WorldWideScience

Sample records for cationic protein ecp

  1. Detection of eosinophil cationic protein (ECP) by an enzyme-linked immunosorbent assay

    DEFF Research Database (Denmark)

    Reimert, C M; Venge, P; Kharazmi, A;

    1991-01-01

    Eosinophil cationic protein (ECP) is a highly basic and potent cytotoxic single-chain zinc-containing protein present in the granules of the eosinophilic granulocytes. ECP appears to be involved in defence against parasites and in the tissue damage seen in subjects with allergic and inflammatory...... disease. To investigate ECP release from in vitro activated human eosinophils and to study the involvement of eosinophils in health and disease, we have developed a sensitive and specific enzyme immunoassay. ECP was purified from normal human peripheral blood eosinophils and polyclonal antibodies to ECP...

  2. [Relation between serum eosinophil cationic protein (ECP) level and asthma attack in children].

    Science.gov (United States)

    Ishigaki, N; Masuhara, C; Sakamaki, K; Ishikawa, Y; Ohta, K; Koike, R; Mikuni, K; Haruna, H; Awa, S

    2000-11-01

    Serum eosinophil cationic protein (sECP) levels were measured in 339 patients with childhood asthma, and the clinical courses of these patients were followed for 57 weeks. While considering the history and characteristics of each patient, we examined the correlation between asthma attack frequency and sECP, blood eosinophil count, and serum total IgE (tIgE) to determine their usefulness in predicting asthma attacks. Among patients with no other allergic diseases, sECP levels in patients who had no asthma attacks two weeks before or after the measurement were significantly lower than those of patients who had attacks during the same four-week period. Among patients who had attacks, those patients with no attack for a year after the measurement were also found to have low sECP levels. Similarly, even among patients with asthma attacks and high sECP levels, there were cases where attacks were well controlled using nebulizer treatments with DSCG or BDP. The incident rate of attacks for patients with other allergic diseases and a low sECP was low. Yet, there was no common trend in patients with high sECP levels. Moreover, this study detected a significant correlation between sECP level and blood eosinophil count as well as between sECP level and serum tIgE. The most significant correlation with asthma attack frequency was sECP level. Thus, sECP level seems to reflect the allergy activity level, especially two weeks prior to and after the measurement. For patients without other allergic diseases, asthma attack prediction during the two weeks period after the measurement of sECP also seems possible. Therefore, periodic measurement of sECP level is useful in objectively monitoring the improvement of symptoms and establishing the treatment plan, including treatment with DSCG or BDP. PMID:11193461

  3. Indirect assessment of eosinophiluria in urinary schistosomiasis using eosinophil cationic protein (ECP) and eosinophil protein X (EPX)

    DEFF Research Database (Denmark)

    Reimert, C M; Ouma, J H; Mwanje, M T;

    1993-01-01

    The pre- and post-treatment level of eosinophiluria, as measured indirectly by the amount of free or cell bound eosinophil cationic protein (ECP) and eosinophil protein X (EPX) in urine from Schistosoma haematobium-infected Kenyan school children, were measured and compared with intensity......-treatment follow-up, eosinophiluria persisted in a significant proportion of the treated children indicating continued eosinophil activity in the bladder wall. Detection and quantification of early acute inflammatory reactions using ECP/eosinophils in combination with detection of later stages of bladder pathology...

  4. Eosinophil granule proteins ECP and EPX as markers for a potential early-stage inflammatory lesion in female genital schistosomiasis (FGS)

    DEFF Research Database (Denmark)

    Ramarokoto, Charles Emile; Kildemoes, Anna M. O.; Randrianasolo, Bodo Sahondra;

    2014-01-01

    pathology, as viable schistosome egg granulomas often are eosinophil rich. Here it was investigated whether eosinophil granule proteins ECP (eosinophil cationic protein) and EPX (eosinophil protein-X) in urine and genital lavage can be used as markers for active FGS lesions. METHODS: Uro-genital samples...

  5. Genetic factors explain half of all variance in serum eosinophil cationic protein

    DEFF Research Database (Denmark)

    Elmose, Camilla; Sverrild, Asger; van der Sluis, Sophie;

    2014-01-01

    BACKGROUND: Eosinophil cationic protein (ECP) is one of four basic proteins of the secretory granules of eosinophils. It has a variety of functions associated with inflammatory responses. Little is known about the causes for variation in serum ECP levels. AIM: To identify factors associated...

  6. Eosinophil Granule Proteins ECP and EPX as Markers for a Potential Early-Stage Inflammatory Lesion in Female Genital Schistosomiasis (FGS)

    Science.gov (United States)

    Randrianasolo, Bodo Sahondra; Ravoniarimbinina, Pascaline; Ravaoalimalala, Vololomboahangy Elisabeth; Leutscher, Peter; Kjetland, Eyrun Floerecke; Vennervald, Birgitte Jyding

    2014-01-01

    Background Genital granulomas induced by Schistosoma haematobium eggs can manifest as different lesion types visible by colposcopy; rubbery papules (RP), homogenous sandy patches (HSP) and grainy sandy patches (GSP). Pronounced tissue eosinophilia is a candidate marker for active S. haematobium pathology, as viable schistosome egg granulomas often are eosinophil rich. Here it was investigated whether eosinophil granule proteins ECP (eosinophil cationic protein) and EPX (eosinophil protein-X) in urine and genital lavage can be used as markers for active FGS lesions. Methods Uro-genital samples from 118 Malagasy women were analysed for ECP and EPX by standard sandwich avidin/biotin amplified ELISA. Principal findings The women with RP lesions had significantly higher levels of ECP and EPX in both lavage and urine. Furthermore, women with RP lesions were significantly younger than those with GSP. This could indicate that RP lesions might be more recently established and thus represent an earlier inflammatory lesion stage. Conclusion ECP in genital lavage might be a future tool aiding the identification of FGS pathology at a stage where reversibility remains a possibility following praziquantel treatment. PMID:25033206

  7. Eosinophil granule proteins ECP and EPX as markers for a potential early-stage inflammatory lesion in female genital schistosomiasis (FGS.

    Directory of Open Access Journals (Sweden)

    Charles Emile Ramarokoto

    2014-07-01

    Full Text Available Genital granulomas induced by Schistosoma haematobium eggs can manifest as different lesion types visible by colposcopy; rubbery papules (RP, homogenous sandy patches (HSP and grainy sandy patches (GSP. Pronounced tissue eosinophilia is a candidate marker for active S. haematobium pathology, as viable schistosome egg granulomas often are eosinophil rich. Here it was investigated whether eosinophil granule proteins ECP (eosinophil cationic protein and EPX (eosinophil protein-X in urine and genital lavage can be used as markers for active FGS lesions.Uro-genital samples from 118 Malagasy women were analysed for ECP and EPX by standard sandwich avidin/biotin amplified ELISA.The women with RP lesions had significantly higher levels of ECP and EPX in both lavage and urine. Furthermore, women with RP lesions were significantly younger than those with GSP. This could indicate that RP lesions might be more recently established and thus represent an earlier inflammatory lesion stage.ECP in genital lavage might be a future tool aiding the identification of FGS pathology at a stage where reversibility remains a possibility following praziquantel treatment.

  8. Antibody to eosinophil cationic protein suppresses dextran sulfate sodium-induced colitis in rats

    Institute of Scientific and Technical Information of China (English)

    Kazuko Shichijo; Kazuya Makiyama; Chun-Yang Wen; Mutsumi Matsuu; Toshiyuki Nakayama; Masahiro Nakashima; Makoto Ihara; Ichiro Sekine

    2005-01-01

    AIM: To produce an antibody against rat eosinophil cationic protein (ECP) and to examine the effects of the antibody in rats with dextran sulfate sodium (DSS)-induced colitis.METHODS: An antibody was raised against rat ECP. Rats were treated with 3% DSS in drinking water for 7 d and received the antibody or normal serum. The colons were exarmined histologically and correlated with clinical symptoms.Immunohistochemistry and Western blot analysis were estimated as a grade of inflammation.RESULTS: The ECP antibody stained the activated eosinophils around the injured crypts in the colonic mucosa.Antibody treatment reduced the severity of colonic ulceration and acute clinical symptoms (diarrhea and/or blood-stained stool). Body weight gain was significantly greater and the colon length was significantly longer in anti-ECP-treated rats than in normal serum-treated rats. Expression of ECP in activated eosinophils was associated with the presence of erosions and inflammation. The number of Ki-67-positive cells in the regenerated surface epithelium increased in anti-ECP-treated rats compared with normal serum-treated rats. Western blot analysis revealed reduced expression of macrophage migration inhibitory factor (MIF) in anti-ECP-treated rats.CONCLUSION: Our results indicate that treatment with ECP antibody, improved DSS-induced colitis in rats, possibly by increasing the regenerative activity of the colonic epithelium and downregulation of the immune response,and suggest that anti-ECP may promote intestinal wound healing in patients with ulcerative colitis (UC).

  9. Allergen-induced increase of eosinophil cationic protein in nasal lavage fluid

    DEFF Research Database (Denmark)

    Bisgaard, H; Grønborg, H; Mygind, N;

    1990-01-01

    It was our aim to study the effect of nasal allergen provocation on the concentration of eosinophil cationic protein (ECP) in nasal lavage fluid, with and without glucocorticoid pretreatment. Twenty grass-pollen sensitive volunteers were provoked outside the pollen season on 2 consecutive days...... untreated, prechallenge noses was 400 micrograms/L. (3) The ECP level did not increase during the early phase response. (4) There was a late occurring increase in the ECP concentration (6 to 24 hours). (5) This increase was completely inhibited by budesonide pretreatment. (6) The glucocorticoid therapy also...... reduced the prechallenge ECP concentration. In conclusion, allergen provocation in the nose results in a late occurring increase of ECP in nasal lavage fluid, and one of the therapeutic effects of topical glucocorticoid therapy may be an inhibition of the allergen-induced increase of this cytotoxic...

  10. Effect of lodoxamide and disodium cromoglycate on tear eosinophil cationic protein in vernal keratoconjunctivitis

    OpenAIRE

    Leonardi, A.; Borghesan, F.; Avarello, A.; Plebani, M.; Secchi, A.

    1997-01-01

    AIM—To validate the use of tear eosinophil cationic protein (ECP) as a marker for eosinophil activation, and its pharmacological modulation, in addition to evaluating the efficacy of lodoxamide and sodium cromoglycate in the treatment of vernal keratoconjunctivitis (VKC).
METHODS—Tears were collected from 30 patients affected by active mild to moderate VKC before and after therapy with disodium cromoglycate 4% (DSCG) (n=15) or lodoxamide 0.1% (n=15) for 10 days. Tear cytology and ECP measurem...

  11. Is Serum or Sputum Eosinophil Cationic Protein Level Adequate for Diagnosis of Mild Asthma?

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Khakzad

    2009-09-01

    Full Text Available Spirometry has been used as a common diagnostic test in asthma. Most of the patients with a mild asthma have a FEV1 within normal range. Hence, other diagnostic methods are usually used. The aim of this study was to evaluate whether eosinophil Cationic Protein (ECP could be an accurate diagnostic marker of mild asthma.In this study diagnosis of asthma was made according to internationally accepted criteria. Asthma severity was evaluated according to frequency of symptoms and FEV1. Adequate sputum samples were obtained in 50 untreated subjects. A control group of 12 normal subjects that showed PC20 more than 8 mg/dl was also examined. Sputum was induced by inhalation of hypertonic saline. Inflammatory cells in sputum smears were assessed semi-quantitatively. ECP and IgE concentrations, eosinophil (EO percentage and ECP/EO ratio in serum and sputum were also determined. The results revealed that Cough and dyspnea were the most frequent clinical findings. Dyspnea and wheezing were the symptoms that correlated with staging of asthma. FEV1 was within normal range (more than 80% of predicted in 22 (44% subjects.Asthmatic patients showed significantly higher numbers of blood eosinophils (4.5± 3.1% vs. 1.2±0.2%, P=0.009, and higher levels of serum ECP than control group (3.1± 2.6 % and 22.6± 15.8 ng/ml, respectively. Sputum ECP level in asthmatics was significantly higher than non- asthmatics (55.3±29.8ng/mL vs. 25.0±24.7ng/mL, P=0.045. Regression analysis showed no significant correlation between spirometric parameters and biomarkers, the only exception was significant correlation between FEF25-75 and serum ECP (r= 0.28, P 0.041. Regarding clinical symptoms, wheezing was significantly correlated with elevation of most of biomarkers. Since, serum and sputum ECP levels are elevated in untreated asthmatics, the ECP level could be used for accurate diagnosis of mild form of asthma in which spirometry is unremarkable.

  12. Role of serum eosinophil cationic protein as a biological marker to assess the severity of bronchial asthma

    International Nuclear Information System (INIS)

    Objective: The study was carried out to evaluate the role of serum eosinophil cationic protein (ECP) as a biological marker for the diagnosis and to assess the severity of bronchial asthma. Methodology: This observational cross-sectional study was conducted among 70 bronchial asthma patients and 45 disease controls (tuberculosis-15, chronic obstructive pulmonary disease-15, interstitial lung disease-15) enrolled from patients attending the outpatient department of the National Institute of Disease of the Chest and Hospital (NIDCH), Dhaka, Bangladesh during July 2010 to June 2011. Global Initiative of Asthma Management and Prevention (GINA) criteria were followed for selection of both atopic and non-atopic patients with intermittent or persistent (mild, moderate and severe) asthma. Serum level of eosinophil cationic protein (ECP), IgE, forced expiratory volume in 1 second (FEV 1% predicted) and circulatory eosinophil (CE) count were estimated. Results: Mean serum ECP level (28.8 +- 42.9 vs. 6.82 +- 3.5 ng/mL; P<0.001), IgE level (383.59 - 225.3 vs. 135 +- 131.8 IU/mL; P<0.001) and percent circulatory eosinophil count (9.95 +- 3.7 vs. 5.95 +- 1.4; P<0.024) were all found significantly raised among asthma patients than disease controls but % FEV1 was equivocal. All grades of persistent asthma patients had significantly (P<0.025 and P<0.002) higher mean ECP level than intermittent cases but serum IgE level and CE count did not differ significantly. FEV1 % predicted correlated well among moderate and severe persistent asthma but was equivocal for intermittent and mild persistent cases. Conclusion: This study has reinforced that serum eosinophil cationic protein is a dependable biological marker with more discriminatory power over other indicators for bronchial asthma and to assess its severity. (author)

  13. The 434(G>C) polymorphism in the eosinophil cationic protein gene and its association with tissue eosinophilia in oral squamous cell carcinomas

    DEFF Research Database (Denmark)

    Pereira, Michele C; Oliveira, Denise T; Olivieri, Eloísa H R;

    2010-01-01

    OBJECTIVE: The aim of this study was to investigate the prevalence of the Eosinophil cationic protein (ECP)-gene polymorphism 434(G>C) in oral squamous cell carcinoma (OSCC) patients and its association with tumor-associated tissue eosinophilia (TATE), demographic, clinical, and microscopic...... variables. METHODS: The ECP genotypes of 165 healthy individuals and 157 OSCC patients were detected by PCR-RFLP analysis after cleavage of the amplified DNA sequence with enzyme PstI. TATE was obtained by morphometric analysis. Chi-square test or Fisher's exact test was used to analyze the association...... of ECP-gene polymorphism 434(G>C) with TATE, demographic, clinical, and microscopic variables in OSCC patients. Disease-free survival and overall survival were calculated by the Kaplan-Meier product-limit actuarial method and the comparison of the survival curves were performed using log rank test...

  14. The novel Cladosporium fulvum lysin motif effector Ecp6 is a virulence factor with orthologues in other fungal species.

