Full Text Available Cattle temperament is an important factor that affects the profitability of beef cattle enterprises, due to its relationship with productivity traits, animal welfare and labor safety. Temperament is a complex phenotype often assessed by measuring a series of behavioral traits, which result from the effects of multiple environmental and genetic factors, and their interactions. The aims of this study were to perform a genome-wide association study and detect genomic regions, potential candidate genes and their biological mechanisms underlying temperament, measured by flight speed (FS test in Nellore cattle.The genome-wide association study (GWAS was performed using a single-step procedure (ssGBLUP which combined simultaneously all 16,600 phenotypes from genotyped and non-genotyped animals, full pedigree information of 162,645 animals and 1,384 genotyped animals in one step. The animals were genotyped with High Density Bovine SNP BeadChip which contains 777,962 SNP markers. After quality control (QC a total of 455,374 SNPs remained.Heritability estimated for FS was 0.21 ± 0.02. Consecutive SNPs explaining 1% or more of the total additive genetic variance were considered as windows associated with FS. Nine candidate regions located on eight different Bos taurus chromosomes (BTA (1 at 73 Mb, 2 at 65 Mb, 5 at 22 Mb and 119 Mb, 9 at 98 Mb, 11 at 67 Mb, 15 at 16 Mb, 17 at 63 Kb, and 26 at 47 Mb were identified. The candidate genes identified in these regions were NCKAP5 (BTA2, PARK2 (BTA9, ANTXR1 (BTA11, GUCY1A2 (BTA15, CPE (BTA17 and DOCK1 (BTA26. Among these genes PARK2, GUCY1A2, CPE and DOCK1 are related to dopaminergic system, memory formation, biosynthesis of peptide hormone and neurotransmitter and brain development, respectively.Our findings allowed us to identify nine genomic regions (SNP windows associated with beef cattle temperament, measured by FS test. Within these windows, six promising candidate genes and their biological functions were

  15. Spectroscopy of Putative Brown Dwarfs in Taurus

    CERN Document Server

    Luhman, K L

    2010-01-01

    Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2+/-0.5) and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

  16. Visualization of the transmission of direct genomic values for paternal and maternal chromosomes for 15 traits in U.S. Brown Swiss, Holstein, and Jersey cattle

    Science.gov (United States)

    Reliable haplotypes are available for 171,420 Brown Swiss, Holstein, and Jersey bulls and cows that received genomic evaluations in April 2012. Differences in least-squares means of direct genomic values (DGV) for paternal and maternal haplotypes of Bos taurus autosome (BTA) 1, 6, 14, and 18 for lif...

  17. Virulence of H5N1 Influenza Virus in Cattle Egrets (Bubulcus Ibis)

    DEFF Research Database (Denmark)

    Phuong, Do Quy; Dung, Nguyen Tien; Jørgensen, Poul Henrik

    2011-01-01

    In Vietnam, Cattle Egrets (Bubulcus ibis) are common in a variety of habitats, such as freshwater marshes, beaches, and paddy fields. They are also found associated with cattle (Bos spp.) and occasionally with pigs (Sus scrofa), goats (Capra hircus), and horses (Equus caballus) and are kept...

  18. Bioanalytical methods for the metalloproteomics study of bovine longissimus thoracis muscle tissue with different grades of meat tenderness in the Nellore breed (Bos indicus).

    Science.gov (United States)

    Baldassini, Welder Angelo; Braga, Camila Pereira; Chardulo, Luis Artur Loyola; Vasconcelos Silva, Josineudson Augusto; Malheiros, Jessica Moraes; de Albuquerque, Lúcia Galvão; Fernandes, Talita Tanaka; Padilha, Pedro de Magalhães

    2015-02-15

    The work describes a metalloproteomics study of bovine muscle tissue with different grades of meat tenderness from animals of the Nellore breed (Bos indicus) based on protein separation by two-dimensional gel electrophoresis, the identification of calcium ions in protein spots by X-ray fluorescence (SR-XRF) and the characterisation of proteins by electrospray ionisation mass spectrometry. Forty (40) specimens were selected and divided into two experimental groups: animals with tough meat (TO) and animals with tender meat (TE). A third group (P) of Piedmontese breed animals (Bos taurus) was included to serve as a comparative model for the level of meat tenderness. The procedures were efficient and preserved the metal-protein structure, enabling calcium detection in protein spots by SR-XRF at a given molecular weight range of 14-97kDa. Two proteins (pyruvate kinase and albumin) were inferred to be related to the phenotypical differences in animals from the different groups.

  19. Pilot meetnet functievervulling bos, natuur en landschap

    NARCIS (Netherlands)

    Dirkse, G.M.; Daamen, W.P.

    2000-01-01

    Alterra en Bosdata voerden in opdracht van het Expertisecentrum LNV een proef uit voor het meetnet functievervulling bos, natuur en landschap. Het meetnet schat periodiek met een geografische steekproef de oppervlakte land met een zekere kwaliteit voor recreatie, natuur, milieu en economie. De steek

  20. The Taurus Spitzer Survey: New Candidate Taurus Members Selected Using Sensitive Mid-Infrared Photometry

    CERN Document Server

    Rebull, L M; McCabe, C -E; Hillenbrand, L A; Stapelfeldt, K R; Noriega-Crespo, A; Carey, S J; Brooke, T; Huard, T; Terebey, S; Audard, M; Monin, J -L; Fukagawa, M; Guedel, M; Knapp, G R; Menard, F; Allen, L E; Angione, J R; Baldovin-Saavedra, C; Bouvier, J; Briggs, K; Dougados, C; Evans, N J; Flagey, N; Guieu, S; Grosso, N; Glauser, A M; Harvey, P; Hines, D; Latter, W B; Skinner, S L; Strom, S; Tromp, J; Wolf, S

    2009-01-01

    We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in 7 mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously-identified members of the Taurus star-forming region in our ~44 square degree map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ~20% of the bonafide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 candidate new members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, 3 probable new members, and 10 possible new members, an increase of 15-20% in Taurus members. Of the objects for which we have spectroscopy, 7 are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candida...

  1. Evaluación de los polimorfismos de nucleotido simple asociados a cambios en el color de la carne en ganados bos indicus y cruces con bos taurus

    OpenAIRE

    Castro Molina, Susan Lorena

    2013-01-01

    La palatabilidad de la carne comprende muchos factores como el aspecto, el color, el sabor, la jugosidad y la dureza, los cuales se asocian a la calidad sensorial. Actualmente existe una tendencia hacia el bajo consumo de carne, dado por los elevados precios y en muchas ocasiones por la inadecuada calidad. El color de la carne constituye el primer atributo sensorial que recibe el consumidor en el momento de tomar la decisión para la compra, un óptimo color le otorga a la carne propiedades de ...

  2. Differential expression of IGF family members in heat-stressed embryos produced in vitro from OPU-derived oocytes of Nelore (Bos indicus) and Holstein (Bos taurus) cows.

    Science.gov (United States)

    Satrapa, R A; Razza, E M; Castilho, A C S; Simões, R A L; Silva, C F; Nabhan, T; Pegorer, M F; Barros, C M

    2013-12-01

    The IGF system is related to embryo quality. We aim to determine the effect of the heat stress on the mRNA expression of IGF1 and IGF2, IGFR1 and IGFR2, IGFBP2 and IGFBP4, and PAPPA in in vitro production (IVP) blastocysts from Nelore and Holstein after ovum pick up (OPU) to better understand the differences between these breeds. Oocytes from four Nelore and seven Holstein were collected in six OPU sessions. Following in vitro maturation and fertilization using six Nelore or Holstein sires, embryos were divided into control (cultured at 39°C) and heat stress (HS; exposed to 41°C for 9 h). Blastocysts were submitted to RNA extraction. The IGF1 expression was higher in blastocysts under HS in both breeds, and the expression of IGFBP2 and IGFBP4 was higher in Holstein blastocysts under HS. The high PAPPA expression and the low expression of IGFBP2 and IGFBP4 are associated with a more efficient degradation of IGFBPs, which results in greater IGF bioavailability in Nelore blastocysts and may contribute to the superior HS tolerance in Nelore, when compared to Holstein.

  3. Assessment of autozygosity in Nellore cows (Bos indicus) through high-density SNP genotypes

    Science.gov (United States)

    Zavarez, Ludmilla B.; Utsunomiya, Yuri T.; Carmo, Adriana S.; Neves, Haroldo H. R.; Carvalheiro, Roberto; Ferenčaković, Maja; Pérez O'Brien, Ana M.; Curik, Ino; Cole, John B.; Van Tassell, Curtis P.; da Silva, Marcos V. G. B.; Sonstegard, Tad S.; Sölkner, Johann; Garcia, José F.

    2015-01-01

    The use of relatively low numbers of sires in cattle breeding programs, particularly on those for carcass and weight traits in Nellore beef cattle (Bos indicus) in Brazil, has always raised concerns about inbreeding, which affects conservation of genetic resources and sustainability of this breed. Here, we investigated the distribution of autozygosity levels based on runs of homozygosity (ROH) in a sample of 1,278 Nellore cows, genotyped for over 777,000 SNPs. We found ROH segments larger than 10 Mb in over 70% of the samples, representing signatures most likely related to the recent massive use of few sires. However, the average genome coverage by ROH (>1 Mb) was lower than previously reported for other cattle breeds (4.58%). In spite of 99.98% of the SNPs being included within a ROH in at least one individual, only 19.37% of the markers were encompassed by common ROH, suggesting that the ongoing selection for weight, carcass and reproductive traits in this population is too recent to have produced selection signatures in the form of ROH. Three short-range highly prevalent ROH autosomal hotspots (occurring in over 50% of the samples) were observed, indicating candidate regions most likely under selection since before the foundation of Brazilian Nellore cattle. The putative signatures of selection on chromosomes 4, 7, and 12 may be involved in resistance to infectious diseases and fertility, and should be subject of future investigation. PMID:25688258

  4. Le Flaubert de Charles Du Bos

    Directory of Open Access Journals (Sweden)

    Jacques Neefs

    2009-01-01

    Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

  5. [Polymorphism of the BoLA-DRB3 gene in the Mongolian, Kalmyk, and Yakut cattle breeds].

    Science.gov (United States)

    Ruzina, M N; Shtyfurko, T A; Mohammadabadi, M R; Gendzhieva, O V; Tsedev, Tsenduren; Sulimova, G E

    2010-04-01

    Polymorphism of the BoLA-DRB3 gene was studied with the use of the PCR-RFLP technique in three cattle breeds (Mongolian, Kalmyk, and Yakut) representing the Bos taurus turano-mongolicus group. 35 BoLA-DRB3.2 alleles were detected in the Mongolian breed and 34 alleles in the Kalmyk breed. The frequencies of alleles in both populations are distributed rather evenly: the frequencies of the most widely represented alleles (*18, *20, and *28) in the Mongolian cattle varied from 7.75 to 8.45%. The most frequent alleles in the Kalmyk cattle were *28(14.52%), *24(7.26%), and *12(6.45%). Only five alleles were identified in the Yakut cattle breed. The prevailing allele was *29 (77.3%); a relatively frequent allele was *1(13.1%), and the remaining three alleles constituted only 9.6%. Such a low level of diversity of BoLA-DRB3 gene alleles was not observed earlier in any other cattle breed. The Mongolian and Kalmyk breeds showed a wide diversity of BoLA-DRB3 genotypes (56 and 51 genotypes, respectively) and a high level of expected heterozygosity (He = 0.953 and 0.946, respectively). Both breeds had a deficiency of heterozygotes (Mongolian cattle: Ho = 0.775, D = -0.187; Kalmyk cattle: Ho = 0.708, D= -0.252). A low level ofgenotypic diversity for the BoLA-DRB3 locus (only seven genotypes; the frequency for the genotype *29/*29 is 71.4%) and a very low level of observed heterozygosity (Ho = 0.12) were revealed in the Yakut breed. BoLA-DRB3.2 alleles associated with resistance to persistent lymphocytosis caused by the bovine leukemia virus (total frequencies 15.49 and 24.19%) and to various forms of mastitis (total frequencies 12.68 and 20.96%, respectively) were identified in the Mongolian and Kalmyk animals. In the Yakut breed, alleles associated with resistance to diseases are represented only by the BoLA-DRB3.2 allele *7 (1.2%). Thus, the Mongolian and Kalmyk cattle breeds are characterized by a wide diversity of alleles and genotypes for the BoLA-DRB3 gene. In contrast

  6. Molecular characterization and combined genotype association study of bovine cluster of differentiation 14 gene with clinical mastitis in crossbred dairy cattle

    Directory of Open Access Journals (Sweden)

    A. Sakthivel Selvan

    2016-07-01

    Full Text Available Aim: The present study was undertaken with the objectives to characterize and to analyze combined genotypes of cluster of differentiation 14 (CD14 gene to explore its association with clinical mastitis in Karan Fries (KF cows maintained in the National Dairy Research Institute herd, Karnal. Materials and Methods: Genomic DNA was extracted using blood of randomly selected 94 KF lactating cattle by phenolchloroform method. After checking its quality and quantity, polymerase chain reaction (PCR was carried out using six sets of reported gene-specific primers to amplify complete KF CD14 gene. The forward and reverse sequences for each PCR fragments were assembled to form complete sequence for the respective region of KF CD14 gene. The multiple sequence alignments of the edited sequence with the corresponding reference with reported Bos taurus sequence (EU148610.1 were performed with ClustalW software to identify single nucleotide polymorphisms (SNPs. Basic Local Alignment Search Tool analysis was performed to compare the sequence identity of KF CD14 gene with other species. The restriction fragment length polymorphism (RFLP analysis was carried out in all KF cows using Helicobacter pylori 188I (Hpy188I (contig 2 and Haemophilus influenzae I (HinfI (contig 4 restriction enzyme (RE. Cows were assigned genotypes obtained by PCRRFLP analysis, and association study was done using Chi-square (χ2 test. The genotypes of both contigs (loci number 2 and 4 were combined with respect to each animal to construct combined genotype patterns. Results: Two types of sequences of KF were obtained: One with 2630 bp having one insertion at 616 nucleotide (nt position and one deletion at 1117 nt position, and the another sequence was of 2629 bp having only one deletion at 615 nt position. ClustalW, multiple alignments of KF CD14 gene sequence with B. taurus cattle sequence (EU148610.1, revealed 24 nt changes (SNPs. Cows were also screened using PCR-RFLP with Hpy188I

  7. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  8. Reuse of norgestomet implants in an eCG-based superovulation protocol administered to Nelore (Bos taurus indicus) cows

    OpenAIRE

    Sudano, Mateus Jose [UNESP; Landim-Alvarenga, Fernanda da Cruz [UNESP; Sartori, Roberto; Machado, Rui

    2011-01-01

    This study assessed the reuse of norgestomet implants in Nelore cows that were superstimulated with eCG. In a crossover design trial, eight cows were randomly divided into two experimental groups and twice superstimulated: Group 1 - half of the cows received a new norgestomet implant and 2 mg estradiol benzoate (EB) on Day 0; Group 2 - remaining cows received two once-used norgestomet implants and 2 mg EB also on Day 0. on Day 4 all cows received a single dose of 2000 IU eCG, and on Day 6 cow...

  9. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus).

    Science.gov (United States)

    Ha, Minh; Sabherwal, Manya; Duncan, Elizabeth; Stevens, Stewart; Stockwell, Peter; McConnell, Michelle; Bekhit, Alaa El-Din; Carne, Alan

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes) was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes). This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  10. Genetic polymorphisms related to meat traits in purebred and crossbred Nelore cattle Polimorfismos genéticos relacionados às características da carne em bovinos Nelore puros e cruzados

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2009-12-01

    Full Text Available The objective of this work was to estimate the allelic and genotypic frequencies of CAST/XmnI, a calpastatin gene polymorphism, and CAPN530, a calpain 1 large subunit gene polymorphism, in different beef genetic groups (Nelore and Nelore x Bos taurus, and to investigate associations between these polymorphisms and carcass and meat traits. Three hundred animals - comprising 114 Nelore, 67 Angus x Nelore, 44 Rubia Gallega x Nelore, 41 Canchim, 19 Brangus three-way cross and 15 Braunvieh three-way cross- were genotyped by PCR-RFLP and phenotyped for rib-eye area (REA, back-fat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The occurrence of the two alleles of the CAST/XmnI and CAPN530 single nucleotide polymorphisms (SNPs in a B. indicus breed, which permitted association studies in purebred and crossbred Nelore cattle, was first shown in the present work. No relationship was found between the CAST or CAPN1 SNPs and growth-related traits (REA or fat deposition (BT and IF, since calpastatin and µ-calpain are not physiologically involved with these traits. Moreover, the association results between genotypes and aged meat tenderness (assessed by SF and MFI showed that these markers are useless in assisted selection for purebred Nelore and their crosses with B. taurus.O presente trabalho objetivou estimar, em bovinos de corte de diferentes grupos genéticos (Nelore e Nelore x Bos taurus, as frequências alélicas e genotípicas dos polimorfismos CAST/XmnI, do gene da calpastatina, e CAPN530, do gene da calpaína, bem como avaliar a ocorrência de associações entre esses polimorfismos e características da carcaça e da carne produzida. Trezentos animais - 114 Nelore, 67 Angus x Nelore, 44 Rubia Galega x Nelore, 41 Canchim, 19 tricross Brangus e 15 tricross Braunvieh - foram genotipados por PCR-RFLP e fenotipados para área de olho de lombo (AOL, cobertura de gordura subcutânea (CGS, gordura

  11. Novel SNPs in HSPB8 gene and their association with heat tolerance traits in Sahiwal indigenous cattle.

    Science.gov (United States)

    Verma, Nishant; Gupta, Ishwar Dayal; Verma, Archana; Kumar, Rakesh; Das, Ramendra; Vineeth, M R

    2016-01-01

    Heat shock proteins (HSPs) are expressed in response to heat stress, and the polymorphism in HSP genes at single-nucleotide level has been reported to be associated with heat tolerance and production performance traits in cattle. HSPB8 gene has been mapped on Bos taurus autosome 17 (BTA-17) spanning nearly 13,252 bp and comprising three exons and two introns. The present study was conducted in Sahiwal cows (n = 108) reared in subtropical climate with the objectives to identify SNPs in all three exons and part of intron 1 of HSPB8 gene and to analyze their association with heat tolerance traits in Sahiwal cows. Respiration rate (RR) and rectal temperature (RT) were recorded once during probable extreme hours in different seasons or Temperature-Humidity Index (THI), i.e., winter, spring, and summer. Heat tolerance coefficient (HTC) was also calculated to check the adaptability of the animals during the period of heat stress. The comparative sequence analysis revealed a total two single-nucleotide polymorphisms (SNPs), i.e., g.507G>A in exon 1 and g.881T>C in intron 1 of HSPB8 gene. Out of these two identified SNPs, only one SNP, i.e., g.507G>A, was found to be significantly associated with heat tolerance indicator traits (RR, RT, and HTC) in Sahiwal cows. The perusal of results across different seasons showed the significant (P A SNP of HSPB8 gene. However, in case of another SNP, i.e., g.881T>C, located on intron 1, the RR, RT, and HTC were having non-significant association with the different genotypes, i.e., TT and TC. These findings may partly suggest that GA genotype of SNP g.507G>A of HSPB8 gene has a probable role in heat tolerance in Sahiwal cattle and can therefore be utilized as a marker in propagation of thermo-tolerance cattle in hot tropical and subtropical climate. Nevertheless, the involvement of other regulatory mechanisms cannot be overruled.

  12. Evaluation of models to induce low progesterone during the early luteal phase in cattle.

    Science.gov (United States)

    Beltman, M E; Roche, J F; Lonergan, P; Forde, N; Crowe, M A

    2009-10-15

    Two experiments were designed to evaluate models for generation of low circulating progesterone concentrations during early pregnancy in cattle. In Experiment 1, 17 crossbred heifers (Bos taurus) were assigned to either prostaglandin F(2alpha) (PGF(2alpha)) administration on Days 3, 3.5, and 4 (PG3; n=9) or to control (n=8). Blood samples were collected from heifers from Days 1 to 9 for progesterone assay. Progesterone concentrations were decreased (P<0.03) between 18 and 48h after first PGF(2alpha) treatment in heifers assigned to PG3 compared with that of controls. In Experiment 2, 39 crossbred heifers detected in estrus were inseminated (Day 0) and assigned to either (1) PGF(2alpha) administration on Days 3, 3.5, and 4 (PG3; n=10), (2) PGF(2alpha) administration on Days 3, 3.5, 4, and 4.5 (PG4; n=10), (3) Progesterone Releasing Intravaginal Device (PRID) insertion on Day 4.5 with PGF(2alpha) administration on Days 5 and 6 (PRID+PGF(2alpha); n=10), or (4) control (n=9). Blood samples were collected daily until Day 15, and conceptus survival rate was determined at slaughter on Day 16. Progesterone concentrations during the sampling period in the PG3 and PG4 groups did not differ but were less than that of controls (P<0.01). After an initial peak, progesterone concentrations in the PRID+PGF(2alpha) group were similar to that of controls. More heifers in the PG4 group (6 of 10) had complete luteal regression than did those in the PG3 group (3 of 10). Conceptus survival rate on Day 16 did not differ between groups. There was a significant correlation between progesterone concentration on Days 5 and 6 and conceptus size on Day 16. In summary, treatment with PGF(2alpha) on Days 3, 3.5, and 4 postestrus appeared to provide the best model to induce reduced circulating progesterone concentrations during the early luteal phase in cattle.

  13. Whole genome resequencing of black Angus and Holstein cattle for SNP and CNV discovery

    Directory of Open Access Journals (Sweden)

    Stothard Paul

    2011-11-01

    Full Text Available Abstract Background One of the goals of livestock genomics research is to identify the genetic differences responsible for variation in phenotypic traits, particularly those of economic importance. Characterizing the genetic variation in livestock species is an important step towards linking genes or genomic regions with phenotypes. The completion of the bovine genome sequence and recent advances in DNA sequencing technology allow for in-depth characterization of the genetic variations present in cattle. Here we describe the whole-genome resequencing of two Bos taurus bulls from distinct breeds for the purpose of identifying and annotating novel forms of genetic variation in cattle. Results The genomes of a Black Angus bull and a Holstein bull were sequenced to 22-fold and 19-fold coverage, respectively, using the ABI SOLiD system. Comparisons of the sequences with the Btau4.0 reference assembly yielded 7 million single nucleotide polymorphisms (SNPs, 24% of which were identified in both animals. Of the total SNPs found in Holstein, Black Angus, and in both animals, 81%, 81%, and 75% respectively are novel. In-depth annotations of the data identified more than 16 thousand distinct non-synonymous SNPs (85% novel between the two datasets. Alignments between the SNP-altered proteins and orthologues from numerous species indicate that many of the SNPs alter well-conserved amino acids. Several SNPs predicted to create or remove stop codons were also found. A comparison between the sequencing SNPs and genotyping results from the BovineHD high-density genotyping chip indicates a detection rate of 91% for homozygous SNPs and 81% for heterozygous SNPs. The false positive rate is estimated to be about 2% for both the Black Angus and Holstein SNP sets, based on follow-up genotyping of 422 and 427 SNPs, respectively. Comparisons of read depth between the two bulls along the reference assembly identified 790 putative copy-number variations (CNVs. Ten

  14. Recent and historical recombination in the admixed Norwegian Red cattle breed

    Directory of Open Access Journals (Sweden)

    Grove Harald

    2011-01-01

    Full Text Available Abstract Background Comparison of recent patterns of recombination derived from linkage maps to historical patterns of recombination from linkage disequilibrium (LD could help identify genomic regions affected by strong artificial selection, appearing as reduced recent recombination. Norwegian Red cattle (NRF make an interesting case study for investigating these patterns as it is an admixed breed with an extensively recorded pedigree. NRF have been under strong artificial selection for traits such as milk and meat production, fertility and health. While measures of LD is also crucial for determining the number of markers required for association mapping studies, estimates of recombination rate can be used to assess quality of genomic assemblies. Results A dataset containing more than 17,000 genome-wide distributed SNPs and 2600 animals was used to assess recombination rates and LD in NRF. Although low LD measured by r2 was observed in NRF relative to some of the breeds from which this breed originates, reports from breeds other than those assessed in this study have described more rapid decline in r2 at short distances than what was found in NRF. Rate of decline in r2 for NRF suggested that to obtain an expected r2 between markers and a causal polymorphism of at least 0.5 for genome-wide association studies, approximately one SNP every 15 kb or a total of 200,000 SNPs would be required. For well known quantitative trait loci (QTLs for milk production traits on Bos Taurus chromosomes 1, 6 and 20, map length based on historic recombination was greater than map length based on recent recombination in NRF. Further, positions for 130 previously unpositioned contigs from assembly of the bovine genome sequence (Btau_4.0 found using comparative sequence analysis were validated by linkage analysis, and 28% of these positions corresponded to extreme values of population recombination rate. Conclusion While LD is reduced in NRF compared to some of the

  15. Dietary nitrate supplementation reduces methane emission in beef cattle fed sugarcane-based diets

    NARCIS (Netherlands)

    Hulshof, R.B.A.; Berndt, A.; Gerrits, W.J.J.; Dijkstra, J.; Zijderveld, van S.M.; Newbold, J.R.; Perdok, H.B.

    2012-01-01

    The objective of this study was to determine the effect of dietary nitrate on methane emission and rumen fermentation parameters in Nellore × Guzera (Bos indicus) beef cattle fed a sugarcane based diet. The experiment was conducted with 16 steers weighing 283 ± 49 kg (mean ± SD), 6 rumen cannulated

  16. The Olduvai buffalo Pelorovis and the origin of Bos

    Science.gov (United States)

    Martínez-Navarro, Bienvenido; Antonio Pérez-Claros, Juan; Palombo, Maria Rita; Rook, Lorenzo; Palmqvist, Paul

    2007-09-01

    The origin of the genus Bos is a debated issue. From ˜ 0.5 Ma until historic times, the genus is well known in the Eurasian large mammal assemblages, where it is represented by Bos primigenius. This species has a highly derived cranial anatomy that shows important morphological differences from other Plio-Pleistocene Eurasian genera of the tribe Bovini such as Leptobos, Bison, Proamphibos-Hemibos, and Bubalus. The oldest clear evidence of Bos is the skull fragment ASB-198-1 from the middle Pleistocene (˜ 0.6-0.8 Ma) site of Asbole (Lower Awash Valley, Ethiopia). The first appearance of Bos in Europe is at the site of Venosa-Notarchirico, Italy (˜ 0.5-0.6 Ma). Although the origin of Bos has traditionally been connected with Leptobos and Bison, after a detailed anatomical and morphometric study we propose here a different origin, connecting the middle Pleistocene Eurasian forms of B. primigenius with the African Late Pliocene and early Pleistocene large size member of the tribe Bovini Pelorovis sensu stricto. The dispersal of the Bos lineage in Western Europe during middle Pleistocene times seems to coincide with the arrival of the Acheulean tool technology in this continent.

  17. 13CO Cores in Taurus Molecular Cloud

    CERN Document Server

    Qian, Lei; Goldsmith, Paul

    2012-01-01

    Young stars form in molecular cores, which are dense condensations within molecular clouds. We have searched for $^{13}$CO $J=1\\to 0$ cores in the Taurus molecular cloud and studied their properties. Our data set has a spatial dynamic range (the ratio of linear map size to the pixel size) of about 1000 and spectrally resolved velocity information. We use empirical fit to the CO and CO$_2$ ice to correct the depletion. The core mass function (CMF) can be fitted better with a log-normal function than with a power law function. We also extract cores and calculate the CMF based on the integrated intensity of $^{13}$CO and the extinction from 2MASS. We demonstrate that there exists core blending, i.e. combined structures that are incoherent in velocity but continuous in column density. The resulting core samples based on 2D and 3D data thus differ significantly from each other. In particular, the cores derived from 2MASS extinction can be fitted with a power-law function, but not a log-normal function. The core ve...

  18. Complete mitochondrial genome of wild aurochs (Bos primigenius) reconstructed from ancient DNA.

    Science.gov (United States)

    Zeyland, J; Wolko, L; Bocianowski, J; Szalata, M; Słomski, R; Dzieduszycki, A M; Ryba, M; Przystałowska, H; Lipiński, D

    2013-01-01

    Extinct aurochs (Bos primigenius), accepted as the ancestor of domestic cattle, was one of the largest wild animals inhabiting Europe, Asia and North Africa. The gradual process of aurochs extinction finished in Poland in 1627, were the last recorded aurochs, a female, died. Some aspects of cattle domestication history and the distribution of aurochs genetic material among modern cattle breeds still remain unclear. Analyses of ancient DNA (aDNA) from bone sample deliver new genetic information about extinct wild aurochs as well as modern cattle phylogeny. DNA was extracted from a fragment of aurochs fossil bone found in the Pisz Forest, Poland. The sample was radiocarbon-dated to about 1500 yBP. The aDNA was used for Whole Genome Amplification in order to form a DNA bank. Auroch mitochondrial DNA sequences were amplified using sets of 41 primers overlapping the whole mtDNA, cloned and sequenced. The sequence of the whole mitochondrial genome was reconstructed and deposed in GenBank [GenBank:JQ437479]. Based on the phylogenetic analyses of the Bovine mitochondrial genomes, a phylogenetic tree was created. As expected, the tree clearly shows that the mtDNA sequence of the analyzed PWA (Polish Wild Aurochs) individual belongs to haplogroup P. In the course of the comparative mtDNA analysis we identified 30 nucleotide marker positions for haplogroup P and nine unique PWA differences compared to the two remaining haplotype P representatives. Our analysis provides the next step to the reconstruction of the demographic history of this extinct but still exciting species.

  19. Temperature Studies for ATLAS MDT BOS Chambers

    CERN Document Server

    Engl, A; Hertenberger, R; Mameghani, R; Merkl, D; Rauscher, F; Schaile, A D; Ströhmer, R

    2009-01-01

    Data sets with high statistics taken at the cosmic ray facility, equipped with 3 ATLAS BOS MDT chambers, in Garching (Munich) have been used to study temperature and pressure effects on gas gain and drifttime. The deformation of a thermally expanded chamber was reconstructed using the internal RasNik alignment monitoring system and the tracks from cosmic data. For these studies a heating system was designed to increase the temperature of the middle chamber by up to 20 Kelvins over room temperature. For comparison the temperature effects on gas properties have been simulated with Garfield. The maximum drifttime decreased under temperature raise by -2.21 +- 0.08 ns/K, in agreement with the results of pressure variations and the Garfield simulation. The increased temperatures led to a linear increase of the gas gain of about 2.1% 1/K. The chamber deformation has been analyzed with the help of reconstructed tracks. By the comparison of the tracks through the reference chambers with these through the test chamber ...

  20. Population Structure Analysis of Bull Genomes of European and Western Ancestry

    OpenAIRE

    Neo Christopher Chung; Joanna Szyda; Magdalena Frąszczak

    2017-01-01

    Since domestication, population bottlenecks, breed formation, and selective breeding have radically shaped the genealogy and genetics of Bos taurus. In turn, characterization of population structure among diverse bull (males of Bos taurus) genomes enables detailed assessment of genetic resources and origins. By analyzing 432 unrelated bull genomes from 13 breeds and 16 countries, we demonstrate genetic diversity and structural complexity among the European/Western cattle population. Important...