    Science.gov (United States)

    Bolton, Melvin D; van Esse, H Peter; Vossen, Jack H; de Jonge, Ronnie; Stergiopoulos, Ioannis; Stulemeijer, Iris J E; van den Berg, Grardy C M; Borrás-Hidalgo, Orlando; Dekker, Henk L; de Koster, Chris G; de Wit, Pierre J G M; Joosten, Matthieu H A J; Thomma, Bart P H J

    2008-07-01

    During tomato leaf colonization, the biotrophic fungus Cladosporium fulvum secretes several effector proteins into the apoplast. Eight effectors have previously been characterized and show no significant homology to each other or to other fungal genes. To discover novel C. fulvum effectors that might play a role in virulence, we utilized two-dimensional polyacrylamide gel electrophoresis (2D-PAGE) to visualize proteins secreted during C. fulvum-tomato interactions. Three novel C. fulvum proteins were identified: CfPhiA, Ecp6 and Ecp7. CfPhiA shows homology to proteins found on fungal sporogenous cells called phialides. Ecp6 contains lysin motifs (LysM domains) that are recognized as carbohydrate-binding modules. Ecp7 encodes a small, cysteine-rich protein with no homology to known proteins. Heterologous expression of Ecp6 significantly increased the virulence of the vascular pathogen Fusarium oxysporum on tomato. Furthermore, by RNA interference (RNAi)-mediated gene silencing we demonstrate that Ecp6 is instrumental for C. fulvum virulence on tomato. Hardly any allelic variation was observed in the Ecp6 coding region of a worldwide collection of C. fulvum strains. Although none of the C. fulvum effectors identified so far have obvious orthologues in other organisms, conserved Ecp6 orthologues were identified in various fungal species. Homology-based modelling suggests that the LysM domains of C. fulvum Ecp6 may be involved in chitin binding.

  15. Denatured Thermodynamics of Proteins in Weak Cation-exchange Chromatography

    Institute of Scientific and Technical Information of China (English)

    LI Rong; CHEN Guo-Liang

    2003-01-01

    The thermostability of some proteins in weak cation-exchange chromatography was investigated at 20-80 ℃. The results show that there is a fixed thermal denaturation transition temperature for each protein. The appearance of the thermal transition temperature indicates that the conformations of the proteins are destroyed seriously. The thermal behavior of the proteins in weak cation-exchange and hydrophobic interaction chromatographies were compared in a wide temperature range. It was found that the proteins have a higher thermostability in a weak cation-exchange chromatography system. The thermodynamic parameters(ΔH0, ΔS0) of those proteins were determined by means of Vant Hoff relationship(lnk-1/T). According to standard entropy change(ΔS0), the conformational change of the proteins was judged in the chromatographic process. The linear relationships between ΔH0 and ΔS0 can be used to evaluate "compensation temperature"(β) at the protein denaturation and identify the identity of the protein retention mechanism in weak cation-exchange chromatography.

  16. Assessment of Schistosoma mansoni induced intestinal inflammation by means of eosinophil cationic protein, eosinophil protein X and myeloperoxidase before and after treatment with praziquantel

    DEFF Research Database (Denmark)

    Reimert, Claus Michael; Tukahebwa, Edridah M.; Kabatereine, Narcis B.;

    2008-01-01

    Western Uganda where Schistosoma mansoni is endemic. Samples were collected before treatment and 5, 15, 20 and 52 weeks after treatment with praziquantel. Significantly increased levels of faecal ECP and EPX were found in S. mansoni infected individuals (n=155) compared to the levels found in stools from...... found between faecal egg counts and faecal concentrations of ECP and EPX. Treatment with praziquantel induced a significant decline in both ECP and EPX, but only a non-significant reduction in faecal MPO. Following reinfection and despite of very low infection intensities, the protein levels increased...... significantly reaching the pre-treatment level (ECP and EPX) or levels significantly higher than the pre-treatment levels (MPO). This response pattern may imply a rebound effect during reinfection following treatment and resolution of immune regulatory immunosuppressive mechanisms in function during the chronic...

  17. Emergency contraception use up -- new ECP arrives.

    Science.gov (United States)

    1999-09-01

    The first progestin-only dedicated emergency contraceptive pill (ECP) is about to enter the US market. The arrival of Plan B, a levonorgestrel-only ECP produced by the Women's Capital Corporation (WCC) of Seattle, has been long awaited by providers in the US because of it is more effective and produces fewer side effects than does the combined regimen. The WCC is taking a different marketing and distributing approach to emergency contraception than its competitor, Gynetics, focusing on existing ECP provider/dispensers such as Planned Parenthood affiliates, major Title X programs, and college/university student health centers. The FDA has also approved a change in product labeling for Gynetics¿ ECU Preven. The change, marked by the disappearance of the "Black Box Warning," puts the benefits and risks of emergency contraception in perspective, according to a Gynetics executive. It further eliminates substantial restrictions on the company's ability to communicate directly to the consumer and to the medical professional. The FDA¿s decisions should help to accelerate the process of building awareness of emergency contraception and its availability in the US.

  18. Circulating fibrosis markers, eosinophil cationic protein and eosinophil protein X in patients with Wuchereria bancrofti infection: association with clinical status

    Directory of Open Access Journals (Sweden)

    Esterre P.

    2006-06-01

    Full Text Available We measured the concentrations of several circulating fibrosis markers (type I collagen I, type III procollagen, hyaluronan and eosinophil granule proteins (ECP and EPX in lymphatic filariasis patients to investigate their relationship with clinical, parasitological and immunological data. This study was conducted in Polynesian patients with various stages of the disease (acute lymphangitis, chyluria, hydrocoele, elephantiasis, a closely related microbial lymphangitis and endemic controls. We observed modifications of the different markers in this pathology. Serum type I collagen and PIIINP were decreased. Serum hyaluronan, linked to perilymphatic granulomatous inflammation, was significantly increased in acute lymphangitis and elephantiasis patients. Serum ECP was also increased, at the limit of significance in our sample, in elephantiasis patients. These two last markers, already validated in another helminth disease, schistosomiasis, have potential interest in terms of follow-up of morbidity in these parasitic diseases.

  19. Analytical methods for soluble microbial products (SMP) and extracellular polymers (ECP) in wastewater treatment systems: a review.

    Science.gov (United States)

    Kunacheva, Chinagarn; Stuckey, David C

    2014-09-15

    Effluents from biological processes contain a wide range of complex organic compounds, including soluble microbial products (SMP) and extracellular polymers (ECP), released during bacteria metabolism in mixed culture in bioreactors. It is important to clearly identify the primary components of SMPs and ECPs in order to understand the fundamental mechanisms of biological activity that create these compounds, and how to reduce these compounds in the effluent. In addition, these compounds constitute the main foulants in membrane bioreactors which are being used more widely around the world. A review on the extraction of ECP, characterization, and identification of SMPs and ECPs is presented, and we summarize up-to-date pretreatments and analytical methods for SMPs. Most researchers have focused more on the overall properties of SMPs and ECPs such as their concentrations, molecular weight distribution, aromaticity, hydrophobic and hydrophilic properties, biodegradability, and toxicity characteristics. Many studies on the identification of effluent SMPs show that most of these compounds were not present in the influent, such as humic acids, polysaccharides, proteins, nucleic acids, organic acids, amino acids, exocellular enzymes, structural components of cells and products of energy metabolism. A few groups of researchers have been working on the identification of compounds in SMPs using advanced analytical techniques such as GC-MS, LC-IT-TOF-MS and MALDI-TOF-MS. However, there is still considerably more work needed to be done analytically to fully understand the chemical characteristics of SMPs and ECPs.

  20. Analytical methods for soluble microbial products (SMP) and extracellular polymers (ECP) in wastewater treatment systems: a review.

    Science.gov (United States)

    Kunacheva, Chinagarn; Stuckey, David C

    2014-09-15

    Effluents from biological processes contain a wide range of complex organic compounds, including soluble microbial products (SMP) and extracellular polymers (ECP), released during bacteria metabolism in mixed culture in bioreactors. It is important to clearly identify the primary components of SMPs and ECPs in order to understand the fundamental mechanisms of biological activity that create these compounds, and how to reduce these compounds in the effluent. In addition, these compounds constitute the main foulants in membrane bioreactors which are being used more widely around the world. A review on the extraction of ECP, characterization, and identification of SMPs and ECPs is presented, and we summarize up-to-date pretreatments and analytical methods for SMPs. Most researchers have focused more on the overall properties of SMPs and ECPs such as their concentrations, molecular weight distribution, aromaticity, hydrophobic and hydrophilic properties, biodegradability, and toxicity characteristics. Many studies on the identification of effluent SMPs show that most of these compounds were not present in the influent, such as humic acids, polysaccharides, proteins, nucleic acids, organic acids, amino acids, exocellular enzymes, structural components of cells and products of energy metabolism. A few groups of researchers have been working on the identification of compounds in SMPs using advanced analytical techniques such as GC-MS, LC-IT-TOF-MS and MALDI-TOF-MS. However, there is still considerably more work needed to be done analytically to fully understand the chemical characteristics of SMPs and ECPs. PMID:24878622

  1. ROLE OF SERUM EOSINOPHILIC CATIONIC PROTEIN AND TRYPTASE IN MYELOPROLIFERATIVE AND LYMPHOPROLIFERATIVE DISORDERS

    Directory of Open Access Journals (Sweden)

    L. S. Komarova

    2008-01-01

    Full Text Available Abstract. A role of intracellular proteins of eosinophils and mast cells remains unclear in the patients with hematological neoplasia. There is a substantial evidence that eosinophils possess some common mechanisms of cooperation with mast cells. Therapeutic interventions into key events controlling eosinophil migration may be a leading factor in treatment of hypereosinophylic states in onco-hematological disorders. Due to unknown functions of eosinophils in majority of eosinophilia-associated diseases, it would be useful to establish an algorithm of accurate diagnostics in the patients with eosinophilia, in order to choose more effective treatment in future.We studied serum levels of secretable eosinophil and mast cells proteins in oncohematological patients with increased eosinophil counts. The aim of our study was to test a significance of quantitative assay for tryptase and ECP in the patients with myelo- and lymphoproliferative diseases. The study group included thirty-eight patients with oncohematological diseases, accompanied by a marked eosinophilia (> 0.4 x 109/L. Eighteen patients with bronchial asthma (BA, and eight cases of solid tumors comprised a reference group for polyclonal eosinophilia. The levels of ECP and tryptase were measured in blood serum using a commercial fluoroimmunoenzyme assay («Pharmacia», Uppsala, Sweden. Total ECP levels were markedly increased in general group with hematological malignancies (p < 0.03, , and in cases of chronic GvHD (p < 0.03, and in a sub-group with lymphoproliferative disorders (р = 0.007 as compared to the group of non-hematological diseases.Serum levels of tryptase were significantly increased in the patients with chronic GvHD after allo-HSCT and lymphoproliferative diseases, as compared to the group of patients with solid tumors (р = 0.03, as well in GvHD compared with lymphoproliferative disorders (р < 0.05.A direct correlation was found between serum ECP levels and absolute

  2. Purification, crystallization and preliminary X-ray diffraction analysis of the Escherichia coli common pilus chaperone EcpB

    Energy Technology Data Exchange (ETDEWEB)

    Garnett, James A.; Diallo, Mamou; Matthews, Steve J., E-mail: s.j.matthews@imperial.ac.uk [Imperial College London, South Kensington, London SW7 2AZ (United Kingdom)

    2015-05-20

    In Escherichia coli, the common pilus (Ecp) belongs to an alternative chaperone–usher pathway that plays a major role in both early biofilm formation and host-cell adhesion. Initial attempts at crystallizing the chaperone EcpB using natively purified protein from the bacterial periplasm were not successful; however, after the isolation of EcpB under denaturing conditions and subsequent refolding, crystals were obtained at pH 8.0 using the sitting-drop method of vapour diffusion. This is the first time that this refolding strategy has been used to purify CU chaperones. Pili are key cell-surface components that allow the attachment of bacteria to both biological and abiotic solid surfaces, whilst also mediating interactions between themselves. In Escherichia coli, the common pilus (Ecp) belongs to an alternative chaperone–usher (CU) pathway that plays a major role in both early biofilm formation and host-cell adhesion. The chaperone EcpB is involved in the biogenesis of the filament, which is composed of EcpA and EcpD. Initial attempts at crystallizing EcpB using natively purified protein from the bacterial periplasm were not successful; however, after the isolation of EcpB under denaturing conditions and subsequent refolding, crystals were obtained at pH 8.0 using the sitting-drop method of vapour diffusion. Diffraction data have been processed to 2.4 Å resolution. These crystals belonged to the trigonal space group P3{sub 1}21 or P3{sub 2}21, with unit-cell parameters a = b = 62.65, c = 121.14 Å and one monomer in the asymmetric unit. Molecular replacement was unsuccessful, but selenomethionine-substituted protein and heavy-atom derivatives are being prepared for phasing. The three-dimensional structure of EcpB will provide invaluable information on the subtle mechanistic differences in biogenesis between the alternative and classical CU pathways. Furthermore, this is the first time that this refolding strategy has been used to purify CU chaperones, and it

  3. Purification, crystallization and preliminary X-ray diffraction analysis of the Escherichia coli common pilus chaperone EcpB.

    Science.gov (United States)

    Garnett, James A; Diallo, Mamou; Matthews, Steve J

    2015-06-01

    Pili are key cell-surface components that allow the attachment of bacteria to both biological and abiotic solid surfaces, whilst also mediating interactions between themselves. In Escherichia coli, the common pilus (Ecp) belongs to an alternative chaperone-usher (CU) pathway that plays a major role in both early biofilm formation and host-cell adhesion. The chaperone EcpB is involved in the biogenesis of the filament, which is composed of EcpA and EcpD. Initial attempts at crystallizing EcpB using natively purified protein from the bacterial periplasm were not successful; however, after the isolation of EcpB under denaturing conditions and subsequent refolding, crystals were obtained at pH 8.0 using the sitting-drop method of vapour diffusion. Diffraction data have been processed to 2.4 Å resolution. These crystals belonged to the trigonal space group P3(1)21 or P3(2)21, with unit-cell parameters a = b = 62.65, c = 121.14 Å and one monomer in the asymmetric unit. Molecular replacement was unsuccessful, but selenomethionine-substituted protein and heavy-atom derivatives are being prepared for phasing. The three-dimensional structure of EcpB will provide invaluable information on the subtle mechanistic differences in biogenesis between the alternative and classical CU pathways. Furthermore, this is the first time that this refolding strategy has been used to purify CU chaperones, and it could be implemented in similar systems where it has not been possible to obtain highly ordered crystals.

  4. Serum insensitive, intranuclear protein delivery by the multipurpose cationic lipid SAINT-2

    NARCIS (Netherlands)

    van der Gun, Bemardina T. F.; Monami, Amlie; Laarmann, Sven; Rasko, Tamas; Slaska-Kiss, Krystyna; Weinhold, Elmar; Wasserkort, Reinhold; de Leij, Lou F. M. H.; Ruiters, Marcel H. J.; Kiss, Antal; McLaughlin, Pamela M. J.

    2007-01-01

    Cationic liposomal compounds are widely used to introduce DNA and siRNA into viable cells, but none of these compounds are also capable of introducing proteins. Here we describe the use of a cationic amphiphilic lipid SAINT-2:DOPE for the efficient delivery of proteins into cells (profection). Label

  5. Eosinophils and eosinophil-derived proteins in children with moderate asthma

    NARCIS (Netherlands)

    Hoekstra, MO; Hovenga, H; Gerritsen, J; Kauffman, HF

    1996-01-01

    Laboratory parameters can contribute to the diagnosis of asthma, which is often a difficult procedure in paediatric patients, The aim of this study was to investigate the value of eosinophil cationic protein (ECP) and eosinophil-derived neurotoxin (EDN) in the diagnosis of paediatric asthma. The num

  6. Divalent cation tolerance protein binds to β-secretase and inhibits the processing of amyloid precursor protein

    Institute of Scientific and Technical Information of China (English)

    Runzhong Liu; Haibo Hou; Xuelian Yi; Shanwen Wu; Huan Zeng

    2013-01-01

    The deposition of amyloid-beta is a pathological hallmark of Alzheimer's disease. Amyloid-beta is derived from amyloid precursor protein through sequential proteolytic cleavages by β-secretase (beta-site amyloid precursor protein-cleaving enzyme 1) and γ-secretase. To further elucidate the roles of beta-site amyloid precursor protein-cleaving enzyme 1 in the development of Alzheimer's disease, a yeast two-hybrid system was used to screen a human embryonic brain cDNA library for proteins directly interacting with the intracellular domain of beta-site amyloid precursor protein-cleaving enzyme 1. A potential beta-site amyloid precursor protein-cleaving enzyme 1- interacting protein identified from the positive clones was divalent cation tolerance protein. Immunoprecipitation studies in the neuroblastoma cell line N2a showed that exogenous divalent cation tolerance protein interacts with endogenous beta-site amyloid precursor protein-cleaving enzyme 1. The overexpression of divalent cation tolerance protein did not affect beta-site amyloid precursor protein-cleaving enzyme 1 protein levels, but led to increased amyloid precursor protein levels in N2a/APP695 cells, with a concomitant reduction in the processing product amyloid precursor protein C-terminal fragment, indicating that divalent cation tolerance protein inhibits the processing of amyloid precursor protein. Our experimental findings suggest that divalent cation tolerance protein negatively regulates the function of beta-site amyloid precursor protein-cleaving enzyme 1. Thus, divalent cation tolerance protein could play a protective role in Alzheimer's disease.