  1. GUADALUPIAN BRACHIOPODS FROM WESTERN TAURUS, TURKEY

    Directory of Open Access Journals (Sweden)

    VINCENZO VERNA

    2011-03-01

    Full Text Available  Here we describe 41 brachiopod species belonging to the orders Productida, Orthotetida, Orthida, Rhynchonellida, Athyridida, Spiriferida, Spiriferinida, and Terebratulida coming from the Guadalupian lower-middle part of the Pamuçak Formation at Çürük Dað, Antalya (Western Taurus, Turkey. Associated conodonts are also reported and illustrated. The brachiopod taxa are either pedicle attached genera, with one genus also stabilized by penetration of its elongate umbo, or free living concavo-convex semi-infaunal genera; this indicates that the energy of the environment was never very high, as in settings just below the fair weather wave-base or in a back-reef, more protected inner platform. The brachiopods from the Pamuçak Formation are very similar to the Wordian fauna of southeastern Oman, and they are similar to the Guadalupian assemblages of Chios, North Iran, South Thailand, and Salt Range. In comparison they share only a few taxa with the Guadalupian faunas of Central Afghanistan and Karakorum. Therefore the biotic affinity of the Guadalupian brachiopods of the Pamuçak Formation is clearly peri-Gondwanan. The brachiopod record at Çürük Dað has implications for understanding the pattern of the end-Guadalupian (pre-Lopingian biotic crisis. The pre-Lopingian crisis assemblages are quite diverse and nearly totally consist of Guadalupian genera and species except for a single Lopingian incomer. Their stratigraphic range terminates rather abruptly and the following 120 metres of shallow water limestones are barren of brachiopods, after which there is the first occurrence of Lopingian brachiopod taxa, which show a much lower biodiversity.  This pattern is different from that observed in South China and it shows that the end-Guadalupian crisis is not only characterized by taxonomic selectivity, but also by a strong local control on the extinction/recovery pattern of some groups. 

  2. A comparative study of the morphometry of sperm head components in cattle, sheep, and pigs with a computer-assisted fluorescence method

    Directory of Open Access Journals (Sweden)

    Jesús L Yániz

    2016-01-01

    Full Text Available The aim of this study was to compare the sperm nuclear and acrosomal morphometry of three species of domestic artiodactyls; cattle (Bos taurus, sheep (Ovis aries, and pigs (Sus scrofa. Semen smears of twenty ejaculates from each species were fixed and labeled with a propidium iodide-Pisum sativum agglutinin (PI/PSA combination. Digital images of the sperm nucleus, acrosome, and whole sperm head were captured and analyzed. The use of the PI/PSA combination and CASA-Morph fluorescence-based method allowed the capture, morphometric analysis, and differentiation of most sperm nuclei, acrosomes and whole heads, and the assessment of acrosomal integrity with a high precision in the three species studied. For the size of the head and nuclear area, the relationship between the three species may be summarized as bull > ram > boar. However, for the other morphometric parameters (length, width, and perimeter, there were differences in the relationships between species for sperm nuclei and whole sperm heads. Bull sperm acrosomes were clearly smaller than those in the other species studied and covered a smaller proportion of the sperm head. The acrosomal morphology, small in the bull, large and broad in the sheep, and large, long, and with a pronounced equatorial segment curve in the boar, was species-characteristic. It was concluded that there are clear variations in the size and shape of the sperm head components between the three species studied, the acrosome being the structure showing the most variability, allowing a clear distinction of the spermatozoa of each species.

  3. A comparative study of the morphometry of sperm head components in cattle, sheep, and pigs with a computer-assisted fluorescence method

    Science.gov (United States)

    Yániz, Jesús L; Capistrós, Sara; Vicente-Fiel, Sandra; Hidalgo, Carlos O; Santolaria, Pilar

    2016-01-01

    The aim of this study was to compare the sperm nuclear and acrosomal morphometry of three species of domestic artiodactyls; cattle (Bos taurus), sheep (Ovis aries), and pigs (Sus scrofa). Semen smears of twenty ejaculates from each species were fixed and labeled with a propidium iodide-Pisum sativum agglutinin (PI/PSA) combination. Digital images of the sperm nucleus, acrosome, and whole sperm head were captured and analyzed. The use of the PI/PSA combination and CASA-Morph fluorescence-based method allowed the capture, morphometric analysis, and differentiation of most sperm nuclei, acrosomes and whole heads, and the assessment of acrosomal integrity with a high precision in the three species studied. For the size of the head and nuclear area, the relationship between the three species may be summarized as bull > ram > boar. However, for the other morphometric parameters (length, width, and perimeter), there were differences in the relationships between species for sperm nuclei and whole sperm heads. Bull sperm acrosomes were clearly smaller than those in the other species studied and covered a smaller proportion of the sperm head. The acrosomal morphology, small in the bull, large and broad in the sheep, and large, long, and with a pronounced equatorial segment curve in the boar, was species-characteristic. It was concluded that there are clear variations in the size and shape of the sperm head components between the three species studied, the acrosome being the structure showing the most variability, allowing a clear distinction of the spermatozoa of each species. PMID:27624987

  4. Effects of breed group by location interaction on crossbred cattle in Nebraska and Florida.

    Science.gov (United States)

    Olson, T A; Euclides Filho, K; Cundiff, L V; Koger, M; Butts, W T; Gregory, K E

    1991-01-01

    Data on 2,744 calves produced in Clay Center, Nebraska and Brooksville, Florida were used to evaluate the importance of genotype x location interactions on the reproductive and maternal performance of eight breed groups of F1 crossbred cows. A total of 648 F1 crossbred cows included Bos taurus x Bos taurus (Bt x Bt) crosses: Hereford x Angus reciprocal crossbreds (HA and AH), Pinzgauer x Angus (PA), Pinzgauer x Hereford (PH); and Bos indicus x Bos taurus (Bi x Bt) crosses: Brahman x Angus (BA), Brahman x Hereford (BH), Sahiwal x Angus (SA) and Sahiwal x Hereford (SH). The first calf crop was sired by Red Poll bulls. All remaining calf crops were sired by Simmental bulls. Although the pregnancy rate was 9% higher in Nebraska, the rate of unassisted calvings and calf survival rate were both 4.6% lower in Nebraska. Calf birth and weaning weights were 8.0 and 15.6 kg heavier in Nebraska than in Florida. Bi x Bt dams exceeded (P less than .001) Bt x Bt crossbred dams for all traits except age of calf at weaning and calf-survival rates (P greater than .10). Birth weights of calves from Bi x Bt crossbred dams were 3.4 kg lighter than those from the Bt x Bt crossbred dams. The interaction of location with the breed group comparison of Bi x Bt vs Bt x Bt crossbred dams was significant for pregnancy rate, calf age at weaning, rate of unassisted calving and all weight traits. Adjusted weaning weights of calves from HA, AH, PA, PH, BA, BH, SA and SH cows were as follows: HA, 194 and 222; AH, 202 and 230; PA, 213 and 242; PH, 217 and 245; BA, 251 and 254; BH, 252 and 254; SA, 236 and 238; and SH, 238 and 243 kg, respectively, in Florida and Nebraska. Bos indicus-sired cows (BA, BH, SA and SH) weaned essentially equal-weight calves at both locations, whereas calves from Bt x Bt crossbred cows (HA, AH, PA, PH) were about 28 kg lighter in Florida.

  5. Niveles de infestación parasitaria y condición corporal en bovinos doble propósito infestados en condiciones naturales (Degree of infestation and body condition in dual purpose naturally infected cattle

    Directory of Open Access Journals (Sweden)

    Gustavo Morales

    2006-04-01

    Full Text Available En una finca semi-intensiva ubicada en el sector San Antonio de la parroquia Ciudad Bolivia, municipio Pedraza, Estado Barinas; se realizó el estudio coproparasitológico de 65 bovinos mestizos (Predominante Bos taurus y acebuados [ ½ Bos taurus x ½ Bos indicus], mediante la técnica coproscópica de McMaster con solución salina sobresaturada como líquido de flotación, se estableció la condición corporal por el método de la escala del 1 al 5 y 2,5 como punto de inflexión. Se determinó el hematocrito mediante el método de microhematocrito por centrifugación. Los resultados obtenidos fueron los siguientes: Los recuentos más elevados de huevos por gramo de heces de estróngilos digestivos (h.p.g. le correspondieron a animales con condición corporal ≤ 2,5. Estos animales pueden ser considerados acumuladores de parásitos. Los animales con altas cargas de parásitos y buena condición corporal pueden ser considerados resilientes. Estos dos grupos de animales son los principales contaminadores del pastizal, se evidenció el efecto negativo de las altas cargas parasitarias sobre los valores de hematocrito. Los animales no acumuladores de parásitos y los resilientes presentaron valores de hematocrito similares. No se evidenció ninguna asociación entre el color de la conjuntiva ocular y el valor del hematocrito. Los animales acebuados presentaron mayores valores de hematocrito. Este valor se vio afectado por las altas cargas parasitarias. Se determinó elevada eficiencia en los antihelmínticos utilizados en la finca (Albendazol, Doramectina e Ivermectina, a pesar de que se vienen usando desde hace cinco años. Esto puede ser debido a la baja frecuencia de dosificación y a la rotación del producto en relación al grupo etario de los animales. La presencia de animales resilientes en la granja limita el uso de la condición corporal como criterio de selección de la fracción de animales a tratar dentro del rebaño. SUMMARY.- This

  6. In Memoriam Dr Lute Bos (1928-2010)

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.

    2010-01-01

    Tuesday July 6, 2010 we were shocked by the news that that day our former colleague Lute Bos had died unexpectedly at the age of 82. Lute was a world-famous plant virologist. From the start of his career in 1957 until his retirement from the Institute for Plant Protection (IPO-DLO) in Wageningen in

  7. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  8. De 10 meest gestelde vragen over koolstofvastlegging in bos

    NARCIS (Netherlands)

    Nabuurs, G.J.; Verkaik, E.

    1999-01-01

    Uitleg en cijfers over de koolstofvoorraden en koolstofvastlegging in het Nederlandse bos, de mogelijkheden om de CO2 uitstoot te compenseren via bosaanplant, de kosteneffectiviteit van dergelijke maatregelen, en het gewenste bostype en bosbeheer om CO2 vast te leggen en de CO2 emissie te reduceren

  9. Selection for breed-specific growth hormone and IGF-I alleles in a synthetic beef cattle cross, Canchim

    Directory of Open Access Journals (Sweden)

    L.C.A. Regitano

    1999-12-01

    ístico de Bos taurus e de um alelo de IGF-I característico de Bos indicus sugere que a seleção fenotípica tenha favorecido regiões diferentes de ambos os genomas que entraram na formação dessa raça.

  10. The effect of type of vaginal insert and dose of pLH on embryo production, following fixed-time AI in a progestin-based superstimulatory protocol in Nelore cattle.

    Science.gov (United States)

    Nogueira, Marcelo F Gouveia; Fragnito, Paulo S; Trinca, Luzia A; Barros, Ciro M

    2007-02-01

    The objective was to analyze and report field data focusing on the effect of type of progesterone-releasing vaginal insert and dose of pLH on embryo production, following a superstimulatory protocol involving fixed-time artificial insemination (FTAI) in Nelore cattle (Bos taurus indicus). Donor heifers and cows (n = 68; 136 superstimulations over 2 years) received an intravaginal, progesterone-releasing insert (CIDR or DIB, with 1.9 or 1.0 g progesterone, respectively) and 3-4 mg of estradiol benzoate (EB) i.m. at random stages of the estrous cycle. Five days later (designated Day 0), cattle were superstimulated with a total of 120-200 mg of pFSH (Folltropin-V), given twice daily in decreasing doses from Days 0 to 3. All cattle received two luteolytic doses of PGF2alpha at 08:00 and 20:00 h on Day 2 and progesterone inserts were removed at 20:00 h on Day 3 (36 h after the first PGF2alpha injection). Ovulation was induced with pLH (Lutropin-V, 12.5 or 25 mg, i.m.) at 08:00 h on Day 4 with FTAI 12, 24 and in several cases, 36 h later. Embryos were recovered on Days 11 or 12, graded and transferred to synchronous recipients. Overall, the mean (+/-S.E.M.) number of total ova/embryos (13.3 +/- 0.8) and viable embryos (9.4 +/- 0.6) and pregnancy rate (43.5%; 528/1213) did not differ among groups, but embryo viability rate (overall, 70.8%) was higher in donors with a DIB (72.3%) than a CIDR (68.3%, P = 0.007). In conclusion, the administration of pLH 12 h after progesterone removal in a progestin-based superstimulatory protocol facilitated fixed-time AI in Nelore donors, with embryo production, embryo viability and pregnancy rates after embryo transfer, comparable to published results where estrus detection and AI was done. Results suggested a possible alternative, which would eliminate the need for estrus detection in donors.

  11. Effects of Anomalous Tensor Couplings in BOs -(B-)Os Mixing

    Institute of Scientific and Technical Information of China (English)

    CHANG Qin; HAN Lin; YANG Ya-Dong

    2012-01-01

    Motivated by the recently observed anomalous large dimuon charge asymmetry in neutral B decays,we study the effects of the anomalous tensor couplings to pursue a possible solution.With the constraints from the observables φJ/(φ)(φ,f0)s,aSsl and ΔMs,the new physics parameter spaces are severely restricted.We find that the contributions induced by the color-singlet or the color-octet tensor operators are helpful to moderate the anomaly in BOs - (B-)Osmixing.Numerically,the observable aSsl could be enhanced by about two orders of magnitude by the contributionsof color-singlet or color-octet tensor operators with their respective nontrivial new weak phase φT1 =41° ± 35° orφs =-47° ± 33° and relevant strength parameters |gT1| =(2.89 ± 1.40) × 10-2 or |gT8| =(0.79 ± 0.34) × 10-2.However,due to the fact that the NP contributions are severely suppressed by the recent LHCb measurement for φJ/φ(φ,f0)s,our theoretical result of aSsl is still much smaller than the central value of the experimental data.

  12. Bayesian fitting of Taurus brown dwarf spectral energy distributions

    CERN Document Server

    Mayne, N J; Rowe, John; Acreman, David M

    2012-01-01

    We present derived stellar and disc parameters for a sample of Taurus brown dwarfs both with and without evidence of an associated disc. These parameters have been derived using an online fitting tool (http://bd-server.astro.ex.ac.uk/), which includes a statistically robust derivation of uncertainties, an indication of pa- rameter degeneracies, and a complete treatment of the input photometric and spectroscopic observations. The observations of the Taurus members with indications of disc presence have been fitted using a grid of theoretical models including detailed treatments of physical processes accepted for higher mass stars, such as dust sublimation, and a simple treatment of the accretion flux. This grid of models has been designed to test the validity of the adopted physical mechanisms, but we have also constructed models using parameterisation, for example semi-empirical dust sublimation radii, for users solely interested in parameter derivation and the quality of the fit. The parameters derived for t...

  13. Gene discovery in the horned beetle Onthophagus taurus

    Directory of Open Access Journals (Sweden)

    Yang Youngik

    2010-12-01

    Full Text Available Abstract Background Horned beetles, in particular in the genus Onthophagus, are important models for studies on sexual selection, biological radiations, the origin of novel traits, developmental plasticity, biocontrol, conservation, and forensic biology. Despite their growing prominence as models for studying both basic and applied questions in biology, little genomic or transcriptomic data are available for this genus. We used massively parallel pyrosequencing (Roche 454-FLX platform to produce a comprehensive EST dataset for the horned beetle Onthophagus taurus. To maximize sequence diversity, we pooled RNA extracted from a normalized library encompassing diverse developmental stages and both sexes. Results We used 454 pyrosequencing to sequence ESTs from all post-embryonic stages of O. taurus. Approximately 1.36 million reads assembled into 50,080 non-redundant sequences encompassing a total of 26.5 Mbp. The non-redundant sequences match over half of the genes in Tribolium castaneum, the most closely related species with a sequenced genome. Analyses of Gene Ontology annotations and biochemical pathways indicate that the O. taurus sequences reflect a wide and representative sampling of biological functions and biochemical processes. An analysis of sequence polymorphisms revealed that SNP frequency was negatively related to overall expression level and the number of tissue types in which a given gene is expressed. The most variable genes were enriched for a limited number of GO annotations whereas the least variable genes were enriched for a wide range of GO terms directly related to fitness. Conclusions This study provides the first large-scale EST database for horned beetles, a much-needed resource for advancing the study of these organisms. Furthermore, we identified instances of gene duplications and alternative splicing, useful for future study of gene regulation, and a large number of SNP markers that could be used in population

  14. First Report of Bovine Leukemia Virus Infection in Yaks (Bos mutus in China

    Directory of Open Access Journals (Sweden)

    Jian-Gang Ma

    2016-01-01

    Full Text Available Enzootic bovine leukosis (EBL is a chronic lymphosarcoma disease of cattle caused by bovine leukemia virus (BLV. No information is available concerning the epidemiology of BLV infection in yaks (Bos mutus. One thousand five hundred and eighty-four serum samples from 610 black yaks and 974 white yaks from Gansu province, northwest China, were collected between April 2013 and March 2014 and tested for BLV antibodies using a commercially available ELISA kit. The overall BLV seroprevalence in yaks was 21.09% (334/1584, with 24.26% (148/610 black yaks and 19.10% (186/974 white yaks yielding positive results. Risk factor analysis indicated that with the exception of breed (OR = 1.36, 95% CI = 1.06–1.73, P<0.05, the age, region, gender, farm, and the numbers of pregnancies were not considered as risk factors for the presence of BLV in yaks included in this study. This is the first report of BLV infection in yaks in China, which provides information for controlling BLV infection in yaks.

  15. A WISE survey of circumstellar disks in Taurus

    Energy Technology Data Exchange (ETDEWEB)

    Esplin, T. L.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E., E-mail: taran.esplin@psu.edu [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States)

    2014-04-01

    We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M {sub ☉}).

  16. Calibration of a Background Oriented Schlieren (BOS) Set-up

    Science.gov (United States)

    Porta, David; Echeverría, Carlos; Cardoso, Hiroki; Aguayo, Alejandro; Stern, Catalina

    2014-11-01

    We use two materials with different known indexes of refraction to calibrate a Background Oriented Schlieren (BOS) experimental set-up, and to validate the Lorenz-Lorentz equation. BOS is used in our experiments to determine local changes of density in the shock pattern of an axisymmetric supersonic air jet. It is important to validate, in particular, the Gladstone Dale approximation (index of refraction close to one) in our experimental conditions and determine the uncertainty of our density measurements. In some cases, the index of refraction of the material is well known, but in others the density is measured and related to the displacement field. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  17. Detection of quantitative trait loci for growth and carcass composition in cattle.

    Science.gov (United States)

    Casas, E; Shackelford, S D; Keele, J W; Koohmaraie, M; Smith, T P L; Stone, R T

    2003-12-01

    The objective of the present study was to detect quantitative trait loci for economically important traits in a family from a Bos indicus x Bos taurus sire. A Brahman x Hereford sire was used to develop a half-sib family (n = 547). The sire was mated to Bos taurus cows. Traits analyzed were birth (kg) and weaning weights (kg); hot carcass weight (kg); marbling score; longissimus area (cm2); USDA yield grade; estimated kidney, pelvic, and heart fat (%); fat thickness (cm); fat yield (%); and retail product yield (%). Meat tenderness was measured as Warner-Bratzler shear force (kg) at 3 and 14 d postmortem. Two hundred and thirty-eight markers were genotyped in 185 offspring. One hundred and thirty markers were used to genotype the remaining 362 offspring. A total of 312 markers were used in the final analysis. Seventy-four markers were common to both groups. Significant QTL (expected number of false-positives carcass weight, QTL were detected on chromosomes 10, 18, and 29. Four QTL for yield grade were identified on chromosomes 2, 11, 14, and 19. Three QTL for fat thickness were detected on chromosomes 2, 3, 7, and 14. For marbling score, QTL were identified on chromosomes 3, 10, 14, and 27. Four QTL were identified for retail product yield on chromosomes 12, 18, 19, and 29. A QTL for estimated kidney, pelvic, and heart fat was detected on chromosome 15, and a QTL for meat tenderness measured as Warner-Bratzler shear force at 3 d postmortem was identified on chromosome 20. Two QTL were detected for meat tenderness measured as Warner-Bratzler shear force at 14 d postmortem on chromosomes 20 and 29. These results present a complete scan in all available progeny in this family. Regions underlying QTL need to be assessed in other populations.

  18. Genetic dissection of milk yield traits and mastitis resistance quantitative trait loci on chromosome 20 in dairy cattle.

    Science.gov (United States)

    Kadri, Naveen K; Guldbrandtsen, Bernt; Lund, Mogens S; Sahana, Goutam

    2015-12-01

    Intense selection to increase milk yield has had negative consequences for mastitis incidence in dairy cattle. Due to low heritability of mastitis resistance and an unfavorable genetic correlation with milk yield, a reduction in mastitis through traditional breeding has been difficult to achieve. Here, we examined quantitative trait loci (QTL) that segregate for clinical mastitis and milk yield on Bos taurus autosome 20 (BTA20) to determine whether both traits are affected by a single polymorphism (pleiotropy) or by multiple closely linked polymorphisms. In the latter but not the former situation, undesirable genetic correlation could potentially be broken by selecting animals that have favorable variants for both traits. First, we performed a within-breed association study using a haplotype-based method in Danish Holstein cattle (HOL). Next, we analyzed Nordic Red dairy cattle (RDC) and Danish Jersey cattle (JER) with the goal of determining whether these QTL identified in Holsteins were segregating across breeds. Genotypes for 12,566 animals (5,966 HOL, 5,458 RDC, and 1,142 JER) were determined by using the Illumina Bovine SNP50 BeadChip (50K; Illumina, San Diego, CA), which identifies 1,568 single nucleotide polymorphisms on BTA20. Data were combined, phased, and clustered into haplotype states, followed by within- and across-breed haplotype-based association analyses using a linear mixed model. Association signals for both clinical mastitis and milk yield peaked in the 26- to 40-Mb region on BTA20 in HOL. Single-variant association analyses were carried out in the QTL region using whole sequence level variants imputed from references of 2,036 HD genotypes (BovineHD BeadChip; Illumina) and 242 whole-genome sequences. The milk QTL were also segregating in RDC and JER on the BTA20-targeted region; however, an indication of differences in the causal factor(s) was observed across breeds. A previously reported F279Y mutation (rs385640152) within the growth hormone

  19. Implementasi Manajemen Bantuan Biaya Operasional Sekolah (BOS) Di SD Negeri 060820 Kecamatan Medan Kota

    OpenAIRE

    Mayasari, Poppy

    2013-01-01

    This study, entitled Implementation Management Assistance Operational costs (BOS) in the Elementary School District 060820 Medan City. The problem in this study is how the implementation of cost management Operational Management Assistance (BOS) in the Elementary School District 060820 Medan City. Achievable goal of this study was to describe the planning, organizing, directing, supervision, accountability of the program in elementary school BOS 060820 District of Medan City. The research ...

  20. Whole-genome scan to detect quantitative trait loci associated with milk protein composition in 3 French dairy cattle breeds.

    Science.gov (United States)

    Sanchez, M P; Govignon-Gion, A; Ferrand, M; Gelé, M; Pourchet, D; Amigues, Y; Fritz, S; Boussaha, M; Capitan, A; Rocha, D; Miranda, G; Martin, P; Brochard, M; Boichard, D

    2016-10-01

    In the context of the PhénoFinLait project, a genome-wide analysis was performed to detect quantitative trait loci (QTL) that affect milk protein composition estimated using mid-infrared spectrometry in the Montbéliarde (MO), Normande (NO), and Holstein (HO) French dairy cattle breeds. The 6 main milk proteins (α-lactalbumin, β-lactoglobulin, and αS1-, αS2-, β-, and κ-caseins) expressed as grams per 100g of milk (% of milk) or as grams per 100g of protein (% of protein) were estimated in 848,068 test-day milk samples from 156,660 cows. Genotyping was performed for 2,773 MO, 2,673 NO, and 2,208 HO cows using the Illumina BovineSNP50 BeadChip (Illumina Inc., San Diego, CA). Individual test-day records were adjusted for environmental effects and then averaged per cow to define the phenotypes analyzed. Quantitative trait loci detection was performed within each breed using a linkage disequilibrium and linkage analysis approach. A total of 39 genomic regions distributed on 20 of the 29 Bos taurus autosomes (BTA) were significantly associated with milk protein composition at a genome-wide level of significance in at least 1 of the 3 breeds. The 9 most significant QTL were located on BTA2 (133 Mbp), BTA6 (38, 47, and 87 Mbp), BTA11 (103 Mbp), BTA14 (1.8 Mbp), BTA20 (32 and 58 Mbp), and BTA29 (8 Mbp). The BTA6 (87 Mbp), BTA11, and BTA20 (58 Mbp) QTL were found in all 3 breeds, and they had highly significant effects on κ-casein, β-lactoglobulin, and α-lactalbumin, expressed as a percentage of protein, respectively. Each of these QTL explained between 13% (BTA14) and 51% (BTA11) of the genetic variance of the trait. Many other QTL regions were also identified in at least one breed. They were located on 14 additional chromosomes (1, 3, 4, 5, 7, 15, 17, 19, 21, 22, 24, 25, 26, and 27), and they explained 2 to 8% of the genetic variance of 1 or more protein composition traits. Concordance analyses, performed between QTL status and sequence-derived polymorphisms from

  1. Birth and weaning traits in crossbred cattle from Hereford, Angus, Norwegian Red, Swedish Red and White, Wagyu, and Friesian sires.

    Science.gov (United States)

    Casas, E; Thallman, R M; Cundiff, L V

    2012-09-01

    The objective of this study was to characterize breeds representing diverse biological types for birth and weaning traits in crossbred cattle (Bos taurus). Gestation length, calving difficulty, percentage of unassisted calving, percentage of perinatal survival, percentage of survival from birth to weaning, birth weight, weaning weight, BW at 205 d, and ADG was measured in 1,370 calves born and 1,285 calves weaned. Calves were obtained by mating Hereford, Angus, and MARC III (1/4 Hereford, 1/4 Angus, 1/4 Pinzgauer, and 1/4 Red Poll) mature cows to Hereford or Angus (British breeds), Norwegian Red, Swedish Red and White, Wagyu, and Friesian sires. Calves were born during the spring of 1997 and 1998. Sire breed was significant for gestation length, birth weight, BW at 205 d, and ADG (P gestation length (282 d), whereas offspring from Wagyu sires had the longest gestation length (286 d). Progeny from British breeds were the heaviest at birth (40.5 kg) and at 205 d (237 kg), and grew faster (0.97 kg/d) than offspring from other breeds. Offspring from Wagyu sires were the lightest at birth (36.3 kg) and at 205 d (214 kg), and had the slowest growth (0.91 kg/d). Dam breed was significant for gestation length (P gestation length (284 d), whereas offspring from Angus cows had the shortest (282 d). Offspring from MARC III cows were the heaviest at birth (39.4 kg) when compared with offspring from Hereford (38.2 kg) and Angus (38.6 kg) cows. Progeny from Angus cows were the heaviest at 205 d (235 kg) and grew faster (0.96 kg/d), whereas offspring from Hereford cows were the lightest at 205 d (219 kg) and were the slowest in growth (0.88 kg/d). Sex was significant for gestation length (P = 0.026), birth weight, BW at 205 d, and ADG (P gestation length (284 d) when compared with female calves (283 d). Males were heavier than females at birth and at 205 d, and grew faster. Sire breed effects can be optimized by selection and use of appropriate crossbreeding systems.

  2. USO DE ANTI-HELMÍNTICOS E BIOESTIMULANTES NO DESEMPENHO DE BOVINOS DE CORTE SUPLEMENTADOS A PASTO NO ESTADO DO PARÁ EFFECTS OF VERMIFUGES AND BIOSTIMULANTS ON BEEF CATTLE PERFORMANCE UNDER PASTURE SUPPLEMENTATION IN PARÁ STATE

    Directory of Open Access Journals (Sweden)

    Sâmia Rubielle Silva de Castro

    2009-07-01

    Full Text Available O experimento avaliou o efeito da vermifugação e da utilização de bioestimulantes no ganho de peso e no escore de condição corporal (ECC de bovinos de corte, criados em sistema de pastejo rotacionado com suplementação a pasto, no Estado do Pará, durante 160 dias. Foram utilizados 132 bovinos machos não castrados, com idade média de 24 meses, da raça Nelore (Bos taurus indicus. Os grupos experimentais compreenderam o grupo G1 (controle; n=33, G2 (moxidectina 1%; n=33, G3 (moxidectina 10%; n=33 e G4 (ivermectina 3,15%; n=33. Em todos os grupos foram estabelecidas três subparcelas, a fim de serem testados dois bioestimulantes de crescimento animal (bioestimulante 1 e bioestimulante 2. Não houve diferença estatística significativa no ganho de peso médio, no ECC e nas contagens de OPG entre animais do G1, G2, G3 e G4, independentemente dos anti-helmínticos e/ou bioestimulantes usados. Contudo, o tratamento baseado na associação de moxidectina 1% e o bioestimulante 2 apresentou maior receita líquida e incrementou a lucratividade da terminação em 1,24%. Os resultados sugerem que não há necessidade de um controle contra nematódeos durante a terminação, desde que os animais apresentem uma baixa carga parasitária, porém o uso de fármacos pode, sob certas condições, apresentar resultado econômico favorável.

    PALAVRAS-CHAVES: Anti-helmíntico, bovinocultura, crescimento, rentabilidade, sistema de produção.
    The experiment evaluated the effect of vermifuges and biostimulants on weight gain and body condition score (BCS of beef cattle, created in pasture supplementation system, in the State of Pará, during 160 days. Experimental animal were 132 Nelore (Bos taurus indicus, non-castrated male, with average age of 24 months. Experimental groups were: G1 group (control; n=33, G2 (1% moxidectin; n=33, G3 (10% moxidectin; n=33 and G4 (3.15% ivermectin; n=33. Each group was divided in three plots, in order to test

  3. Staphylococcus via an interaction with the ELR+ CXC chemokine ENA-78 is associated with BOS.

    Science.gov (United States)

    Gregson, A L; Wang, X; Injean, P; Weigt, S S; Shino, M; Sayah, D; DerHovanessian, A; Lynch, J P; Ross, D J; Saggar, R; Ardehali, A; Li, G; Elashoff, R; Belperio, J A

    2015-03-01

    Staphylococcus aureus is the most commonly isolated gram-positive bacterium after lung transplantation (LT) and has been associated with poor posttransplant outcomes, but its effect on bronchiolitis obliterans syndrome (BOS) and death in the context of the allograft inflammatory environment has not been studied. A three-state Cox semi-Markovian model was used to determine the influence of allograft S. aureus and the ELR+ CXC chemokines on the survival rates and cause-specific hazards for movement from lung transplant (State 1) to BOS (State 2), from transplant (State 1) to death (State 3), and from BOS (State 2) to death (State 3). Acute rejection, pseudomonas pneumonia, bronchoalveolar lavage fluid (BALF) CXCL5 and its interaction with S. aureus all increased the likelihood of transition from transplant to BOS. Transition to death from transplant was facilitated by pseudomonas infection and single lung transplant. Movement from BOS to death was affected by the interaction between aspergillus, pseudomonas and CXCL5, but not S. aureus. S. aureus isolation had state specific effects after LT and only in concert with elevated BALF CXCL5 concentrations did it augment the risk of BOS. Pseudomonas and elevated BALF concentrations of CXCL5 continued as significant risk factors for BOS and death after BOS in lung transplantation.

  4. NCBI nr-aa BLAST: CBRC-TNIG-22-0261 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0261 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 9e-85 39% ...