  7. Is it Difficult to Acquire Subjacency and the ECP

    Directory of Open Access Journals (Sweden)

    Chun-yin Doris Chen

    2006-06-01

    Full Text Available This paper aims to examine English- and Japanese-speaking adult learners’ acquisition of Subjacency and the Empty Category Principle (ECP (Chomsky 1981, 1986 in Chinese. The participants were forty intermediate foreign students of the Mandarin Training Center of Nation Taiwan Normal University: half were native English speakers and half Japanese. In addition, there were twenty native controls. Two tasks (i.e., a preference task and an ordering task were designed on the basis of the following properties concerning Subjacency and the ECP: wh-island constraints, complex NP constraints, sentential subject constraints, that-trace effects and subject/object asymmetries, and superiority L2 learners carried their L1 knowledge to acquire Subjacency and the ECP, suggesting the L1 influence is not significant. Furthermore, it was found that the Japanese speakers did not perform significantly better than the English speakers. This shows that Universal Grammar is still available, since our participants have reset their L1 parameters to proper L2 values. In addition, among these features our participants did less well on non-superiority, and the native controls rejected island violations more strongly than either group of L2 participants. Finally, Subjacency and the ECP were found equally easy for our participants to acquire.

  8. Procedure of generation of the ECP database for Laguna Verde

    International Nuclear Information System (INIS)

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  9. Blood-brain barrier transport of cationized immunoglobulin G: Enhanced delivery compared to native protein

    Energy Technology Data Exchange (ETDEWEB)

    Triguero, D.; Buciak, J.B.; Yang, J.; Pardridge, W.M.

    1989-06-01

    IgG molecules are potential neuropharmaceuticals that may be used for therapeutic or diagnostic purposes. However, IgG molecules are excluded from entering brain, owing to a lack of transport of these plasma proteins through the brain capillary wall, or blood-brain barrier (BBB). The possibility of enhanced IgG delivery through the BBB by cationization of the proteins was explored in the present studies. Native bovine IgG molecules were cationized by covalent coupling of hexamethylenediamine and the isoelectric point was raised to greater than 10.7 based on isoelectric focusing studies. Native and cationized IgG molecules were radiolabeled with /sup 125/I and chloramine T. Cationized IgG, but not native IgG, was rapidly taken up by isolated bovine brain microvessels, which were used as an in vitro model system of the BBB. Cationized IgG binding was time and temperature dependent and was saturated by increasing concentrations of unlabeled cationized IgG (dissociation constant of the high-affinity binding site, 0.90 +/- 0.37 microM; Bmax, 1.4 +/- 0.4 nmol per mg of protein). In vivo studies documented enhanced brain uptake of 125I-labeled cationized IgG relative to (3H)albumin, and complete transcytosis of the 125I-labeled cationized IgG molecule through the BBB and into brain parenchyma was demonstrated by thaw-mount autoradiography of frozen sections of rat brain obtained after carotid arterial infusions of 125I-labeled cationized IgG. These studies demonstrate that cationization of IgG molecules greatly facilitates the transport of these plasma proteins through the BBB in vivo, and this process may provide a new strategy for IgG delivery through the BBB.

  10. Utility of anion and cation combinations for phasing of protein structures.

    Science.gov (United States)

    Sharma, Ashwani; Yogavel, Manickam; Sharma, Amit

    2012-09-01

    We report the use of anionic (I(-)), cationic (Ba(2+), Cd(2+)) and ionic mixtures (I(-) plus Ba(2+)) for derivatizing liver fatty acid binding protein (LFABP) crystals. Use of cationic and anionic salts in phasing experiments revealed distinct non-overlapping sites for these ions, suggesting exclusive binding regions on LFABP. Interestingly, cations of identical charge and valency (like Ba(2+) and Cd(2+)) bound to distinct pockets on the protein surface. Furthermore, a mixture of salts containing both I(-) and Ba(2+) was very useful in phasing experiments as these oppositely charged ions bound to different regions of LFABP. Our data therefore suggest that cationic and anionic salt mixtures like BaCl(2) with NH(4)I or salts like CdI, BaI where each ion has a significant anomalous signal for a given X-ray wavelength may be valuable reagents for phasing during structure determination. PMID:22562242

  11. Generation of the ECP database (ECP02.DAT) at the beginning of the cycle 1 of the Unit 1 of Laguna Verde; Generacion de la base ECP (ECP02.DAT) al inicio del ciclo 1 de la Unidad 1 de Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-10-15

    In order to carrying out a comparison among the results provided for the Program of Estimate of the ECP Critical Position and the Shutdown/Startup produced in the Cycle 1 of the Unit 1 of Laguna Verde, it was generated the base of the ECP program, following the outlines settled down in the Procedure 'Generation of ECP Database for Laguna Verde' (IT.SN/DFR 074). Next the data sheets filled when being generated the ECP02.DAT database at the beginning of the cycle are provided. In the IT.SN/DFR 079 report 'Adjustment and Preliminary Evaluation of the Predictions of Criticity of the ECP Program with Reported Data of Cycle 1 of the Unit 1 of Laguna Verde, the results of the comparison among the estimates of the ECP program using the ECP02.DAT with the real data of the Cycle 1 of the Unit 1 of Laguna Verde are presented. (Author)

  12. Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany

    Directory of Open Access Journals (Sweden)

    Epplen Jörg T

    2008-11-01

    Full Text Available Abstract Background Atopic dermatitis (AD is believed to result from complex interactions between genetic and environmental factors. A main feature of AD as well as other allergic disorders is serum and tissue eosinophilia. Human eosinophils contain high amounts of cationic granule proteins, including eosinophil cationic protein (ECP, eosinophil-derived neurotoxin (EDN, eosinophil peroxidase (EPO and major basic protein (MBP. Recently, variation in genes encoding eosinophil granule proteins has been suggested to play a role in the pathogenesis of allergic disorders. We therefore genotyped selected single nucleotide polymorphisms within the ECP, EDN, EPO and MBP genes in a cohort of 361 German AD patients and 325 healthy controls. Results Genotype and allele frequencies did not differ between patients and controls for all polymorphisms investigated in this study. Haplotype analysis did not reveal any additional information. Conclusion We did not find evidence to support an influence of variation in genes encoding eosinophil granule proteins for AD pathogenesis in this German cohort.

  13. 嗜酸粒细胞和嗜酸粒细胞阳离子蛋白在气道高反应性患者诊断中的价值%Diagnostic Value of Eosinophil Count and Eosinophil Cationic Protein in the Patients with Airway Hyperresponsiveness

    Institute of Scientific and Technical Information of China (English)

    吴小军; 聂汉祥; 丁续红; 余红樱; 黄毅; 李清泉

    2011-01-01

    Objective: To determine the diagnostic value of eosinophil count and eosinophil cationic protein (ECP) in the patients with chronic cough and/or chest tightness and airway hyperresponsiveness (AHR). Methods: A total of 378 subjects with mild respiratory symptoms were screened through methacholine challenge test (MCT) and the patients with positive MCT were further studied and followed up. They underwent further laboratory studies, including serum eosinophil count, sputum eosinophil count, and sputum ECP analysis. All the patients with AHR were considered suspected diagnosed asthma and were systematic treated according to GINA. A final diagnosis of asthma was made by reactivity to therapy and 24 months' follow-up. Results: Of all the 112 positive subjects, 83 subjects (74.1%) were diagnosed as asthma and 25 (22.3%) subjects were considered non-asthmatics. Serum eosinophil count of the asthma patients was different from that of the non-asthma patients ([4.8±3.5]% vs [1.2±2. 1]%, P<0.01) ; the eosinophil count and ECP of induced sputum in non-asthma group were (2. 1±1.3)% and 57. 7±18. 7 μg/L, respectively, which were lower than those in subjects with asthma (9. 4±3.2 and 289.4± 112.3μg/L, respectively, both P<0.01). The concordance of eosinophil count and ECP of induced sputum was high in the diagnosis of asthma. Conclusion: The sputum eosinophils, ECP and serum eosinophils are important indicators in diagnosing for asthma.%目的:探讨嗜酸粒细胞和嗜酸粒细胞阳离子蛋白(ECP)在气道高反应性患者诊断中的价值.方法:378名慢性咳嗽和/或胸闷病人作激发试验,激发试验阳性者作进一步的检查,包括血清嗜酸粒细胞、痰液嗜酸粒细胞和ECP.排除其它疾病后,这些病人被拟诊为支气管哮喘,根据GINA方案进行规范治疗,并追踪24个月.结果:83名患者诊断为哮喘,25名诊断为非哮喘,哮喘患者血清嗜酸细胞计数为(4.8±3.5)%,明显高于非哮喘患者[(1.2

  14. The effects of ultrashortwave irradiation and chest-wall vibration therapy on serum eosinophil cationic protein and the percentage of eosinophil in the sputum of children with asthma%超短波和胸壁振动辅助治疗对轻、中度儿童哮喘诱导痰EOS及血清ECP的影响

    Institute of Scientific and Technical Information of China (English)

    赵飞; 乔艳红; 刘丰; 王一彪

    2008-01-01

    Objective To study the effect of ultrashortwave irradiation and chest-wall vibration therapy on serum eosinophil cationic protein(ECP)and percentage of eosinophil(EOS%)in the sputum of children with mild to moderate asthma. Methods A total of 68 children with asthma were divided into a control group and a treatment group.The control group WaS treated with conventional treatment only,while the treatment group was given ultrashortwave irradiation and chest-wall vibration therapy in addition to the conventional treatment.The serum ECP,EOS% in induced sputum,FEV1.0%,and PEF% were measured before and after treatment.The relationships among ECP,EOS%,FEV1.0% and PEF% were analyzed.Results FEV1.0% and PEF% were negatively correlated with serum ECP and EOS% in children with asthma.Compared with the control group,ECP and EOS% were significantly reduced after treatment,while FEV1.0% and PEF% were significantly elevated. Conclusion Uhrashortwave irradiation and chest-wall vibration therapy can improve ventilation by ameliorating airway inflammation and obstruction.%目的 探讨超短波和胸壁振动辅助治疗儿童哮喘对诱导痰嗜酸粒细胞百分数(EOS%)、血清嗜酸粒细胞阳离子蛋白(ECP)及肺通气功能的影响.方法 68例哮喘儿童随机分为对照组和治疗组,对照组采用常规治疗,治疗组除常规治疗外,先后行超短波和胸壁振动辅助治疗,并分别于治疗前、后采血测ECP,行肺通气功能检查及诱导痰EOS%分类.结果 哮喘儿童诱导痰EOS%、血清ECP与肺通气功能指标第1秒最大呼气量占预计值的百分数(FEV1.0%)及呼气峰流速占预计值的百分数(PEF%)均呈显著负相关(P<0.01);与对照组比较,治疗后治疗组血清ECP、诱导痰EOS%均显著降低,FEV1.0%、PEF%显著升高(P<0.05或0.01).结论 超短波和胸壁振动辅助治疗儿童哮喘具有减轻气道炎症和气道受阻、提高肺通气功能的作用.

  15. Fact and fiction in ECP measurement and control

    International Nuclear Information System (INIS)

    A review is presented of various electrochemical potentials, including the electrochemical corrosion potential, ECP, and the redox potential (Eredox) that are used in describing corrosion processes that occur in aqueous systems and for controlling and mitigating stress corrosion cracking in the primary coolant circuits of nuclear power reactors (primarily BWRs). Attention is paid to carefully defining each potential in terms of fundamental electrochemical concepts, so as to counter the confusion that has arisen amongst practitioners and theorists alike, due to the misuse of previously accepted terminology. A brief discussion is also included of reference electrodes and it is shown that the use of a platinum redox sensor as a reference electrode in the monitoring of ECP in BWR primary coolant circuits is inappropriate unless it is demonstrated to yield a potential that is invariant with changes in the composition of the medium. Data from laboratory experiments in simulated BWR coolant and model calculations argue that the potential of the Pt redox sensor is not invariant with respect to composition under the conditions that exist in BWR pressure vessels and hence the use of a Pt sensor as a reference electrode is inappropriate. (author)

  16. Cationic antimicrobial protein of Mr 37 kDa: a multifunctional inflammatory protein

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Purpose To investigate the role of cationic antimicrobial protein of Mr 37?kDa (CAP37) a neutrophil-derived inflammatory mediator on endothelial cell function. Data sources Endothelial cells used in this study were obtained from human lung microvessels and rat aorta. The latter was a kind gift of Dr. Paula Grammas. The mono-mac 6 cell line used in this study was the generous gift of Dr. H.W. Loms Ziegler-Heitbrock. Study selection and data extraction Endothelial cell proteins kinase C activity was determined by measuring calcium- and phospholipid-dependent phosphorylation of histone. Endothelial cell migration was determined using CostarTM Transwell apparatus. Cell surface expression of adhesion molecules, ICAM-1 and PECAM-1 was determined using flow cytometry. RT-PCR was used to amplify the CAP37 from endothelial cells treated with LPS. Results We demonstrated that CAP37 which was originally identified as having potent antimicrobial activity and chemotactic activity for monocytes was capable of modulating endothelial cell functions. CAP37 activated endothelial cell protein kinase C in a dose- and time-dependent fashion. Importantly CAP37 increased the adhesive properties of the endothelium for monocytes. CAP37 upregulated the well known adhesion molecules, ICAM-1 and PECAM-1 in a dose- and time- dependent manner. In addition, CAP37 promoted endothelial cell migration. Further investigations indicated that CAP37 was induced in endothelial cells in response to pro-inflammatory cytokines such as tumor necrosis factor-α and interleukin-1α as well as inflammatory mediators such as lipopolysaccharide. Unstimulated endothelial cells did not constitutively express CAP37. The cDNA sequence of endothelial CAP37 was determined and found to be highly homologous to the sequence obtained for neutrophil-derived CAP37. Conclusions Our studies strongly suggest that CAP37 plays a pivotal role in monocyte-endothelial interactions and the transmigration of monocytes from

  17. Effect of synthetic cationic protein on mechanoexcitability of vagal afferent nerve subtypes in guinea pig esophagus.

    Science.gov (United States)

    Yu, Shaoyong; Ouyang, Ann

    2011-12-01

    Eosinophilic esophagitis is characterized by increased infiltration and degranulation of eosinophils in the esophagus. Whether eosinophil-derived cationic proteins regulate esophageal sensory nerve function is still unknown. Using synthetic cationic protein to investigate such effect, we performed extracellular recordings from vagal nodose or jugular neurons in ex vivo esophageal-vagal preparations with intact nerve endings in the esophagus. Nerve excitabilities were determined by comparing action potentials evoked by esophageal distensions before and after perfusion of synthetic cationic protein poly-L-lysine (PLL) with or without pretreatment with poly-L-glutamic acid (PLGA), which neutralized cationic charges of PLL. Perfusion with PLL did not evoke action potentials in esophageal nodose C fibers but increased their responses to esophageal distension. This potentiation effect lasted for 30 min after washing out of PLL. Pretreatment with PLGA significantly inhibited PLL-induced mechanohyperexcitability of esophageal nodose C fibers. In esophageal nodose Aδ fibers, perfusion with PLL did not evoke action potentials. In contrast to nodose C fibers, both the spontaneous discharges and the responses to esophageal distension in nodose Aδ fibers were decreased by perfusion with PLL, which can be restored after washing out PLL for 30-60 min. Pretreatment with PLGA attenuated PLL-induced decrease in spontaneous discharge and mechanoexcitability of esophageal nodose Aδ fibers. In esophageal jugular C fibers, PLL neither evoked action potentials nor changed their responses to esophageal distension. Collectively, these data demonstrated that synthetic cationic protein did not evoke action potential discharges of esophageal vagal afferents but had distinctive sensitization effects on their responses to esophageal distension.