  5. First results from the Herschel Gould Belt Survey in Taurus

    CERN Document Server

    Kirk, J M; Palmeirim, P; Andre, Ph; Griffin, M J; Hargrave, P J; Konyves, V; Bernard, J P; Nutter, D J; Sibthorpe, B; Di Francesco, J; Abergel, A; Arzoumanian, D; Benedettini, M; Bontemps, S; Elia, D; Hennemann, M; Hill, T; Men'shchikov, A; Motte, F; Nguyen-Luong, Q; Peretto, N; Pezzuto, S; Rygl, K L J; Sadavoy, S I; Schisano, E; Schneider, N; Testi, L; White, G

    2013-01-01

    The whole of the Taurus region (a total area of 52 sq. deg.) has been observed by the Herschel SPIRE and PACS instruments at wavelengths of 70, 160, 250, 350 and 500 {\\mu}m as part of the Herschel Gould Belt Survey. In this paper we present the first results from the part of the Taurus region that includes the Barnard 18 and L1536 clouds. A new source-finding routine, the Cardiff Source-finding AlgoRithm (CSAR), is introduced, which is loosely based on CLUMPFIND, but that also generates a structure tree, or dendrogram, which can be used to interpret hierarchical clump structure in a complex region. Sources were extracted from the data using the hierarchical version of CSAR and plotted on a mass-size diagram. We found a hierarchy of objects with sizes in the range 0.024-2.7 pc. Previous studies showed that gravitationally bound prestellar cores and unbound starless clumps appeared in different places on the mass-size diagram. However, it was unclear whether this was due to a lack of instrumental dynamic range ...

  6. Change of land use in the Turkish Taurus Mountains

    Directory of Open Access Journals (Sweden)

    Yıldız Güneş

    2016-01-01

    Full Text Available The effects of land use changes on forests and agricultural areas in the central Taurus Mountains of Turkey have been studied. In this region a progressive conversion of extensive grazing was observed towards more intensively farmed arable land in recent decades. The loss of forest land is obvious, and the remaining forests are currently severely degraded and fragmented. Based on a model area it was shown that forests accounted for more than 80% of the land cover in the 1960s. In the following decades the forest area decreased by more than 20%. To the same extent, the share of agricultural land increased, predominantly of the pastures, too. The use of pastures in turn was replaced in the 1990s by arable use, so that now for almost 30% of land use accont for production crop. Accordingly, the way of life of the rural population changed in the last 50 years. By the middle of the 20th century, people had mostly been living as nomads. Thereafter, they become increasingly stationary. While the population density decreased at the some time agriculture was intensified and livestock reduced. This change led to today to profound changes in the landscape of the Taurus Mountains and its unique habitats. Restrictive measures as a way to curb forest degradation and to intensify the use of arable land are discussed.

  7. Gene : CBRC-ACAR-01-0189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CTED: hypothetical protein [Bos taurus] 1e-06 28% MQIDLMTMSFVAKFGVIWFSGFVVYSIGIILSTNKTQSGYVSIISIIISMIYTPLILSTNKTQSGYVSIISII...ISMIYTPLILSTNKTQSVYVSIISIIISIIYTPLILSTNKTQSVYVSIISIIISMIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSGYVSIISIIYTPLILSTNKTQRSYVSINSISMYYYIAA ...

  8. Investigation of haemoglobin polymorphism in Ogaden cattle

    Directory of Open Access Journals (Sweden)

    Sanjoy Kumar Pal

    2014-04-01

    Full Text Available Background and Aim: The Ogaden cattle is one among the tropical cattle breeds (Bos indicus widely distributed in eastern and south eastern part of Ethiopia. The breed has been evolved in arid and semi arid agro-ecological setup, but later on distributed and adapted to the wide agro-ecological zones. Because of its multi-purpose role, the Ogaden cattle have been used for milk, beef, and income generation. Information on the inherent genetic diversity is important in the design of breeding improvement programmes, making rational decisions on sustainable utilization and conservation of Animal Genetic Resources. Limited information is available about genetic variation of Ogaden breed at molecular level. The present investigation was aimed to study the biochemical polymorphism at the Hemoglobin (Hb locus. Materials and Methods: Blood samples collected from 105 Ogaden cattle maintained at Haramaya beef farm by jugular vein puncture were subjected to agarose gel electrophoresis [pH range 8.4-8.5] to study the polymorphic activities of haemoglobin. Results: Three types of phenotypes were detected i.e. a slow moving (AA band, fast moving (BB band and a combination of slow + fast moving bands (AB. The frequency of the fast moving band was less [13 (12.3%] than the slow moving band [57 (54.2%]. Both slow & fast moving phenotype was observed in 35 (33.3% animals. The gene frequency of HBA allele was 0.709 and that of HBB allele 0.291. Conclusion: The distribution of phenotypes was in agreement with codominant single gene inheritance. The Chi-square (χ2 test revealed that the population is under Hardy-Weinberg equilibrium.

  9. Estudo histopatológico comparativo em fígados de bovinos (Bos taurus L. e Bos indicus L.), bubalinos (Bubalus bubalis L.) e ovinos (Ovis aries L.) infectados por Fasciola hepatica (Linnaeus, 1758)

    OpenAIRE

    Bostelmann, Silvia Cristina Werle

    2013-01-01

    Este trabalho foi realizado com o objetivo de melhor identificar e estudar comparativamente as lesões histológicas do fígado decorrente da fasciolose hepática em três espécies de animais domésticos. Foram examinados fígados infectados por Fasciola hepatica de bovinos e bubalinos provenientes de matadouros e frigoríficos oficialmente inspecionados no Estado do Paraná e fígados de ovinos de propriedades particulares, onde o abate era realizado no local. O material foi processado pela técnica de...

  10. Producción in vivo de embriones bovinos F1 (Bos taurus x Bos indicus) durante la época de lluvias y nortes en un agroecosistema tropical.

    OpenAIRE

    Gordillo Paez, Leonardo

    2012-01-01

    El objetivo fue determinar el efecto de la temperatura ambiental y la humedad relativa sobre la producción in vivo de embriones bovinos F1, durante la época de lluvias y nortes, en un agroecosistema tropical cálido subhúmedo en Veracruz, México. A 22 vacas Cebú se les indujo ovulación múltiple, y siete días después de la inseminación artificial se recolectaron los embriones. Durante el estudio se monitoreó la humedad relativa y temperatura ambiental, y se asociaron con la producción de embrio...

  11. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  12. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus gestantes e não gestantes

    Directory of Open Access Journals (Sweden)

    L.R. Vargas

    2015-04-01

    Full Text Available Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o trimestre gestacional: primeiro - gestação de até 90 dias; segundo - de 91 a 180 dias; e terceiro - de 181 a 270 dias. Os corpos lúteos, processados para inclusão em paraplast, foram avaliados em microscópio de luz. Na proporção volumétrica do corpo lúteo, os constituintes avaliados foram citoplasma e núcleo de células lúteas, tecido conjuntivo e fibroblastos, células endoteliais e pericitos e vasos sanguíneos. A proporção volumétrica de citoplasma de células lúteas reduziu de 46,1±2,8% para 37,9±3,5% e a de núcleo de células lúteas reduziu de 9,2±1,0% para 6,2±1,0%, do primeiro para o segundo trimestre. A proporção de tecido conjuntivo e fibroblastos aumentou de 20,9±5,4%, no primeiro trimestre, para 34,0±4,2%, no segundo trimestre. Grânulos citoplasmáticos foram evidenciados pelas técnicas histoquímicas xylidine ponceau e azul de bromofenol, que indicam sua provável composição proteica. A quantidade de células maiores com grânulos aumentou significativamente de 2,3±1,9%, no primeiro trimestre, para 25,5±20,3%, no segundo. A proporção volumétrica de citoplasma e núcleo de células lúteas diminuiu ao longo da gestação, e a de tecido conjuntivo aumentou. A quantidade de células lúteas maiores contendo grânulos também aumentou ao longo da gestação.

  13. An original SERPINA3 gene cluster: Elucidation of genomic organization and gene expression in the Bos taurus 21q24 region

    Directory of Open Access Journals (Sweden)

    Ouali Ahmed

    2008-04-01

    Full Text Available Abstract Background The superfamily of serine proteinase inhibitors (serpins is involved in numerous fundamental biological processes as inflammation, blood coagulation and apoptosis. Our interest is focused on the SERPINA3 sub-family. The major human plasma protease inhibitor, α1-antichymotrypsin, encoded by the SERPINA3 gene, is homologous to genes organized in clusters in several mammalian species. However, although there is a similar genic organization with a high degree of sequence conservation, the reactive-centre-loop domains, which are responsible for the protease specificity, show significant divergences. Results We provide additional information by analyzing the situation of SERPINA3 in the bovine genome. A cluster of eight genes and one pseudogene sharing a high degree of identity and the same structural organization was characterized. Bovine SERPINA3 genes were localized by radiation hybrid mapping on 21q24 and only spanned over 235 Kilobases. For all these genes, we propose a new nomenclature from SERPINA3-1 to SERPINA3-8. They share approximately 70% of identity with the human SERPINA3 homologue. In the cluster, we described an original sub-group of six members with an unexpected high degree of conservation for the reactive-centre-loop domain, suggesting a similar peptidase inhibitory pattern. Preliminary expression analyses of these bovSERPINA3s showed different tissue-specific patterns and diverse states of glycosylation and phosphorylation. Finally, in the context of phylogenetic analyses, we improved our knowledge on mammalian SERPINAs evolution. Conclusion Our experimental results update data of the bovine genome sequencing, substantially increase the bovSERPINA3 sub-family and enrich the phylogenetic tree of serpins. We provide new opportunities for future investigations to approach the biological functions of this unusual subset of serine proteinase inhibitors.

  14. Metal exposure and accumulation patterns in free-range cows (Bos taurus) in a contaminated natural area: Influence of spatial and social behavior

    NARCIS (Netherlands)

    Roggeman, S.; Brink, van den N.W.; Praet, van N.; Blust, R.; Bervoets, L.

    2013-01-01

    Possible effects of spatial metal distribution, seasonal-, ecological- and ethological parameters, on the metal exposure of cows were investigated. Therefore the habitat use, vegetation selection and foraging behavior of two free ranging Galloway herds in a metal polluted nature reserve were observe

  15. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter;

    2015-01-01

    . In particular, we investigated the suitability of β-glucuronidase (GLU) as an early indicator of E. coli mastitis. Besides GLU, the enzymes l-lactate dehydrogenase (LDH), N-acetyl-β-d-glucosaminidase (NAGase), and alkaline phosphatase were included. The study was conducted in an experimental setup with 31....... The enzymes LDH, NAGase, and alkaline phosphatase showed similar responses, with a significantly increased activity and higher peak values for the HH than the HL cows. Significant differences between HH and HL cows were detected at different time points for these 3 enzymes, but not after adjusting P...... infection but with differences in the size and profile of the activity of the 4 enzymes. The enzyme GLU was an equally good indicator of E. coli mastitis compared with the other studied enzymes, although it showed a slower response compared with LDH and NAGase....

  16. Bayesian fitting of Taurus brown dwarf spectral energy distributions

    Science.gov (United States)

    Mayne, N. J.; Harries, Tim J.; Rowe, John; Acreman, David M.

    2012-06-01

    We present derived stellar and disc parameters for a sample of Taurus brown dwarfs both with and without evidence of an associated disc. These parameters have been derived using an online fitting tool (), which includes a statistically robust derivation of uncertainties, an indication of parameter degeneracies and a complete treatment of the input photometric and spectroscopic observations. The observations of the Taurus members with indications of disc presence have been fitted using a grid of theoretical models including detailed treatments of physical processes accepted for higher mass stars, such as dust sublimation, and a simple treatment of the accretion flux. This grid of models has been designed to test the validity of the adopted physical mechanisms, but we have also constructed models using parametrization, for example semi-empirical dust sublimation radii, for users solely interested in parameter derivation and the quality of the fit. The parameters derived for the naked and disc brown dwarf systems are largely consistent with literature observations. However, our inner disc edge locations are consistently closer to the star than previous results and we also derive elevated accretion rates over non-spectral energy distribution based accretion rate derivations. For inner edge locations, we attribute these differences to the detailed modelling we have performed of the disc structure, particularly at the crucial inner edge where departures in geometry from the often adopted vertical wall due to dust sublimation (and therefore accretion flux) can compensate for temperature (and therefore distance) changes to the inner edge of the dust disc. In the case of the elevated derived accretion rates, in some cases, this may be caused by the intrinsic stellar luminosities of the targets exceeding that predicted by the isochrones we have adopted.

  17. Sequencing and phylogenetic analysis of partial CXCR2 gene of Murrah buffalo

    Directory of Open Access Journals (Sweden)

    S. A. Wani

    2014-05-01

    Full Text Available Aim: Present study was carried out to sequence and phylogenetic analysis of CXCR2 gene of Murrah buffalo. Materials and Methods: For the present investigation, from a group of forty eight Murrah buffaloes (Bubalus bubalis, blood samples were collected randomly from eight animals, out of which four were healthy and four were mastitic. Results: The amplification of Interleukin-8B (IL-8B receptor gene target sequence was carried out using the primer pair in an optimized polymerase chain reaction. Partial sequencing of IL-8B receptor gene of Bubalus bubalis (Murrah has been done successfully. The sequences of IL-8B receptor gene showed 99% homology to that of Bos indicus × Bos taurus, 98% to that of Bos taurus, 97% to that of Ovis aries, 93% to that of Sus scrofa, 92% to that of Equus caballus and 90% to that of Felis catus. Conclusion: From the present study it can be concluded that the PCR amplification procedure for target region of IL-8B receptor gene yielding 459 bp products has been standardized, which yielded consistent and specific amplification. Amplification of partial IL-8B receptor gene (exon 2- 459 bp using self designed primers specific for cattle ortholog sequence signifies that the locus is conserved in cattle and buffaloes. In phylogenetic tree, the target sequence of IL-8B receptor gene of Bubalus bubalis were found to be more closely related to Bos indicus × Bos Taurus and Bos taurus than to Ovis aries and Sus scrofa.

  18. New Young Star Candidates in the Taurus-Auriga Region as Selected From WISE

    CERN Document Server

    Rebull, L M; Padgett, D L; Terebey, S; McGehee, P M; Hillenbrand, L A; Knapp, G; Leizawitz, D; Liu, W; Noriega-Crespo, A; Ressler, M; Stapelfeldt, K R; Fajardo-Acosta, S; Mainzer, A

    2011-01-01

    The Taurus Molecular Cloud subtends a large solid angle on the sky, in excess of 250 square degrees. The search for legitimate Taurus members to date has been limited by sky coverage as well as the challenge of distinguishing members from field interlopers. The Wide-field Infrared Survey Explorer (WISE) has recently observed the entire sky, and we take advantage of the opportunity to search for young stellar object (YSO) candidate Taurus members from a ~260 square degree region designed to encompass previously-identified Taurus members. We use near- and mid-infrared colors to select objects with apparent infrared excesses and incorporate other catalogs of ancillary data to present: a list of rediscovered Taurus YSOs with infrared excesses (taken to be due to circumstellar disks), a list of rejected YSO candidates (largely galaxies), and a list of 94 surviving candidate new YSO-like Taurus members. There is likely to be contamination lingering in this candidate list, and follow-up spectra are warranted.

  19. Studies on the transmission of malignant catarrhal fever in experimental animals: A serial infection of cattle and buffalo by means of whole blood inoculation

    Directory of Open Access Journals (Sweden)

    Agus Wiyono

    1999-12-01

    Full Text Available Malignant catarrhal fever (MCF is a fatal disease especially affecting cattle and buffaloes. A study on the serial blood transmission of MCF was conducted by injecting whole blood of MCF animals into 9 experimental animals. Diagnosis of MCF was based on the clinico-pathological fmdings and polymerase chain reaction (PCR test. The disease has successfully, been achieved in six animals of three Bali cattle and three buffaloes but not in a Bali-cross breed and two Bos indicus (Ongole cattle. Wide range of clinical signs and gross-pathological features were observed. The study showed the degree of susceptibility of experimental animals: Bali cattle and buffalo were highly susceptible (3 out of 3 affected with MCF, Bali-cross breed and Bos indicus (Ongole cattle seemed not susceptible to whole blood experimental transmission. It shows that when Bali cattle acted as inoculum donor, buffalo tended to be clinically more severe than Bali cattle. On the other hand, when buffalo acted as inoculum donor, Bali cattle suffered from MCF more severe than buffalo. The diagnosis of MCF by histopathological examination and the PCR test bad positive correlation (100% in the first experiment, while in the second experiment the PCR test tends to be more sensitive. Based on the restriction endonuclease (RE test, the MCF causal agent in this study appeared to be genetically similar in each case. It is concluded that the serial experimental transmission of MCF by means of whole blood inoculation has been successfully achieved in Bali cattle and buffalo but not in Bali-cross breed and Ongole cattle, and there is a positive correlation between the PCR test and histopathological examination with the PCR test tends to be more sensitive.

  20. Fibroblasts express OvHV-2 capsid protein in vasculitis lesions of American bison (Bison bison) with experimental sheep-associated malignant catarrhal fever

    Science.gov (United States)

    Sheep-associated malignant catarrhal fever (SA-MCF) caused by ovine herpesvirus-2 (OvHV-2), a '-herpesvirus, is an often fatal disease characterized by lymphoproliferation, vasculitis, and mucosal ulceration in American bison (Bison bison), cattle (Bos taurus), and other clinically susceptible speci...

  1. Unlocking the bovine genome

    Directory of Open Access Journals (Sweden)

    Worley Kim C

    2009-04-01

    Full Text Available Abstract The draft genome sequence of cattle (Bos taurus has now been analyzed by the Bovine Genome Sequencing and Analysis Consortium and the Bovine HapMap Consortium, which together represent an extensive collaboration involving more than 300 scientists from 25 different countries.

  2. NUTGRANJA 2.0

    NARCIS (Netherlands)

    Prado, del A.; Corré, W.J.; Gallejones, P.; Pardo, G.; Pinto, M.; Hierro, del O.; Oenema, O.

    2016-01-01

    Farm nutrient management has been identified as one of the most important factors determining the economic and environmental performance of dairy cattle (Bos taurus) farming systems. Given the environmental problems associated with dairy farms, such as emissions of greenhouse gases (GHG), and the co

  3. $\\rm^{13}CO$ Filaments in the Taurus Molecular Cloud

    CERN Document Server

    Panopoulou, G V; Goldsmith, P F; Heyer, M H

    2014-01-01

    We have carried out a search for filamentary structures in the Taurus molecular cloud using $\\rm^{13}CO$ line emission data from the FCRAO survey of $\\rm \\sim100 \\, deg^2$. We have used the topological analysis tool, DisPerSe, and post-processed its results to include a more strict definition of filaments that requires an aspect ratio of at least 3:1 and cross section intensity profiles peaked on the spine of the filament. In the velocity-integrated intensity map only 10 of the hundreds of filamentary structures identified by DisPerSe comply with our criteria. Unlike Herschel analyses, which find a characteristic width for filaments of $\\rm \\sim0.1 \\, pc$, we find a much broader distribution of profile widths in our structures, with a peak at 0.4 pc. Furthermore, even if the identified filaments are cylindrical objects, their complicated velocity structure and velocity dispersions imply that they are probably gravitationally unbound. Analysis of velocity channel maps reveals the existence of hundreds of `velo...

  4. The Circumstellar Disk of the Butterfly Star in Taurus

    CERN Document Server

    Wolf, S; Stapelfeldt, K R; Wolf, Sebastian; Padgett, Deborah L.; Stapelfeldt, Karl R.

    2003-01-01

    We present a model of the circumstellar environment of the so-called ``Butterfly Star'' in Taurus (IRAS 04302+2247). The appearance of this young stellar object is dominated by a large circumstellar disk seen edge-on and the light scattering lobes above the disk. The model is based on multi-wavelength continuum observations: Millimeter maps and high-resolution near-infrared images obtained with HST/NICMOS. It was found that the disk and envelope parameters are comparable with those of the circumstellar environment of other young stellar objects. A main result is that the dust properties must be different in the circumstellar disk and in the envelope: While a grain size distribution with grain radii up to 100 micron is required to reproduce the millimeter observations of the disk, the envelope is dominated by smaller grains similar to those of the interstellar medium. Preprint with high figure quality available at: http://spider.ipac.caltech.edu/staff/swolf/homepage/public/preprints/i04302.ps

  5. Demographics of Transition Discs in Ophiuchus and Taurus

    CERN Document Server

    Najita, Joan R; Muzerolle, James

    2015-01-01

    Transition disc systems are young stars that appear to be on the verge of dispersing their protoplanetary discs. We explore the nature of these systems by comparing the stellar accretion rates and disc masses of transition discs and normal T Tauri stars in Taurus and Ophiuchus. After controlling for the known dependencies of stellar accretion rate and disc mass and on age, stellar accretion rate on stellar mass, and disc mass on the presence of stellar or sub-stellar companions, we find that the normal T Tauri stars show a trend of stellar accretion rate increasing with disc mass. The transition discs tend to have higher average disc masses than normal T Tauri stars as well as lower accretion rates than normal T Tauri stars of the same disc mass. These results are most consistent with the interpretation that the transition discs have formed objects massive enough to alter the accretion flow, i.e., single or multiple giant planets. Several Ophiuchus T Tauri stars that are not known transition disc systems also...

  6. [OI] disk emission in the Taurus star forming region

    CERN Document Server

    Aresu, G; Meijerink, R; Spaans, M; Vicente, S; Podio, L; Woitke, P; Menard, F; Thi, W -F; Gudel, M; Liebhart, A

    2014-01-01

    The structure of protoplanetary disks is thought to be linked to the temperature and chemistry of their dust and gas. Whether the disk is flat or flaring depends on the amount of radiation that it absorbs at a given radius, and on the efficiency with which this is converted into thermal energy. The understanding of these heating and cooling processes is crucial to provide a reliable disk structure for the interpretation of dust continuum emission and gas line fluxes. Especially in the upper layers of the disk, where gas and dust are thermally decoupled, the infrared line emission is strictly related to the gas heating/cooling processes. We aim to study the thermal properties of the disk in the oxygen line emission region, and to investigate the relative importance of X-ray (1-120 Angstrom) and far-UV radiation (FUV, 912-2070 Angstrom) for the heating balance there. We use [OI] 63 micron line fluxes observed in a sample of protoplanetary disks of the Taurus/Auriga star forming region and compare it to the mode...

  7. Star Formation in Space and Time Taurus-Auriga

    CERN Document Server

    Palla, Fabrizio; Palla, Francesco; Stahler, Steven W.

    2002-01-01

    To understand the formation of stellar groups, one must first document carefully the birth pattern within real clusters and associations. In this study of Taurus-Auriga, we combine pre-main-sequence ages from our own evolutionary tracks with stellar positions from observational surveys. Aided by the extensive, millimeter data on the molecular clouds, we develop a picture of the region's history. Star formation began, at a relatively low level and in a spatially diffuse manner, at least 10 Myr in the past. Within the last few million years, new stars have been produced at an accelerating rate, almost exclusively within a confined group of striated cloud filaments. The gas both inside and around the filaments appears to be in force balance. Thus, the appearance of the filaments is due to global, quasi-static contraction of the parent cloud material. Gravity drives this contraction and shock dissipation mediates it, but the internal motion of the gas does not appear to be turbulent. The accelerating nature of re...

  8. An Extinction Study of the Taurus Dark Cloud Complex

    CERN Document Server

    Arce, H G; Arce, Hector G.; Goodman, Alyssa A.

    1999-01-01

    We present a study of the detailed distribution of extinction in a region of the Taurus dark cloud complex. Our study uses new BVR images of the region, spectral classification data for 95 stars, and IRAS Sky Survey Atlas (ISSA) 60 and 100 micron images. We study the extinction of the region in four different ways, and we present the first inter-comparison of all these methods, which are: 1) using the color excess of background stars for which spectral types are known; 2) using the ISSA 60 and 100 micron images; 3) using star counts; and 4) using an optical (V and R) version of the average color excess method used by Lada et al. (1994). We find that all four methods give generally similar results, with important exceptions. To study the structure in the dust distribution, we compare the ISSA extinction and the extinction measured for individual stars. From the comparison, we conclude that in the relatively low extinction regions studied, with 0.9 < A_V < 3.0 mag (away from filamentary dark clouds and IR...

  9. PENGELOLAAN DANA BOS PADA SD NEGERI DI UPT PELAYANAN PENDIDIKAN KECAMATAN MOYUDAN KABUPATEN SLEMAN

    Directory of Open Access Journals (Sweden)

    Irene Muryati

    2016-09-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui: (1 perencanaan, (2 pelaksanaan, (3 pengawasan dan evaluasi pengelolaan, serta (4 pelaporan dana Bantuan Operasional Sekolah (BOS pada Sekolah Dasar Negeri dengan jumlah siswa sedikit dan jumlah siswa banyak di wilayah UPT Pelayanan Pendidikan Kecamatan Moyudan. Jenis penelitian ini adalah studi kasus. Responden penelitian ini yaitu kepala sekolah, bendahara, guru, komite sekolah, dan orang tua siswa. Data dikumpulkan melalui wawancara, observasi dan studi dokumen. Hasil penelitian ini menunjukkan bahwa: (1 perencanaan pengelolaan dana BOS diprioritaskan untuk peningkatan mutu, namun partisipasi warga sekolah kurang optimal. (2 Pada pelaksanaan: (a penyaluran dana dilaksanakan di awal triwulan, (b proses pembukuan dilaksanakan secara rutin, dan (c prinsip akuntabilitas dan keterbukaan telah dilaksanakan dengan baik. (3 pengawasan dilakukankan oleh kepala sekolah dan pengawas sekolah dengan memeriksa SPJ BOS; evaluasi dilakukan dengan mengisi angket pelaksanaan sekali dalam setahun oleh TIM Manajemen BOS Kabupaten. (4 Pelaporan penggunaan dana BOS dalam bentuk SPJ dilaksanakan setiap triwulan kepada Tim Manajemen BOS Kabupaten melalui UPT Pelayanan Pendidikan. Kata kunci: Pengelolaan, Dana Bantuan Operasional Sekolah. BOS FUNDS MANAGEMENT ON STATE ELEMENTARY SCHOOLS IN THE DISTRICT MOYUDAN EDUCATION SERVICES UNIT SLEMAN REGENCY Abstract This study aims to reveal: (1 the planning, (2 implementation, (3 monitoring and evaluation, and (4 reporting of the management of School Operational Fund (BOS on public elementary schools whcihhas small and a big number of students in the District Moyudan Education. Respondents were the principals, treasurers, teachers, school committees, and parents of students. Data collection techniques were interviews, observation and document study The results of this study indicate that: (1 the fund was prioritized for student activities to improve the quality of education but

  10. B- and A-Type Stars in the Taurus-Auriga Star-Forming Region

    Science.gov (United States)

    Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

    2013-01-01

    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), t Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

  11. Preservation of mithun (Bos frontalis) semen at refrigeration temperature.

    Science.gov (United States)

    Karunakaran, M; Dhali, A; Mech, A; Khate, K; Rajkhowa, C; Mishra, D P

    2007-10-01

    The objective of the present study was to investigate the possibility of preserving mithun (Bos frontalis) spermatozoa at refrigeration temperature using tris-egg yolk diluent. Semen samples were collected from four adult mithun bulls through rectal massage method. Good quality semen samples (n=30) were preserved at 4 degrees C using tris-egg yolk diluent for 72 h. Progressive motility, live spermatozoa count and morphological abnormalities were evaluated every 12 h until 72 h of preservation. The colour, consistency and mass activity of fresh semen samples were found to be creamy white, medium and 3+ to 4+ (5+ scale), respectively. The average (mean+/-S.E.) volume (ml), pH and spermatozoa concentration (10(6) ml(-1)) of fresh semen samples were found to be 0.6+/-0.01, 6.8+/-0.03 and 425+/-48, respectively. Progressive motility and live spermatozoa count were found to be less than 30% (Prefrigeration temperature in tris-egg yolk diluent, which can be further used for artificial insemination within 36 h of storage.

  12. New Brown Dwarfs and an Updated Initial Mass Function in Taurus

    CERN Document Server

    Luhman, K L

    2004-01-01

    I have performed a search for young low-mass stars and brown dwarfs (BDs) in 2 regions encompassing a total area of 4 deg^2 in the Taurus star-forming region, discovering 15 new members of Taurus. In addition, I present 7 new members outside of these areas from the initial stage of a survey of all of Taurus. These 22 objects exhibit spectral types of M4.5-M9.25 and masses of 0.3-0.015 M_sun according to the theoretical evolutionary models of Baraffe and Chabrier, 7 of which are likely to be BDs. Emission in H(alpha), He I, Ca II, [O I], and [S II] and excess emission in optical and near-IR bands among some of these objects suggest the presence of accretion, outflows, and circumstellar disks. The results from the 4 deg^2 survey have been combined with previous studies of Taurus to arrive at an IMF for a total area of 12.4 deg^2. As in the previous IMFs for Taurus, the updated IMF peaks at a higher mass (0.8 M_sun) than the mass functions in IC 348 and Orion (0.1-0.2 M_sun). Meanwhile, the deficit of BDs in Tau...

  13. Molecular outflows identified in the FCRAO CO survey of the Taurus Molecular Cloud

    Science.gov (United States)

    Narayanan, Gopal; Snell, Ronald; Bemis, Ashley

    2012-10-01

    Jets and outflows are an integral part of the star formation process. While there are many detailed studies of molecular outflows towards individual star-forming sites, few studies have surveyed an entire star-forming molecular cloud for this phenomenon. The 100-deg2 Five College Radio Astronomy Observatory CO survey of the Taurus Molecular Cloud provides an excellent opportunity to undertake an unbiased survey of a large, nearby, molecular cloud complex for molecular outflow activity. Our study provides information on the extent, energetics and frequency of outflows in this region, which are then used to assess the impact of outflows on the parent molecular cloud. The search identified 20 outflows in the Taurus region, eight of which were previously unknown. Both 12CO and 13CO data cubes from the Taurus molecular map were used, and dynamical properties of the outflows are derived. Even for previously known outflows, our large-scale maps indicate that many of the outflows are much larger than previously suspected, with eight of the outflows (40 per cent) being more than a parsec long. The mass, momentum and kinetic energy from the 20 outflows are compared to the repository of turbulent energy in Taurus. Comparing the energy deposition rate from outflows to the dissipation rate of turbulence, we conclude that outflows by themselves cannot sustain the observed turbulence seen in the entire cloud. However, when the impact of outflows is studied in selected regions of Taurus, it is seen that locally outflows can provide a significant source of turbulence and feedback. The L1551 dark cloud which is just south of the main Taurus complex was not covered by this survey, but the outflows in L1551 have much higher energies compared to the outflows in the main Taurus cloud. In the L1551 cloud, outflows can not only account for the turbulent energy present, but are probably also disrupting their parent cloud. We conclude that for a molecular cloud like Taurus, an L1551-like

  14. WOOD-WATER RELATIONSHIPS AND BIOLOGICAL DURABILITY OF HEAT-TREATED TAURUS FIR WOOD

    Directory of Open Access Journals (Sweden)

    Bekir Cihad BAL

    2015-09-01

    Full Text Available In this study, Taurus Fir (Abies cilicica wood was treated with hot air at temperatures of 160, 190 and 220°C for 2h durations. After heat treatment, some physical properties and wood-water relationships were evaluated, such as mass loss, density, tangential swelling, radial swelling, volumetric swelling, swelling anisotropy, and fiber saturation point. In addition, the biological durability of Taurus Fir wood was tested in the laboratory with the soil contact test, and determined weight loss. The relationships between mass loss and some of the tested properties were determined using regression analysis. The results showed that heat treatment at 220°C had significant effects on the physical properties and the biological durability of Taurus Fir wood. Further, it was determined that there was a linear-negative correlation between weight loss and mass loss.