  18. Binding of cationic surfactants to DNA, protein and DNA-protein mixtures.

    Science.gov (United States)

    Gani, S A; Chattoraj, D K; Mukherjee, D C

    1999-06-01

    Extent of binding (gamma 2(1)) of cationic surfactants cetyltrimethyl ammonium bromide (CTAB), myristyltrimethyl ammonium bromide (MTAB) and dodecyl trimethyl ammonium bromide (DTAB) to calf-thymus DNA, bovine serum albumin (BSA) and to their binary mixture respectively have been measured as function of bulk concentration of the surfactant by using equilibrium dialysis technique. Binding of CTAB has been studied at different pH, ionic strength (mu), temperature and biopolymer composition and with native and denatured states of the biopolymers. The chain-length of different long chain amines plays a significant role in the extent of binding under identical solution condition. The binding ratios for CTAB to collagen, gelatin, DNA-collagen and DNA-gelatin mixtures respectively have also been determined. The conformational structures of different biopolymers are observed to play significant role in macromolecular interactions between protein and DNA in the presence of CTAB. From the experimental values of the maximum binding ratio (gamma 2m) at the saturation level for each individual biopolymer, ideal values (gamma 2m)id have been theoretically calculated for binary mixtures of biopolymers using additivity rule. The protein-DNA-CTAB interaction in mixture has been explained in terms of the deviation (delta) of (gamma 2m) from (gamma 2m)id in the presence of a surfactant in bulk. The binding of surfactants to biopolymers and to their binary mixtures are compared more precisely in terms of the Gibbs' free energy decrease (-delta G degree) for the saturation of the binding sites in the biopolymers or biopolymer mixtures with the change of the bulk surfactant activity from zero to unity in the rational mole fraction scale. PMID:10650715

  19. Protein phylogenetic analysis of Ca2+/cation antiporters and insights into their evolution in plants

    Directory of Open Access Journals (Sweden)

    Laura eEmery

    2012-01-01

    Full Text Available Cation transport is a critical process in all organisms and is essential for mineral nutrition, ion stress tolerance, and signal transduction. Transporters that are members of the Ca2+/Cation Antiporter (CaCA superfamily are involved in the transport of Ca2+ and/or other cations using the counter exchange of another ion such as H+ or Na+. The CaCA superfamily has been previously divided into five transporter families: the YRBG, NCX, NCKX, CAX and CCX families, which include the well-characterized Na+/Ca2+ exchanger (NCX and H+/cation exchanger (CAX transporters. To examine the evolution of CaCA transporters within higher plants and the green plant lineage, CaCA genes were identified from the genomes of sequenced flowering plants, a bryophyte, lycophyte, and freshwater and marine algae, and compared with those from non-plant species. We found evidence of the expansion and increased diversity of flowering plant genes within the CAX and CCX families. Genes related to the NCX family are present in land plant though they encode distinct MHX homologs which probably have an altered transport function. In contrast, the NCX and NCKX genes which are absent in land plants have been retained in many species of algae, especially the marine algae, indicating that these organisms may share ‘animal-like’ characteristics of Ca2+ homeostasis and signaling. A group of genes encoding novel CAX-like proteins containing an EF hand domain were identified from plants and selected algae but appeared to be lacking in any other species. Lack of functional data for most of the CaCA proteins make it impossible to reliably predict substrate specificity and function for many of the groups or individual proteins. The abundance and diversity of CaCA genes throughout all branches of life indicates the importance of this class of cation transporter, and that many transporters with novel functions are waiting to be discovered.

  20. Helicobacter pylori Outer Membrane Vesicle Proteins Induce Human Eosinophil Degranulation via a β2 Integrin CD11/CD18- and ICAM-1-Dependent Mechanism

    Directory of Open Access Journals (Sweden)

    Su Hyuk Ko

    2015-01-01

    Full Text Available Eosinophil cationic protein (ECP, a cytotoxic protein contained in eosinophils granules, can contribute to various inflammatory responses. Although Helicobacter pylori infection increases infiltration of eosinophils, the mechanisms of eosinophil degranulation by H. pylori infection are largely unknown. The goal of this study was to investigate the role of H. pylori outer membrane vesicles (OMVs in modulating eosinophil degranulation. We found that eosinophils treated with H. pylori OMVs released significantly more ECP compared with untreated controls. In addition, eosinophils cocultured with OMV-preexposed primary gastric epithelial cells exhibited significantly increased ECP release. Similarly, eosinophils cocultured with culture supernatant (CM from primary gastric epithelial cells exposed to OMVs (OMV-CM released significantly higher amounts of ECP compared with eosinophils cocultured with CM from unexposed control cells. Furthermore, OMVs and OMV-CM both induced the upregulation of ICAM-1 on gastric epithelial cells and β2 integrin CD11b on eosinophils. In addition, both transduction of ICAM-1 shRNA into gastric epithelial cells and treatment with neutralizing mAbs to CD18 significantly decreased OMV-mediated or OMV-CM-mediated release of ECP. These results suggest that the eosinophil degranulation response to H. pylori OMVs occurs via a mechanism that is dependent on both β2 integrin CD11/CD18 and ICAM-1.

  1. Design of cationic microspheres based on aminated gelatin for controlled release of peptide and protein drugs.

    Science.gov (United States)

    Morimoto, Kazuhiro; Chono, Sumio; Kosai, Tadashi; Seki, Toshinobu; Tabata, Yasuhiko

    2008-02-01

    Two different types of cationized microspheres based on a native cationic gelatin (NGMS) and aminated gelatin with ethylendiamine (CGMS) were investigated for the controlled release of three model acidic peptide/protein drugs with different molecular weights (MWs) and isoelectric points (IEPs). Recombinant human (rh)-insulin (MW: 5.8 kDa, IEP: 5.3), bovine milk lactoalbumin, BMLA (MW: 14 kDa, IEP: 4.3), and bovine serum albumin (BSA MW: 67 kDa, IEP: 4.9) were used as model acidic peptide/protein drugs. The in vitro release profiles of these acidic peptide/protein drugs from NGMS and CGMS were compared and different periods of cross-linking were obtained. The slower release of these acidic peptide/protein drugs from CGMS compared with those from NGMS with cross-linking for 48 hr. was caused by the suppression of burst release during the initial phase. The degree of suppression of burst release of the three peptide/protein drugs during the initial phase by CGMS was in the following order: (rh)-insulin > BMLA > BSA. The release of insulin with a lower molecular weight from CGMS was particularly suppressed compared with the other two drugs with higher molecular weights in the initial phase. The control of the release rate of acidic peptide/protein drugs from gelatin microsphere can be achieved by amination of gelatin. Therefore, CGMS is useful for the controlled release of acidic peptide/ protein drugs.

  2. Cold-set hydrogels made of whey protein nanofibrils with different divalent cations.

    Science.gov (United States)

    Mohammadian, Mehdi; Madadlou, Ashkan

    2016-08-01

    Whey protein nanofibrils are gaining interest to fabricate cold-set hydrogels due to their ability to gel at lower concentrations than parent proteins. In the present research, fibrillated protein solution was gelled with three different divalent cation salts including CaCl2, MnCl2 and ZnCl2 and the textural and functional characteristics of the resulting hydrogel samples were studied. Atomic force microscopy indicated that the flexible micron-scaled fibrils with nanometric thickness (up to 8.0nm) that formed at pH 2.0 underwent breaking in length upon post-formation pH rise to 7.5. Whilst heat-denatured protein solution failed to form self-supporting gel at pH 7.5, fibrillated protein solution gelled by all three types of cations. Fibrillation increased the protein solution consistency coefficient (K) much more than heat denaturation. It was suggested based on Fourier-transform infra-red (FT-IR) spectra that some hydrogen bonds were disrupted by fibrillation. Zn(2+)-induced gel was firmer, had a higher water holding capacity and a more compact microstructure, as well, required a higher compressive stress to fracture than its counterparts. Nonetheless, the Mn(2+)- and Ca(2+)-induced gels disintegrated to a much lesser extent in both pepsin-free and pepsin-present simulated gastric juice than Zn(2+)-induced sample. Chitosan coating approximately halved the simulated degradability of all gel samples. PMID:27155233

  3. Effect of Pingmin Granule (PMG) on Chronic Eczema and Its Impact on Serum Levels of TNF-2α, sIL-2R and ECP%平敏冲剂治疗慢性湿疹及其对患者血清中TNF-2α,sIL-2R和ECP水平的影响

    Institute of Scientific and Technical Information of China (English)

    曾金贵; 喻国华; 刘建国

    2012-01-01

    目的:观察平敏冲剂对慢性湿疹患者的疗效及其对血清肿瘤坏死因子2α(TNF-2α)、可溶性白细胞介素2受体(sIL-2R)、嗜酸细胞阳离子蛋白(ECP)水平的影响.方法:将71例慢性湿疹患者随机分为平敏冲剂组与西替利嗪组,采用ELISA法检测两组治疗前后血清TNF-2α,sIL-2R及ECP水平,并观察疗效.结果:平敏冲剂组有效率86.1%,西替利嗪组有效率54.3%,两组比较差异有统计学意义(P<0.05);且平敏冲剂组复发率8.0%低于西替利嗪组41.4%,两组比较差异有统计学意义(P<0.05).慢性湿疹患者血清TNF-2α,sIL-2R及ECP水平较健康组明显升高(P<0.01),平敏冲剂组与西替利嗪组比较能显著降低患者血清中的TNF-2α[(36.93±9.51),(42.83±11.72)ng·L-1,(P<0.05)],sIL-2R[(46.42±10.61),(53.34±15.66) μg·L-1,(P<0.05)],ECP[(25.81±9.64),(30.16 ±8.68)μg·L-1,(P <0.05)].结论:平敏冲剂对慢性湿疹具有良好的疗效,调节TNF-2α,sIL-2R与ECP的血清水平可能是其作用机制.%Objective: To study effect of Pingmin Granule (PMG) on chronic eczema and its impact on tumor necrosis factor 2α (TNF-2α) , soluble inter leukin 2 thereceptor (slL-2R) and eosinophil cationic protein ( ECP) levels. Method: The effects of PMG and cetirizine on chronic eczema patients in two groups were observed respectively, and the serum levels of TNF-2α, slL-2R and ECP were measured by ELISA before and after treatment. Result: In PMG group effective rate was 86. 1% vs 54. 3% (cetirizine) and recurrence rate was 8. 0% vs 44. 4% ( cetirizine) ( all P < 0. 05 ) . Serum levels of TNF-2α, slL-2R and ECP in patients were higher than those in normal subjects ( P < 0. 01 ) , and PMG group could be significantly lower than cetirizine group in the serum of.patients with TNF-2α [ (36.93 ±9.51), (42.83 ± 11.72) ng ·L-1, (P < 0. 05) ], sIL-2R [ (46.42 ±10.61), (53.34±15.66) μg·L-1, (P<0.05)], ECP [ (25.81±9.64) , (30.16±8.68) μg · L-1, (P <0. 05

  4. Cationic versus anionic surfactant in tuning the structure and interaction of nanoparticle, protein, and surfactant complexes.

    Science.gov (United States)

    Mehan, Sumit; Aswal, Vinod K; Kohlbrecher, Joachim

    2014-08-26

    The structure and interaction in complexes of anionic Ludox HS40 silica nanoparticle, anionic bovine serum albumin (BSA) protein, and cationic dodecyl trimethylammonium bromide (DTAB) surfactant have been studied using small-angle neutron scattering (SANS). The results are compared with similar complexes having anionic sodium dodecyl sulfate (SDS) surfactant (Mehan, S; Chinchalikar, A. J.; Kumar, S.; Aswal, V. K.; Schweins, R. Langmuir 2013, 29, 11290). In both cases (DTAB and SDS), the structure in nanoparticle-protein-surfactant complexes is predominantly determined by the interactions of the individual two-component systems. The nanoparticle-surfactant (mediated through protein-surfactant complex) and protein-surfactant interactions for DTAB, but nanoparticle-protein (mediated through protein-surfactant complex) and protein-surfactant interactions for SDS, are found to be responsible for the resultant structure of nanoparticle-protein-surfactant complexes. Irrespective of the charge on the surfactant, the cooperative binding of surfactant with protein leads to micellelike clusters of surfactant formed along the unfolded protein chain. The adsorption of these protein-surfactant complexes for DTAB on oppositely charged nanoparticles gives rise to the protein-surfactant complex-mediated aggregation of nanoparticles (similar to that of DTAB surfactant). It is unlike that of depletion-induced aggregation of nanoparticles with nonadsorption of protein-surfactant complexes for SDS in similarly charged nanoparticle systems (similar to that of protein alone). The modifications in nanoparticle aggregation as well as unfolding of protein in these systems as compared to the corresponding two-component systems have also been examined by selectively contrast matching the constituents.

  5. Generation of the ECP database (ECP01.DAT) of the cycle 1 of the Unit 1 of Laguna Verde with burnt of 1377 MWD/MT; Generacion de la base ECP (ECP01.DAT) del ciclo 1 de la Unidad 1 de Laguna Verde con quemado de 1377 MWD/MT

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-10-15

    In order to carrying out a comparison among the results provided by the Program of Estimate of the ECP Critical Position and the Shutdown/Startup produced in the Cycle 1 of the Unit 1 of Laguna Verde, it was generated the base of the ECP program, following the outlines settled down in the Procedure 'Generation of ECP Database for Laguna Verde' (IT.SN/DFR-074). Next the data sheets filled when being generated the ECP01.DAT database with a burnt of 1377 MWD/MT are provided. In the report IT.SN/DFR-079 'Adjustment and Preliminary Evaluation of the Predictions of Criticity of the ECP Program with Reported Data of the Cycle 1 of the Unit 1 of Laguna Verde', the results of the comparison among those estimates of the ECP program using the ECP01.DAT database with the real data of the Cycle 1 of the Unit 1 of Laguna Verde are presented. (Author)

  6. 粪便嗜酸粒细胞阳离子蛋白对溃疡性结肠炎活动性的评价价值%Significance of Fecal Eosinophil Cationic Protein in the Evaluation of Disease Activity in Ulcerative Colitis

    Institute of Scientific and Technical Information of China (English)

    龙彦; 李俊霞; 冯珍如; 邢凌生; 李志艳; 柏明见; 王美玲; 闫存林; 郑新芝

    2012-01-01

    诊断效能最好.结论 粪便ECP与UCAI有很好的相关性,诊断效能优于血清CRP和ESR,有助于临床判断UC活动性,但对活动期患者活动度的判断价值有限;可作为一种简便、经济、准确、灵敏、无创的生物标记物用于监测UC活动性.%Objective To investigate the value of fecal eosinophil cationic protein ( ECP ) in the evaluation of the activity of ulcerative colitis ( UC ). Methods 45 UC patients confirmed in the Department of Digestive System of the First Hospital of Peking University from January 2010 to April 2012 were selected as case group. The patients were divided into remission group ( 19 cases ) and active group ( 26 cases ) according to Mayo disease activity index ( UCAI ), diarrhea times, hemafecia, mucous membrane condition and the doctor's assessment. Patients in active group were also divided into slightly active group ( 5 cases ), moderately active group ( 9 cases ) and severely active group ( 12 cases ). 30 healthy people who underwent physical examination in the same period were selected as control group. Fluorescence enzyme - immunoassay method was used to quantitatively detect the levels of ECP as well as C - reactive protein ( CRP ) and erythrocyte sedimentation rate ( ESR ) in each group. SPSS 13. 0 was used to make statistical analysis. Receiver Operating Characteristic ( ROC ) curve was drawn and the area of AUC and Youden's index were calculated. The diagnostic efficiency of each index for the evaluation of the UC activity was assessed. Results The levels of fecal ECP between each group showed statistically significant differences ( P =0. 000 ). The level of fecal ECP in the active group was significantly higher than that of the remission group ( P 0. 05 ), and the level of the remission group was significantly high- er than that of the control group ( P 0. 05 ). The ECP levels of the UC patients with different activity levels showed statistically significant differences ( P = 0. 012 ), among which the slightly active

  7. Procedure of generation of the ECP database for Laguna Verde; Procedimiento de generacion de base de datos ECP para Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-09-15

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  8. The specificity of protection against cationic antimicrobial peptides by lactoferrin binding protein B.

    Science.gov (United States)

    Morgenthau, Ari; Partha, Sarathy K; Adamiak, Paul; Schryvers, Anthony B

    2014-10-01

    A variety of Gram-negative pathogens possess host-specific lactoferrin (Lf) receptors that mediate the acquisition of iron from host Lf. The integral membrane protein component of the receptor, lactoferrin binding protein A specifically binds host Lf and is required for acquisition of iron from Lf. In contrast, the role of the bi-lobed surface lipoprotein, lactoferrin binding protein B (LbpB), in Lf binding and iron acquisition is uncertain. A common feature of LbpBs from most species is the presence of clusters of negatively charged amino acids in the protein's C-terminal lobe. Recently it has been shown that the negatively charged regions from the Neisseria meningitidis LbpB are responsible for protecting against an 11 amino acid cationic antimicrobial peptide (CAP), lactoferricin (Lfcin), derived from human Lf. In this study we investigated whether the LbpB confers resistance to other CAPs since N. meningitidis is likely to encounter other CAPs from the host. LbpB provided protection against the cathelicidin derived peptide, cathelicidin related antimicrobial peptide (mCRAMP), but did not confer protection against Tritrp 1 or LL37 under our experimental conditions. When tested against a range of rationally designed synthetic peptides, LbpB was shown to protect against IDR-1002 and IDR-0018 but not against HH-2 or HHC10. PMID:25038734

  9. Analysis of Native-Like Proteins and Protein Complexes Using Cation to Anion Proton Transfer Reactions (CAPTR)

    Science.gov (United States)

    Laszlo, Kenneth J.; Bush, Matthew F.

    2015-12-01

    Mass spectra of native-like protein complexes often exhibit narrow charge-state distributions, broad peaks, and contributions from multiple, coexisting species. These factors can make it challenging to interpret those spectra, particularly for mixtures with significant heterogeneity. Here we demonstrate the use of ion/ion proton transfer reactions to reduce the charge states of m/ z-selected, native-like ions of proteins and protein complexes, a technique that we refer to as cation to anion proton transfer reactions (CAPTR). We then demonstrate that CAPTR can increase the accuracy of charge state assignments and the resolution of interfering species in native mass spectrometry. The CAPTR product ion spectra for pyruvate kinase exhibit ~30 peaks and enable unambiguous determination of the charge state of each peak, whereas the corresponding precursor spectra exhibit ~6 peaks and the assigned charge states have an uncertainty of ±3%. 15+ bovine serum albumin and 21+ yeast enolase dimer both appear near m/ z 4450 and are completely unresolved in a mixture. After a single CAPTR event, the resulting product ions are baseline resolved. The separation of the product ions increases dramatically after each subsequent CAPTR event; 12 events resulted in a 3000-fold improvement in separation relative to the precursor ions. Finally, we introduce a framework for interpreting and predicting the figures of merit for CAPTR experiments. More generally, these results suggest that CAPTR strongly complements other mass spectrometry tools for analyzing proteins and protein complexes, particularly those in mixtures.

  10. Multi-colored fibers by self-assembly of DNA, histone proteins, and cationic conjugated polymers.

    Science.gov (United States)

    Wang, Fengyan; Liu, Zhang; Wang, Bing; Feng, Liheng; Liu, Libing; Lv, Fengting; Wang, Yilin; Wang, Shu

    2014-01-01

    The development of biomolecular fiber materials with imaging ability has become more and more useful for biological applications. In this work, cationic conjugated polymers (CCPs) were used to construct inherent fluorescent microfibers with natural biological macromolecules (DNA and histone proteins) through the interfacial polyelectrolyte complexation (IPC) procedure. Isothermal titration microcalorimetry results show that the driving forces for fiber formation are electrostatic and hydrophobic interactions, as well as the release of counterions and bound water molecules. Color-encoded IPC fibers were also obtained based on the co-assembly of DNA, histone proteins, and blue-, green-, or red- (RGB-) emissive CCPs by tuning the fluorescence resonance energy-transfer among the CCPs at a single excitation wavelength. The fibers could encapsulate GFP-coded Escherichia coli BL21, and the expression of GFP proteins was successfully regulated by the external environment of the fibers. These multi-colored fibers show a great potential in biomedical applications, such as biosensor, delivery, and release of biological molecules and tissue engineering.

  11. Translation of the Hope Creek procedure of generation of the ECP database; Traduccion del procedimiento de Hope Creek de generacion de base de datos ECP

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-10-15

    This procedure contains the methodology and the necessary data sheets for the execution of PRESTO runs to generate the data for the ECP program. The data consist of corrections of the Moderator Temperature like a function of the bar density, xenon value like a function of the numeric density, and k-effective like a function of the extracted notches. This procedure will only be used for a list of extraction of sequence bars A-2. (Author)

  12. ECP and localized corrosion of steam generator tube materials under simulated crevice conditions

    International Nuclear Information System (INIS)

    The electrochemical corrosion potential (ECP) of tube materials was measured to provide input into attempts to determine the stress-corrosion cracking (SCC), pitting and under-deposit corrosion susceptibility of SG tube materials. All measurements were performed under faulted steam generator (SG) water and MULTEQ-calculated crevice chemistry conditions-which include crevice conditions resulting from seawater ingress, and simulated Bruce Nuclear Generating Station A (BNGS A) crevice conditions. The effect of magnetite sludge, and of minor impurities in the sludge, on the ECP of the SG tube materials was studied by comparing the ECP of sludge-coated and uncoated samples. Experimental results revealed that magnetite sludge deposits containing a variety of impurities- including nickel ferrite, lead oxide and zinc silicate --- can increase die ECP by more than 100 mV. Significant positive shifts in the ECP of the SG tube materials were also observed in simulated BNGS A crevice chemistries. In these simulated chemistry environments, 100 ppm of PbO and 30 g/L of SiO2 were added. In most cases, the measured ECP values for tube materials under crevice chemistry conditions were lower than the passive film breakdown potential of SG tube materials. This discrepancy is due to localized corrosion that had already taken place in the aggressive crevice electrolyte. The kinetics of localized corrosion depends on many factors. This diversity makes it difficult to reproduce the observed ECP values of SG tube materials. For instance, the measured value in simulated seawater crevice solution varied between -590 and -250 mV (SHE). The SG tube in the crevice is coupled with the tube free-span. The ECP of tube alloy in the crevice will also be influenced by the ECP at the tube free-span area. Because of the hideout of impurities and because of a higher temperature inside a crevice than at the tube free-span, the anodic kinetics of the tube material inside the crevice may be enhanced. A

  13. Separation of proteins by cation-exchange sequential injection chromatography using a polymeric monolithic column.

    Science.gov (United States)

    Masini, Jorge Cesar

    2016-02-01

    Since sequential injection chromatography (SIC) emerged in 2003, it has been used for separation of small molecules in diverse samples, but separations of high molar mass compounds such as proteins have not yet been described. In the present work a poly(glycidyl methacrylate-co-ethylene dimethacrylate) (GMA-co-EDMA) monolithic column was prepared by free radical polymerization inside a 2.1-mm-i.d. activated fused silica-lined stainless steel tubing and modified with iminodiacetic acid (IDA). The column was prepared from a mixture of 24% GMA, 16% EDMA, 20% cyclohexanol, and 40% 1-dodecanol (all% as w/w) containing 1% of azobisisobutyronitrile (AIBN) (in relation to monomers). Polymerization was done at 60 °C for 24 h. The polymer was modified with 1.0 M IDA (in 2 M Na2CO3, pH 10.5) at 80 °C for 16 h. Separation of myoglobin, ribonuclease A, cytochrome C, and lysozyme was achieved at pH 7.0 (20 mM KH2PO4/K2HPO4) using a salt gradient (NaCl). Myoglobin was not retained, and the other proteins were separated by a gradient of NaCl created inside the holding coil (4 m of 0.8-mm-i.d. PTFE tubing) by sequential aspiration of 750 and 700 μL of 0.2 and 0.1 M NaCl, respectively. As the flow was reversed toward the column (5 μL s(-1)) the interdispersion of these solutions created a reproducible gradient which separated the proteins in 10 min, with the following order of retention: ribonuclease A < cytochrome C < lysozyme. The elution order was consistent with a cation-exchange mechanism as the retention increased with the isoelectric points.

  14. A Low Protein Binding Cationic Poly(2-oxazoline) as Non-Viral Vector

    KAUST Repository

    He, Zhijian

    2015-04-02

    © 2015 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim. Developing safe and efficient non-viral gene delivery systems remains a major challenge. We present a new cationic poly(2-oxazoline) (CPOx) block copolymer for gene therapy that was synthesized by sequential polymerization of non-ionic 2-methyl-2-oxazoline and a new 2-oxazoline monomer, 2-(N-methyl, N-Boc-amino)-methyl-2-oxazoline, followed by deprotection of the pendant secondary amine groups. Upon mixing with plasmid DNA (pDNA), CPOx forms small (diameter ≈80 nm) and narrowly dispersed polyplexes (PDI <0.2), which are stable upon dilution in saline and against thermal challenge. These polyplexes exhibited low plasma protein binding and very low cytotoxicity in vitro compared to the polyplexes of pDNA and poly(ethylene glycol)-b-poly(L-lysine) (PEG-b-PLL). CPOx/pDNA polyplexes at N/P = 5 bound considerably less plasma protein compared to polyplexes of PEG-b-PLL at the same N/P ratio. This is a unique aspect of the developed polyplexes emphasizing their potential for systemic delivery in vivo. The transfection efficiency of the polyplexes in B16 murine melanoma cells was low after 4 h, but increased significantly for 10 h exposure time, indicative of slow internalization of polyplexes. Addition of Pluronic P85 boosted the transfection using CPOx/pDNA polyplexes considerably. The low protein binding of CPOx/pDNA polyplexes is particularly interesting for the future development of targeted gene delivery.

  15. The use of cationic nanogels to deliver proteins to myeloma cells and primary T lymphocytes that poorly express heparan sulfate.

    Science.gov (United States)

    Watanabe, Kozo; Tsuchiya, Yumiko; Kawaguchi, Yoshinori; Sawada, Shin-ichi; Ayame, Hirohito; Akiyoshi, Kazunari; Tsubata, Takeshi

    2011-09-01

    Fusion proteins containing protein transduction domain (PTD) are widely used for intracellular delivery of exogenous proteins. PTD-mediated delivery requires expression of heparan sulfate on the surface of the target cells. However, some of metastatic tumor cells and primary lymphocytes poorly express heparan sulfate. Here we demonstrate that proteins complexed with nanosize hydrogels formed by cationic cholesteryl group-bearing pullulans (cCHP) are efficiently delivered to myeloma cells and primary CD4(+) T lymphocytes probably by induction of macropinocytosis, although these cells are resistant to PTD-mediated protein delivery as a consequence of poor heparan sulfate expression. The anti-apoptotic protein Bcl-xL delivered by cCHP nanogels efficiently blocked apoptosis of these cells, establishing functional regulation of cells by proteins delivered by cCHP nanogels. Thus, cCHP nanogel is a useful tool to deliver proteins for development of new cancer therapy and immune regulation. PMID:21605901

  16. 49 CFR 232.609 - Handling of defective equipment with ECP brake systems.

    Science.gov (United States)

    2010-10-01

    ... or locomotive equipped with an ECP brake system that is found with inoperative or ineffective brakes...; provided, all applicable provisions of this section are met and the defective car or locomotive is hauled... appliance may be used or hauled without civil penalty under this part to the nearest or nearest...

  17. A chimeric protein of aluminum-activated malate transporter generated from wheat and Arabidopsis shows enhanced response to trivalent cations.

    Science.gov (United States)

    Sasaki, Takayuki; Tsuchiya, Yoshiyuki; Ariyoshi, Michiyo; Ryan, Peter R; Yamamoto, Yoko

    2016-07-01

    TaALMT1 from wheat (Triticum aestivum) and AtALMT1 from Arabidopsis thaliana encode aluminum (Al)-activated malate transporters, which confer acid-soil tolerance by releasing malate from roots. Chimeric proteins from TaALMT1 and AtALMT1 (Ta::At, At::Ta) were previously analyzed in Xenopus laevis oocytes. Those studies showed that Al could activate malate efflux from the Ta::At chimera but not from At::Ta. Here, functions of TaALMT1, AtALMT1 and the chimeric protein Ta::At were compared in cultured tobacco BY-2 cells. We focused on the sensitivity and specificity of their activation by trivalent cations. The activation of malate efflux by Al was at least two-fold greater in the chimera than the native proteins. All proteins were also activated by lanthanides (erbium, ytterbium, gadolinium, and lanthanum), but the chimera again released more malate than TaALMT1 or AtALMT1. In Xenopus oocytes, Al, ytterbium, and erbium activated inward currents from the native TaALMT1 and the chimeric protein, but gadolinium only activated currents from the chimera. Lanthanum inhibited currents from both proteins. These results demonstrated that function of the chimera protein was altered compared to the native proteins and was more responsive to a range of trivalent cations when expressed in plant cells. PMID:27039280

  18. The effects of salt on the physicochemical properties and immunogenicity of protein based vaccine formulated in cationic liposome.

    Science.gov (United States)

    Yan, Weili; Huang, Leaf

    2009-02-23

    Recently, we have developed a simple and potent therapeutic cancer vaccine consisting of a cationic lipid and a peptide antigen. In this report, we expanded the utility of this formulation to protein based vaccines. First, we formulated the human papillomavirus (HPV) 16 E7 protein (E7) in different doses of DOTAP liposome. The results showed that these formulations failed to regress an established tumor. However, when sodium chloride (30 mM) was added to the DOTAP (100 nmol)/E7 (20 microg) formulation, anti-tumor activity was generated in the immunized mice. Correlatively, 30 mM NaCl in the DOTAP/E7 protein formulation increased the particle size from approximately 350 to 550 nm, decreased the protein loading capacity (from 95 to 90%), and finally increased the zeta potential (from 29 to 38 mV). Next, a model protein antigen ovalbumin (OVA) was formulated in different doses of DOTAP liposomes. Similarly, the results showed that 20 microg OVA formulated in 200 nmol DOTAP with 30 mM NaCl had the best OVA-specific antibody response, including both IgG(1) and IgG(2a), suggesting both Th1 and Th2 immune responses were generated by this formulation. In conclusion, we have expanded the application of cationic DOTAP liposome formulation to protein based vaccines and also identified that small amounts of salt could change the physicochemical properties of the vaccine formulation and enhance the activity of the DOTAP/protein based vaccine. The enhancement of immune responses by salt is possibly due to its interference of the electrostatic interaction between the cationic lipid and the protein antigen to facilitate the antigen release from the carrier and at the same time activate the antigen presenting cells. PMID:18992312

  19. Eotaxin induces degranulation and chemotaxis of eosinophils through the activation of ERK2 and p38 mitogen-activated protein kinases

    DEFF Research Database (Denmark)

    Kampen, G T; Stafford, S; Adachi, T;

    2000-01-01

    Eotaxin and other CC chemokines acting via CC chemokine receptor-3 (CCR3) are believed to play an integral role in the development of eosinophilic inflammation in asthma and allergic inflammatory diseases. However, little is known about the intracellular events following agonist binding to CCR3...... and the relationship of these events to the functional response of the cell. The objectives of this study were to investigate CCR3-mediated activation of the mitogen-activated protein (MAP) kinases extracellular signal-regulated kinase-2 (ERK2), p38, and c-jun N-terminal kinase (JNK) in eosinophils and to assess...... the requirement for MAP kinases in eotaxin-induced eosinophil cationic protein (ECP) release and chemotaxis. MAP kinase activation was studied in eotaxin-stimulated eosinophils (more than 97% purity) by Western blotting and immune-complex kinase assays. ECP release was measured by radioimmunoassay. Chemotaxis...