  15. A global survey of banteng (Bos javanicus) housing and husbandry.

    Science.gov (United States)

    Rowden, Lewis J; Rose, Paul E

    2016-11-01

    Banteng (Bos javanicus) are an example of a species of conservation concern without current "best practice" guidance, as they have been the focus of little applied husbandry research. Despite their elevated conservation status, and established, increasing global captive population, zoos do not yet have information on optimal husbandry. To help address this problem, a husbandry survey was distributed to all global holders of banteng. Questions focused on herd demographic structure, exhibit features (including mixed-species exhibition), dietary provision, and behavioral management. Completed surveys from 16 zoos enabled analysis of contemporary practice between institutions. Results indicate differences in enclosure size between zoos, and that herd size is unlikely to predict enclosure size. Herd sizes are smaller than wild examples, and enclosure space (per animal) is significantly smaller than a potential wild range. Banteng are frequently maintained successfully in mixed species exhibits alongside a wide range of other taxa. Nutrient analysis focused on fiber and protein, and although provision of these nutrients appears comparable between zoos, more work is needed on browse and forage intake to determine overall diet suitability. Behavior management shows variation between zoos, with numerous collections providing browse but only a minority undertaking training, and not all providing enrichment. The overall diversity in findings between zoos suggest future research areas that should focus on key aspects of behavioral ecology, such as wild foraging behavior, food plant selection and day/night activity patterns, which may help underpin husbandry guidelines and excellent animal welfare. Zoo Biol. 35:546-555, 2016. © 2016 Wiley Periodicals, Inc.

  16. Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

    Directory of Open Access Journals (Sweden)

    Gustavo Gasparin

    2005-12-01

    Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

  17. Another Look at Taurus Littrow: An Interactive Geographic Information System DataBase

    Science.gov (United States)

    Coombs, Cassandra R.; Meisburger, J. L.; Nettles, J. W.

    1998-01-01

    A variety of data has been amassed for the Apollo 17 landing site, including topography, sample locations, and imagery. These data were compiled into a Geographic Information System (GIS) to analyze their interrelationships more easily. The database will allow the evaluation of the resource potential of the Taurus Littrow region pyroclastic deposits. The database also serves as a catalog for the returned lunar samples. This catalog includes rock type, size, and location. While this project specifically targets the Taurus Littrow region, it is applicable to other regions as well.

  18. An experimental study of aero-optical aberration and dithering of supersonic mixing layer via BOS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The optical performance of supersonic mixing layer is heavily deteriorated by the aero-optical aberration and dithering of coherent structures, but current measuring methods limit the spatiotemporal resolution in relevant studies. A high resolution whole-field aero-optical aberration and dithering measuring method based on the Background Orient Schlieren (BOS) technique was studied. The systematic structure, sensitivity and resolution of BOS are analyzed in this paper. The aero-optical aberration and dithering of streamwise structures in supersonic mixing layers were quantificationally studied with BOS. The aberration field of spanwise structures revealed the ribbon-like aberration structures, which heavily restrict the optical performance of a mixing layer. The quantifications of aero-optical aberration and dithering are very important in studying aero-optical performance of supersonic mixing layer.

  19. Molecular Outflows Identified in the FCRAO CO Survey of the Taurus Molecular Cloud

    CERN Document Server

    Narayanan, Gopal; Bemis, Ashley

    2012-01-01

    The 100 square degree FCRAO CO survey of the Taurus molecular cloud provides an excellent opportunity to undertake an unbiased survey of a large, nearby, molecular cloud complex for molecular outflow activity. Our study provides information on the extent, energetics and frequency of outflows in this region, which are then used to assess the impact of outflows on the parent molecular cloud. The search identified 20 outflows in the Taurus region, 8 of which were previously unknown. Both $^{12}$CO and $^{13}$CO data cubes from the Taurus molecular map were used, and dynamical properties of the outflows are derived. Even for previously known outflows, our large-scale maps indicate that many of the outflows are much larger than previously suspected, with eight of the flows (40%) being more than a parsec long. The mass, momentum and kinetic energy from the 20 outflows are compared to the repository of turbulent energy in Taurus. Comparing the energy deposition rate from outflows to the dissipation rate of turbulenc...

  20. An Infrared/X-ray Survey for New Members of the Taurus Star-Forming Region

    CERN Document Server

    Luhman, K L; Allen, P R; Cruz, K L

    2009-01-01

    We present the results of a search for new members of the Taurus star-forming region using data from the Spitzer Space Telescope and the XMM-Newton Observatory. We have obtained optical and near-infrared spectra of 44 sources that exhibit red Spitzer colors that are indicative of stars with circumstellar disks and 51 candidate young stars that were identified by Scelsi and coworkers using XMM-Newton. We also performed spectroscopy on four possible companions to members of Taurus that were reported by Kraus and Hillenbrand. Through these spectra, we have demonstrated the youth and membership of 41 sources, 10 of which were independently confirmed as young stars by Scelsi and coworkers. Five of the new Taurus members are likely to be brown dwarfs based on their late spectral types (>M6). One of the brown dwarfs has a spectral type of L0, making it the first known L-type member of Taurus and the least massive known member of the region (M=4-7 M_Jup). Another brown dwarf exhibits a flat infrared spectral energy d...

  1. B- and A-Type Stars in the Taurus-Auriga Star Forming Region

    CERN Document Server

    Mooley, Kunal P; Rebull, Luisa M; Padgett, Deborah L; Knapp, Gillian R

    2013-01-01

    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral type B. The second group consists of early-type stars compiled from (i) literature listings in SIMBAD; (ii) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud; (iii) magnitude- and color-selected point sources from the 2MASS; and (iv) spectroscopically identified early-type stars from the SDSS coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emiss...

  2. Outflows and Bubbles in Taurus: Star-formation Feedback Sufficient to Maintain Turbulence

    CERN Document Server

    Li, Huixian; Qian, Lei; Xu, Duo; Goldsmith, Paul F; Noriega-Crespo, Alberto; Wu, Yuefang; Song, Yuzhe; Nan, Rendong

    2015-01-01

    We have identified outflows and bubbles in the Taurus molecular cloud based on the $\\sim 100$ deg$^2$ Five College Radio Astronomy Observatory $^{12}$CO(1-0) and $^{13}$CO(1-0) maps and the Spitzer young stellar object catalogs. In the main 44 deg$^2$ area of Taurus we found 55 outflows, of which 31 were previously unknown. We also found 37 bubbles in the entire 100 deg$^2$ area of Taurus, all of which had not been found before. The total kinetic energy of the identified outflows is estimated to be $\\bf \\sim 3.9 \\times 10^{45}$ erg, which is \\textbf{1\\%} of the cloud turbulent energy. The total kinetic energy of the detected bubbles is estimated to be $\\sim 9.2 \\times 10^{46}$ erg, which is 29\\% of the turbulent energy of Taurus. The energy injection rate from outflows is $\\bf \\sim 1.3 \\times 10^{33}~\\rm erg\\ s^{-1}$, \\textbf{0.4 - 2 times} the dissipation rate of the cloud turbulence. The energy injection rate from bubbles is $\\sim 6.4 \\times 10^{33}$ erg s$^{-1}$, \\textbf{2 - 10 times} the turbulent dissipa...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-0803 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0803 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  4. NCBI nr-aa BLAST: CBRC-VPAC-01-1397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1397 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 88% ...

  5. NCBI nr-aa BLAST: CBRC-TTRU-01-1041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1041 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  6. Multiplicity and clustering in Taurus star-forming region. I. Unexpected ultra-wide pairs of high-order multiplicity in Taurus

    Science.gov (United States)

    Joncour, Isabelle; Duchêne, Gaspard; Moraux, Estelle

    2017-02-01

    Aims: This work analyses the spatial distribution of stars in Taurus with a specific focus on multiple stars and wide pairs in order to derive new constraints on star formation and early dynamical evolution scenarios. Methods: We collected the multiplicity data of stars in Taurus to build an up-to-date stellar/multiplicity catalog. We first present a general study of nearest-neighbor statistics on spatial random distribution, comparing its analytical distribution and moments to those obtained from Monte Carlo samplings. We introduce the one-point correlation Ψ function to complement the pair correlation function and define the spatial regimes departing from randomness in Taurus. We then perform a set of statistical studies to characterize the binary regime that prevails in Taurus. Results: The Ψ function in Taurus has a scale-free trend with a similar exponent as the correlation function at small scale. It extends almost 3 decades up to 60 kAU showing a potential extended wide binary regime. This was hidden in the correlation function due to the clustering pattern blending. Distinguishing two stellar populations, single stars versus multiple systems (separation ≤1 kAU), within Class II/III stars observed at high angular resolution, we highlight a major spatial neighborhood difference between the two populations using nearest-neighbor statistics. The multiple systems are three times more likely to have a distant companion within 10 kAU when compared to single stars. We show that this is due to the presence of most probable physical ultra-wide pairs (UWPs, defined as such from their mutual nearest neighbor property), that are themselves generally composed of multiple systems containing up to five stars altogether. More generally, our work highlights; 1) a new large population of candidate UWPs in Taurus within the range 1-60 kAU in Taurus and 2) the major local structural role they play up to 60 kAU. There are three different types of UWPs; either composed of two

  7. Molecular characterization of a long range haplotype affecting protein yield and mastitis susceptibility in Norwegian Red cattle

    Directory of Open Access Journals (Sweden)

    Hayes Ben J

    2011-08-01

    Full Text Available Abstract Background Previous fine mapping studies in Norwegian Red cattle (NRC in the region 86-90.4 Mb on Bos taurus chromosome 6 (BTA6 has revealed a quantitative trait locus (QTL for protein yield (PY around 88 Mb and a QTL for clinical mastitis (CM around 90 Mb. The close proximity of these QTLs may partly explain the unfavorable genetic correlation between these two traits in NRC. A long range haplotype covering this region was introduced into the NRC population through the importation of a Holstein-Friesian bull (1606 Frasse from Sweden in the 1970s. It has been suggested that this haplotype has a favorable effect on milk protein content but an unfavorable effect on mastitis susceptibility. Selective breeding for milk production traits is likely to have increased the frequency of this haplotype in the NRC population. Results Association mapping for PY and CM in NRC was performed using genotypes from 556 SNPs throughout the region 86-97 Mb on BTA6 and daughter-yield-deviations (DYDs from 2601 bulls made available from the Norwegian dairy herd recording system. Highest test scores for PY were found for single-nucleotide polymorphisms (SNPs within and surrounding the genes CSN2 and CSN1S2, coding for the β-casein and αS2-casein proteins. High coverage re-sequencing by high throughput sequencing technology enabled molecular characterization of a long range haplotype from 1606 Frasse encompassing these two genes. Haplotype analysis of a large number of descendants from this bull indicated that the haplotype was not markedly disrupted by recombination in this region. The haplotype was associated with both increased milk protein content and increased susceptibility to mastitis, which might explain parts of the observed genetic correlation between PY and CM in NRC. Plausible causal polymorphisms affecting PY were detected in the promoter region and in the 5'-flanking UTR of CSN1S2. These polymorphisms could affect transcription or translation of

  8. Dental fluorosis in cattle

    Energy Technology Data Exchange (ETDEWEB)

    Narozny, J.

    1965-01-01

    Dental fluorosis in cattle was used as an indicator of toxic effects produced by fluorine emissions from an aluminium factory. Data are presented on the effects of a ten-year exposure to fluorides on cattle teeth. Emissions from the factory were observed in two directions from the factory, and extended as far as 16 km from the source.

  9. Effect of biological type of cattle on the incidence of the dark, firm, and dry condition in the longissimus muscle.

    Science.gov (United States)

    Shackelford, S D; Koohmaraie, M; Wheeler, T L; Cundiff, L V; Dikeman, M E

    1994-02-01

    The objectives of this experiment were to characterize longissimus muscle color, texture, and firmness for beef carcasses of diverse biological types and to determine the genetic parameters of lean color, texture, and firmness. The carcasses (n = 3,641) used in this experiment were from steers produced by mating Angus, Brahman, Braunvieh, Charolais, Chianina, Galloway, Gelbvieh, Hereford, Jersey, Limousin, Longhorn, Maine Anjou, Nellore, Piedmontese, Pinzgauer, Red Poll, Sahiwal, Salers, Shorthorn, Simmental, South Devon, and Tarentaise sires to Hereford and Angus dams. Steers were fed a corn-corn silage diet from weaning until slaughter at 356 to 575 d of age. Steers were slaughtered at commercial packing plants and longissimus muscle color, texture, and firmness were scored by trained carcass evaluators. Sire line least squares means for lean color, texture, and firmness ranged approximately one unit on a 7-point scale. Chianina crosses had darker-colored lean than all breed groups except Tarentaise and Simmental crosses (P < .05). Moreover, a higher percentage (P < .05) of Chianina crosses than of all other breed groups had unacceptably dark-colored ("dark red" or darker) lean. Bos indicus sire lines were not different from Bos taurus sire lines in frequency of carcasses with unacceptably dark-colored lean. However, Bos indicus crosses were more likely to be scored "very light cherry-red." Lean color and texture were lowly heritable, whereas lean firmness was moderately heritable. Thus, this experiment demonstrated that there is genetic variation in the incidence of the DFD condition; however, genetic variation was small relative to environmental variation.

  10. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    NARCIS (Netherlands)

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthra

  11. Ideologie ontmoet economie; Private investeringen in Nederlands bos, natuur en landschap

    NARCIS (Netherlands)

    Vinken, M.; Hoogstra, M.A.

    2011-01-01

    Meer investeringen van burgers en bedrijven in bos, natuur en landschap. Dat is wat de overheid graag wil. Private investeringen komen echter nauwelijks van de grond, ondanks de vele verschillende initiatieven om deze te stimuleren. De vraag die we ons daarom moeten stellen, is of private financieri

  12. ‘Lute Bos draagt nog altijd bij aan de virologie’ : fonds laat ecologische virologie herrijzen

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.; Branderhorst, A.

    2014-01-01

    Met ecologische kennis van plantenvirussen in de tuin- en akkerbouw zijn opbrengstverliezen te voorkomen. René van der Vlugt gaat het onderzoek en onderwijs in dit vakgebied nieuw leven inblazen. Dat is mogelijk dankzij een legaat van de Wageningse plantenviroloog Lute Bos.

  13. Optimization of manganese peroxidase production by the white rot fungus Bjerkandera sp. strain BOS55.

    NARCIS (Netherlands)

    Mester, T.; Field, J.A.

    1997-01-01

    Manganese dependent peroxidase (MnP) is the most ubiquitous peroxidase produced by white rot fungi. MnP is known to be involved in lignin degradation, biobleaching and in the oxidation of hazardous organopollutants. Bjerkandera sp. strain BOS55 is a nitrogen-unregulated white rot fungus which produc

  14. The prion protein gene polymorphisms associated with bovine spongiform encephalopathy susceptibility differ significantly between cattle and buffalo.

    Science.gov (United States)

    Zhao, Hui; Du, Yanli; Chen, Shunmei; Qing, Lili; Wang, Xiaoyan; Huang, Jingfei; Wu, Dongdong; Zhang, Yaping

    2015-12-01

    Prion protein, encoded by the prion protein gene (PRNP), plays a crucial role in the pathogenesis of transmissible spongiform encephalopathies (TSEs). Several polymorphisms within the PRNP are known to be associated with influencing bovine spongiform encephalopathy (BSE) susceptibility in cattle, namely two insertion/deletion (indel) polymorphisms (a 23-bp indel in the putative promoter and a 12-bp indel in intron 1), the number of octapeptide repeats (octarepeats) present in coding sequence (CDS) and amino acid polymorphisms. The domestic buffaloes, Bubalus bubalis, are a ruminant involved in various aspects of agriculture. It is of interest to ask whether the PRNP polymorphisms differ between cattle and buffalo. In this study, we analyzed the previously reported polymorphisms associated with BSE susceptibility in Chinese buffalo breeds, and compared these polymorphisms in cattle with BSE, healthy cattle and buffalo by pooling data from the literature. Our analysis revealed three significant findings in buffalo: 1) extraordinarily low deletion allele frequencies of the 23- and 12-bp indel polymorphisms; 2) significantly low allelic frequencies of six octarepeats in CDS and 3) the presence of S4R, A16V, P54S, G108S, V123M, S154N and F257L substitutions in buffalo CDSs. Sequence alignments comparing the buffalo coding sequence to other species were analyzed using the McDonald-Kreitman test to reveal five groups (Bison bonasus, Bos indicus, Bos gaurus, Boselaphus tragocamelus, Syncerus caffer caffer) with significantly divergent non-synonymous substitutions from buffalo, suggesting potential divergence of buffalo PRNP and others. To the best of our knowledge this is the first study of PRNP polymorphisms associated with BSE susceptibility in Chinese buffalo. Our findings have provided evidence that buffaloes have a unique genetic background in the PRNP gene in comparison with cattle.

  15. ALGUNOS FACTORES RELACIONADOS CON LA DINÁMICA FOLICULAR EN BOS INDICUS SOME FACTORS RELATED TO FOLLICULAR DYNAMICS IN BOS INDICUS

    OpenAIRE

    Guillermo Henao Restrepo

    2010-01-01

    El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos tauru...

  16. Isolation and genetic diversity of endangered grey nurse shark (Carcharias taurus) populations

    OpenAIRE

    Stow, Adam; Zenger, Kyall; Briscoe, David; Gillings, Michael; Peddemors, Victor; Otway, Nicholas; Harcourt, Robert

    2006-01-01

    Anthropogenic impacts are believed to be the primary threats to the eastern Australian population of grey nurse sharks (Carcharias taurus), which is listed as critically endangered, and the most threatened population globally. Analyses of 235 polymorphic amplified fragment length polymorphisms (AFLP) loci and 700 base pairs of mitochondrial DNA control region provide the first account of genetic variation and geographical partitioning (east and west coasts of Australia, South Africa) in C. ta...

  17. Large-Scale Distribution of Herbig-Haro Objects in Taurus

    Institute of Scientific and Technical Information of China (English)

    Ke-Feng Sun; Ji Yang; Shao-Guang Luo; Min Wang; Li-Cai Deng; Xu Zhou; Jian-Sheng Chen

    2003-01-01

    We report our new results on Herbig-Haro (HH) objects in the star forming region of Taurus from a wide-field survey with the 60/90 cm Schmidt telescope of the Beijing Astronomical Observatory. This survey using CCD imaging with a narrow band [SⅡ] filter and an intermediate band [BATC10] filter covered approximately 30 square degrees in Taurus. Besides confirming the known HH Objects in the region, we discovered seven new HH candidates, and groups. Six of these are HH 701A-B, HH 702A-D, HH 703, HH 704A-D, HH 705, HH 706 and the seventh is a group, a new component of HH 319, labeled HH 319B-D. Based on the large-scale distribution of pre-main-sequence (PMS) stars in Taurus, we analyze statistically the most probable distance from the HH objects to each PMS star,from which we estimate the typical timescale of these HH objects to be between(1.3 - 2.0) × 104 yrs; and we also obtain the birth rates of HH objects: 0.447±0.198 for Class Ⅰ PMS stars, 0.360±0.222 for Class Ⅱ PMS stars, and -0.148±0.234 for Class Ⅲ PMS stars.

  18. THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

    Energy Technology Data Exchange (ETDEWEB)

    Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México Apartado Postal 3-72, 58090 Morelia, Michoacán (Mexico); Mioduszewski, Amy J. [National Radio Astronomy Observatory, Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Kounkel, Marina A.; Hartmann, Lee [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48105 (United States); Torres, Rosa M. [Instituto de Astronomía y Meteorología, Universidad de Guadalajara, Avenida Vallarta No. 2602, Col. Arcos Vallarta, CP 44130 Guadalajara, Jalisco, México (Mexico); Boden, Andrew F. [Division of Physics, Math, and Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, 1 University Station, C1400, Austin, TX 78712 (United States); Briceño, Cesar [Cerro Tololo Interamerican Observatory, Casilla 603, La Serena (Chile); Tobin, John, E-mail: sdzib@mpifr-bonn.mpg.de [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)

    2015-03-10

    We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature.

  19. Isolation and genetic diversity of endangered grey nurse shark (Carcharias taurus) populations.

    Science.gov (United States)

    Stow, Adam; Zenger, Kyall; Briscoe, David; Gillings, Michael; Peddemors, Victor; Otway, Nicholas; Harcourt, Robert

    2006-06-22

    Anthropogenic impacts are believed to be the primary threats to the eastern Australian population of grey nurse sharks (Carcharias taurus), which is listed as critically endangered, and the most threatened population globally. Analyses of 235 polymorphic amplified fragment length polymorphisms (AFLP) loci and 700 base pairs of mitochondrial DNA control region provide the first account of genetic variation and geographical partitioning (east and west coasts of Australia, South Africa) in C. taurus. Assignment tests, analysis of relatedness and Fst values all indicate that the Australian populations are isolated from South Africa, with negligible migration between the east and west Australian coasts. There are significant differences in levels of genetic variation among regions. Australian C. taurus, particularly the eastern population, has significantly less AFLP variation than the other sampling localities. Further, the eastern Australian sharks possess only a single mitochondrial haplotype, also suggesting a small number of founding individuals. Therefore, historical, rather than anthropogenic processes most likely account for their depauperate genetic variation. These findings have implications for the viability of the eastern Australian population of grey nurse sharks.

  20. The Gould Belt Very Large Array Survey IV: The Taurus-Auriga complex

    CERN Document Server

    Dzib, Sergio A; Rodríguez, Luis F; Mioduszewski, Amy J; Ortiz-León, Gisela N; Kounkel, Marina A; Pech, Gerardo; Rivera, Juana L; Torres, Rosa M; Boden, Andrew F; Hartmann, Lee; Evans, Neal J; Briceño, Cesar; Tobin, John

    2014-01-01

    We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects and 18 to field stars. The properties of 56\\% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved young stellar objects tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star forming regions. By comparing our results with previously reported X-ray observations, we notice that young stellar objects in Taurus-Auriga follow a G\\"{u}del-Benz relation with $\\kappa$=0.03, as we previously suggested for other regions of star formation. In general, young stellar objects in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of $\\sim1$ dex. Finally, we propose that most of the remaining ...

  1. Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

    Directory of Open Access Journals (Sweden)

    Luchman Hakim

    2015-09-01

    Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

  2. Length and Straightness of the Tubes for the BOS Prototype Chamber

    CERN Document Server

    Lagouri, T

    1998-01-01

    We have measured length and straightness of 50 tubes of 3.8~m length, after cleaning, wiring and testing from a batch that was used in the construction of the BOS prototype chamber. The specifi ed length (aluminum tube only, without endplug) was 3800~mm with a tolerance of $\\pm$1~mm. We found a mean value of (3805$\\pm$2)~mm with a standard deviation of (0.3$\\pm$0.1)~mm. The measureme nts of the straightness of the 50 BOS MDT tubes gave a mean of the maximum deviation of 150~$\\mu$m for 10 measured points along the tubes at 0$^{\\circ}$, 90$^{\\circ}$, 180$^{\\circ}$ and 270$^{\\circ }$ around the tube diameter and a mean value of all deviations of 20~$\\mu$m with a measuring accuracy of 10~$\\mu$m.

  3. Characterization and genetic analysis of bovine alpha S1-casein I variant.

    Science.gov (United States)

    Lühken, G; Caroli, A; Ibeagha-Awemu, E M; Erhardt, G

    2009-08-01

    The aim of this study was to identify the molecular genetic origin underlying the I variant of alpha(s1)-casein and to develop a DNA-based test for this polymorphism as a tool for genetic analyses independent of milk sample testing. All coding exons and flanking regions of the alpha(s1)-casein gene were sequenced in DNA samples from cattle of known alpha(s1)-casein genotypes (BI, CI, II, CC), determined by isoelectric focusing of milk samples. A nucleotide substitution (A>T) in exon 11 (g.19836A>T) leads to the exchange of Glu with Asp at amino acid position 84 of the mature protein (p.Glu84Asp) and perfectly co-segregated with the presence of the alpha(s1)-casein I variant in the milk of the analysed animals. Genotyping of a total of 680 DNA samples from 31 Bos taurus and Bos indicus cattle breeds and from Bos grunniens, Bison bison and Bison bonasus by restriction fragment length polymorphism analysis revealed the occurrence of Asp at position 84 at low frequencies in Bos taurus and Bos indicus breeds and established its origin from the alpha(s1)-casein C variant (p.Glu192Gly). Ten different intragenic haplotypes in the gene region from intron 8 to intron 12 were observed by sequencing, of which two occurred in Bison bison and one in Bison bonasus only. Using available casein gene complex information, an association of Asp at position 84 to beta-casein A(2) and kappa-casein B was shown in the Bos indicus breed Banyo Gudali. Taken together, we can postulate that the alpha(s1)-casein variant I is caused by a non-synonymous nucleotide substitution in exon 11 of the gene and that it originated within Bos indicus and spread to Bos taurus subsequently.

  4. Application of background-oriented schlieren (BOS) technique to a laser-induced underwater shock wave

    CERN Document Server

    Yamamoto, Shota; Kameda, Masaharu

    2015-01-01

    We build an ultra-high-speed imaging system based on the background-oriented schlieren (BOS) technique in order to capture a laser-induced underwater shock wave. This BOS technique is able to provide two-dimensional density-gradient field of fluid and requires a simple setup. The imaging system consists of an ultra-high speed video camera, a laser stroboscope, and a patterned background. This system takes images every 0.2 $\\mu$s. Furthermore, since the density change of water disturbed by the shock is exceedingly small, the system has high spatial resolution $\\sim$ 10 $\\mu$m/pixel. Using this BOS system, we examine temporal position of a shock wave. The position agrees well with that measured by conventional shadowgraph, which indicates that the high-speed imaging system can successfully capture the instantaneous position of the underwater shock wave that propagates with the speed of about 1500 m/s. The local density gradient can be determined up to $O$(10$^3$ kg/m$^4$), which is confirmed by the gradient est...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0585 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0585 ref|NP_001071387.1| hypothetical protein LOC514131 [Bos taurus] r...ef|XP_001254537.1| PREDICTED: hypothetical protein LOC514131 [Bos taurus] dbj|BAF36506.1| p97Bucentaur-2 [Bos tau...rus] gb|AAI49203.1| P97Bucentaur-2 [Bos taurus] NP_001071387.1 4e-12 32% ...

  6. NCBI nr-aa BLAST: CBRC-PCAP-01-1467 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1467 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-117 81% ...

  7. NCBI nr-aa BLAST: CBRC-MEUG-01-2178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2178 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-61 57% ...

  8. NCBI nr-aa BLAST: CBRC-RNOR-09-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-09-0075 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-147 70% ...

  9. NCBI nr-aa BLAST: CBRC-OCUN-01-1390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1390 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 6e-88 76% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-07-0080 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-07-0080 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-148 71% ...

  11. NCBI nr-aa BLAST: CBRC-ACAR-01-0732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0732 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 59% ...

  12. NCBI nr-aa BLAST: CBRC-CFAM-37-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-37-0004 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-173 82% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-0816 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0816 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-125 79% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-2252 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2252 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 4e-70 71% ...

  15. NCBI nr-aa BLAST: CBRC-MMUR-01-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0053 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 6e-33 72% ...

  16. Genomic dairy cattle breeding

    DEFF Research Database (Denmark)

    Mark, Thomas; Sandøe, Peter

    2010-01-01

    The aim of this paper is to discuss the potential consequences of modern dairy cattle breeding for the welfare of dairy cows. The paper focuses on so-called genomic selection, which deploys thousands of genetic markers to estimate breeding values. The discussion should help to structure...... the thoughts of breeders and other stakeholders on how to best make use of genomic breeding in the future. Intensive breeding has played a major role in securing dramatic increases in milk yield since the Second World War. Until recently, the main focus in dairy cattle breeding was on production traits......, unfavourable genetic trends for metabolic, reproductive, claw and leg diseases indicate that these attempts have been insufficient. Today, novel genome-wide sequencing techniques are revolutionising dairy cattle breeding; these enable genetic changes to occur at least twice as rapidly as previously. While...

  17. Cattle as urban planner

    OpenAIRE

    2015-01-01

    Hong Kong has a wide variety of habitats which contribute to the diversity of local fauna especially birds and insects. However, wild mammals are declining rapidly because of the degradation or loss of habitats caused by urbanization. For hundreds of years, bovid such as cattle and water buffalo have been an enduring presence amongst the diverse landscape of Hong Kong. Prior to the 1970’s, cattle were important to Hong Kong’s agricultural industry as a valuable labor for farming. Large popula...

  18. Analysis of Two Chinese Yak(Bos grunniens) Population Using Bovine Microsatellite Primers

    Institute of Scientific and Technical Information of China (English)

    Wang Minqiang; S.Weigend; A.Barre-Dirie; J.W.Carnwath; Lou Zhonglin; H.Niemann

    2005-01-01

    Two Chinese domestic yak populations representing the Plateau type and the Huanhu Alpine type were analysed with 12 bovine microsatellite primers. All primer pairs functioned in the yak genome and polymorphism was found at all loci. The allele size ranges and frequencies of the two yak populations were similar and there was considerable overlap with the allele size ranges observed in cattle. Data for European cattle breeds was obtained from the Cattle Diversity Database(CaDBase)to interpret the heterozygosity and genetic distance estimates in yak populations. Heterozygosity estimated for the two yak populations was comparable to that of European cattle while Nei's Genetic Distance DA between the two yak populations was less than distances between the most closely related German cattle breeds. Bovine microsatellite primers proved to be a valuable tool for characterization of yak populations.

  19. A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, K. O.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Konopacky, Q. M. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); McLeod, K. K. [Whitin Observatory, Wellesley College, Wellesley, MA 02481 (United States); Apai, D.; Pascucci, I. [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Ghez, A. M. [Division of Astronomy and Astrophysics, University of California, Los Angeles, CA 90095 (United States); Robberto, M., E-mail: todorovk@phys.ethz.ch [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2014-06-10

    We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M {sub ☉}). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15{sub −0.03}{sup +0.05} for M4-M6 (M ∼ 0.1-0.3 M {sub ☉}) and 4/108 = 0.04{sub −0.01}{sup +0.03} for >M6 (M ≲ 0.1 M {sub ☉}) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

  20. Two confirmed class I very low-mass objects in Taurus

    OpenAIRE

    Dang-Duc, C.; Phan-Bao, N.; Dao-Van, D. T.

    2016-01-01

    [GKH94] 41 and IRAS 04191+1523B were previously identified to be proto-brown dwarf candidates in Taurus. [GKH94] 41 was classified to be a class I object. The dereddened spectral energy distribution of the source was later found to be suggestive of a class II object. IRAS 04191+1523B is a class I object that is the secondary component of a binary. We determine the evolutionary stage of [GKH94] 41 and estimate the final masses of the two proto-brown dwarf candidates. We used archive millimeter...

  1. Arsenic poisoning in cattle

    Energy Technology Data Exchange (ETDEWEB)

    Reagor, J.C.