  20. A cationic tetrapyrrole inhibits toxic activities of the cellular prion protein.

    Science.gov (United States)

    Massignan, Tania; Cimini, Sara; Stincardini, Claudia; Cerovic, Milica; Vanni, Ilaria; Elezgarai, Saioa R; Moreno, Jorge; Stravalaci, Matteo; Negro, Alessandro; Sangiovanni, Valeria; Restelli, Elena; Riccardi, Geraldina; Gobbi, Marco; Castilla, Joaquín; Borsello, Tiziana; Nonno, Romolo; Biasini, Emiliano

    2016-01-01

    Prion diseases are rare neurodegenerative conditions associated with the conformational conversion of the cellular prion protein (PrP(C)) into PrP(Sc), a self-replicating isoform (prion) that accumulates in the central nervous system of affected individuals. The structure of PrP(Sc) is poorly defined, and likely to be heterogeneous, as suggested by the existence of different prion strains. The latter represents a relevant problem for therapy in prion diseases, as some potent anti-prion compounds have shown strain-specificity. Designing therapeutics that target PrP(C) may provide an opportunity to overcome these problems. PrP(C) ligands may theoretically inhibit the replication of multiple prion strains, by acting on the common substrate of any prion replication reaction. Here, we characterized the properties of a cationic tetrapyrrole [Fe(III)-TMPyP], which was previously shown to bind PrP(C), and inhibit the replication of a mouse prion strain. We report that the compound is active against multiple prion strains in vitro and in cells. Interestingly, we also find that Fe(III)-TMPyP inhibits several PrP(C)-related toxic activities, including the channel-forming ability of a PrP mutant, and the PrP(C)-dependent synaptotoxicity of amyloid-β (Aβ) oligomers, which are associated with Alzheimer's Disease. These results demonstrate that molecules binding to PrP(C) may produce a dual effect of blocking prion replication and inhibiting PrP(C)-mediated toxicity. PMID:26976106

  1. The Effects of Salt on the Physicochemical Properties and Immunogenicity of Protein Based Vaccine Formulated in Cationic Liposome

    OpenAIRE

    Yan, Weili; Huang, Leaf

    2008-01-01

    Recently, we have developed a simple and potent therapeutic cancer vaccine consisting of a cationic lipid and a peptide antigen. In this report, we expanded the utility of this formulation to a protein based vaccine. First, we formulated the human papillomavirus (HPV) 16 E7 protein (E7) in different doses of DOTAP liposome. The results showed that these formulations failed to regress an established tumor. However, when sodium chloride (30 mM) was added to the DOTAP (100 nmol) / E7 (20 μg) for...

  2. Translation of the Hope Creek procedure of generation of the ECP database

    International Nuclear Information System (INIS)

    This procedure contains the methodology and the necessary data sheets for the execution of PRESTO runs to generate the data for the ECP program. The data consist of corrections of the Moderator Temperature like a function of the bar density, xenon value like a function of the numeric density, and k-effective like a function of the extracted notches. This procedure will only be used for a list of extraction of sequence bars A-2. (Author)

  3. Effects of LTE4 and nasopharyngeal secretions ECP on the treatment and prognosis of bronchiolitis%LTE4和鼻咽分泌物ECP对毛细支气管炎治疗和预后的影响

    Institute of Scientific and Technical Information of China (English)

    侯秀玲; 王敬敏; 刘冬梅; 李雪萍

    2015-01-01

    目的:探讨尿白三烯 E4(L T E4)和鼻咽分泌物嗜酸性细胞阳离子蛋白(EC P )对呼吸道合胞病毒(RS V )毛细支气管炎患儿治疗和预后的影响。方法选取2014年1月至2015年3月保定市第二中心医院儿科住院RS V毛细支气管炎患儿79例作为研究对象,设为RS V毛细支气管炎组,均采用常规西医治疗,选取同期涿州市健康小儿75例作为健康对照组,均检测 L T E4和 EC P水平,观察治疗前、后和两组之间以上指标变化情况。结果治疗前,治疗后3、7、14、21 d RSV 毛细支气管炎患儿 LTE4水平分别为(176.35±78.24)、(164.35±71.45)、(112.45±54.62)、(67.55±25.24)、(41.35±10.57)pg/m L ;EC P水平分别为(98.56±61.57)、(88.34±43.64)、(61.46±24.66)、(50.41±17.84)、(34.68±12.54)μg/L ,治疗后明显低于治疗前,治疗前、后比较差异均有统计学意义(P<0.05)。治疗前健康对照组受试者LTE4、ECP水平均明显低于RSV毛细支气管炎患儿,组间比较差异有统计学意义(P<0.05);RSV患儿治疗末 LTE4、ECP水平与健康对照组受试者比较,差异无统计学意义(P>0.05)。结论 LTE4和鼻咽分泌物ECP能反映出RSV毛细支气管炎患儿的治疗进展和预后情况,在临床上有一定指导意义。%Objective To investigate the effects of urinary leukotriene E4 (LTE4) and nasopharyngeal secre‐tions eosinophil cationic protein (ECP) on the treatment and prognosis of children with respiratory syncytial virus (RSV) bronchiolitis .Methods 79 children with RSV bronchiolitis hospitalized in Department of Paediatrics ,Second Central Hospital of Baoding ,Baoding from January 2014 to March 2015 were enrolled as RSV bronchiolitis group , and were treated by conventional therapy .79 healthy children of Zhuozhou City were selected as normal control group .The levels of LTE

  4. Toward Separating Alpha-lactalbumin and Beta-lactoglobulin Proteins from Whey through Cation-exchange Adsorption

    Science.gov (United States)

    El-Sayed, Mayyada; Chase, Howard

    2009-05-01

    This paper describes the cation-exchange adsorption of the two major whey proteins, alpha-lactalbumin (ALA) and beta-lactoglobulin (BLG) with the purpose of establishing a process for isolating them from cow's milk whey. The single- and two-component adsorption of 1.5 mg/ml ALA and 3 mg/ml BLG to the cation-exchanger SP Sepharose FF at 20° C using 0.1 M acetate buffer of pH 3.7 was studied. Langmuir isotherm parameters were determined for the pure proteins. In two-component systems, BLG breakthrough curve exhibited an overshoot phenomenon that gave evidence for the presence of a competitive adsorption between the two proteins. Complete separation occurred and it was possible to obtain each of the two proteins in a pure form. The process was then applied to a whey concentrate mixture where incomplete separation took place. However, BLG was produced with 95% purity and a recovery of 80%, while ALA showed an 84% recovery with low purity.

  5. Effects of structural and operating parameters of ECP fan on dust particles removed in the transition flow regime

    Institute of Scientific and Technical Information of China (English)

    Shiqiang Chen; Youming Chen; Haiqiao Wang; Ronghua Liu; Haijiao Cui

    2014-01-01

    An enclosed cyclone passageway (ECP) dust-collecting fan is discussed. The ECP fan separates dust by centrifugal force originating from a driven spiral airflow, and its design takes the constraints of Chinese underground coal mines into consideration. Using the force equilibrium law, a general equation for dust removal in the centrifugal dust removal section (CDRS) of the ECP fan is deduced. This general equation is simplified using the CDRS structure and the fan operating parameters and is analysed numerically. The attractive results show that increases in the airflow rate of the fan, the structural ratio of the ECPs and the radius of the extended axis can improve the dust removal performance of the CDRS. Furthermore, the effects of the structural ratio and the radius on dust removal dominate over that of the flow rate, and the effect of the structural ratio is more significant than that of the radius.

  6. Proteomics-based, multivariate random forest method for prediction of protein separation behavior during cation-exchange chromatography.

    Science.gov (United States)

    Swanson, Ryan K; Xu, Ruo; Nettleton, Dan; Glatz, Charles E

    2012-08-01

    The most significant cost of recombinant protein production lies in the optimization of the downstream purification methods, mainly due to a lack of knowledge of the separation behavior of the host cell proteins (HCP). To reduce the effort required for purification process development, this work was aimed at modeling the separation behavior of a complex mixture of proteins in cation-exchange chromatography (CEX). With the emergence of molecular pharming as a viable option for the production of recombinant pharmaceutical proteins, the HCP mixture chosen was an extract of corn germ. Aqueous two phase system (ATPS) partitioning followed by two-dimensional electrophoresis (2DE) provided data on isoelectric point, molecular weight and surface hydrophobicity of the extract and step-elution fractions. A multivariate random forest (MVRF) method was then developed using the three characterization variables to predict the elution pattern of individual corn HCP. The MVRF method achieved an average root mean squared error (RMSE) value of 0.0406 (fraction of protein eluted in each CEX elution step) for all the proteins that were characterized, providing evidence for the effectiveness of both the characterization method and the analysis approach for protein purification applications. PMID:22748375

  7. Proteomics-based, multivariate random forest method for prediction of protein separation behavior during cation-exchange chromatography.

    Science.gov (United States)

    Swanson, Ryan K; Xu, Ruo; Nettleton, Dan; Glatz, Charles E

    2012-08-01

    The most significant cost of recombinant protein production lies in the optimization of the downstream purification methods, mainly due to a lack of knowledge of the separation behavior of the host cell proteins (HCP). To reduce the effort required for purification process development, this work was aimed at modeling the separation behavior of a complex mixture of proteins in cation-exchange chromatography (CEX). With the emergence of molecular pharming as a viable option for the production of recombinant pharmaceutical proteins, the HCP mixture chosen was an extract of corn germ. Aqueous two phase system (ATPS) partitioning followed by two-dimensional electrophoresis (2DE) provided data on isoelectric point, molecular weight and surface hydrophobicity of the extract and step-elution fractions. A multivariate random forest (MVRF) method was then developed using the three characterization variables to predict the elution pattern of individual corn HCP. The MVRF method achieved an average root mean squared error (RMSE) value of 0.0406 (fraction of protein eluted in each CEX elution step) for all the proteins that were characterized, providing evidence for the effectiveness of both the characterization method and the analysis approach for protein purification applications.

  8. Crystal Structure of an Integron Gene Cassette-Associated Protein from Vibrio cholerae Identifies a Cationic Drug-Binding Module

    Energy Technology Data Exchange (ETDEWEB)

    Deshpande, Chandrika N.; Harrop, Stephen J.; Boucher, Yan; Hassan, Karl A.; Di Leo, Rosa; Xu, Xiaohui; Cui, Hong; Savchenko, Alexei; Chang, Changsoo; Labbate, Maurizio; Paulsen, Ian T.; Stokes, H.W.; Curmi, Paul M.G.; Mabbutt, Bridget C. (MIT); (UT-Australia); (Macquarie); (Toronto); (New South)

    2012-02-15

    The direct isolation of integron gene cassettes from cultivated and environmental microbial sources allows an assessment of the impact of the integron/gene cassette system on the emergence of new phenotypes, such as drug resistance or virulence. A structural approach is being exploited to investigate the modularity and function of novel integron gene cassettes. We report the 1.8 {angstrom} crystal structure of Cass2, an integron-associated protein derived from an environmental V. cholerae. The structure defines a monomeric beta-barrel protein with a fold related to the effector-binding portion of AraC/XylS transcription activators. The closest homologs of Cass2 are multi-drug binding proteins, such as BmrR. Consistent with this, a binding pocket made up of hydrophobic residues and a single glutamate side chain is evident in Cass2, occupied in the crystal form by polyethylene glycol. Fluorescence assays demonstrate that Cass2 is capable of binding cationic drug compounds with submicromolar affinity. The Cass2 module possesses a protein interaction surface proximal to its drug-binding cavity with features homologous to those seen in multi-domain transcriptional regulators. Genetic analysis identifies Cass2 to be representative of a larger family of independent effector-binding proteins associated with lateral gene transfer within Vibrio and closely-related species. We propose that the Cass2 family not only has capacity to form functional transcription regulator complexes, but represents possible evolutionary precursors to multi-domain regulators associated with cationic drug compounds.

  9. Crystal structure of an integron gene cassette-associated protein from Vibrio cholerae identifies a cationic drug-binding module.

    Directory of Open Access Journals (Sweden)

    Chandrika N Deshpande

    Full Text Available The direct isolation of integron gene cassettes from cultivated and environmental microbial sources allows an assessment of the impact of the integron/gene cassette system on the emergence of new phenotypes, such as drug resistance or virulence. A structural approach is being exploited to investigate the modularity and function of novel integron gene cassettes.We report the 1.8 Å crystal structure of Cass2, an integron-associated protein derived from an environmental V. cholerae. The structure defines a monomeric beta-barrel protein with a fold related to the effector-binding portion of AraC/XylS transcription activators. The closest homologs of Cass2 are multi-drug binding proteins, such as BmrR. Consistent with this, a binding pocket made up of hydrophobic residues and a single glutamate side chain is evident in Cass2, occupied in the crystal form by polyethylene glycol. Fluorescence assays demonstrate that Cass2 is capable of binding cationic drug compounds with submicromolar affinity. The Cass2 module possesses a protein interaction surface proximal to its drug-binding cavity with features homologous to those seen in multi-domain transcriptional regulators.Genetic analysis identifies Cass2 to be representative of a larger family of independent effector-binding proteins associated with lateral gene transfer within Vibrio and closely-related species. We propose that the Cass2 family not only has capacity to form functional transcription regulator complexes, but represents possible evolutionary precursors to multi-domain regulators associated with cationic drug compounds.

  10. Latent Ice Recrystallization Inhibition Activity in Nonantifreeze Proteins: Ca2+-Activated Plant Lectins and Cation-Activated Antimicrobial Peptides.

    Science.gov (United States)

    Mitchell, Daniel E; Gibson, Matthew I

    2015-10-12

    Organisms living in polar regions have evolved a series of antifreeze (glyco) proteins (AFGPs) to enable them to survive by modulating the structure of ice. These proteins have huge potential for use in cellular cryopreservation, ice-resistant surfaces, frozen food, and cryosurgery, but they are limited by their relatively low availability and questions regarding their mode of action. This has triggered the search for biomimetic materials capable of reproducing this function. The identification of new structures and sequences capable of inhibiting ice growth is crucial to aid our understanding of these proteins. Here, we show that plant c-type lectins, which have similar biological function to human c-type lectins (glycan recognition) but no sequence homology to AFPs, display calcium-dependent ice recrystallization inhibition (IRI) activity. This IRI activity can be switched on/off by changing the Ca2+ concentration. To show that more (nonantifreeze) proteins may exist with the potential to display IRI, a second motif was considered, amphipathicity. All known AFPs have defined hydrophobic/hydrophilic domains, rationalizing this choice. The cheap, and widely used, antimicrobial Nisin was found to have cation-dependent IRI activity, controlled by either acid or addition of histidine-binding ions such as zinc or nickel, which promote its amphipathic structure. These results demonstrate a new approach in the identification of antifreeze protein mimetic macromolecules and may help in the development of synthetic mimics of AFPs.

  11. Interaction of Gram-negative bacteria with cationic proteins: Dependence on the surface characteristics of the bacterial cell

    Directory of Open Access Journals (Sweden)

    Isabella R Prokhorenko

    2009-03-01

    Full Text Available Isabella R Prokhorenko1, Svetlana V Zubova1, Alexandr Yu Ivanov2, Sergey V Grachev31Laboratory of Molecular Biomedicine, Institute of Basic Biological Problems; 2Institute of Cell Biophysics, Russian Academy of Sciences, Moscow, Russia; 3I.M. Sechenov’s Moscow Medical Academy, Moscow, Russia Abstract: Gram-negative bacteria can enter the bloodstream and interact with serum cationic proteins. The character of interaction will depend on the surface characteristics of bacterial cells, which are determined by bacterial chemotype and density of lipopolysaccharide (LPS packing in the cell wall. It was shown that the lysozyme treatment resulted in the increase sensitivity to hypotonic shock. Signifi cant differences to this effect were found between Escherichia coli strain D21 and D21f2 under treatment with physiological protein concentration. On the basis of electrokinetic measurements and studies of the interaction of cells with lysozyme, the hypothesis was formed that the cell wall of the E. coli strain D21f2 contains more LPS and has a higher density of their packing than the cell wall of the E. coli D21 cells. The effect of lysozyme and lactoferrin on the viability of E. coli cells of two different strains was examined. Lysozyme was found to more effectively inhibit the growth of the E. coli D21 bacteria, and lactoferrin suppressed mainly the growth of the E. coli D21f2 bacteria. These results indicate that the differences in LPS core structure of bacterial R-chemotype, which determines surface charge and density of LPS packing, plays an essential role in the mechanisms of interaction of the cationic proteins with the cell wall.Keywords: lipopolysaccharide, Escherichia coli, chemotype, lysozyme, lactoferrin, colony-forming units

  12. Structure and expression of a tandem gene pair in Leishmania donovani that encodes a protein structurally homologous to eucaryotic cation-transporting ATPases.