    Reports of heavy metal intoxication submitted to the Texas Veterinary Medical Diagnostic Laboratory indicate that arsenic is the most common heavy metal intoxicant in Texas. The most frequent sources of arsenic are compounds used as herbicides and cotton defoliants. The misuse of these compounds and subsequent intoxication of cattle is discussed in this paper. 8 references, 1 table.

  2. A Survey for New Members of the Taurus Star-forming Region with the Sloan Digital Sky Survey

    Science.gov (United States)

    Luhman, K. L.; Mamajek, E. E.; Shukla, S. J.; Loutrel, N. P.

    2017-01-01

    Previous studies have found that ∼1 deg2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg2) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types. Based on observations performed with the Sloan Digital Sky Survey, Hobby-Eberly Telescope, NASA Infrared Telescope Facility, Gemini Observatory, and Canada–France–Hawaii Telescope.

  3. Alteración diurna de la carga calórica corporal e interrelación de las temperaturas rectal y láctea en vacas cruzadas (6/8 Bos taurus x 2/8 Bos indicus, Pardo Suizo y Holstein bajo estrés calórico diurno durante la época seca en el clima tropical húmedo - Daytime alteration of body heat load and relationship between rectal and milk temperatures in crossbred (6/8 Bos taurus x 2/8 Bos indicus, Brown Swiss and Holstein lactating cows under heat stress during summer time in the humid tropical climate

    Directory of Open Access Journals (Sweden)

    Araúz, E. E.

    2010-11-01

    Full Text Available ResumenLas temperaturas rectal y de la secreción láctea y la carga calóricacorporal fueron evaluadas en 191 vacas en lactación (cruzadas 6/8Pardo Suizo x 2/8 Cebú y 6/8 Holstein x 2/8 Cebú: 27; Pardo Suizo:131; y Holstein: 33; bajo estrés calórico diurno en la época secadistribuidas entre 45 y 1064 msnm; con el objetivo de establecer laalteración diurna y su interrelación según el grupo genético y el grado de sensibilidad calórica.SummaryRectal and milk temperatures were measured in the afternoon (2 PM to4 PM in 191 lactating dairy cows (6/8 Brown Swiss x 2/8 Zebu and 6/8Holstein x 2/8 Zebu: 27, Brown Swiss: 131 and Holstein: 33 underheat stress in the tropical environment to evaluate daytime alterationof body heat load and establish the relationship between rectal andmilk temperature.

  4. Algunos factores relacionados con la dinámica folicular en bos indicus.

    OpenAIRE

    Henao Restrepo, Guillermo

    2011-01-01

    El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos tauru...

  5. Assessing the association of single nucleotide polymorphisms at the thyroglobulin gene with carcass traits in beef cattle.

    Science.gov (United States)

    Casas, E; White, S N; Shackelford, S D; Wheeler, T L; Koohmaraie, M; Bennett, G L; Smith, T P L

    2007-11-01

    The objective of this study was to assess the association of SNP in the thyroglobulin gene, including a previously reported marker in current industry use, with marbling score in beef cattle. Three populations, designated GPE6, GPE7, and GPE8, were studied. The GPE6 population sampled breeds that could be used as alternative germplasm sources in beef cattle production, including Wagyu, Swedish Red and White, Friesian, and Norwegian Red. The GPE7 population sampled 7 popular beef cattle breeds used in temperate climates of the United States: Angus, Charolais, Gelbvieh, Hereford, Limousin, Red Angus, and Simmental. The GPE8 population sampled Bos indicus-influenced breeds used in subtropical regions of the country and subtropical and tropical regions of the world, including Beefmaster, Bonsmara, Brangus, and Romosinuano. Evaluation of 6 SNP in the thyroglobulin gene, including 5 newly described variations, showed no association (P > 0.10) with marbling score in these populations, except a tendency (P carcass trait for this marker in the 3 populations. Furthermore, none of the 5 newly described markers in the gene displayed an association with marbling score. The data indicate that markers at the thyroglobulin gene may be a useful predictor of marbling performance for producers raising Wagyu-based cattle. Although associations with marbling score in the remaining populations were not large or significant, the TT genotype had the numerically greatest marbling score in each population.

  6. Applying a one-dimensional PDR model to the Taurus molecular cloud and its atomic envelope

    CERN Document Server

    Heiner, J S

    2012-01-01

    In this contribution, we test our previously published one-dimensional PDR model for deriving total hydrogen volume densities from HI column density measurements in extragalactic regions by applying it to the Taurus molecular cloud, where its predictions can be compared to available data. Also, we make the first direct detailed comparison of our model to CO(1-0) and far-infrared emission. Using an incident UV flux G0 of 4.25 ({\\chi} = 5) throughout the main body of the cloud, we derive total hydrogen volume densities of \\approx 430 cm-3, consistent with the extensive literature available on Taurus. The distribution of the volume densities shows a log-normal shape with a hint of a power-law shape on the high density end. We convert our volume densities to H2 column densities assuming a cloud depth of 5 parsec and compare these column densities to observed CO emission. We find a slope equivalent to a CO conversion factor relation that is on the low end of reported values for this factor in the literature (0.9 x...

  7. Striations in the Taurus molecular cloud: Kelvin-Helmholtz instability or MHD waves?

    Science.gov (United States)

    Heyer, M.; Goldsmith, P. F.; Yıldız, U. A.; Snell, R. L.; Falgarone, E.; Pineda, J. L.

    2016-10-01

    The origin of striations aligned along the local magnetic field direction in the translucent envelope of the Taurus molecular cloud is examined with new observations of 12CO and 13CO J = 2-1 emission obtained with the 10-m Submillimeter Telescope of the Arizona Radio Observatory. These data identify a periodic pattern of excess blue and redshifted emission that is responsible for the striations. For both 12CO and 13CO, spatial variations of the J = 2-1 to J = 1-0 line ratio are small and are not spatially correlated with the striation locations. A medium comprised of unresolved CO emitting substructures (cells) with a beam area filling factor less than unity at any velocity is required to explain the average line ratios and brightness temperatures. We propose that the striations are generated from the modulation of velocities and beam filling factor of the cells as a result of either the Kelvin-Helmholtz instability or magnetosonic waves propagating through the envelope of the Taurus molecular cloud. Both processes are likely common features in molecular clouds that are sub-Alfvénic and may explain low column density, cirrus-like features similarly aligned with the magnetic field observed throughout the interstellar medium in far-infrared surveys of dust emission.

  8. Striations in the Taurus molecular cloud: Kelvin-Helmholtz instability or MHD waves?

    CERN Document Server

    Heyer, M; Yildiz, U A; Snell, R L; Falgarone, E; Pineda, J

    2016-01-01

    The origin of striations aligned along the local magnetic field direction in the translucent envelope of the Taurus molecular cloud is examined with new observations of 12CO and 13CO J=2-1 emission obtained with the 10~m submillimeter telescope of the Arizona Radio Observatory. These data identify a periodic pattern of excess blue and redshifted emission that is responsible for the striations. For both 12CO and 13CO, spatial variations of the J=2-1 to J=1-0 line ratio are small and are not spatially correlated with the striation locations. A medium comprised of unresolved CO emitting substructures (cells) with a beam area filling factor less than unity at any velocity is required to explain the average line ratios and brightness temperatures. We propose that the striations result from the modulation of velocities and the beam filling factor of the cells as a result of either the Kelvin-Helmholtz instability or magnetosonic waves propagating through the envelope of the Taurus molecular cloud. Both processes ar...

  9. ISOLATION AND PARTIAL PURIFICATION OF ANTIMICROBIAL PEPTIDES/PROTEINS FROM DUNG BEETLE, ONTHOPHAGUS TAURUS IMMUNE HEMOLYMPH

    Directory of Open Access Journals (Sweden)

    Vasanth Patil H.B

    2013-06-01

    Full Text Available Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes & not against eukaryotes. These properties reveal its unique characteristics and therapeutic application.

  10. A survey of T Tauri stars with AKARI toward the Taurus-Auriga region

    CERN Document Server

    Takita, Satoshi; Kitamura, Yoshimi; Ishihara, Daisuke; Ita, Yoshifusa; Oyabu, Shinki; Ueno, Munetaka

    2010-01-01

    Aims: We search new T Tauri star (TTS) candidates with the mid-infrared (MIR) part of the AKARI All-Sky Survey at 9 and 18 um wavelengths. Methods: We used the point source catalogue (PSC), obtained by the Infrared Camera (IRC) on board AKARI. We combined the 2MASS PSC and the 3rd version of the USNO CCD Astrograph Catalogue (UCAC) with the AKARI IRC-PSC, and surveyed 517 known TTSs over a 1800-square-degree part of the Taurus-Auriga region to find criteria to extract TTSs. We considered asymptotic giant branch (AGB) stars, post-AGB stars, Planetary Nebulae (PNe), and galaxies, which have similar MIR colours, to separate TTSs from these sources. Results: Of the 517 known TTSs, we detected 133 sources with AKARI. Based on the colour-colour and colour-magnitude diagrams made from the AKARI, 2MASS, and UCAC surveys, we propose the criteria to extract TTS candidates from the AKARI All-Sky data. On the basis of our criteria, we selected 176/14725 AKARI sources as TTS candidates which are located around the Taurus-...

  11. Near-infrared polarimetry of a normal spiral galaxy viewed through the Taurus Molecular Cloud Complex

    CERN Document Server

    Clemens, Dan P; Cashman, L R

    2013-01-01

    Few normal galaxies have been probed using near-infrared polarimetry, even though it reveals magnetic fields in the cool interstellar medium better than either optical or radio polarimetry. Deep H-band (1.6um) linear imaging polarimetry toward Taurus serendipitously included the galaxy 2MASX J04412715+2433110 with adequate sensitivity and resolution to map polarization across nearly its full extent. The observations revealed the galaxy to be a steeply inclined (~75 deg) disk type with a diameter, encompassing 90% of the Petrosian flux, of 4.2 kpc at a distance of 53 Mpc. Because the sight line passes through the Taurus Molecular Cloud complex, the foreground polarization needed to be measured and removed. The foreground extinction Av of 2.00+/-0.10 mag and reddening E(H-K) of 0.125 +/- 0.009 mag were also assessed and removed, based on analysis of 2MASS, UKIDSS, Spitzer, and WISE photometry using the NICE, NICER, and RJCE methods. Corrected for the polarized foreground, the galaxy polarization values range fr...

  12. Genome Sequences of 11 Brucella abortus Isolates from Persistently Infected Italian Regions

    OpenAIRE

    2015-01-01

    Bovine brucellosis, typically caused by Brucella abortus, has been eradicated from much of the developed world. However, the disease remains prevalent in southern Italy, persisting as a public and livestock health concern. We report here the whole-genome sequences of 11 isolates from cattle (Bos taurus) and water buffalo (Bubalus bubalis) that are representative of the current genetic diversity of B. abortus lineages circulating in Italy.

  13. Vitamin C nutrition in cattle.

    Science.gov (United States)

    Matsui, T

    2012-05-01

    Domestic animals, including ruminants, can synthesize vitamin C (VC) in their liver; as such, the dietary requirement for VC has not been confirmed in these animals. The adequacy of VC has been evaluated by quantifying VC levels in plasma, but the reported values in bovine plasma have been widely variable. Plasma VC concentration is decreased by heat stress, hepatic lesions, fattening, and infectious diseases such as mastitis in cattle. Therefore, VC supplementation is potentially beneficial for cattle with low plasma VC concentration. This review discusses the methods for determination of plasma VC concentration in cattle, VC nutrition, and the efficacy of VC supplementation in calves, dairy cattle, and beef cattle. Additionally I propose a reference range for plasma VC concentration in Japanese Black cattle.

  14. Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sergio do Nascimento Kronka

    2008-08-01

    Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

  15. Arsenic poisoning in cattle

    Energy Technology Data Exchange (ETDEWEB)

    McLennan, M.W.; Dodson, M.E.

    1972-06-01

    A case of acute arsenic poisoning in cattle was reported. The losses occurred on a property in the south east of South Australia. The weather had been hot for two or three days before the death occurred. The tank supplying the water trough had almost run dry. The cattle then attempted to meet their water requirements by drinking from the sheep dipping vat. A sample of rumen contents and a sample of water from the dipping vat were checked for arsenic. The rumen sample contained 45 ppM As/sub 2/O/sub 3/ and the sample of dipping fluid contained 200 ppM As. The lesions observed were similar to earlier reported arsenic poisoning. 5 references.

  16. Genomic Variants Revealed by Invariably Missing Genotypes in Nelore Cattle.

    Directory of Open Access Journals (Sweden)

    Joaquim Manoel da Silva

    Full Text Available High density genotyping panels have been used in a wide range of applications. From population genetics to genome-wide association studies, this technology still offers the lowest cost and the most consistent solution for generating SNP data. However, in spite of the application, part of the generated data is always discarded from final datasets based on quality control criteria used to remove unreliable markers. Some discarded data consists of markers that failed to generate genotypes, labeled as missing genotypes. A subset of missing genotypes that occur in the whole population under study may be caused by technical issues but can also be explained by the presence of genomic variations that are in the vicinity of the assayed SNP and that prevent genotyping probes from annealing. The latter case may contain relevant information because these missing genotypes might be used to identify population-specific genomic variants. In order to assess which case is more prevalent, we used Illumina HD Bovine chip genotypes from 1,709 Nelore (Bos indicus samples. We found 3,200 missing genotypes among the whole population. NGS re-sequencing data from 8 sires were used to verify the presence of genomic variations within their flanking regions in 81.56% of these missing genotypes. Furthermore, we discovered 3,300 novel SNPs/Indels, 31% of which are located in genes that may affect traits of importance for the genetic improvement of cattle production.

  17. Production indices for dual purpose cattle in central Brazil

    Directory of Open Access Journals (Sweden)

    Concepta McManus

    2011-07-01

    Full Text Available This study examined the effects of crossbreeding low genetic potential cows of Bos indicus origin characterized by Gyr crossed with Holstein-Friesian and Simmental bulls to produce animals in a low input dual purpose system. The farm is situated near Brasilia, in the savannah region of Brazil. The climate of the region is classified as Aw by Köppen. Data was available on 1580 calvings and completed lactations of cows with three genetic types: Gyr, Holstein-Friesian × Gyr and Simmental × Gyr. The bulls ran with the cows all year round and the diet comprised of pasture (mainly Brachiaria and Andropogon during the summer (rainy season and milled sugar cane with added urea during the winter (dry season. A mineral salt mixture was available ad libitum. Data was analysed using Statistical Analysis System. The results show that, under low input management conditions, the crossbred cows produce approximately twice the volume of milk per lactation, calve at a younger age and have a shorter open period, but there are no significant differences between crosses for growth rates of the calves or body condition of the cows. In this system, crossbred cows had production higher indices than zebu cattle. The best indices were found for cows calving in the rainy season (September to December and thinner cows (with body condition 3-5 on a scale of 9.

  18. FACTORS AFFECTING HEAT TOLERANCE IN CROSSBRED CATTLE IN CENTRAL BRAZIL

    Directory of Open Access Journals (Sweden)

    Concepta Margaret McManus

    2014-06-01

    Full Text Available This study compared the adaptation traits in common crosses of crossbred dairy cattle in central Brazil. Twenty animals of each of three genetic groups were used: zebu (Bos indicus, Simmental x Zebu (SZ and Holstein x Zebu (HZ. The test measured variations in rectal temperature (RT, respiration rate (RR and heart rate (HR of animals in the shade and after exposure to the sun, as well as mean daily milk production throughout the lactation period. The procedure was repeated three times. There were significant interactions between test group and genetic group for the traits investigated and the correlations among traits were low. The RR of the crossbred groups may be controlling body temperature in such a way as not to cause an increase in RT. Milk production influenced RR in crossbred cows exposed to the sun, confirming their poorer adaptation in comparison with zebu cows. We observed that the adaptation can be measured in terms of production within the same genetic group. In conclusion, the crosses with European breeds produced more milk than zebu, although they were influenced by heat/solar radiation.

  19. A Survey for New Members of the Taurus Star-Forming Region with the Sloan Digital Sky Survey

    CERN Document Server

    Luhman, K L; Shukla, S J; Loutrel, N P

    2016-01-01

    Previous studies have found that ~1 deg2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC~348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the IMF, we have performed a survey for members of Taurus across a large field (~40 deg2) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields towards the stellar aggregates that were sur...

  20. Large-Scale Structure of the Molecular Gas in Taurus Revealed by High Spatial Dynamic Range Spectral Line Mapping

    Science.gov (United States)

    Goldsmith, Paul F.

    2008-01-01

    Viewgraph topics include: optical image of Taurus; dust extinction in IR has provided a new tool for probing cloud morphology; observations of the gas can contribute critical information on gas temperature, gas column density and distribution, mass, and kinematics; the Taurus molecular cloud complex; average spectra in each mask region; mas 2 data; dealing with mask 1 data; behavior of mask 1 pixels; distribution of CO column densities; conversion to H2 column density; variable CO/H2 ratio with values much less than 10(exp -4) at low N indicated by UV results; histogram of N(H2) distribution; H2 column density distribution in Taurus; cumulative distribution of mass and area; lower CO fractional abundance in mask 0 and 1 regions greatly increases mass determined in the analysis; masses determined with variable X(CO) and including diffuse regions agrees well with the found from L(CO); distribution of young stars as a function of molecular column density; star formation efficiency; star formation rate and gas depletion; and enlarged images of some of the regions with numerous young stars. Additional slides examine the origin of the Taurus molecular cloud, evolution from HI gas, kinematics as a clue to its origin, and its relationship to star formation.

  1. Feedlot Processing and Arrival Cattle Management.

    Science.gov (United States)

    Noffsinger, Tom; Lukasiewicz, Kip; Hyder, LeeAnn

    2015-11-01

    Acclimating newly arrived cattle in a feedlot setting can increase cattle confidence, reduce stress, improve immune function, and increase cattle well-being. Understanding cattle instincts and using low-stress handling techniques teaches cattle to trust their caregivers and work efficiently for them throughout the feeding period. These techniques should be applied with newly arrived cattle when they are unloaded, moved from the holding pen to the home pen, and handled inside the home pen. Low-stress handling during processing and a sound processing protocol based on cattle history and proper risk assessment can improve cattle health from the start of the feeding period.

  2. The XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST)

    Science.gov (United States)

    Guedel, M.; Briggs, K. R.; Arzner, K.; Audard, M.; Bouvier, J.; Feigelson, E. D.; Franciosini, E.; Glauser, A.; Grosso, N.; Micela, G.; Monin, J.-L.; Montmerle, T.; Padgett, D. L.; Palla, F.; Pillitteri, I.; Rebull, L.; Scelsi, L.; Silva, B.; Skinner, S. L.; Stelzer, B.; Telleschi, A.

    2007-01-01

    The Taurus Molecular Cloud (TMC) is the nearest large star-forming region, prototypical for the distributed mode of low-mass star formation. Pre-main sequence stars are luminous X-ray sources, probably mostly owing to magnetic energy release. Aims. The XMM-Newton Extended Survey of the Taurus Molecular Cloud (EST) presented in this paper surveys the most populated =5 square degrees of the TMC, using the XMM-Newton X-ray observatory to study the thermal structure, variability, and long-term evolution of hot plasma, to investigate the magnetic dynamo, and to search for new potential members of the association. Many targets are also studied in the optical, and high-resolution X-ray grating spectroscopy has been obtained for selected bright sources. Methods. The X-ray spectra have been coherently analyzed with two different thermal models (2-component thermal model, and a continuous emission measure distribution model). We present overall correlations with fundamental stellar parameters that were derived from the previous literature. A few detections from Chandra observations have been added. Results. The present overview paper introduces the project and provides the basic results from the X-ray analysis of all sources detected in the XEST survey. Comprehensive tables summarize the stellar properties of all targets surveyed. The survey goes deeper than previous X-ray surveys of Taurus by about an order of magnitude and for the first time systematically accesses very faint and strongly absorbed TMC objects. We find a detection rate of 85% and 98% for classical and weak-line T Tau stars (CTTS resp. WTTS), and identify about half of the surveyed protostars and brown dwarfs. Overall, 136 out of 169 surveyed stellar systems are detected. We describe an X-ray luminosity vs. mass correlation, discuss the distribution of X-ray-to-bolometric luminosity ratios, and show evidence for lower X-ray luminosities in CTTS compared to WTTS. Detailed analysis (e.g., variability, rotation

  3. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  4. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

    2013-01-01

    motility; and the paraclinical parameters: bacterial counts, somatic cell count (SCC), and milk amyloid A levels in milk; and white blood cell count, polymorphonuclear neutrophilic leukocyte (PMNL) count, and serum amyloid A levels in blood were recorded at different time points post-E. coli inoculation...... with a low E. coli dose (20 to 40 cfu) in one front quarter at time 0 h. Liver biopsies were collected at -144, 12, 24, and 192 h; udder biopsies were collected at 24 h and 192 h post-E. coli inoculation. The clinical parameters: feed intake, milk yield, body temperature, heart rate, respiration rate, rumen...

  5. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus durante o anestro pós-parto

    Directory of Open Access Journals (Sweden)

    R.S. Lima

    2011-08-01

    Full Text Available Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12. Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica de imunoistoquímica. Altas contagens relativas e alta intensidade de marcação para receptor de estrógeno e progesterona no epitélio glandular e no estroma foram observadas nos dois grupos. No entanto, a intensidade de marcação para o receptor de progesterona no epitélio glandular foi mais alta no grupo 2 comparado ao grupo 1. Quando o epitélio glandular e o estroma foram comparados, o número relativo de receptor de estrógeno no grupo 1 foi mais alto no epitélio glandular comparado ao estroma, e a intensidade de marcação para o receptor de progesterona no grupo 2 foi mais alta no epitélio glandular comparado ao estroma. Os resultados sugerem que os mecanismos que controlam a expressão de receptores no anestro são semelhantes aos observados durante o ciclo estral.

  6. Tipos de fibras en el músculo esquelético del toro bravo (bos taurus ibericus) : su relación con la caída durante la lídia / 2001.

    OpenAIRE

    2001-01-01

    Tesis-Universidad de Murcia. Consulte la tesis en: BCA. GENERAL. ARCHIVO UNIVERSITARIO. T.M.-2275. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Departamentos. E002B TESIS 95. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Sala de estudio. Tesis-V 153.

  7. Parámetros protéicos del plasma seminal y su relación con la calidad del semen en toros de la raza nelore (bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2006-10-01

    Full Text Available El propósito de este estudio fue investigar la presenciae incidencia de bandas proteicas específicas delplasma seminal en toros Nelore, completa y parcialmente aptos para la actividad reproductiva. Se utilizaron 68 ejemplares; 20 de variedad Padrón y 48 Mochos, con edad media de 4 años. En el perímetro escrotal (35,05±0,49 cm e 33,30±0,39cm, índice de masa corpórea (302,62±5,87 e 284,19±5,15Kg|m2 hubo diferencia (p<0,05 entre las variedades Padrón y Mocho, respectivamente. Con respecto al peso corpóreo (627,70±11,37 e 611,58±8,66Kg; la altura (1,44±0,01e 1,47±0,01m; el volumen del eyaculado (5,82±0,48 e 5,17±0,29 mL, la motilidad espermática progresiva (73,50±2,81% e75,62±0,97%, el vigor espermático (4,30±0,19 e4,27±0,11 y motilidad en masa (4,27±0,11 e3,33±0,23 no se presentó diferencia (p>0,05. En morfología espermática, tampoco hubo desigualdad entre las variedades Padrón y Mocho, respectivamente con 5,06 ± 8,20% e 5,32 ± 6,40% de defectos mayores; 9,91±6,74% e 8,36±6,06% para los defectos menores; e 14,76±13,20% e 13,82±12,61% para los defectos totales. La electroforesis del plasma seminal reveló bandas proteicas con pesos entre 5 a 105 KDa. En el 100% de toros aptos para la reproducción, la proteína con pesos de 13 Kda estuvo presente. De la misma forma ocurrió con las bandas de 20 KDa. El resto de las bandas proteicas mostraron presencia con diferentes porcentajes de incidencia en toros aptos o parcialmente aptos para la actividad reproductiva. Las dos variedades estudiadas hicieron evidente la adaptación reproductiva eficaz en condiciones de clima semejantes.

  8. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  9. The major cow milk allergen Bos d 5 manipulates T-helper cells depending on its load with siderophore-bound iron.

    Directory of Open Access Journals (Sweden)

    Franziska Roth-Walter

    Full Text Available The mechanisms of allergic sensitization to milk are still elusive. The major allergen Bos d 5 belongs to the lipocalin-family and thus is able to transport numerous ligands. In this study we investigated its ability to bind to iron-siderophore complexes and tested the immune-modulatory properties of Bos d 5 in either forms. Structural and in silico docking analysis of Bos d 5 revealed that Bos d 5 is able to bind to iron via catechol-based flavonoids (quercetin, myricetin, luteolin that act as siderophores as confirmed by spectral-analysis and iron staining. Calculated dissociation constants of docking analyses were below 1 µM by virtual addition of iron. When incubated with human peripheral blood mononuclear cells (PBMCs, only the apo-form of Bos d 5 led to an increase of CD4+positive cells and significantly elevated IL13 and IFNγ-levels. In contrast, holo-Bos d 5 decreased numbers of CD4 expressing cells and induced apoptosis. Taken together, our data give evidence that Bos d 5 is capable of binding iron via siderophores. Moreover, our data support for the first time the notion that the form of application (apo- or holo-form is decisive for the subsequent immune response. The apo-form promotes Th2 cells and inflammation, whereas the holo-form appears to be immunosuppressive.

  10. Separating, Antagonistic Activity and Identifying of Actinomycetes(BOS-009)%放线菌BOS-009的分离、拮抗活性及鉴定

    Institute of Scientific and Technical Information of China (English)

    王勇; 纪明山; 张文革; 何璐; 张丽; 梁娇

    2009-01-01

    对从长白山不同海拔环境中分离筛选出可以产生抗菌活性物质的BOS-009放线菌菌株进行了研究,测定了该菌的抗菌谱,发现该菌株对多种植物病原性真菌及细菌有拮抗作用.通过形态特征、培养特征观察,生理生化特性及抑菌谱等系列比较.发现该菌株与链霉菌属的除虫链霉菌(Streptomyces avermitilis)的特征基本相符;通过16s rDAN序列比对,发现该菌株16s rDAN与除虫链霉菌的16s rDAN同源性达99%.根据多项分类原则和系统进化树的构建分析,将该菌株暂归入除虫链霉菌类.

  11. The Five College Radio Astronomy Observatory CO Mapping Survey of the Taurus Molecular Cloud

    CERN Document Server

    Narayanan, Gopal; Brunt, Christopher; Goldsmith, Paul F; Snell, Ronald; Li, Di

    2008-01-01

    The FCRAO Survey of the Taurus Molecular Cloud observed the 12CO and 13CO J=1-0 emission from 98 square degrees of this important, nearby star forming region. This set of data with 45" resolution comprises the highest spatial dynamic range image of an individual molecular cloud constructed to date, and provides valuable insights to the molecular gas distribution, kinematics, and the star formation process. In this contribution, we describe the observations, calibration, data processing, and characteristics of the noise and line emission of the survey. The angular distribution of 12CO and 13CO emission over 1 km/s velocity intervals and the full velocity extent of the cloud are presented. These reveal a complex, dynamic medium of cold, molecular gas.

  12. Morphological identification of vesicular-arbuscular mycorrhiza on bulbous plants (Taurus mountain in Turkey

    Directory of Open Access Journals (Sweden)

    Karaarslan Emel

    2015-01-01

    Full Text Available This study was conducted to investigate the morphological identification of vesicular-arbuscular mycorrhiza (VAM on bulbous plants in the Taurus Mountains in Turkey. Thirteen soil samples and bulbous roots were taken from the rhizosphere of bulbous plants. The soils were analyzed for the number of VAM spores and chemical and physical properties. In addition, the roots were examined for infection levels, and morphological identification of VAM spores was made. All tested plants are considered mycorrhizal plants. We determined three spore species (Glomus mosseae, Glomus hoi and Scutellospora calospora from the surveyed soils. The spore distribution rates were as follows: G. Mossea 61.54 %, G. Hoi 23.07 % and Scutellospora calospora 15.38 %. Results suggest that VAM fungal spores and root colonization display variation in rhizosphere under bulbous plants in different ecological conditions.

  13. A Survey and Analysis of Spitzer Infrared Spectrograph Spectra of T Tauri Stars in Taurus

    CERN Document Server

    Furlan, E; Calvet, N; D'Alessio, P; Franco-Hernandez, R; Forrest, W J; Watson, D M; Uchida, K I; Sargent, B; Green, J D; Keller, L D; Herter, T L

    2006-01-01

    We present mid-infrared spectra of T Tauri stars in the Taurus star-forming region obtained with the Spitzer Infrared Spectrograph (IRS). For the first time, the 5-36 micron spectra of a large sample of T Tauri stars belonging to the same star-forming region is studied, revealing details of the mid-infrared excess due to dust in circumstellar disks. We analyze common features and differences in the mid-IR spectra based on disk structure, dust grain properties, and the presence of companions. Our analysis encompasses spectral energy distributions from the optical to the far-infrared, a morphological sequence based on the IRS spectra, and spectral indices in IRS wave bands representative of continuum emission. By comparing the observed spectra to a grid of accretion disk models, we infer some basic disk properties for our sample of T Tauri stars, and find additional evidence for dust settling.

  14. Spitzer IRS Spectra and Envelope Models of Class I Protostars in Taurus

    CERN Document Server

    Furlan, E; Calvet, N; Hartmann, L; D'Alessio, P; Forrest, W J; Watson, D M; Uchida, K I; Sargent, B; Green, J D; Herter, T L

    2007-01-01

    We present Spitzer Infrared Spectrograph spectra of 28 Class I protostars in the Taurus star-forming region. The 5 to 36 micron spectra reveal excess emission from the inner regions of the envelope and accretion disk surrounding these predecessors of low-mass stars, as well as absorption features due to silicates and ices. Together with shorter- and longer-wavelength data from the literature, we construct spectral energy distributions and fit envelope models to 22 protostars of our sample, most of which are well-constrained due to the availability of the IRS spectra. We infer that the envelopes of the Class I objects in our sample cover a wide range in parameter space, particularly in density and centrifugal radius, implying different initial conditions for the collapse of protostellar cores.

  15. Water vapor weathering of Taurus-Littrow orange soil - A pore-structure analysis

    Science.gov (United States)

    Cadenhead, D. A.; Mikhail, R. S.

    1975-01-01

    A pore-volume analysis was performed on water vapor adsorption data previously obtained on a fresh sample of Taurus-Littrow orange soil, and the analysis was repeated on the same sample after its exposure to moist air for a period of approximately six months. The results indicate that exposure of an outgassed sample to high relative pressures of water vapor can result in the formation of substantial micropore structure, the precise amount being dependent on the sample pretreatment, particularly the outgassing temperature. Micropore formation is explained in terms of water penetration into surface defects. In contrast, long-term exposure to moist air at low relative pressures appears to reverse the process with the elimination of micropores and enlargement of mesopores possibly through surface diffusion of metastable adsorbent material. The results are considered with reference to the storage of lunar samples.

  16. Pain evaluation in dairy cattle

    DEFF Research Database (Denmark)

    Glerup, Karina Bech; Andersen, Pia Haubro; Munksgaard, Lene

    2015-01-01

    Pain compromises the welfare of animals. A prerequisite for being able to alleviate pain is that we areable to recognize it. Potential behavioural signs of pain were investigated for dairy cattle with the aimof constructing a pain scale for use under production conditions. Forty-three cows were...... of pain in dairy cattle under productionconditions....

  17. Nonrespiratory diseases of stocker cattle.

    Science.gov (United States)

    Step, Douglas L; Smith, Robert A

    2006-07-01

    Bovine respiratory disease is the most common health issue affecting stocker cattle. There are several nonrespiratory diseases that affect stockers. The more common diseases include rumen tympany, infectious bovine keratoconjunctivitis, coccidiosis, photosensitization, and foot rot. Accurate diagnosis, early treatment, and incorporating appropriate preventive measures can assist cattle production.

  18. Association of HLA class II alleles with sensitization to cow dander Bos d 2, an important occupational allergen.

    Science.gov (United States)

    Kauppinen, Anu; Peräsaari, Juha; Taivainen, Antti; Kinnunen, Tuure; Saarelainen, Soili; Rytkönen-Nissinen, Marja; Jeal, Hayley; Jones, Meinir; Virtanen, Tuomas

    2012-01-01

    Allergic sensitization results from a complex interaction between genetic and environmental factors. Earlier studies have shown that highly polymorphic HLA genes are associated with a variety of allergies. Several important respiratory allergens belong to the family of lipocalin proteins. These include occupational sensitizers, such as cow Bos d 2 or rat Rat n 1, and prevalent indoor sensitizers, such as dog Can f 1 or cockroach Bla g 4. HLA associations with sensitization to lipocalin allergens are incompletely known. In the present study we have investigated an association between HLA alleles and sensitization to the major cow allergen Bos d 2. The HLA-DR/DQ genotypes of 40 Bos d 2-sensitized subjects having occupational asthma were determined by polymerase chain reaction (PCR) and the results were compared with the genotypes of 151 unrelated Finnish subjects. The frequencies of HLA class II alleles DRB1*0101, DRB1*0404, DQB1*0302, and DQB1*0501 were significantly higher among Bos d 2-sensitized than among control subjects. In addition, the allergic subjects expressed significantly lower frequencies of HLA-DRB1*0301 and DQB1*0201 alleles than did the control subjects. These data suggest that the HLA class II alleles DRB1*0101, DRB1*0404, DQB1*0302, and DQB1*0501, and the haplotypes that include them, are associated with sensitization to the major cow allergen Bos d 2, whereas HLA-DRB1*0301 and DQB1*0201 are dissociated with it. Amino acid analysis provides a biologically plausible explanation for the HLA associations.

  19. Brood ball-mediated transmission of microbiome members in the dung beetle, Onthophagus taurus (Coleoptera: Scarabaeidae.

    Directory of Open Access Journals (Sweden)

    Anne M Estes

    Full Text Available Insects feeding on plant sap, blood, and other nutritionally incomplete diets are typically associated with mutualistic bacteria that supplement missing nutrients. Herbivorous mammal dung contains more than 86% cellulose and lacks amino acids essential for insect development and reproduction. Yet one of the most ecologically necessary and evolutionarily successful groups of beetles, the dung beetles (Scarabaeinae feeds primarily, or exclusively, on dung. These associations suggest that dung beetles may benefit from mutualistic bacteria that provide nutrients missing from dung. The nesting behaviors of the female parent and the feeding behaviors of the larvae suggest that a microbiome could be vertically transmitted from the parental female to her offspring through the brood ball. Using sterile rearing and a combination of molecular and culture-based techniques, we examine transmission of the microbiome in the bull-headed dung beetle, Onthophagus taurus. Beetles were reared on autoclaved dung and the microbiome was characterized across development. A ~1425 bp region of the 16S rRNA identified Pseudomonadaceae, Enterobacteriaceae, and Comamonadaceae as the most common bacterial families across all life stages and populations, including cultured isolates from the 3(rd instar digestive system. Finer level phylotyping analyses based on lepA and gyrB amplicons of cultured isolates placed the isolates closest to Enterobacter cloacae, Providencia stuartii, Pusillimonas sp., Pedobacter heparinus, and Lysinibacillus sphaericus. Scanning electron micrographs of brood balls constructed from sterile dung reveals secretions and microbes only in the chamber the female prepares for the egg. The use of autoclaved dung for rearing, the presence of microbes in the brood ball and offspring, and identical 16S rRNA sequences in both parent and offspring suggests that the O. taurus female parent transmits specific microbiome members to her offspring through the brood

  20. Influência de diferentes concentrações de etileno glicol nO número de células da granulosa e morfometria de folículos pré-antrais inclusos em tecido ovariano de Bos taurus indicus, Linnaeus, 1758 Influence of different concentrations of the glycol in the number of granulosa cells and morphometry of the preantral ovarian follicles of Bos taurus indicus, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Hélder Silva e Luna

    2010-12-01

    Full Text Available A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica clássica. Os folículos primordiais expostos à concentração de 40% apresentaram redução do diâmetro folicular e ovocitário quando comparados ao grupo controle (sem exposição, 10% e 20% (P0,05. Esses resultados sugerem que folículos primários são mais resistentes aos efeitos do etileno glicol quando comparados aos primordiais.The cryopreservation of the ovarian preantral follicles could help the conservation of several domestic and wild animal species. The objective of this study was to verify the effect of different concentrations of ethylene glycol on the morphometry and number of granulosa cells of the preantral ovarian follicles. A toxicity test was conducted with strips of ovarian cortex using ethylene glycol (10, 20 or 40%. Tissue analysis was done using classical histology techniques. The primordial follicles expose at a concentration of 40% showed reduction of the follicular diameter and oocyte when compared to the control (non exposing, 10 and 20% groups (P0.05. These results suggest that primary follicles are more resistant to the effect of ethylene glycol when compared to primordial ones.

  1. VizieR Online Data Catalog: Infrared photometry of all known members in Taurus (Esplin+, 2014)

    Science.gov (United States)

    Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

    2016-08-01

    To construct a census of the circumstellar disks in Taurus, we begin by compiling a list of all known members of the region. We adopt the 352 members from Luhman et al. 2010 (cat. J/ApJS/186/111), 4 additional stars that have good evidence of membership from previous studies (Section 5.4), 32 members found in a subsequent survey by K. Luhman (in preparation; 33 if GZ Tau A and B are counted separately), and 25 new members (26 if BS Tau A and B are counted separately) that we have confirmed with spectroscopy (Section 5.3). We also adopt as a member HD 285957, which has a proper motion consistent with that of the Taurus subgroup L1551 (Zacharias et al. 2013, cat. I/322; Luhman et al. 2009ApJ...703..399L) and exhibits evidence of youth in the form of Li absorption (Wichmann et al. 2000A&A...359..181W; Sestito et al. 2008, cat. J/A+A/488/943). We make use of mid-infrared photometry for members of Taurus measured with Spitzer's Infrared Array Camera (IRAC) and the Multiband Imaging Photometer for Spitzer (MIPS). We consider the four bands of IRAC (3.6, 4.5, 5.8, and 8.0μm) and the 24μm band of MIPS, which are denoted as [3.6], [4.5], [5.8], [8.0], and [24], respectively. IRAC produced images with a field of view of 5.2'*5.2' and FWHM of 1.6''-1.9'' for [3.6] to [8.0]. MIPS had a field of view of 5.4'*5.4' and a FWHM of 5.9'' for [24]. Photometry from most Spitzer images for most members of Taurus has been measured by Luhman et al. 2010 (cat. J/ApJS/186/111) (see also Hartmann et al. 2005ApJ...629..881H; Luhman et al. 2006, cat. J/ApJ/647/1180; Guieu et al. 2007, cat. 2007A&A...465..855G; Rebull et al. 2010, cat. J/ApJS/186/259). We have measured photometry of the members that were not considered in Luhman et al. 2010 (cat. J/ApJS/186/111) and all known members appearing in Spitzer images that have become publicly available since that study (Astronomical Observation Requests 26470912, 26471168 26477056, 26475264, 26472704, 26473216, and 23272448). These data were

  2. Placentation in cloned cattle

    DEFF Research Database (Denmark)

    Miglino, M A; Pereira, F T V; Visintin, J A

    2007-01-01

    To elucidate the morphological differences between placentas from normal and cloned cattle pregnancies reaching term, the umbilical cord, placentomes and interplacentomal region of the fetal membranes were examined macroscopically as well as by light and scanning electron microscopy. In pregnancies...... than one primary villus, as opposed to a single villus in non-cloned placentae. Scanning electron microscopy of blood vessel casts revealed that there was also more than one stem artery per villous tree and that the ramification of the vessels failed to form dense complexes of capillary loops...

  3. Production and processing studies on calpain-system gene markers for tenderness in Brahman cattle: 2. Objective meat quality.

    Science.gov (United States)

    Cafe, L M; McIntyre, B L; Robinson, D L; Geesink, G H; Barendse, W; Pethick, D W; Thompson, J M; Greenwood, P L

    2010-09-01

    Effects and interactions of calpain-system tenderness gene markers on objective meat quality traits of Brahman (Bos indicus) cattle were quantified within 2 concurrent experiments at different locations. Cattle were selected for study from commercial and research herds at weaning based on their genotype for calpastatin (CAST) and calpain 3 (CAPN3) gene markers for beef tenderness. Gene marker status for mu-calpain (CAPN1-4751 and CAPN1-316) was also determined for inclusion in statistical analyses. Eighty-two heifer and 82 castrated male cattle with 0 or 2 favorable alleles for CAST and CAPN3 were studied in New South Wales (NSW), and 143 castrated male cattle with 0, 1, or 2 favorable alleles for CAST and CAPN3 were studied in Western Australia (WA). The cattle were backgrounded for 6 to 8 mo and grain-fed for 117 d (NSW) or 80 d (WA) before slaughter. One-half the cattle in each experiment were implanted with a hormonal growth promotant during feedlotting. One side of each carcass was suspended from the Achilles tendon (AT) and the other from the pelvis (tenderstretch). The M. longissimus lumborum from both sides and the M. semitendinosus from the AT side were collected; then samples of each were aged at 1 degrees C for 1 or 7 d. Favorable alleles for one or more markers reduced shear force, with little effect on other meat quality traits. The size of effects of individual markers varied with site, muscle, method of carcass suspension, and aging period. Individual marker effects were additive as evident in cattle with 4 favorable alleles for CAST and CAPN3 markers, which had shear force reductions of 12.2 N (P 0.05) of interactions between the gene markers, or between the hormonal growth promotant and gene markers for any meat quality traits. This study provides further evidence that selection based on the CAST or CAPN3 gene markers improves meat tenderness in Brahman cattle, with little if any detrimental effects on other meat quality traits. The CAPN1-4751 gene

  4. IMPLIKASI BANTUAN OPERASIONAL SEKOLAH (BOS) BUKU TERHADAP KREATIVITAS GURU MENULIS BUKU MODUL

    OpenAIRE

    Isharijadi, Isharijadi

    2016-01-01

    This  research  serves  an analysis  as to empirically   explain  the implementation    of School Operational Grant  (BOS)  for books from government and  its relevance   towards  the teachers' creativeness in writing   books  and  modules.   School  Operational   Grant  for books  is intended    to  ease   students’ parents   in  providing    books   for  their children.Teachers, as the front-liners for the students' learning development, are attempted to creatively provide the  sufficient l...

  5. Study of interfaces in an Axisymmetric Supersonic Jet using Background Oriented Schlieren (BOS)

    Science.gov (United States)

    Echeverría, Carlos; Porta, David; Aguayo, Alejandro; Cardoso, Hiroki; Stern, Catalina

    2014-11-01

    We have used several techniques to study a small axisymmetric supersonic jet: Rayleigh scattering, Schlieren Toepler and PIV. Each technique gives different kind of information. In this paper, a BOS set-up is used to study the structure of the shock pattern. A shadowgraph of a dot matrix is obtained with and without a flow. The displacement field of the dots is related to changes in the index of refraction, which can be related, through the Gladstone-Dale equation, to changes in density. Previous results with this technique were not conclusive because of the relative size of the dots compared to the diameter of the nozzle. Measurements have been taken for three different exit speeds. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  6. Aktivitas Manusia dan Distribusi Banteng (Bos Javanicus D’alton 1832 di Taman Nasional Alas Purwo

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Imron

    2013-01-01

    Full Text Available Human Activities and Distribution of Banteng (Bos Javanicus D’alton 1832 in Alas Purwo National Park This study aims to comprehend whether human activities contribute to the presence of banteng (Bos sundaicus d’Alton 1836 in the Alas Purwo National Park (APNP. We laid continuous strip line transects from centre of human activities to the direction of core area of APNP. Three locations were selected: Sadengan grazing area, Giri Salaka Hinduism praying area, and Kutorejo village; representing low to high human disturbance respectively. We collected both direct and indirect presence of banteng as well as human activities within 20 metre strip lines with 10 metre width. Data were compiled each 100 metres and analyzed with means comparison to observe difference among locations. Correlation analyses were used to assess the relation between distance from centre of human activities, human activities and banteng presence. Regression analysis was used when  significant correlations found. Our non parametric test showed that human disturbances are significantly different among sites (Kruskal Wallis Test; df 2 = 6.220, p< 0.05. In similar tendency but different manner, it is showed that the different levels of human disturbance conveyed significant difference in number of banteng’s tracks (Kruskal Wallis Test; df 2 = 18.888, p< 0.05. The distance from centre of human activities is negatively related to number of human tracks (Spearman rho; r2= -0.307 N= 64, p<0.05* and also to number of banteng’s tracks (Spearman rho, r2= -0.728 N= 30, p<0.05**. The regression analysis showed that number of human tracks explained 18.6% of total variation on number of Banteng’s tracks, while distance from centre of human activities explained 59%.

  7. Engineering disease resistant cattle.

    Science.gov (United States)

    Donovan, David M; Kerr, David E; Wall, Robert J

    2005-10-01

    Mastitis is a disease of the mammary gland caused by pathogens that find their way into the lumen of the gland through the teat canal. Mammary gland infections cost the US dairy industry approximately $2 billion dollars annually and have a similar impact in Europe. In the absence of effective treatments or breeding strategies to enhance mastitis resistance, we have created transgenic dairy cows that express lysostaphin in their mammary epithelium and secrete the antimicrobial peptide into milk. Staphylococcus aureus, a major mastitis pathogen, is exquisitely sensitive to lysostaphin. The transgenic cattle resist S. aureus mammary gland challenges, and their milk kills the bacteria, in a dose dependent manner. This first step in protecting cattle against mastitis will be followed by introduction of other genes to deal with potential resistance issues and other mastitis causing organisms. Care will be taken to avoid altering milk's nutritional and manufacturing properties. Multi-cistronic constructs may be required to achieve our goals as will other strategies possibly involving RNAi and gene targeting technology. This work demonstrates the possibility of using transgenic technology to address disease problems in agriculturally important species.

  8. Water intoxication in adult cattle.

    Science.gov (United States)

    Kawahara, Naoya; Ofuji, Sosuke; Abe, Sakae; Tanaka, Ai; Uematsu, Masami; Ogata, Yoshimi

    2016-05-01

    Water intoxication is a common disorder in calves and is usually characterized by transient hemoglobinuria. In contrast, the condition is very rare in adult cattle, with few reports on naturally occurring cases. In the present report, four female Japanese Black cattle, aged 16-25 months, showed neurological signs when they drank water following a water outage. Hemoglobinuria was not grossly observed, while severe hyponatremia was revealed by laboratory tests. Autopsy indicated cerebral edema with accumulation of serous fluid in expanded Virchow-Robin spaces. These results indicate the possibility of water intoxication associated with cerebral edema due to severe dilutional hyponatremia in adult cattle.

  9. Whole genome sequencing of Gir cattle for identifying polymorphisms and loci under selection.

    Science.gov (United States)

    Liao, Xiaoping; Peng, Fred; Forni, Selma; McLaren, David; Plastow, Graham; Stothard, Paul

    2013-10-01

    Genetic variation in Gir cattle (Bos indicus) has so far not been well characterized. In this study, we used whole genome sequencing of three Gir bulls and a pooled sample from another 11 bulls to identify polymorphisms and loci under selection. A total of 9 990 733 single nucleotide polymorphisms (SNPs) and 604 308 insertion/deletions (indels) were discovered in Gir samples, of which 62.34% and 83.62%, respectively, are previously unknown. Moreover, we detected 79 putative selective sweeps using the sequence data of the pooled sample. One of the most striking sweeps harbours several genes belonging to the cathelicidin gene family, such as CAMP, CATHL1, CATHL2, and CATHL3, which are related to pathogen- and parasite-resistance. Another interesting region harbours genes encoding mitogen-activated protein kinases, which are involved in directing cellular responses to a variety of stimuli, such as osmotic stress and heat shock. These findings are particularly interesting because Gir is resistant to hot temperatures and tropical diseases. This initial selective sweep analysis of Gir cattle has revealed a number of loci that could be important for their adaptation to tropical climates.

  10. A genome-wide scan for selection signatures in Nellore cattle.

    Science.gov (United States)

    Somavilla, A L; Sonstegard, T S; Higa, R H; Rosa, A N; Siqueira, F; Silva, L O C; Torres Júnior, R A A; Coutinho, L L; Mudadu, M A; Alencar, M M; Regitano, L C A

    2014-12-01

    Brazilian Nellore cattle (Bos indicus) have been selected for growth traits for over more than four decades. In recent years, reproductive and meat quality traits have become more important because of increasing consumption, exports and consumer demand. The identification of genome regions altered by artificial selection can potentially permit a better understanding of the biology of specific phenotypes that are useful for the development of tools designed to increase selection efficiency. Therefore, the aims of this study were to detect evidence of recent selection signatures in Nellore cattle using extended haplotype homozygosity methodology and BovineHD marker genotypes (>777,000 single nucleotide polymorphisms) as well as to identify corresponding genes underlying these signals. Thirty-one significant regions (P meat quality, fatty acid profiles and immunity. In addition, 545 genes were identified in regions harboring selection signatures. Within this group, 58 genes were associated with growth, muscle and adipose tissue metabolism, reproductive traits or the immune system. Using relative extended haplotype homozygosity to analyze high-density single nucleotide polymorphism marker data allowed for the identification of regions potentially under artificial selection pressure in the Nellore genome, which might be used to better understand autozygosity and the effects of selection on the Nellore genome.

  11. The effect of sire breed on the melting point and fatty acid composition of subcutaneous fat in steers.

    Science.gov (United States)

    Perry, D; Nicholls, P J; Thompson, J M

    1998-01-01

    Fatty acid composition and the melting point of subcutaneous fat was determined in 18 Hereford, 25 Brahman x Hereford, 22 Simmental x Hereford, and 15 Friesian x Hereford steers that were grown out on pasture at two sites and slaughtered when the mean weight of the Herefords at each site was ca. 450 kg. Multivariate and univariate analyses tested the relations of fatty acid composition, degree of saturation, and melting point with sire breed, environment, age, and carcass characteristics. Hereford and Brahman steers were fatter than the Simmental and Friesian steers. Fat from Brahman-sired steers had a melting point 2.5 degrees C lower than fat from the Bos taurus-sired steers at the same age and had a higher proportion of unsaturated fatty acids, independent of variation in carcass weight and fatness. Melting point and degree of saturation decreased as age increased. Step-down discriminant analyses identified a set of three acids (14:0, 16:0, and 17:1) that differed among sire breeds, independent of differences in melting point: the acids 14:0 and 16:0 discriminated between Brahman and Bos taurus steers and 17:1 between Hereford and Simmental and Friesian steers. Increase in fatness was associated with an increase in 17:1, but, at the same fatness, no acids discriminated among the Bos taurus-sired steers. The use of Bos indicus cattle or their crossbreeds in situations in which hard-setting fat is likely may mitigate the problem.

  12. Height-diameter model for black locust, Anatolian black pine and Taurus cedar tree species in Lakes Region

    OpenAIRE

    ÇATAL, Yılmaz

    2012-01-01

    The height of a tree is important for assessing tree volume and site index. Diameter of breast height-tree height releation equations are often used to predict the mean tree height for trees in case only diameter at breast height is measured. This study aim describes between the tree heights with diameter of breast height relationships for artificially grown black locust (Robinia pseudoacacia L.), Anatolian black pine (Pinus nigra Arnold. subsp. pallasiana (Lamb.) Holmboe) and Taurus cedar (C...

  13. The large-scale disk fraction of brown dwarfs in the Taurus cloud as measured with Spitzer

    CERN Document Server

    Monin, J -L; Pinte, C; Rebull, L; Goldsmith, P; Fukagawa, M; Ménard, F; Padgett, D; Stappelfeld, K; McCabe, C; Carey, S; Noriega-Crespo, A; Brooke, T; Huard, T; Terebey, S; Hillenbrand, L; Guedel, M

    2010-01-01

    Aims. The brown dwarf (BD) formation process has not yet been completely understood. To shed more light on the differences and similarities between star and BD formation processes, we study and compare the disk fraction among both kinds of objects over a large angular region in the Taurus cloud. In addition, we examine the spatial distribution of stars and BD relative to the underlying molecular gas Methods. In this paper, we present new and updated photometry data from the Infrared Array Camera (IRAC) aboard the Spitzer Space Telescope on 43 BDs in the Taurus cloud, and recalculate of the BD disk fraction in this region. We also useed recently available CO mm data to study the spatial distribution of stars and BDs relative to the cloud's molecular gas. Results. We find that the disk fraction among BDs in the Taurus cloud is 41 \\pm 12%, a value statistically consistent with the one among TTS (58 \\pm 9%). We find that BDs in transition from a state where they have a disk to a diskless state are rare, and we st...

  14. Organic facies characteristics of the Carboniferous Pamucakyayla Formation, western Taurus, Antalya Nappes, Kemer (Antalya/Turkey)

    Science.gov (United States)

    Bertan Gulludag, Cevdet; Altunsoy, Mehmet; Ozcelik, Orhan

    2015-04-01

    The study area is located in the western part of the Taurus Belt (SW Turkey). This region exhibits a complex structure involving two autochthonous units surrounded and imbricated with three allochthonous complexes. Antalya Nappes is a complex tectonic imbricate structure including sedimantary and ultrabasic rocks. In this study, organic facies characteristics of Carboniferous coaly units in the Pamucakyayla region (Kemer, Antalya-Turkey) were examined. The Carboniferous Pamucakyayla Formation, which is characterized by sandstone, claystone, marl and coaly units. This units includes different levels of coal seams in different thicknesses. Organic matter is composed predominantly of woody and amorphous material, with a minor contribution of planty and coaly material. Kerogen in the deposits is type II/III, as indicated by organic petrographic observations and Rock-Eval data. Total organic carbon (TOC) values are generally between 0.01 and 1.44 %, but reach 5.81 % in the formation. Tmax values vary between 446 and 451 °C and indicate mature zone (Based on the value of 0.25 % TOC). Organic facies type BC, C and CD were identified in the investigated units. Organic facies BC is related sandstoneand marl lithofacies. This facis is deposited under an anoxic water column in a fine grained clastics, where rapid deposition creates anoxia in the sediments after deposition. This facies is characterized by average values of HI around 317 (equivalent to type II kerogene), TOC around 0.02 %, and an average of S2 of 0.04 mg HC/g of rock. Organic facies C is related to sandstone, marl and coal lithofacies. This facies is characterized by average values of HI around 176 (equivalent to type III kerogene), TOC around 0.19 %, and an average of S2 of 0.03 mg HC/g of rock. The organic matter is partly oxidized, and terrestrial. Organic facies C is the "gas-prone" facies. Organic facies CD is related to limestone, marl and coal lithofacies. This facies is characterized by average values

  15. Modelos de regresión aleatoria para la estimación de funciones de covarianza, parámetros genéticos y predicción de valores genéticos en una población bovina multirracial bos indicus-bos taurus en colombia

    OpenAIRE

    Martínez, Carlos Alberto; Elzo, Mauricio; Manrique, Carlos; Grajales, Luis Fernando; Jiménez, Ariel

    2011-01-01

    En este trabajo presentamos una aplicación de modelos de regresión aleatoria (RRM) para obtener estimadores de máxima verosimilitud restringida de funciones de covarianza y predicciones del valor genético para datos longitudinales de área de ojo del lomo medidos por ultrasonido (REA) en una población bovina multirracial en Colombia. El conjunto de datos contenía 708 registros de 340 animales descendientes de 37 toros de 9 razas apareados con hembras Brahman Gris. Los modelos mixtos empleados ...

  16. Assessment of inbreeding depression in Nellore cows (Bos indicus) through high-density SNP genotypes

    Science.gov (United States)

    Inbreeding has been incriminated as a cause of decrease in reproductive performance in cattle. This negative correlation is known as ‘inbreeding depression’, and evidence supporting this hypothesis was generated from association studies between reproductive traits and estimates of inbreeding coeffic...

  17. Populations of domesticated cattle and buffalo in the Western Forest Complex of Thailand and their possible impacts on the wildlife community.

    Science.gov (United States)

    Chaiyarat, Rattanawat; Srikosamatara, Sompod

    2009-03-01

    The Western Forest Complex (WEFCOM) of Thailand is comprised of many protected areas and has one of the highest wildlife populations in the country. Populations of wildlife in the WEFCOM have decreased dramatically over recent years. Rapid economic development has resulted in the conversion of forest into agricultural and pastoral land, which has directly and indirectly impacted the wildlife community. This research aimed to evaluate populations of domesticated cattle (Bos indicus) and buffalo (Bubalus bubalis) in the WEFCOM and their possible impacts on the wildlife community. Domesticated cattle and buffalo keepers from 1561 (or 3.3%) of houses in and near WEFCOM were interviewed. The average number of animals per household was 15.6 cattle and 8.5 buffalo. Most villagers released domesticated cattle and buffalo to forage in the protected areas. This tended to have a high impact on the wildlife community in Huai Kha Khaeng Wildlife Sanctuary and Tungyai Naresuan Wildlife Sanctuary. The least impacted areas were Luam Khlong Ngu National Park, Thong Pha Phum National Park and Chaleam Ratanakosin National Park. With a high risk to the wildlife community, law enforcement should be used in combination with a certain level of co-management with local communities.

  18. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  19. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

  20. Managing bronchiolitis obliterans syndrome (BOS) and chronic lung allograft dysfunction (CLAD) in children: what does the future hold?

    Science.gov (United States)

    Snell, Gregory I; Paraskeva, Miranda; Westall, Glen P

    2013-08-01

    The success of pediatric lung transplantation continues to be limited by long-term graft dysfunction. Historically this has been characterized as an obstructive spirometric defect in the form of the bronchiolitis obliterans syndrome (BOS). It is recognized, however, that this does not reflect many of the other acknowledged etiologies of chronic lung dysfunction-noting it is the sum of the parts that contribute to respiratory morbidity and mortality after transplant. The term chronic lung allograft dysfunction (CLAD) has been coined to reflect these other entities and, in particular, a group of relatively recently described lung disorders called the restrictive allograft syndrome (RAS). RAS is characterized by a restrictive spirometric defect. Although these entities have not yet been studied in a pediatric setting their association with poor compliance, antibody-mediated rejection (AMR), and post-infectious lung damage (particularly viral) warrants attention by pediatric lung transplant teams. Current therapy for the BOS subset of CLAD is otherwise limited to changing immunosuppressants and avoiding excessive infectious risk by avoiding over-immunosuppression. Long-term macrolide therapy in lung transplantation is not of proven efficacy. Reviewing previous BOS studies to explore restrictive spirometric cases and joint projects via groups like the International Pediatric Lung Transplant Collaborative will be the way forward to solve this pressing problem.

  1. Molecular line study of the very young protostar IRAM 04191 in Taurus Infall, rotation, and outflow

    CERN Document Server

    Belloche, A; Despois, D; Blinder, S M

    2002-01-01

    We present a detailed millimeter line study of the circumstellar environment of the low-luminosity Class 0 protostar IRAM 04191+1522 in the Taurus molecular cloud. New line observations demonstrate that the ~14000 AU radius protostellar envelope is undergoing both extended infall and fast, differential rotation. Radiative transfer modeling of multitransition CS and C34S maps indicate an infall velocity v_inf ~ 0.15 km/s at r ~ 1500 AU and v_inf ~ 0.1 km/s up to r ~ 11000 AU, as well as a rotational angular velocity Omega ~ 3.9 x 10^{-13} rad/s, strongly decreasing with radius beyond 3500 AU down to a value Omega ~ 1.5-3 x 10^{-14} rad/s at ~ 11000 AU. Two distinct regions, which differ in both their infall and their rotation properties, therefore seem to stand out: the inner part of the envelope (r ~< 2000-4000 AU) is rapidly collapsing and rotating, while the outer part undergoes only moderate infall/contraction and slower rotation. These contrasted features suggest that angular momentum is conserved in t...

  2. Chemistry in Disks X: The Molecular Content of Proto-planetary Disks in Taurus

    CERN Document Server

    Guilloteau, S; Dutrey, A; Chapillon, E; Wakelam, V; Piétu, V; Di Folco, E; Semenov, D; Henning, Th

    2016-01-01

    (abridged) We used the IRAM 30-m to perform a sensitive wideband survey of 30 protoplanetary disks in the Taurus Auriga region. We simultaneously observed HCO$^+$(3-2), HCN(3-2), C$_2$H(3-2), CS(5-4), and two transitions of SO. We combine the results with a previous survey which observed $^{13}$CO (2-1), CN(2-1), two o-H$_2$CO lines and one of SO. We use available interferometric data to derive excitation temperatures of CN and C$_2$H in several sources. We determine characteristic sizes of the gas disks and column densities of all molecules using a parametric power-law disk model. Our study is mostly sensitive to molecules at 200-400 au from the stars. We compare the derived column densities to the predictions of an extensive gas-grain chemical disk model, under conditions representative of T Tauri disks. This survey provides 20 new detections of HCO$^+$ in disks, 18 in HCN, 11 in C$_2$H, 8 in CS and 4 in SO. HCO$^+$ is detected in almost all sources, and its J=3-2 line is essentially optically thick, provid...

  3. Determining the 3D Subsurface Density Structure of Taurus Littrow Valley Using Apollo 17 Gravity Data

    Science.gov (United States)

    Urbancic, N.; Ghent, R.; Stanley, S,; Johnson, C. L.; Carroll, K. A.; Hatch, D.; Williamson, M. C.; Garry, W. B.; Talwani, M.

    2016-01-01

    Surface gravity surveys can detect subsurface density variations that can reveal subsurface geologic features. In 1972, the Apollo 17 (A17) mission conducted the Traverse Gravimeter Experiment (TGE) using a gravimeter that measured the local gravity field near Taurus Littrow Valley (TLV), located on the south-eastern rim of the Serenitatis basin. TLV is hypothesized to be a basaltfilled radial graben resulting from the impact that formed Mare Serenitatis. It is bounded by both the North and South Massifs (NM and SM) as well as other smaller mountains to the East that are thought to be mainly composed of brecciated highland material. The TGE is the first and only successful gravity survey on the surface of the Moon. Other more recent satellite surveys, such as NASA's Gravity Recovery and Interior Laboratory (GRAIL) mission (2011- 2012), have produced the best global gravity field to date (approx. 13km resolution). However, these satellite surveys are not sensitive enough to detect fine-scale (structures. This underscores the value of the data collected at the surface by A17. In the original analysis of the data a 2D forward-modelling approach was used to derive a thickness of the subsurface basalt layer of 1.0 km by assuming a simple flat-faced rectangular geometry and using densities derived from Apollo lunar samples. We are investigating whether modern 3D modelling techniques in combination with high-resolution topographical and image datasets can reveal additional fine-scale subsurface structure in TLV.