    OpenAIRE

    Meade, J C; Shaw, J; Lemaster, S; Gallagher, G.; Stringer, J R

    1987-01-01

    An oligonucleotide probe was used to clone a cation-transporting ATPase gene from the genome of Leishmania donovani. The nucleotide sequence of the gene contained a 2,922-base-pair open reading frame that was predicted to encode a 107,406-dalton protein composed of 974 amino acids. The predicted L. donovani protein contained all the structural and functional domains expected to be present in a cation-transporting ATPase of the aspartyl phosphate class. The nucleotide sequence encoding the ATP...

  13. The effect of geometrical presentation of multimodal cation-exchange ligands on selective recognition of hydrophobic regions on protein surfaces.

    Science.gov (United States)

    Woo, James; Parimal, Siddharth; Brown, Matthew R; Heden, Ryan; Cramer, Steven M

    2015-09-18

    The effects of spatial organization of hydrophobic and charged moieties on multimodal (MM) cation-exchange ligands were examined by studying protein retention behavior on two commercial chromatographic media, Capto™ MMC and Nuvia™ cPrime™. Proteins with extended regions of surface-exposed aliphatic residues were found to have enhanced retention on the Capto MMC system as compared to the Nuvia cPrime resin. The results further indicated that while the Nuvia cPrime ligand had a strong preference for interactions with aromatic groups, the Capto MMC ligand appeared to interact with both aliphatic and aromatic clusters on the protein surfaces. These observations were formalized into a new set of protein surface property descriptors, which quantified the local distribution of electrostatic and hydrophobic potentials as well as distinguishing between aromatic and aliphatic properties. Using these descriptors, high-performing quantitative structure-activity relationship (QSAR) models (R(2)>0.88) were generated for both the Capto MMC and Nuvia cPrime datasets at pH 5 and pH 6. Descriptors of electrostatic properties were generally common across the four models; however both Capto MMC models included descriptors that quantified regions of aliphatic-based hydrophobicity in addition to aromatic descriptors. Retention was generally reduced by lowering the ligand densities on both MM resins. Notably, elution order was largely unaffected by the change in surface density, but smaller and more aliphatic proteins tended to be more affected by this drop in ligand density. This suggests that modulating the exposure, shape and density of the hydrophobic moieties in multimodal chromatographic systems can alter the preference for surface exposed aliphatic or aromatic residues, thus providing an additional dimension for modulating the selectivity of MM protein separation systems. PMID:26292626

  14. Expression and divalent cation binding properties of the novel chemotactic inflammatory protein psoriasin

    DEFF Research Database (Denmark)

    Vorum, H; Madsen, Peder; Rasmussen, H H;

    1996-01-01

    Psoriasin is a novel chemotactic inflammatory protein that possesses weak similarity to the S100 family members of Ca(2+)-binding proteins, and that is highly up-regulated in hyperproliferative psoriatic keratinocytes. Here we have used the psoriasin cDNA to express recombinant human (rh) psoriasin...... in Escherichia coli as a fusion protein containing a hexa His tag and a factor Xa cleavage site in the NH2-terminus. The protein was purified by affinity chromatography on Ni(2+)-nitrilotriacetic acid agarose, digested with factor Xa, further purified by ion-exchange chromatography and characterized by two...... in KCl and four in NaCl, with an affinity just below 1 x 10(4) M-1 for the first molecule. Thus psoriasin does not bind significant amounts of Zn2+ at physiological concentrations. Mg2+ and Ca2+ are bound anti-cooperatively and binding of each of the ions (Ca2+, Zn2+, or Mg2+), is accompanied...

  15. Analysis of statistical thermodynamic model for binary protein adsorption equilibria on cation exchange adsorbent

    Institute of Scientific and Technical Information of China (English)

    ZHOU Xiaopeng; SU Xueli; SUN Yan

    2007-01-01

    A study of nonlinear competitive adsorption equilibria of proteins is of fundamental importance in understanding the behavior of preparative chromatographic separation.This work describes the nonlinear binary protein adsorption equilibria on ion exchangers by the statistical thermodynamic (ST) model.The single-component and binary protein adsorption isotherms of bovine hemoglobin (Hb) and bovine serum albumin(BSA)on SP Sepharose FF were determined by batch adsorption experiments in 0.05 mol/L sodium acetate buffer at three pH values(4.5,5.0 and 5.5)and three NaCl concentrations(0.05,0.10 and 0.15 mol/L)at pH 5.0.The ST model was found to depict the effects of pH and ionic strength on the single-component equilibria well,with model parameters depending on the pH and ionic strength.Moreover,the ST model gave acceptable fitting to the binary adsorption data with the fltted singlecomponent model parameters,leading to the estimation of the binary ST model parameter.The effects of pH and ionic strength on the model parameters are reasonably interpreted by the electrostatic and thermodynamic theories.Results demonstrate the availability of the ST model for describing nonlinear competitive protein adsorption equilibria in the presence of two proteins.

  16. Ancient association between cation leak channels and Mid1 proteins is conserved in fungi and animals

    Directory of Open Access Journals (Sweden)

    Alfredo eGhezzi

    2014-03-01

    Full Text Available Neuronal resting potential can tune the excitability of neural networks, affecting downstream behavior. Sodium leak channels (NALCN play a key role in rhythmic behaviors by helping set, or subtly changing neuronal resting potential. The full complexity of these newly described channels is just beginning to be appreciated, however. NALCN channels can associate with numerous subunits in different tissues and can be activated by several different peptides and second messengers. We recently showed that NALCN channels are closely related to fungal calcium channels, which they functionally resemble. Here, we use this relationship to predict a family of NALCN-associated proteins in animals on the basis of homology with the yeast protein Mid1, the subunit of the yeast calcium channel. These proteins all share a cysteine-rich region that is necessary for Mid1 function in yeast. We validate this predicted association by showing that the Mid1 homolog in Drosophila, encoded by the CG33988 gene, is coordinately expressed with NALCN, and that knockdown of either protein creates identical phenotypes in several behaviors associated with NALCN function. The relationship between Mid1 and leak channels has therefore persisted over a billion years of evolution, despite drastic changes to both proteins and the organisms in which they exist.

  17. Analysis of plasma protein adsorption onto DC-Chol-DOPE cationic liposomes by HPLC-CHIP coupled to a Q-TOF mass spectrometer

    KAUST Repository

    Capriotti, Anna Laura

    2010-09-22

    Plasma protein adsorption is regarded as a key factor in the in vivo organ distribution of intravenously administered drug carriers, and strongly depends on vector surface characteristics. The present study aimed to characterize the "protein corona" absorbed onto DC-Chol-DOPE cationic liposomes. This system was chosen because it is one of the most efficient and widely used non-viral formulations in vitro and a potential candidate for in vivo transfection of genetic material. After incubation of human plasma with cationic liposomes, nanoparticle-protein complex was separated from plasma by centrifugation. An integrated approach based on protein separation by one-dimensional 12% polyacrylamide gel electrophoresis followed by the automated HPLC-Chip technology coupled to a high-resolution mass spectrometer was employed for protein corona characterization. Thirty gel lanes, approximately 2 mm, were cut, digested and analyzed by HPLC-MS/MS. Fifty-eight human plasma proteins adsorbed onto DC-Chol-DOPE cationic liposomes were identified. The knowledge of the interactions of proteins with liposomes can be exploited for future controlled design of colloidal drug carriers and possibly in the controlled creation of biocompatible surfaces of other devices that come into contact with proteins in body fluids. © 2010 Springer-Verlag.

  18. 阳离子明胶蛋白助剂改性液的循环再利用%Recycling of cationic gelatin protein agent modified liquid

    Institute of Scientific and Technical Information of China (English)

    徐华凤; 王雪燕

    2015-01-01

    探讨了阳离子明胶蛋白助剂一次改性残液中阳离子明胶蛋白助剂和NaOH补加量对棉织物改性效果的影响,通过正交试验,优化阳离子明胶蛋白助剂一次改性残液改性棉的工艺条件,并探讨了阳离子明胶蛋白助剂改性废液的循环再利用次数对棉织物改性和染色效果的影响。结果表明:在阳离子明胶蛋白助剂一次改性残液中添加少量阳离子明胶蛋白助剂和适量NaOH仍然能使棉织物获得良好的阳离子化改性效果,阳离子明胶蛋白改性残液可循环再利用。%The effects of extra amount of cationic gelatin protein agent and sodium hydroxide added in the once modified waste liquid on the modification effect of cotton fabric were investigated. The cotton modi⁃fied process by taking gelatin protein agent once modified waste liquid was optimized through orthogonal ex⁃periments. The effect of recycle times of cationic gelatin protein agent modified waste liquid on the modifica⁃tion and dyeing effect of the modified cotton was discussed. The results showed that cotton fabric with fine cationic modification properties could be obtained with adding an appropriate amount of cationic gelatin protein agent and sodium hydroxide into the cationic gelatin protein agent once modified waste liquid, thus the cation⁃ic gelatin protein agent modified waste liquid could be recycled.

  19. Investigation of human cationic antimicrobial protein-18 (hCAP-18), lactoferrin and CD163 as potential biomarkers for ovarian cancer

    DEFF Research Database (Denmark)

    Lim, Ratana; Lappas, Martha; Riley, Clyde;

    2013-01-01

    plasma concentrations of three putative ovarian cancer biomarkers: human cationic antimicrobial protein-18 (hCAP-18); lactoferrin; and CD163 in normal healthy women and women with ovarian cancer. METHODS: In this case-control cohort study, ovarian tissue and blood samples were obtained from 164 women (73...

  20. Influence of Hydrocolloids (Dietary Fibers) on Lipid Digestion of Protein-Stabilized Emulsions: Comparison of Neutral, Anionic, and Cationic Polysaccharides.

    Science.gov (United States)

    Qin, Dingkui; Yang, Xiaojun; Gao, Songran; Yao, Junhu; McClements, David Julian

    2016-07-01

    The impact of dietary fibers on lipid digestion within the gastrointestinal tract depends on their molecular and physicochemical properties. In this study, the influence of the electrical characteristics of dietary fibers on their ability to interfere with the digestion of protein-coated lipid droplets was investigated using an in vitro small intestine model. Three dietary fibers were examined: cationic chitosan; anionic alginate; neutral locust bean gum (LBG). The particle size, ζ-potential, microstructure, and apparent viscosity of β-lactoglobulin stabilized oil-in-water emulsions containing different types and levels of dietary fiber were measured before and after lipid digestion. The rate and extent of lipid digestion depended on polysaccharide type and concentration. At relatively low dietary fiber levels (0.1 to 0.2 wt%), the initial lipid digestion rate was only reduced by chitosan, but the final extent of lipid digestion was unaffected by all 3 dietary fibers. At relatively high dietary fiber levels (0.4 wt%), alginate and chitosan significantly inhibited lipid hydrolysis, whereas LBG did not. The impact of chitosan on lipid digestion was attributed to its ability to promote fat droplet aggregation through bridging flocculation, thereby retarding access of the lipase to the droplet surfaces. The influence of alginate was mainly ascribed to its ability to sequester calcium ions and promote depletion flocculation. PMID:27300319

  1. The DEG/ENaC cation channel protein UNC-8 drives activity-dependent synapse removal in remodeling GABAergic neurons

    Science.gov (United States)

    Miller-Fleming, Tyne W; Petersen, Sarah C; Manning, Laura; Matthewman, Cristina; Gornet, Megan; Beers, Allison; Hori, Sayaka; Mitani, Shohei; Bianchi, Laura; Richmond, Janet; Miller, David M

    2016-01-01

    Genetic programming and neural activity drive synaptic remodeling in developing neural circuits, but the molecular components that link these pathways are poorly understood. Here we show that the C. elegans Degenerin/Epithelial Sodium Channel (DEG/ENaC) protein, UNC-8, is transcriptionally controlled to function as a trigger in an activity-dependent mechanism that removes synapses in remodeling GABAergic neurons. UNC-8 cation channel activity promotes disassembly of presynaptic domains in DD type GABA neurons, but not in VD class GABA neurons where unc-8 expression is blocked by the COUP/TF transcription factor, UNC-55. We propose that the depolarizing effect of UNC-8-dependent sodium import elevates intracellular calcium in a positive feedback loop involving the voltage-gated calcium channel UNC-2 and the calcium-activated phosphatase TAX-6/calcineurin to initiate a caspase-dependent mechanism that disassembles the presynaptic apparatus. Thus, UNC-8 serves as a link between genetic and activity-dependent pathways that function together to promote the elimination of GABA synapses in remodeling neurons. DOI: http://dx.doi.org/10.7554/eLife.14599.001 PMID:27403890

  2. Cell-penetrating peptide derived from human eosinophil cationic protein inhibits mite allergen Der p 2 induced inflammasome activation.

    Directory of Open Access Journals (Sweden)

    Sheng-Jie Yu

    Full Text Available Newly discovered cell penetration peptides derived from human eosinophil cationic proteins (CPPecp have the characteristic of cell internalization, but the effect of CPPecp on immunomodulation has not been clarified. House dust mite (HDM major allergen, Der p 2, can induce proinflammatory cytokine production which contributes to airway inflammation and allergic asthma. However, the mechanism of Der p 2 on NLRP3 inflammasome activation remains unclear. The aim of this study was to investigate the immunomodulatory effect of CPPecp on inhibition of Der p 2 induced inflammasome activation. We showed that proinflammatory cytokines IL-1β, IL-6 and IL-8 were significantly upregulated in peripheral blood mononuclear cells (PBMCs derived from HDM allergic patients after Der p 2 stimulation. Expression of NLRP3, ASC, Caspase-1, IL-1β and Caspase-1 activity was upregulated in THP-1 cells after Der p 2 stimulation. Proinflammatory cytokine production, NLRP3 inflammasome activation and caspase-1 activity were downregulated in THP-1 cells and CD14+ cells co-cultured with Der p 2 and CPPecp. The immunomodulatory effect of CPPecp was through upregulation of IFN-α production but not induction of autophagy. These results suggested Der p 2 plays an important role in NLRP3 inflammasome activation and CPPecp has the potential to be a novel anti-inflammatory agent for allergic inflammation treatment in the future.

  3. Effect of dietary cation-anion difference on performance of lactating dairy cows and stability of milk proteins.

    Science.gov (United States)

    Martins, C M M R; Arcari, M A; Welter, K C; Netto, A S; Oliveira, C A F; Santos, M V

    2015-04-01

    Casein micelle stability is negatively correlated with milk concentrations of ionic calcium, which may change according to the metabolic and nutritional status of dairy cows. The present study aimed to evaluate the effect of dietary cation-anion difference (DCAD) on concentrations of casein subunits, whey proteins, ionic calcium, and milk heat and ethanol stability. Sixteen Holstein cows were distributed in 4 contemporary 4 × 4 Latin square designs, which consisted of 4 periods of 21 d and 4 treatments according to DCAD: 290, 192, 98, and -71 mEq/kg of dry matter (DM). The milk concentrations of ionic calcium and κ-casein were reduced as DCAD increased, whereas the milk urea nitrogen and β-lactoglobulin concentrations were increased. As a result of these alterations, the milk ethanol stability and milk stability during heating at 140 °C were increased linearly with increasing DCAD [Y = 74.87 (standard error = 0.87) + 0.01174 (standard error = 0.0025) × DCAD (mEq/kg of DM) and Y = 3.95 (standard error = 1.02) + 0.01234 (standard error = 0.0032) × DCAD (mEq/kg of DM), respectively]. In addition, 3.5% fat-corrected milk and fat, lactose, and total milk solids contents were linearly increased by 13.52, 8.78, 2.5, and 2.6%, respectively, according to DCAD increases from -71 to 290 mEq/kg of DM, whereas crude protein and casein content were linearly reduced by 4.83 and 4.49%, respectively. In conclusion, control of metabolic changes in lactating dairy cows to maintain blood acid-base equilibrium plays an important role in keeping milk stable to ethanol and during heat treatments. PMID:25622868

  4. Disease-Homologous Mutation in the Cation Diffusion Facilitator Protein MamM Causes Single-Domain Structural Loss and Signifies Its Importance.