  4. The relation between gas and dust in the Taurus Molecular Cloud

    CERN Document Server

    Pineda, Jorge L; Chapman, Nicholas; Snell, Ronald L; Li, Di; Cambresy, Laurent; Brunt, Chris

    2010-01-01

    (abridged) We report a study of the relation between dust and gas over a 100deg^2 area in the Taurus molecular cloud. We compare the H2 column density derived from dust extinction with the CO column density derived from the 12CO and 13CO J= 1-0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200", corresponding to 0.14pc at a distance of 140pc. We find that the relation between visual extinction Av and N(CO) is linear between Av~3 and 10 mag in the region associated with the B213--L1495 filament. In other regions the linear relation is flattened for Av > 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ~30--70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO2 ices and Av, we find a linear relationship between the column of carbon mon...

  5. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal

    Science.gov (United States)

    Chapman, Demian D.; Wintner, Sabine P.; Abercrombie, Debra L.; Ashe, Jimiane; Bernard, Andrea M.; Shivji, Mahmood S.; Feldheim, Kevin A.

    2013-01-01

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size (‘hatchlings’) consume all of their smaller siblings during gestation (‘embryonic cannibalism’ or EC). If females commonly mate with multiple males (‘behavioural polyandry’) then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system (‘genetic monogamy’). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species. PMID:23637391

  6. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal.

    Science.gov (United States)

    Chapman, Demian D; Wintner, Sabine P; Abercrombie, Debra L; Ashe, Jimiane; Bernard, Andrea M; Shivji, Mahmood S; Feldheim, Kevin A

    2013-06-23

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size ('hatchlings') consume all of their smaller siblings during gestation ('embryonic cannibalism' or EC). If females commonly mate with multiple males ('behavioural polyandry') then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system ('genetic monogamy'). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species.

  7. SMA and CARMA observations of young brown dwarfs in ρ Ophiuchi and Taurus

    Directory of Open Access Journals (Sweden)

    Lee C.-F.

    2011-07-01

    Full Text Available Molecular outflows provide vital information about the earliest stages in the birth of stars, studying the molecular outflow properties is therefore crucial for understanding how stars form. Brown dwarfs with masses between that of stars and planets are not massive enough to maintain stable hydrogen-burning fusion reactions during most of their lifetime. Their origins are subject to much debate in recent literature because their masses are far below the typical mass where core collapse is expected to occur. Based on Submillimeter Array (SMA and Combined Array for Research in Millimeter-wave Astronomy (CARMA observations, we present the first detections of bipolar molecular outflows from young brown dwarfs in ρ Ophiuchi and Taurus. Our results demonstrate that the bipolar molecular outflow operates down to brown dwarf masses, occurring in brown dwarfs as a scaled-down version of the universal process seen in young low-mass stars. This demonstrates that brown dwarfs and low-mass stars likely share the same formation mechanism.

  8. Intralocus tactical conflict: genetic correlations between fighters and sneakers of the dung beetle Onthophagus taurus.

    Science.gov (United States)

    Buzatto, B A; Kotiaho, J S; Tomkins, J L; Simmons, L W

    2015-03-01

    Males and females differ in their phenotypic optima for many traits, and as the majority of genes are expressed in both sexes, some alleles can be beneficial to one sex but harmful to the other (intralocus sexual conflict; ISC). ISC theory has recently been extended to intrasexual dimorphisms, where certain alleles may have opposite effects on the fitness of males of different morphs that employ alternative reproductive tactics (intralocus tactical conflict; ITC). Here, we use a half-sib breeding design to investigate the genetic basis for ISC and ITC in the dung beetle Onthophagus taurus. We found positive heritabilities and intersexual genetic correlations for almost all traits investigated. Next, we calculated the intrasexual genetic correlation between males of different morphs for horn length, a sexually selected trait, and compared it to intrasexual correlations for naturally selected traits in both sexes. Intrasexual genetic correlations did not differ significantly between the sexes or between naturally and sexually selected traits, failing to support the hypothesis that horns present a reduction of intrasexual genetic correlations due to ITC. We discuss the implications for the idea of developmental reprogramming between male morphs and emphasize the importance of genetic correlations as constraints for the evolution of dimorphisms.

  9. AGE ESTIMATION AND MASS FUNCTIONS OF TTAURI STARS IN THE TAURUS AURIGA MOLECULAR CLOUD

    Directory of Open Access Journals (Sweden)

    I. Küçük

    2010-01-01

    Full Text Available En este trabajo se han calculado las funciones de masas en la actualidad (PDMF de las estrellas T-Tauri (TTS que est n en la fase evolutiva de presecuencia principal (PMS en el complejo de nubes moleculares de Taurus-Auriga. Con este n, mediante la aplicaci n de nuestro c digo modi cado de evoluci n estelar se utilizan modelos estelares en el intervalo de masa de 0:1 - 2:5 M para determinar la masa y la masa de edad de las TTS. La funci n de la masa obtenida se compara con la funci n de masa de Miller & Scalo (1979. La edad encontrada para las TTS es de alrededor de 1-3x10 6 a os y la funci n de masa es de aproximadamente 0.644-+0.348. De estos resultados, hemos calculado la tasa de formaci n estelar como de alrededor de 1.3 x 10-7 M a o-1 en esta regi n.

  10. A New Method for Constraining Molecular Cloud Thickness: A study of Taurus, Perseus and Ophiuchus

    CERN Document Server

    Qian, Lei; Offner, Stella; Pan, Zhichen

    2015-01-01

    The core velocity dispersion (CVD) is a potentially useful tool for studying the turbulent velocity field of molecular clouds. CVD is based on centroid velocities of dense gas clumps, thus is less prone to density fluctuation and reflects more directly the cloud velocity field. Prior work demonstrated that the Taurus molecular cloud CVD resembles the well-known Larson's linewidth-size relation of molecular clouds. In this work, we studied the dependence of the CVD on the line-of-sight thickness of molecular clouds, a quantity which cannot be measured by direct means. We produced a simple statistical model of cores within clouds and analyzed the CVD of a variety of hydrodynamical simulations. We show that the relation between the CVD and the 2D projected separation of cores ($L_{2D}$) is sensitive to the cloud thickness. When the cloud is thin, the index of CVD-$L_{2D}$ relation ($\\gamma$ in the relation CVD$\\sim L_{2D}^{\\gamma}$) reflects the underlying energy spectrum ($E(k)\\sim k^{-\\beta}$) in that $\\gamma\\...

  11. Variation in dust properties in a dense filament of the Taurus molecular complex (L1506)

    CERN Document Server

    Ysard, Nathalie; Ristorcelli, Isabelle; Juvela, Mika; Pagani, Laurent; Konyves, Vera; Spencer, Locke; White, Glenn; Zavagno, Annie

    2013-01-01

    We observed the L1506 filament, which is located in the Taurus molecular complex, with the Herschel PACS and SPIRE instruments. Our aim is to prove the variation in grain properties along the entire length of the filament. In particular, we want to determine above which gas density this variation arises and what changes in the grain optical properties/size distribution are required. We use the 3D radiative transfer code CRT, coupled to the dust emission and extinction code DustEM, to model the emission and extinction of the dense filament. We test a range of optical properties and size distributions for the grains: dust of the diffuse interstellar medium (interstellar PAHs and amorphous carbons and silicates) and both compact and fluffy aggregates. We find that the grain opacity has to increase across the filament to fit simultaneously the near-IR extinction and Herschel emission profiles of L1506. We interpret this change to be a consequence of the coagulation of dust grains to form fluffy aggregates. Grains...

  12. Far-ultraviolet Observations of the Taurus-Perseus-Auriga Complex

    CERN Document Server

    Lim, Tae-Ho; Seon, Kwang-Il

    2013-01-01

    We have constructed a far-ultraviolet (FUV) continuum map of the Taurus-Auriga-Perseus complex, one of the largest local associations of dark clouds, by merging the two data sets of GALEX and FIMS, which made observations at similar wavelengths. The FUV intensity varies significantly across the whole region, but the diffuse FUV continuum is dominated by dust scattering of stellar photons. A diffuse FUV background of $\\sim$1000 CU is observed, part of which may be attributable to the scattered photons of foreground FUV light, located in front of the thick clouds. The fluorescent emission of molecular hydrogen constitutes $\\sim$10% of the total FUV intensity throughout the region, generally proportional to the local continuum level. We have developed a Monte Carlo radiative transfer code and applied it to the present clouds complex to obtain the optical properties of dust grains and the geometrical structures of the clouds. The albedo and the phase function asymmetry factor were estimated to be $0.42^{+0.05}_{-...

  13. Rotationally-supported disks around Class I sources in Taurus: disk formation constraints

    CERN Document Server

    Harsono, Daniel; van Dishoeck, Ewine F; Hogerheijde, Michiel R; Bruderer, Simon; Persson, Magnus V; Mottram, Joseph C

    2013-01-01

    (Abridged) Disks are observed around pre-main sequence stars, but how and when they form is still heavily debated. While disks around young stellar objects have been identified through thermal dust emission, spatially and spectrally resolved molecular line observations are needed to determine their nature. We present subarcsecond observations of dust and gas toward four Class I low-mass young stellar objects in Taurus. The 13CO and C18O J=2-1 transitions at 220 GHz were observed with the Plateau de Bure Interferometer at a spatial resolution of ~0.8'' and analyzed using uv-space position velocity diagrams to determine the nature of their observed velocity radient. Rotationally supported disks (RSDs) are detected around 3 of the 4 Class I sources studied. The derived masses identify them as Stage I objects; i.e., their stellar mass is higher than their envelope and disk masses. The outer radii of the Keplerian disks toward our sample of Class I sources are 100 AU around these sources are dominated by infallin...

  14. Accretion discs as regulators of stellar angular momentum evolution in the ONC and Taurus-Auriga

    CERN Document Server

    Davies, Claire L; Greaves, Jane S

    2014-01-01

    In light of recent substantial updates to spectral type estimations and newly established intrinsic colours, effective temperatures, and bolometric corrections for pre-main sequence (PMS) stars, we re-address the theory of accretion-disc regulated stellar angular momentum (AM) evolution. We report on the compilation of a consistent sample of fully convective stars within two of the most well-studied and youngest, nearby regions of star formation: the Orion Nebula Cluster (ONC) and Taurus-Auriga. We calculate the average specific stellar AM ($j_{\\star}$) assuming solid body rotation, using surface rotation periods gathered from the literature and new estimates of stellar radii and ages. We use published Spitzer IRAC fluxes to classify our stars as Class II or Class III and compare their $j_{\\star}$ evolution. Our results suggest that disc dispersal is a rapid process that occurs at a variety of ages. We find a consistent $j_{\\star}$ reduction rate between the Class II and Class III PMS stars which we interpret...

  15. Properties of Starless and Prestellar Cores in Taurus Revealed by Herschel SPIRE/PACS Imaging

    CERN Document Server

    Marsh, K A; Palmeirim, P; André, Ph; Kirk, J; Stamatellos, D; Ward-Thompson, D; Roy, A; Bontemps, S; Di Francesco, J; Elia, D; Hill, T; Konyves, V; Motte, F; Nguyen-Luong, Q; Peretto, N; Pezzuto, S; Rivera-Ingraham, A; Schneider, N; Spinoglio, L; White, G

    2014-01-01

    The density and temperature structures of dense cores in the L1495 cloud of the Taurus star-forming region are investigated using Herschel SPIRE and PACS images in the 70 $\\mu$m, 160 $\\mu$m, 250 $\\mu$m, 350 $\\mu$m and 500 $\\mu$m continuum bands. A sample consisting of 20 cores, selected using spectral and spatial criteria, is analysed using a new maximum likelihood technique, COREFIT, which takes full account of the instrumental point spread functions. We obtain central dust temperatures, $T_0$, in the range 6-12 K and find that, in the majority of cases, the radial density falloff at large radial distances is consistent with the $r^{-2}$ variation expected for Bonnor-Ebert spheres. Two of our cores exhibit a significantly steeper falloff, however, and since both appear to be gravitationally unstable, such behaviour may have implications for collapse models. We find a strong negative correlation between $T_0$ and peak column density, as expected if the dust is heated predominantly by the interstellar radiatio...

  16. X-ray deficiency on strong accreting T Tauri stars - Comparing Orion with Taurus

    CERN Document Server

    Bustamante, Ignacio; Bouy, Hervé; Manara, Carlo; Ribas, Álvaro; Riviere-Marichalar, Pablo

    2015-01-01

    Depending on whether a T Tauri star accretes material from its circumstellar disk or not, different X-ray emission properties can be found. The accretion shocks produce cool heating of the plasma, contributing to the soft X-ray emission from the star. Using X-ray data from the Chandra Orion Ultra-deep Project and accretion rates that were obtained with the Hubble Space Telescope/WFPC2 photometric measurements in the Orion Nebula Cluster, we studied the relation between the accretion processes and the X-ray emissions of a coherent sample of T Tauri sources in the region. We performed regression and correlation analyses of our sample of T Tauri stars between the X-ray parameters, stellar properties, and the accretion measurements. We find that a clear anti-correlation is present between the residual X-ray luminosity and the accretion rates in our samples in Orion that is consistent with that found on the XMM-Newton Extended Survey of the Taurus molecular cloud (XEST) study. We provide a catalog with X-ray lumin...

  17. Evidence for dust evolution within the Taurus Complex from Spitzer images

    CERN Document Server

    Flagey, N; Boulanger, F; Carey, S J; Brooke, T Y; Falgarone, E; Huard, T L; McCabe, C E; Miville-Deschênes, M A; Padgett, D L; Paladini, R; Rebull, L M

    2009-01-01

    We present Spitzer images of the Taurus Complex (TC) and take advantage of the sensitivity and spatial resolution of the observations to characterize the diffuse IR emission across the cloud. This work highlights evidence of dust evolution within the translucent sections of the archetype reference for studies of quiescent molecular clouds. We combine Spitzer 160 um and IRAS 100 um observations to produce a dust temperature map and a far-IR dust opacity map at 5' resolution. The average dust temperature is about 14.5K with a dispersion of +/-1K across the cloud. The far-IR dust opacity is a factor 2 larger than the average value for the diffuse ISM. This opacity increase and the attenuation of the radiation field (RF) both contribute to account for the lower emission temperature of the large grains. The structure of the TC significantly changes in the mid-IR images that trace emission from PAHs and VSGs. We focus our analysis of the mid-IR emission to a range of ecliptic latitudes where the zodiacal light resi...

  18. A GMRT survey of regions towards the Taurus Molecular Cloud at 323 and 608 MHz

    CERN Document Server

    Ainsworth, Rachael E; Green, David A; Scaife, Anna M M; Ray, Tom P

    2016-01-01

    We present observations of three active sites of star formation in the Taurus Molecular Cloud complex taken at 323 and 608 MHz (90 and 50 cm, respectively) with the Giant Metrewave Radio Telescope (GMRT). Three pointings were observed as part of a pathfinder project, targeted at the young stellar objects (YSOs) L1551 IRS 5, T Tau and DG Tau (the results for these target sources were presented in a previous paper). In this paper, we search for other YSOs and present a survey comprising of all three fields; a by-product of the large instantaneous field of view of the GMRT. The resolution of the survey is of order 10 arcsec and the best rms noise at the centre of each pointing is of order $100\\,\\mu$Jy beam$^{-1}$ at 323 MHz and $50\\,\\mu$Jy beam$^{-1}$ at 608 MHz. We present a catalogue of 1815 and 687 field sources detected above $5\\,\\sigma_{\\rm rms}$ at 323 and 608 MHz, respectively. A total of 440 sources were detected at both frequencies, corresponding to a total unique source count of 2062 sources. We compar...

  19. FIRST ISOLATION OF TENACIBACULUM MARITIMUM IN A CAPTIVE SAND TIGER SHARK (CARCHARIAS TAURUS).

    Science.gov (United States)

    Florio, Daniela; Gridelli, Stefano; Fioravanti, Maria Letizia; Zanoni, Renato Giulio

    2016-03-01

    This report describes a case of the first isolation of Tenacibaculum maritimum from a captive-bred adult female sand tiger shark (Carcharias taurus) housed at the Cattolica Aquarium (Italy). The animal showed, between the second dorsal fin and the precaudal pit, skin lesions characterized by the presence of abundant whitish necrotic tissue. Through routine bacteriological examination, a bacterium was isolated from a skin lesion and subsequently identified as T. maritimum by phenotypic characters and species-specific polymerase chain reaction. The antimicrobial sensitivity of the isolated strain was evaluated for 11 antimicrobial agents by disk diffusion method. Antibiotic therapy was conducted with enrofloxacin at 10 mg kg(-1) i.m. on alternate days for 10 days. One month after the end of treatment skin lesions showed complete resolution and the shark recovered completely. The case presented here represents the first report of infection by T. maritimum in a sand tiger shark and highlights the potential pathogenic role of this microorganism in elasmobranchs kept in an aquarium.

  20. Classifying the embedded young stellar population in Perseus and Taurus & the LOMASS database

    CERN Document Server

    Carney, M T; Mottram, J C; van Dishoeck, E F; Ramchandani, J; Jørgensen, J K

    2016-01-01

    Context. The classification of young stellar objects (YSOs) is typically done using the infrared spectral slope or bolometric temperature, but either can result in contamination of samples. More accurate methods to determine the evolutionary stage of YSOs will improve the reliability of statistics for the embedded YSO population and provide more robust stage lifetimes. Aims. We aim to separate the truly embedded YSOs from more evolved sources. Methods. Maps of HCO+ J=4-3 and C18O J=3-2 were observed with HARP on the James Clerk Maxwell Telescope (JCMT) for a sample of 56 candidate YSOs in Perseus and Taurus in order to characterize emission from high (column) density gas. These are supplemented with archival dust continuum maps observed with SCUBA on the JCMT and Herschel PACS to compare the morphology of the gas and dust in the protostellar envelopes. The spatial concentration of HCO+ J=4-3 and 850 micron dust emission are used to classify the embedded nature of YSOs. Results. Approximately 30% of Class 0+I ...

  1. Classifying the embedded young stellar population in Perseus and Taurus and the LOMASS database

    DEFF Research Database (Denmark)

    Carney, M. T.; Ylldlz, U. A.; Mottram, J. C.;

    2016-01-01

    Context. The classification of young stellar objects (YSOs) is typically done using the infrared spectral slope or bolometric temperature, but either can result in contamination of samples. More accurate methods to determine the evolutionary stage of YSOs will improve the reliability of statistic....... Current estimates (0.54 Myr) may overpredict the Stage I lifetime on the order of 30%, resulting in timescales down to 0.38 Myr for the embedded phase....... for the embedded YSO population and provide more robust stage lifetimes. Aims. We aim to separate the truly embedded YSOs from more evolved sources. Methods. Maps of HCO+J = 4-3 and C18O J = 3-2 were observed with HARP on the James Clerk Maxwell Telescope (JCMT) for a sample of 56 candidate YSOs in Perseus...... and Taurus in order to characterize the presence and morphology of emission from high density (ncrit > 106 cm-3) and high column density gas, respectively. These are supplemented with archival dust continuum maps observed with SCUBA on the JCMT and Herschel PACS to compare the morphology of the gas and dust...

  2. Two confirmed class I very low-mass objects in Taurus

    CERN Document Server

    Dang-Duc, C; Dao-Van, D T

    2016-01-01

    [GKH94] 41 and IRAS 04191+1523B were previously identified to be proto-brown dwarf candidates in Taurus. [GKH94] 41 was classified to be a class I object. The dereddened spectral energy distribution of the source was later found to be suggestive of a class II object. IRAS 04191+1523B is a class I object that is the secondary component of a binary. We determine the evolutionary stage of [GKH94] 41 and estimate the final masses of the two proto-brown dwarf candidates. We used archive millimeter observations to produce continuum maps and collected data from the literature to construct the spectral energy distribution of the targets. Our continuum maps revealed that both [GKH94] 41 and IRAS 04191+1523B are surrounded by envelopes. This provides direct evidence that [GKH94] 41 is a class I object, not class II, as previously classified. For IRAS 04191+1523B, our continuum map spatially resolved the binary. Our estimated final masses are below 49$^{+56}_{-27}$ $M_{\\rm J}$ and 75$^{+40}_{-26}$ $M_{\\rm J}$ for [GKH94...

  3. Crystalline silicates and dust processing in the protoplanetary disks of the Taurus young cluster

    CERN Document Server

    Watson, Dan M; Furlan, Elise; Bohac, J; Sargent, B; Forrest, W J; Calvet, Nuria; Hartmann, Lee; Nordhaus, Jason T; Green, Joel D; Kim, K H; Sloan, G C; Chen, C H; Keller, L D; dAlessio, Paola; Najita, J; Uchida, Keven I; Houck, J R

    2007-01-01

    We characterize the crystalline silicate content and spatial distribution of small dust grains in a large sample of protoplanetary disks in the Taurus-Auriga young cluster, using Spitzer Space Telescope mid-infrared spectra. In turn we use the results to analyze the evolution of structure and composition of these 1-2 Myr-old disks around Solar- and later-type young stars, and test the standard models of dust processing which result in the conversion of originally amorphous dust into minerals. We find strong evidence of evolution of the dust crystalline mass fraction in parallel with that of the structure of the disks, in the sense that increasing crystalline mass fraction is strongly linked to dust settling to the disk midplane. We also confirm that the crystalline silicates are confined to small radii, r < 10 AU. However, we see no significant correlation of crystalline mass fraction with stellar mass or luminosity, stellar accretion rate, disk mass, or disk/star mass ratio, as would be expected in the st...

  4. Herschel view of the Taurus B211/3 filament and striations: Evidence of filamentary growth?

    CERN Document Server

    Palmeirim, P; Kirk, J; Ward-Thompson, D; Arzoumanian, D; Könyves, V; Didelon, P; Schneider, N; Benedettini, M; Bontemps, S; Di Francesco, J; Elia, D; Griffin, M; Hennemann, M; Hill, T; Martin, P G; Men'shchikov, A; Molinari, S; Motte, F; Nutter, D; Peretto, N; Pezzuto, S; Roy, A; Rygl, K L J; Spinoglio, L; White, G

    2012-01-01

    We present first results from the Herschel Gould Belt survey for the B211/L1495 region in the Taurus molecular cloud. Thanks to their high sensitivity and dynamic range, the Herschel images reveal the structure of the dense, star-forming filament B211 with unprecedented detail, along with the presence of striations perpendicular to the filament and generally oriented along the magnetic field direction as traced by optical polarization vectors. Based on the column density and dust temperature maps derived from the Herschel data, we find that the radial density profile of the B211 filament approaches a power-law behavior {\\rho} {\\propto} r^(-2.0{\\pm}0.4) at large radii and that the temperature profile exhibits a marked drop at small radii. The observed density and temperature profiles of the B211 filament are in good agreement with a theoretical model of a cylindrical filament undergoing gravitational contraction with a polytropic equation of state: P {\\propto} {\\rho}^{\\gamma} and T {\\propto} {\\rho}^({\\gamma}-1...

  5. Origins and genetic diversity of New World Creole cattle: inferences from mitochondrial and Y chromosome polymorphisms.

    Science.gov (United States)

    Ginja, C; Penedo, M C T; Melucci, L; Quiroz, J; Martínez López, O R; Revidatti, M A; Martínez-Martínez, A; Delgado, J V; Gama, L T

    2010-04-01

    The ancestry of New World cattle was investigated through the analysis of mitochondrial and Y chromosome variation in Creoles from Argentina, Brazil, Mexico, Paraguay and the United States of America. Breeds that influenced the Creoles, such as Iberian native, British and Zebu, were also studied. Creoles showed high mtDNA diversity (H = 0.984 +/- 0.003) with a total of 78 haplotypes, and the European T3 matriline was the most common (72.1%). The African T1a haplogroup was detected (14.6%), as well as the ancestral African-derived AA matriline (11.9%), which was absent in the Iberian breeds. Genetic proximity among Creoles, Iberian and Atlantic Islands breeds was inferred through their sharing of mtDNA haplotypes. Y-haplotype diversity in Creoles was high (H = 0.779 +/- 0.019), with several Y1, Y2 and Y3 haplotypes represented. Iberian patrilines in Creoles were more difficult to infer and were reflected by the presence of H3Y1 and H6Y2. Y-haplotypes confirmed crossbreeding with British cattle, mainly of Hereford with Pampa Chaqueño and Texas Longhorn. Male-mediated Bos indicus introgression into Creoles was found in all populations, except Argentino1 (herd book registered) and Pampa Chaqueño. The detection of the distinct H22Y3 patriline with the INRA189-90 allele in Caracú suggests introduction of bulls directly from West Africa. Further studies of Spanish and African breeds are necessary to elucidate the origins of Creole cattle, and determine the exact source of their African lineages.

  6. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

    Directory of Open Access Journals (Sweden)

    M.S. Khairiah

    2012-10-01

    Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

  7. Assessment of Ruminal Bacterial and Archaeal Community Structure in Yak (Bos grunniens)

    Science.gov (United States)

    Zhou, Zhenming; Fang, Lei; Meng, Qingxiang; Li, Shengli; Chai, Shatuo; Liu, Shujie; Schonewille, Jan Thomas

    2017-01-01

    The aim of this study was to determine the microbial community composition in the rumen of yaks under different feeding regimes. Microbial communities were assessed by sequencing bacterial and archaeal 16S ribosomal RNA gene fragments obtained from yaks (Bos grunniens) from Qinghai-Tibetan Plateau, China. Samples were obtained from 14 animals allocated to either pasture grazing (Graze), a grazing and supplementary feeding regime (GSF), or an indoor feeding regime (Feed). The predominant bacterial phyla across feeding regimes were Bacteroidetes (51.06%) and Firmicutes (32.73%). At genus level, 25 genera were shared across all samples. The relative abundance of Prevotella in the graze and GSF regime group were significantly higher than that in the feed regime group. Meanwhile, the relative abundance of Ruminococcus was lower in the graze group than the feed and GSF regime groups. The most abundant archaeal phylum was Euryarchaeota, which accounted for 99.67% of the sequences. Ten genera were detected across feeding regimes, seven genera were shared by all samples, and the most abundant was genus Methanobrevibacter (91.60%). The relative abundance of the most detected genera were similar across feeding regime groups. Our results suggest that the ruminal bacterial community structure differs across yak feeding regimes while the archaeal community structures are largely similar. PMID:28223980

  8. The cattle crush strategy: trading opportunities for cattle producers The cattle crush strategy: trading opportunities for cattle producers

    Directory of Open Access Journals (Sweden)

    Nicolás Acevedo Vélez

    2007-04-01

    Full Text Available This research shows that it is possible for U.S. cattle feeders to obtain additional profits if a consistent technical strategy for trading is applied to the cattle crush spread. However, when trading costs are introduced, the likelihood of obtaining profit from trading the crush reduces considerably. It also shows that the level of gains from the cattle crush is related to the month the cattle are marketed. When the crush is used as a hedging strategy it decreases the profit from the feeding operation and reduces the volatility of those returns, helping producers to transfer part of the price risk associated with their production. To provide evidence of these findings, this study utilizes daily prices for 1995 to 2006 of the futures contracts of corn, feeder and live cattle to construct the daily cattle crush spread for two different combinations of futures contracts traded in the Chicago Board of Trade and Chicago Mercantile Exchange. These contract combinations suppose that cattle are fed in feedlots for 170 days before being marketed in April and in October. Two different scenarios are also evaluated using the cattle crush spread: one in which the crush is employed as a pre-placement hedging tool and another in which the crush is used as a post-placement hedging method.En este estudio se muestra que es posible para un productor de ganado de carne en EE.UU obtener utilidades adicionales cuando estrategias de operación en el mercado financiero de futuros de Chicago son utilizadas (i.e. la estrategia “cattle crush”. No obstante, los costos de transacción presentes reduce la probabilidad de obtener utilidades mediante la estrategia de análisis técnico. También se muestra que el nivel de ganancia derivado del uso del “cattle crush” está relacionado con el ciclo ganadero en el cual se realice la operación. Cuando el “cattle crush” se utiliza como alternativa para cubrir riesgo, se reduce considerablemente la volatilidad de los

  9. 7 CFR 1260.118 - Cattle.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Cattle. 1260.118 Section 1260.118 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Promotion and Research Order Definitions § 1260.118 Cattle. Cattle means live domesticated bovine...

  10. Improving smallholder food security through investigations of carcass composition and beef marketing of buffalo and cattle in northern Lao PDR.

    Science.gov (United States)

    Nampanya, Sonevilay; Khounsy, Syseng; Phonvisay, Aloun; Bush, Russell David; Windsor, Peter Andrew

    2015-04-01

    This study determined the carcass composition of Lao indigenous buffalo (Bubalus bubalis) and cattle (Bos indicus), then examined trends in bovine meat marketing following review of records of beef production and prices in the two major cities of Luang Prabang (LPB) and Xieng Khoung (XK) provinces in northern Laos. Samples from 41 buffalo and 81 cattle (n = 122) were collected from animals slaughtered in May-June 2014, with live weights, carcass weights and other carcass-related variables collected. The animals were classified into four age cohort groups (4, 4-6 and >6 years) with quantitative and dichotomous qualitative traits determined. There were significant differences in buffalo and cattle predicted mean carcass weights between age classification categories (p = 0.003 and 0.001) but not in dressing percentages (p = 0.1 and 0.1). The carcass weight of buffalo was 104 (±23.1)-176 (±12.0) kg compared to 65 (±8.7)-84 (±6.5) kg of cattle, with dressing percentages of 37-40 and 39-42 %, respectively. Despite an average bovine meat price increase of 42-48 % between 2011 and 2013, there was a reduction in the numbers of large ruminants slaughtered in the surveyed cities of LPB (11 %) and XK (7 %), with bovine meat availability per person of 5.2-6.6 kg (LPB) and 3.0-3.8 kg (XK). Improving the sustainability of the bovine meat supply in Laos requires a systems approach involving improvements to animal health and production, livestock marketing, plus the critical development of improved slaughterhouse facilities enabling a meat-processing sector to emerge. This development pathway is of particular importance for building the capacity of Laos to reduce food insecurity and alleviate the poverty of its largely rural smallholder community.

  11. Ultrastructure of spermatozoa of Onthophagus taurus (Coleoptera, Scarabaeidae) exhibits heritable variation

    Science.gov (United States)

    Werner, Michael; Simmons, Leigh W.

    2011-03-01

    Sperm competition is thought to be an important selective pressure shaping sperm form and function. However, few studies have moved beyond gross examinations of sperm morphology. Sperm length is subject to sexual selection via sperm competition in the scarab beetle Onthophagus taurus. Here, the structure and ultrastructure of spermatozoa in this species were investigated using light and electron microscopy. Spermatozoa were found to be filiform, measuring about 1,200 mm in length. The sperm head consists of a three-layered acrosome and a nuclear region bearing the anterior extension of the centriole adjunct. Acrosome and nuclear regions are bilaterally symmetric, with their axes of symmetry being orthogonal to each other. Head and flagellar structures are connected by a well-developed centriole adjunct. The sperm heads are asymmetrically surrounded by accessory material and embedded into the cytoplasm of the spermatocyst cell. The accessory material is produced inside the spermatids and then transferred to the outside due to a new membrane formed around the sperm's organelles. The old spermatid membrane separates the accessory material from the cyst cell. The flagellum contains a 9+9+2 axoneme, two accessory bodies, and two mitochondrial derivatives of unequal size. The major mitochondrial derivative is significantly larger than the minor one. The axoneme is arranged in a sinusoidal manner parallel along the major mitochondrial derivative. The spermatozoa show no progressive motility when released in buffer solution which is likely to be the result of the flagellar arrangement and the structure of the major mitochondrial derivative. The cross-sectional area of the minor and the major mitochondrial derivatives show different patterns of genetic variation. The data provide the first estimates of genetic variation in sperm ultrastructure for any species, and give evidence for the persistence of genetic variation in ultrastructure required for the rapid and divergent

  12. Protoplanetary disks in Taurus: Probing the role of multiplicity with ALMA observations

    Science.gov (United States)

    Laos, Stefan; Akeson, Rachel L.; Jensen, Eric L. N.

    2017-01-01

    We present results from an ALMA survey of single and multiple young systems in Taurus designed to probe how protoplanetary disk mass depends on both stellar mass and multiplicity. In observations taken in Cycles 0 and 2, we detect over 25 new disks. These detections include disks around stars in both single and multiple systems and are predominantly around lower mass stars with spectral types from M0 to M6. Combined with previous detections, these observations reveal a wide range of disk mass around both primary and companion stars, and allow us to test if the relation previously seen between disk and stellar mass continues at lower stellar masses. We find that within multiple systems the ratio of primary to secondary stellar mass is not correlated with the ratio of primary to secondary disk mass. In some cases, the secondary star hosts the more massive disk, contrary to theoretical predictions. We will discuss the implications of these results for the process of planet formation in multiple systems.This work makes use of the following ALMA data: ADS/JAO.ALMA#2011.0.00150.S. and ADS/JAO.ALMA#2013.1.00105.S. ALMA is a partnership of ESO (representing its member states), NSF (USA) and NINS (Japan), together with NRC (Canada) and NSC and ASIAA (Taiwan), in cooperation with the Republic of Chile. The Joint ALMA Observatory is operated by ESO, AUI/NRAO and NAOJ. The National Radio Astronomy Observatory is a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

  13. Grey Nurse Shark ( Carcharias taurus) Diving Tourism: Tourist Compliance and Shark Behaviour at Fish Rock, Australia

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks ( Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

  14. Nuclear and mitochondrial DNA reveals isolation of imperilled grey nurse shark populations (Carcharias taurus).

    Science.gov (United States)

    Ahonen, H; Harcourt, R G; Stow, A J

    2009-11-01

    Loss of sharks and other upper-trophic marine predators has sparked worldwide concern for the stability of ocean ecosystems. The grey nurse (ragged-tooth or sand tiger) shark (Carcharias taurus) is Vulnerable on a global scale, Critically Endangered in Australia and presumed extinct in parts of its historical range. We used 193 muscle and fin samples collected from six extant populations to assess global mtDNA and microsatellite diversity and the degree of global population genetic structure. Control region mtDNA diversity was low in every population, and two populations (eastern Australia and Japan) contained only a single mtDNA haplotype. Genetic signatures of recent losses of genetic variation were not yet apparent at microsatellite loci, indicating that this low mtDNA variation is not a result of anthropogenic population declines. Population differentiation was substantial between each population pair except Brazil and South Africa, F(ST) values ranged from 0.050 to 0.699 and 0.100 to 1.00 for microsatellite and mitochondrial data respectively. Bayesian analysis clearly partitioned individuals into five of the populations from which they were sampled. Our data imply a low frequency of immigrant exchange among each of these regions and we suggest that each be recognized as a distinct evolutionary significant unit. In contrast to pelagic species such as whale shark and white shark that may cross ocean basins and where cooperative international efforts are necessary for conservation, grey nurse shark, like many coastal species, need to be managed regionally.

  15. Grey nurse shark (Carcharias taurus) diving tourism: Tourist compliance and shark behaviour at Fish Rock, Australia.

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks (Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

  16. Effect of circulating progesterone concentration during synchronization for fixed-time artificial insemination on ovulation and fertility in Bos indicus (Nelore) beef cows.

    Science.gov (United States)

    Sales, J N S; Carvalho, J B P; Crepaldi, G A; Soares, J G; Girotto, R W; Maio, J R G; Souza, J C; Baruselli, P S

    2015-04-01

    Four experiments were designed to evaluate the effect of different circulating progesterone (P4) concentrations during a synchronization of ovulation protocol for the timed artificial insemination (TAI) of Bos indicus (Nelore) beef cattle. In the first trial, 13 ovariectomized Nelore heifers were randomly allocated into one of three groups using new P4 devices (New; 1.0 g P4), previously used P4 devices for 8 days (Used1x), and previously used P4 devices for 16 days (Used2x), in a crossover experimental design. The circulating P4 concentrations during the P4 device treatment were lower for Used1x (2.3 ± 0.1 ng/mL) and Used2x (2.0 ± 0.1 ng/mL) than those for New (3.8 ± 0.2 ng/mL; P = 0.001). In the second trial, the ovarian follicular dynamics of 60 anestrous cows were evaluated after the cows received the treatments described previously (New [n = 20], Used1x [n = 20], and Used2x [n = 20]). During the insertion of the P4 device, the cows were administered 2.0-mg estradiol benzoate. Eight days later, the P4 device was removed, and the cows were administered 0.53-mg sodium cloprostenol, 300 IU eCG, and 1-mg estradiol cypionate. There were no differences among the groups during the interval from P4 device removal to ovulation (73.7 ± 2.9 vs. 69.8 ± 2.4 vs. 68.4 ± 2.3 hours) or regarding the ovulation rate (70.0% vs. 80.0% vs. 85.0%). However, the maximum diameter of the largest follicle was greater (P = 0.06) in the Used2x (15.3 ± 0.4 mm) than that of New (13.5 ± 0.8 mm) and Used1x (14.9 ± 0.5 mm). In experiment 3, 443 anestrous cows were randomly assigned into one of the three treatments (New [n = 144] vs. Used1x [n = 167] vs. Used2x [n = 132]) and received a TAI 48 hours after the P4 device removal. The diameter of the largest follicle during the device removal (10.7 ± 0.3 vs. 11.2 ± 0.2 vs. 11.3 ± 0.3 mm) and the 30-day pregnancy rates (51.4% vs. 53.9% vs. 43.2%) did not differ among the experimental

  17. Modelado de las distribuciones espectrales de energía para tres protoestrellas de Clase I en Taurus

    Science.gov (United States)

    Gramajo, V. L.; Gómez, M.; Whitney, B. A.

    In this contribution we present initial results on the mo-deling of the spectral energy distributions (SEDs) of a group of 3 Class I embedded sources (protostars) belonging to the Taurus-Auriga molecular cloud. We compiled fluxes between 1.25 and 800 µm from the literature for each source. We used a radiative transfer code developed by Whitney et al. (2003) to model the SEDs. We derived geometrical and physical parameters of the star + disk system and compared our results with those obtained by other authors. FULL TEXT IN SPANISH

  18. Characterization of Genetic Variation in Icelandic Cattle

    DEFF Research Database (Denmark)

    Holm, Lars-Erik; Das, Ashutosh; Momeni, Jamal

    Identification of genetic variation in cattle breeds using next-generation sequencing technology has focused on the modern production cattle breeds. We focused on one of the oldest indigenous breeds, the Icelandic cattle breed. Sequencing of two individuals enabled identification of more than 8...... million SNPs and more than one million short indels. Annotation of the genetic variants identified a substantial number of functional SNPs and variants. The number of genetic variants identified in the Icelandic cattle breed is on the same level as previously seen in other studies on Holstein cattle...

  19. Histopathological and histomorphometric testicular characteristics associated to reproductive condition in Bos indicus (Nellore bulls

    Directory of Open Access Journals (Sweden)

    Kethleen Mesquita da Silva

    2015-07-01

    Full Text Available The aim of this study was to evaluate morphological, morphometric and functional aspects of spermatogenesis based on reproductive conditions of Nellore bulls. The study used 25 bulls Bos indicus (Nellore, which were classified as satisfactory (n=10 and unsatisfactory (n=15 for reproduction. After orchiectomy, fragments of the right testis of each animal were processed routinely and stained with hematoxylin and eosin (HE and periodic acid-Schiff (PAS. The slides were analyzed in bright field microscopy at different magnifications. The tubular segments were classified into four levels (normal, mild and moderate degeneration, severe degeneration, and tubular hypoplasia based on the organization and architecture of the tubular tissue. The average height of the seminiferous epithelium, the average thickness of propria tunic and the average tubular diameter were obtained and the proportion of seminiferous tubules, interstitial tissue, lymphatic vessel and blood vessel of each bull testicle were recorded. Furthermore, the frequency of the three classifications of the spermatogenic cycle A, B and C (A = group of stages I, II, and III which comprise the initial phases of the cycle and mitotic proliferation, B = group of stages IV and V, which comprise intermediate phases and intensive mitosis, C = group stages VI, VII and VIII which comprise the final phases and post-meiosis was compared. The results showed that the degenerative changes in germ cells are associated with histomorphometric variations, including those in the density of the structures that comprise the testicular parenchyma, and are more representative in bulls with poor semen quality. In addition, the unsatisfactory bulls for reproduction showed reduced meiotic potential compared to that of satisfactory reproductive bulls.

  20. Genome-wide characterization of perfect microsatellites in yak (Bos grunniens).

    Science.gov (United States)

    Ma, Zhijie

    2015-08-01

    Microsatellites or simple sequence repeats (SSRs) constitute a significant portion of genomes and play an important role in gene function and genome organization. The availability of a complete genome sequence for yak (Bos grunniens) has made it possible to carry out genome-wide analysis of microsatellites in this species. We analyzed the abundance and density of perfect SSRs in the yak genome. We found a total of 723,172 SSRs with 1-6 bp nucleotide motifs, indicating that about 0.47 % of the yak whole genome sequence (2.66 Gb) comprises perfect SSRs, the average length of which was 17.34 bp/Mb. The average frequency and density of perfect SSRs was 272.18 loci/Mb and 4719.25 bp/Mb, respectively. The proportion of the six classes of perfect SSRs was not evenly distributed in the yak genome. Mononucleotide repeats (44.04 %) with a total number of 318,435 and a average length of 14.71 bp appeared to be the most abundant SSRs class, while the percentages of dinucleotide, trinucleotide, pentanucleotide, tetranucleotide and hexanucleotide repeats was 24.11 %, 15.80 %, 9.50 %, 6.40 % and 0.15 %, respectively. Different repeat classes of SSRs varied in their repeat number with the highest being 1206. Our results suggest that 15 motifs comprised the predominant categories with a frequency above 1 loci/Mb: A, AC, AT, AG, AGC, AAC, AAT, ACC, ATTT, GTTT, AATG, CTTT, ATGG, AACTG and ATCTG.

  1. Reproductive characteristics of grass-fed, luteinizing hormone-releasing hormone-immunocastrated Bos indicus bulls.

    Science.gov (United States)

    Hernandez, J A; Zanella, E L; Bogden, R; de Avila, D M; Gaskins, C T; Reeves, J J

    2005-12-01

    Two field trials were conducted in Brazil to evaluate LHRH immunocastration of Bos indicus bulls (d 0 = 2 yr of age). In Study I, 72 bulls were assigned randomly to one of three treatment groups: LHRH0-immunized, castrated, and intact. Immunized animals (n = 25) received a primary and two booster injections of ovalbumin-LHRH-7 and thioredoxin-LHRH-7 fusion proteins on d 0, 141, and 287. Twenty-three bulls were surgically castrated on d 141, and 24 served as intact controls. All animals were slaughtered on d 385, at approximately 3 yr of age. In Study II, 216 bulls were assigned randomly to the same three treatments as in Study I; however, because of a drought in the area, bulls were kept on pasture an additional year, and a fourth treatment was added, in which one-half the LHRH-immunized bulls received an additional booster on d 639 (fourth immunization). All animals in Study II were slaughtered on d 741 (4 yr of age). Luteinizing hormone-releasing hormone antibodies increased following each immunization for immunized bulls, but they were not detectable in castrate or intact animals in either study. Consequently, scrotal circumference was suppressed in immunized bulls compared with intact controls in both studies. By d 287, serum concentrations of testosterone in LHRH-immunized bulls were decreased compared with intact controls (P bulls (173 +/- 22 and 26 +/- 2 g, respectively) and fourth immunization bulls (78 +/- 23 and 20 +/- 2 g, respectively; Study II). At the end of each study, BW was greater (P bulls than for castrated and LHRH-immunized animals. In these two studies, the efficacy of the LHRH fusion proteins to induce an effect similar to that of surgical castration was considered 92 and 93%, respectively. These data support the concept that immunocastration of bulls at 2 yr of age was successful and that it has practical application as a tool for producing grass-fattened bulls in Brazil.

  2. Phenotypic ranges and relationships among carcass and meat palatability traits for fourteen cattle breeds, and heritabilities and expected progeny differences for Warner-Bratzler shear force in three beef cattle breeds.

    Science.gov (United States)

    Dikeman, M E; Pollak, E J; Zhang, Z; Moser, D W; Gill, C A; Dressler, E A

    2005-10-01

    Carcass and Warner-Bratzler shear force (WBSF) data from strip loin steaks were obtained from 7,179 progeny of Angus, Brahman, Brangus, Charolais, Gelbvieh, Hereford, Limousin, Maine-Anjou, Red Angus, Salers, Shorthorn, Simbrah, Simmental, and South Devon sires. Trained sensory panel (TSP) evaluations were obtained on 2,320 steaks sampled from contemporary groups of progeny from one to five sires of each breed. Expected progeny differences for marbling and WBSF were developed for 103 Simmental sires from 1,295 progeny, 23 Shorthorn sires from 310 progeny, and 69 Hereford sires from 1,457 progeny. Pooled phenotypic residual correlations, including all progeny, showed that marbling was lowly correlated with WBSF (-0.21) and with TSP overall tenderness (0.18). The residual correlation between WBSF and TSP tenderness was -0.68, whereas residual correlations for progeny sired by the three Bos indicus breeds were only slightly different than for progeny sired by Bos taurus breeds. The phenotypic range of mean WBSF among sires across breeds was 6.27 kg, and the phenotypic range among breed means was 3.93 kg. Heritability estimates for fat thickness, marbling score, WBSF, and TSP tenderness, juiciness, and flavor were 0.19, 0.68, 0.40, 0.37, 0.46, and 0.07, respectively. Ranges in EPD for WBSF and marbling were -0.41 to +0.26 kg and +0.48 to -0.22, respectively, for Simmentals; -0.41 to +0.36 kg and 0.00 to -0.32, respectively, for Shorthorns; and -0.48 to +0.22 kg and +0.40 to -0.24, respectively, for Herefords. More than 20% of steaks were unacceptable in tenderness. Results of this study demonstrated that 1) selection for marbling would result in little improvement in meat tenderness; 2) heritability of marbling, tenderness, and juiciness are high; and 3) sufficient variation exists in WBSF EPD among widely used Simmental, Shorthorn, and Hereford sires to allow for genetic improvement in LM tenderness.

  3. Variant in the 5' untranslated region of insulin-like growth factor 1 receptor is associated with susceptibility to mastitis in cattle.

    Science.gov (United States)

    Sugimoto, Mayumi; Sugimoto, Yoshikazu

    2012-09-01

    Mastitis is a common infectious disease of the mammary gland and generates large losses in the dairy industry. By means of positional cloning and functional analysis techniques, we here show that insulin-like growth factor 1 receptor (IGF1R) can possibly mediate susceptibility to mastitis through autophagy. Scanning the whole genome of cows (Bos taurus) that were susceptible or resistant to mastitis in the half-sib families revealed that susceptible cows had a relatively long stretch of cytosine residues (C stretch) in the 5' untranslated region of IGF1R. The forebrain embryonic zinc finger-like (FEZL) transcription factor, which was previously identified as a factor controlling mastitis resistance in the same half-sib families, bound the C stretch of IGF1R. The susceptible type of FEZL with a glycine stretch containing 13 glycines (13G) and the longer C stretch of IGF1R together enhanced expression of IGF1R. Enhancing IGF1R inhibited autophagy in response to Streptococcus agalactiae invasion of mammary epithelial cells, whereas treatment with rapamycin, a known inducer of autophagy, rescued it. Cows carrying the variant combination of 13GFEZL might be more susceptible to mastitis as the result of impaired autophagy. Our results suggest that IGF1R could control innate immunity in mammals and serve as a potential tool for preventing mastitis.

  4. Tuberculosis-resistant transgenic cattle

    Science.gov (United States)

    Tuberculosis is a devastating disease that affects humans and many animal species. In humans, tuberculosis (TB) is mainly caused by Mycobacterium tuberculosis, while most cases in cattle are caused by Mycobacterium bovis. However, Mb can also cause, albeit rarely, human TB. In this issue, Wu et al. ...

  5. Beef Cattle: Selection and Evaluation.

    Science.gov (United States)

    Clemson Univ., SC. Vocational Education Media Center.

    Designed for secondary vocational agriculture students, this text provides an overview of selecting and evaluating beef cattle in Future Farmers of America livestock judging events. The first of four major sections addresses topics such as the ideal beef animal, selecting steers, selecting breeding animals, studying the animal systematically, and…

  6. Heat Stress in Feedlot Cattle.

    Science.gov (United States)

    The objective of this study was to determine if supplementing the diet of near-finished beef cattle with a yeast product would mitigate the negative impact of a controlled HS on the physiological and endocrine responses. Crossbred beef heifers (n=111; BW=281.07 kg) were divided into 2 pens in a comm...

  7. Determination of Genetic Structure and Signatures of Selection in Three Strains of Tanzania Shorthorn Zebu, Boran and Friesian Cattle by Genome-Wide SNP Analyses

    Science.gov (United States)

    Msalya, George; Kim, Eui-Soo; Laisser, Emmanuel L. K.; Kipanyula, Maulilio J.; Karimuribo, Esron D.; Kusiluka, Lughano J. M.; Chenyambuga, Sebastian W.; Rothschild, Max F.

    2017-01-01

    Background More than 90 percent of cattle in Tanzania belong to the indigenous Tanzania Short Horn Zebu (TSZ) population which has been classified into 12 strains based on historical evidence, morphological characteristics, and geographic distribution. However, specific genetic information of each TSZ population has been lacking and has caused difficulties in designing programs such as selection, crossbreeding, breed improvement or conservation. This study was designed to evaluate the genetic structure, assess genetic relationships, and to identify signatures of selection among cattle of Tanzania with the main goal of understanding genetic relationship, variation and uniqueness among them. Methodology/Principal findings The Illumina Bos indicus SNP 80K BeadChip was used to genotype genome wide SNPs in 168 DNA samples obtained from three strains of TSZ cattle namely Maasai, Tarime and Sukuma as well as two comparative breeds; Boran and Friesian. Population structure and signatures of selection were examined using principal component analysis (PCA), admixture analysis, pairwise distances (FST), integrated haplotype score (iHS), identical by state (IBS) and runs of homozygosity (ROH). There was a low level of inbreeding (F~0.01) in the TSZ population compared to the Boran and Friesian breeds. The analyses of FST, IBS and admixture identified no considerable differentiation between TSZ trains. Importantly, common ancestry in Boran and TSZ were revealed based on admixture and IBD, implying gene flow between two populations. In addition, Friesian ancestry was found in Boran. A few common significant iHS were detected, which may reflect influence of recent selection in each breed or strain. Conclusions Population admixture and selection signatures could be applied to develop conservation plan of TSZ cattle as well as future breeding programs in East African cattle. PMID:28129396

  8. Carbon Footprint of Beef Cattle

    Directory of Open Access Journals (Sweden)

    Jim Dyer

    2012-12-01

    Full Text Available The carbon footprint of beef cattle is presented for Canada, The United States, The European Union, Australia and Brazil. The values ranged between 8 and 22 kg CO2e per kg of live weight (LW depending on the type of farming system, the location, the year, the type of management practices, the allocation, as well as the boundaries of the study. Substantial reductions have been observed for most of these countries in the last thirty years. For instance, in Canada the mean carbon footprint of beef cattle at the exit gate of the farm decreased from 18.2 kg CO2e per kg LW in 1981 to 9.5 kg CO2e per kg LW in 2006 mainly because of improved genetics, better diets, and more sustainable land management practices. Cattle production results in products other than meat, such as hides, offal and products for rendering plants; hence the environmental burden must be distributed between these useful products. In order to do this, the cattle carbon footprint needs to be reported in kg of CO2e per kg of product. For example, in Canada in 2006, on a mass basis, the carbon footprint of cattle by-products at the exit gate of the slaughterhouse was 12.9 kg CO2e per kg of product. Based on an economic allocation, the carbon footprints of meat (primal cuts, hide, offal and fat, bones and other products for rendering were 19.6, 12.3, 7 and 2 kg CO2e per kg of product, respectively.

  9. Selenium in Cattle: A Review

    Directory of Open Access Journals (Sweden)

    Youcef Mehdi

    2016-04-01

    Full Text Available This review article examines the role of selenium (Se and the effects of Se supplementation especially in the bovine species. Selenium is an important trace element in cattle. Some of its roles include the participation in the antioxidant defense the cattle farms. The nutritional requirements of Se in cattle are estimated at 100 μg/kg DM (dry matter for beef cattle and at 300 μg/kg DM for dairy cows. The rations high in fermentable carbohydrates, nitrates, sulfates, calcium or hydrogen cyanide negatively influence the organism’s use of the selenium contained in the diet. The Se supplementation may reduce the incidence of metritis and ovarian cysts during the postpartum period. The increase in fertility when adding Se is attributed to the reduction of the embryonic death during the first month of gestation. A use of organic Se in feed would provide a better transfer of Se in calves relative to mineral Se supplementation. The addition of Se yeasts in the foodstuffs of cows significantly increases the Se content and the percentage of polyunsaturated fatty acids (PUFA in milk compared to the addition of sodium selenite. The enzyme 5-iodothyronine deiodinase is a seleno-dependent selenoprotein. It is one of the last proteins to be affected in the event of Se deficiency. This delay in response could explain the fact that several studies did not show the effect of Se supplementation on growth and weight gain of calves. Enrichment of Se in the diet did not significantly affect the slaughter weight and carcass yield of bulls. The impact and results of Se supplementation in cattle depend on physiological stage, Se status of animals, type and content of Se and types of Se administration. Further studies in Se supplementation should investigate the speciation of Se in food and yeasts, as well as understanding their metabolism and absorption. This constitute a path to exploit in order to explain certain different effects of Se.

  10. X-ray emission from the young brown dwarfs of the Taurus molecular cloud

    Science.gov (United States)

    Grosso, N.; Briggs, K. R.; Güdel, M.; Guieu, S.; Franciosini, E.; Palla, F.; Dougados, C.; Monin, J.-L.; Ménard, F.; Bouvier, J.; Audard, M.; Telleschi, A.

    2007-06-01

    Aims:We report the X-ray properties of young (~3 Myr) bona fide brown dwarfs of the Taurus Molecular Cloud (TMC). Methods: The XMM-Newton Extended Survey of the TMC (XEST) is a large program designed to systematically investigate the X-ray properties of young stellar/substellar objects in the TMC. In particular, the area surveyed by 15 XMM-Newton pointings (of which three are archival observations), supplemented with one archival Chandra observation, allows us to study 17 brown dwarfs with M spectral types. Results: Half of this sample (9 out of 17 brown dwarfs) is detected; 7 brown dwarfs are detected here for the first time in X-rays. We observed a flare from one brown dwarf. We confirm several previous findings on brown dwarf X-ray activity: a log-log relation between X-ray and bolometric luminosity for stars (with L* ≤ 10 L_⊙) and brown dwarfs detected in X-rays, which is consistent with a mean X-ray fractional luminosity =-3.5 ± 0.4; for the XEST brown dwarfs, the median of log(L_X/L_*) (including upper limits) is -4.0; a shallow log-log relation between X-ray fractional luminosity and mass; a log-log relation between X-ray fractional luminosity and effective temperature; a log-log relation between X-ray surface flux and effective temperature. We find no significant log-log correlation between the X-ray fractional luminosity and EW(Hα). Accreting and nonaccreting brown dwarfs have a similar X-ray fractional luminosity. The median X-ray fractional luminosity of nonaccreting brown dwarfs is about 4 times lower than the mean saturation value for rapidly rotating low-mass field stars. Our TMC brown dwarfs have higher X-ray fractional luminosity than brown dwarfs in the Chandra Orion Ultradeep Project. Conclusions: The X-ray fractional luminosity declines from low-mass stars to M-type brown dwarfs, and as a sample, the brown dwarfs are less efficient X-ray emitters than low-mass stars. We thus conclude that while the brown dwarf atmospheres observed here are

  11. A GALEX based search for the sparse young stellar population in the Taurus-Aurigae star forming region

    CERN Document Server

    de Castro, Ana I Gomez; López-Martínez, Fátima; Sánchez, Néstor; Sestito, Paola; de Castro, Elisa; Cornide, Manuel; Gestoso, Javier Yañez

    2014-01-01

    In this work, we identify 63 bona fide new candidates to T Tauri stars (TTSs) in the Taurus-Auriga region using as baseline its ultraviolet excess. The initial data set has been defined from the GALEX all sky survey (AIS). The GALEX satellite obtained images in the near ultraviolet (NUV) and far ultraviolet (FUV) bands where the TTSs show a prominent excess, compared with main sequence or giants stars. GALEX AIS surveyed the Taurus-Auriga molecular complex, as well as, a fraction of the California Nebula and the Perseus complex; bright sources and the dark clouds themselves are avoided. The properties of the TTSs in the ultraviolet (GALEX), optical (UCAC4) and infrared (2MASS) have been defined using as qualification sample the TTSs observed with the International Ultraviolet Explorer. The candidates have been identified by means of a mixed ultraviolet-optical-infrared excess set of colors; it is found that the color-color diagram FUV-NUV versus J-K is ideally suited for this purpose. From an initial sample o...

  12. A statistical analysis of X-ray variability in pre-main sequence objects of the Taurus Molecular Cloud

    CERN Document Server

    Stelzer, B; Briggs, K; Micela, G; Scelsi, L; Audard, M; Pillitteri, I; Güdel, M

    2006-01-01

    This work is part of a systematic X-ray survey of the Taurus star forming complex with XMM-Newton. We study the time series of all X-ray sources associated with Taurus members, to statistically characterize their X-ray variability, and compare the results to those for pre-main sequence stars in the Orion Nebula Cluster and to expectations arising from a model where all the X-ray emission is the result of a large number of stochastically occurring flares. We find that roughly half of the detected X-ray sources show variability above our sensitivity limit, and in ~ 26 % of the cases this variability is recognized as flares. Variability is more frequently detected at hard than at soft energies. The variability statistics of cTTS and wTTS are undistinguishable, suggesting a common (coronal) origin for their X-ray emission. We have for the first time applied a rigorous maximum likelihood method in the analysis of the number distribution of flare energies on pre-main sequence stars. In its differential form this di...

  13. NCBI nr-aa BLAST: CBRC-BTAU-01-2454 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2454 ref|NP_776656.1| adrenergic, beta-2-, receptor, surface [Bos taur...us] sp|Q28044|ADRB2_BOVIN Beta-2 adrenergic receptor (Beta-2 adrenoceptor) (Beta-2 adrenoreceptor) emb|CAB06661.1| beta-2-adrenerg...ic receptor [Bos taurus] gb|AAI14133.1| Adrenergic, beta-2-, receptor, surface [Bos taurus] NP_776656.1 0.0 100% ...

  14. NCBI nr-aa BLAST: CBRC-BTAU-01-1067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1067 ref|XP_001255730.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_001255807.1| PREDICTED: similar to seven transmembrane helix receptor [Bos t...aurus] ref|XP_001252728.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255730.1 1e-179 100% ...

  15. NCBI nr-aa BLAST: CBRC-MMUS-07-0423 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0423 ref|XP_001255730.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_001255807.1| PREDICTED: similar to seven transmembrane helix receptor [Bos t...aurus] ref|XP_001252728.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255730.1 1e-129 74% ...

  16. NCBI nr-aa BLAST: CBRC-BTAU-01-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0026 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-177 100% ...

  17. NCBI nr-aa BLAST: CBRC-TBEL-01-1959 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1959 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-115 79% ...

  18. NCBI nr-aa BLAST: CBRC-CFAM-21-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-21-0063 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-160 89% ...

  19. NCBI nr-aa BLAST: CBRC-FCAT-01-0617 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0617 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-158 89% ...

  20. NCBI nr-aa BLAST: CBRC-BTAU-01-1044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1044 ref|XP_001255840.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_001252868.1| PREDICTED: similar to seven transmembrane helix receptor [Bos t...aurus] ref|XP_001253817.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255840.1 0.0 100% ...

  1. NCBI nr-aa BLAST: CBRC-CJAC-01-1228 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1228 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-140 79% ...

  2. NCBI nr-aa BLAST: CBRC-BTAU-01-0812 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0812 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-177 100% ...

  3. NCBI nr-aa BLAST: CBRC-LAFR-01-1762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1762 ref|XP_001255673.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_602082.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taur...us] ref|XP_001255654.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255673.1 1e-94 84% ...

  4. NCBI nr-aa BLAST: CBRC-PTRO-12-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-12-0039 ref|XP_001255730.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_001255807.1| PREDICTED: similar to seven transmembrane helix receptor [Bos t...aurus] ref|XP_001252728.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255730.1 1e-137 79% ...

  5. NCBI nr-aa BLAST: CBRC-ETEL-01-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0020 ref|XP_001255730.1| PREDICTED: similar to seven transmembrane hel...ix receptor [Bos taurus] ref|XP_001255807.1| PREDICTED: similar to seven transmembrane helix receptor [Bos t...aurus] ref|XP_001252728.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] XP_001255730.1 1e-133 80% ...

  6. VizieR Online Data Catalog: UBVRIJHKLMNQ photometry in Taurus-Auriga (Kenyon+ 1995)

    Science.gov (United States)

    Kenyon, S. J.; Hartmann, L.

    1996-02-01

    Tables A1-A2 list average V and K magnitudes and broadband optical and near-infrared colors for T Tauri stars in the Taurus-Auriga cloud. The quoted errors are 1 sigma dispersions from the average values for objects with 2 or more measurements at V, K, or the appropriate color. For convenience, the authors quote dispersions of 0.00 for objects with only a single measurement. The last columns of Tables A1-A2 list the number of V, K, and N measurements used to compute the average values. The number of data points used to determine average colors is usually close to the number of V or K measurements. Table A3 lists IRAS colors for the Taurus-Auriga sample. For each IRAS source, the authors compiled fluxes from version 2 of the Point Source Catalog, IRAS ADDSCANs, and the IRAS Serendipitous Survey Catalog and averaged fluxes for sources appearing in 2 or 3 catalogs (see section 2 of the printed paper). The authors adopted flux zero points of Fnu(12um)=28.3Jy, Fnu(25um)=6.73Jy, Fnu(60um)=1.19Jy, and Fnu(100um)=0.43Jy to compute IRAS magnitudes and then derived colors using average K magnitudes from Table A2. In some cases, two or more pre-main-sequence stars fall in a typical IRAS beam. The authors summed the K flux of the individual objects to compute a combined K magnitude and color for these IRAS sources. These IRAS colors assume no color correction for the IRAS flux. Table A4 lists various quantities derived from published spectra and the photometry in Tables A1-A3. Infrared colors and the ratio of far-IR to bolometric luminosity set the spectral energy distribution class, SED. The optical spectral type usually was taken from the literature (Herbig & Bell (1988LicOB1111....1H)) or the authors own work. The effective temperature, Teff, is based on compilations by Schmidt-Kaler (1982) and Straizys (1992). The authors estimated optical extinctions, A_V, from comparisons between the observed optical or infrared colors and colors for normal main sequence stars in Table A