    Science.gov (United States)

    Barber-Zucker, Shiran; Uebe, René; Davidov, Geula; Navon, Yotam; Sherf, Dror; Chill, Jordan H; Kass, Itamar; Bitton, Ronit; Schüler, Dirk; Zarivach, Raz

    2016-08-23

    Cation diffusion facilitators (CDF) are highly conserved, metal ion efflux transporters that maintain divalent transition metal cation homeostasis. Most CDF proteins contain two domains, the cation transporting transmembrane domain and the regulatory cytoplasmic C-terminal domain (CTD). MamM is a magnetosome-associated CDF protein essential for the biomineralization of magnetic iron-oxide particles in magnetotactic bacteria. To investigate the structure-function relationship of CDF cytoplasmic domains, we characterized a MamM M250P mutation that is synonymous with the disease-related mutation L349P of the human CDF protein ZnT-10. Our results show that the M250P exchange in MamM causes severe structural changes in its CTD resulting in abnormal reduced function. Our in vivo, in vitro and in silico studies indicate that the CTD fold is critical for CDF proteins' proper function and support the previously suggested role of the CDF cytoplasmic domain as a CDF regulatory element. Based on our results, we also suggest a mechanism for the effects of the ZnT-10 L349P mutation in human.

  5. Differential serum protein markers and the clinical severity of asthma

    Directory of Open Access Journals (Sweden)

    Meyer N

    2014-04-01

    Full Text Available Norbert Meyer,1,2 Sarah Janine Nuss,1 Thomas Rothe,1 Alexander Siebenhüner,1 Cezmi A Akdis,2 Günter Menz11Hochgebirgsklinik Davos, Davos-Wolfgang, Switzerland; 2Swiss Institute of Allergy and Asthma Research (SIAF, Davos Platz, SwitzerlandBackground: Asthma is a heterogeneous disease characterized by different clinical phenotypes and the involvement of multiple inflammatory pathways. During airway inflammation, many cytokines and chemokines are released and some are detectable in the sera.Objective: Serum chemokines and cytokines, involved in airway inflammation in asthma patients, were investigated.Methods: A total of 191 asthma patients were classified by hierarchical cluster analysis, including the following parameters: forced expiratory volume in 1 second (FEV1, eosinophil cationic protein (ECP serum levels, blood eosinophils, Junipers asthma symptom score, and the change in FEV1, ECP serum levels, and blood eosinophils after 3 weeks of asthma therapy. Serum proteins were measured by multiplex analysis. Receiver operating characteristic (ROC curves were used to evaluate the validity of serum proteins for discriminating between asthma clusters.Results: Classification of asthma patients identified one cluster with high ECP serum levels, increased blood eosinophils, low FEV1 values, and good FEV1 improvement in response to asthma therapy (n=60 and one cluster with low ECP serum levels, low numbers of blood eosinophils, higher FEV1 values, and no FEV1 improvement in response to asthma therapy (n=131. Serum interleukin (IL-8, eotaxin, vascular endothelial growth factor (VEGF, cutaneous T-cell-attracting chemokine (CTACK, growth-related oncogene (GRO-α, and hepatocyte growth factor (HGF were significantly different between the two clusters of asthma patients. ROC analysis for serum proteins calculated a sensitivity of 55.9% and specificity of 75.8% for discriminating between them.Conclusion: Serum cytokine and chemokine levels might be

  6. l-Tryptophan Radical Cation Electron Spin Resonance Studies: Connecting Solution-derived Hyperfine Coupling Constants with Protein Spectral Interpretations

    OpenAIRE

    Connor, Henry D.; Sturgeon, Bradley E.; Mottley, Carolyn; Sipe, Herbert J.; Mason, Ronald P.

    2008-01-01

    Fast-flow electron spin resonance (ESR) spectroscopy has been used to detect a free radical formed from the reaction of l-tryptophan with Ce4+ in an acidic aqueous environment. Computer simulations of the ESR spectra from l-tryptophan and several isotopically modified forms strongly support the conclusion that the l-tryptophan radical cation has been detected by ESR for the first time. The hyperfine coupling constants (HFCs) determined from the well-resolved isotropic ESR spectra support expe...

  7. Management of patients with T4 cutaneous T-cell lymphoma(CTCL) with total skin electron beam therapy(TSEBT) and adjuvant extracorporeal photochemotherapy(ECP)

    International Nuclear Information System (INIS)

    Purpose/Objective: No randomized data are available regarding the use of ECP in CTCL, and its usage as an adjuvant to TSEBT has not been studied extensively. We report the clinical results for patients with T4 CTCL who received TSEBT and adjuvant ECP with respect to overall survival(OS), disease free survival(DFS), and toxicity with comparison to historical controls. Materials and Methods: Between 1974 and 1994, a total of 47 patients with T4 CTCL were treated with TSEBT. All patients were staged as T4 based on the presence of erythroderma. Of the 47 patients in the cohort, 42 were evaluable, 12 received adjuvant ECP, 7 received systemic chemotherapy, 2 received PUVA, and 21 were not treated adjuvantly. TSEBT was offered via 6MeV linac, total 36Gy, 1Gy daily, 6 fields, with boosts to the perineum(20Gy), soles(20Gy), and scalp (6Gy), over 9 weeks. ECP was offered monthly on 2 consecutive days with the use of oral psoralen, pheresis of leukocytes and reinfusion, for 6 months. Overall survival, DFS, response to TSEBT, and toxicity were evaluated for all patients, and subgroups were compared based on adjuvant modality. Median age was 64 years (29-82), 14 patients were female, and the median follow-up was 11 months(2-100). Results: Response to TSEBT was complete(CR) in (23(42))(55%) of patients. The median OS for the entire cohort was 37 months, with a median DFS of only 2.2 months. When patients were evaluated by subgroup based on adjuvant therapy, the median OS for those not receiving adjuvant treatment was 29 months, not reached at 42 months for TSEBT+ECP, and 65 months for TSEBT+Chemo (p>0.05). DFS by adjuvant group was 0, 6, and 3 months for no adjuvant, TSEBT+ECP, and TSEBT+Chemo respectively. When stratified by response to TSEBT prior to adjuvant therapy, the CR rates were: 55% (11 patients) for the TSEBT alone group, 71% (5 patients) TSEBT+Chemo, and 25% (3 patients) for TSEBT+ECP. Differences in OS and DFS for patients after CR to TSEBT by adjuvant group were

  8. Isolation of cross-linked peptides by diagonal strong cation exchange chromatography for protein complex topology studies by peptide fragment fingerprinting from large sequence databases.

    Science.gov (United States)

    Buncherd, Hansuk; Roseboom, Winfried; Ghavim, Behrad; Du, Weina; de Koning, Leo J; de Koster, Chris G; de Jong, Luitzen

    2014-06-27

    Knowledge of spatial proximity of amino acid residues obtained by chemical cross-linking and mass spectrometric analysis provides information about protein folding, protein-protein interactions and topology of macromolecular assemblies. We show that the use of bis(succinimidyl)-3-azidomethyl glutarate as a cross-linker provides a solution for two major analytical problems of cross-link mapping by peptide fragment fingerprinting (PFF) from complex sequence databases, i.e., low abundance of protease-generated target peptides and lack of knowledge of the masses of linked peptides. Tris(carboxyethyl)phosphine (TCEP) reduces the azido group in cross-linked peptides to an amine group in competition with cleavage of an amide bond formed in the cross-link reaction. TCEP-induced reaction products were separated by diagonal strong cation exchange (SCX) from unmodified peptides. The relation between the sum of the masses of the cleavage products and the mass of the parent cross-linked peptide enables determination of the masses of candidate linked peptides. By reversed phase LC-MS/MS analysis of secondary SCX fractions, we identified several intraprotein and interprotein cross-links in a HeLa cell nuclear extract, aided by software tools supporting PFF from the entire human sequence database. The data provide new information about interacting protein domains, among others from assemblies involved in splicing.

  9. Dysregulation of protein degradation pathways may mediate the liver injury and phospholipidosis associated with a cationic amphiphilic antibiotic drug

    International Nuclear Information System (INIS)

    A large number of antibiotics are known to cause drug-induced liver injury in the clinic; however, interpreting clinical risk is not straightforward owing to a lack of predictivity of the toxicity by standard preclinical species and a poor understanding of the mechanisms of toxicity. An example is PF-04287881, a novel ketolide antibiotic that caused elevations in liver function tests in Phase I clinical studies. In this study, a mouse diversity panel (MDP), comprised of 34 genetically diverse, inbred mouse strains, was utilized to model the toxicity observed with PF-04287881 treatment and investigate potential mechanisms that may mediate the liver response. Significant elevations in serum alanine aminotransferase (ALT) levels in PF-04287881-treated animals relative to vehicle-treated controls were observed in the majority (88%) of strains tested following a seven day exposure. The average fold elevation in ALT varied by genetic background and correlated with microscopic findings of hepatocellular hypertrophy, hepatocellular single cell necrosis, and Kupffer cell vacuolation (confirmed as phospholipidosis) in the liver. Global liver mRNA expression was evaluated in a subset of four strains to identify transcript and pathway differences that distinguish susceptible mice from resistant mice in the context of PF-04287881 treatment. The protein ubiquitination pathway was highly enriched among genes associated with PF-04287881-induced hepatocellular necrosis. Expression changes associated with PF-04287881-induced phospholipidosis included genes involved in drug transport, phospholipid metabolism, and lysosomal function. The findings suggest that perturbations in genes involved in protein degradation leading to accumulation of oxidized proteins may mediate the liver injury induced by this drug. - Highlights: • Identified susceptible and resistant mouse strains to liver injury induced by a CAD • Liver injury characterized by single cell necrosis, and phospholipidosis

  10. Dysregulation of protein degradation pathways may mediate the liver injury and phospholipidosis associated with a cationic amphiphilic antibiotic drug

    Energy Technology Data Exchange (ETDEWEB)

    Mosedale, Merrie [Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Wu, Hong [Drug Safety Research and Development, Pfizer Global Research and Development, Groton, CT06340 (United States); Kurtz, C. Lisa [Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); Schmidt, Stephen P. [Drug Safety Research and Development, Pfizer Global Research and Development, Groton, CT06340 (United States); Adkins, Karissa, E-mail: Karissa.Adkins@pfizer.com [Drug Safety Research and Development, Pfizer Global Research and Development, Groton, CT06340 (United States); Harrill, Alison H. [Hamner-University of North Carolina Institute for Drug Safety Sciences, The Hamner Institutes for Health Sciences, Research Triangle Park, NC 27709 (United States); University of Arkansas for Medical Sciences, Little Rock, AR72205 (United States)

    2014-10-01

    A large number of antibiotics are known to cause drug-induced liver injury in the clinic; however, interpreting clinical risk is not straightforward owing to a lack of predictivity of the toxicity by standard preclinical species and a poor understanding of the mechanisms of toxicity. An example is PF-04287881, a novel ketolide antibiotic that caused elevations in liver function tests in Phase I clinical studies. In this study, a mouse diversity panel (MDP), comprised of 34 genetically diverse, inbred mouse strains, was utilized to model the toxicity observed with PF-04287881 treatment and investigate potential mechanisms that may mediate the liver response. Significant elevations in serum alanine aminotransferase (ALT) levels in PF-04287881-treated animals relative to vehicle-treated controls were observed in the majority (88%) of strains tested following a seven day exposure. The average fold elevation in ALT varied by genetic background and correlated with microscopic findings of hepatocellular hypertrophy, hepatocellular single cell necrosis, and Kupffer cell vacuolation (confirmed as phospholipidosis) in the liver. Global liver mRNA expression was evaluated in a subset of four strains to identify transcript and pathway differences that distinguish susceptible mice from resistant mice in the context of PF-04287881 treatment. The protein ubiquitination pathway was highly enriched among genes associated with PF-04287881-induced hepatocellular necrosis. Expression changes associated with PF-04287881-induced phospholipidosis included genes involved in drug transport, phospholipid metabolism, and lysosomal function. The findings suggest that perturbations in genes involved in protein degradation leading to accumulation of oxidized proteins may mediate the liver injury induced by this drug. - Highlights: • Identified susceptible and resistant mouse strains to liver injury induced by a CAD • Liver injury characterized by single cell necrosis, and phospholipidosis

  11. Xanthurenic acid binds to neuronal G-protein-coupled receptors that secondarily activate cationic channels in the cell line NCB-20.

    Science.gov (United States)

    Taleb, Omar; Maammar, Mohammed; Brumaru, Daniel; Bourguignon, Jean-Jacques; Schmitt, Martine; Klein, Christian; Kemmel, Véronique; Maitre, Michel; Mensah-Nyagan, Ayikoe Guy

    2012-01-01

    Xanthurenic acid (XA) is a metabolite of the tryptophan oxidation pathway through kynurenine and 3-hydroxykynurenine. XA was until now considered as a detoxification compound and dead-end product reducing accumulation of reactive radical species. Apart from a specific role for XA in the signaling cascade resulting in gamete maturation in mosquitoes, nothing was known about its functions in other species including mammals. Based upon XA distribution, transport, accumulation and release in the rat brain, we have recently suggested that XA may potentially be involved in neurotransmission/neuromodulation, assuming that neurons presumably express specific XA receptors. Recently, it has been shown that XA could act as a positive allosteric ligand for class II metabotropic glutamate receptors. This finding reinforces the proposed signaling role of XA in brain. Our present results provide several lines of evidence in favor of the existence of specific receptors for XA in the brain. First, binding experiments combined with autoradiography and time-course analysis led to the characterization of XA binding sites in the rat brain. Second, specific kinetic and pharmacological properties exhibited by these binding sites are in favor of G-protein-coupled receptors (GPCR). Finally, in patch-clamp and calcium imaging experiments using NCB-20 cells that do not express glutamate-induced calcium signals, XA elicited specific responses involving activation of cationic channels and increases in intracellular Ca(2+) concentration. Altogether, these results suggest that XA, acting through a GPCR-induced cationic channel modulatory mechanism, may exert excitatory functions in various brain neuronal pathways. PMID:23139790

  12. Xanthurenic acid binds to neuronal G-protein-coupled receptors that secondarily activate cationic channels in the cell line NCB-20.

    Directory of Open Access Journals (Sweden)

    Omar Taleb

    Full Text Available Xanthurenic acid (XA is a metabolite of the tryptophan oxidation pathway through kynurenine and 3-hydroxykynurenine. XA was until now considered as a detoxification compound and dead-end product reducing accumulation of reactive radical species. Apart from a specific role for XA in the signaling cascade resulting in gamete maturation in mosquitoes, nothing was known about its functions in other species including mammals. Based upon XA distribution, transport, accumulation and release in the rat brain, we have recently suggested that XA may potentially be involved in neurotransmission/neuromodulation, assuming that neurons presumably express specific XA receptors. Recently, it has been shown that XA could act as a positive allosteric ligand for class II metabotropic glutamate receptors. This finding reinforces the proposed signaling role of XA in brain. Our present results provide several lines of evidence in favor of the existence of specific receptors for XA in the brain. First, binding experiments combined with autoradiography and time-course analysis led to the characterization of XA binding sites in the rat brain. Second, specific kinetic and pharmacological properties exhibited by these binding sites are in favor of G-protein-coupled receptors (GPCR. Finally, in patch-clamp and calcium imaging experiments using NCB-20 cells that do not express glutamate-induced calcium signals, XA elicited specific responses involving activation of cationic channels and increases in intracellular Ca(2+ concentration. Altogether, these results suggest that XA, acting through a GPCR-induced cationic channel modulatory mechanism, may exert excitatory functions in various brain neuronal pathways.

  13. Folding machineries displayed on a cation-exchanger for the concerted refolding of cysteine- or proline-rich proteins

    Directory of Open Access Journals (Sweden)

    Lee Dae-Hee

    2009-03-01

    Full Text Available Abstract Background Escherichia coli has been most widely used for the production of valuable recombinant proteins. However, over-production of heterologous proteins in E. coli frequently leads to their misfolding and aggregation yielding inclusion bodies. Previous attempts to refold the inclusion bodies into bioactive forms usually result in poor recovery and account for the major cost in industrial production of desired proteins from recombinant E. coli. Here, we describe the successful use of the immobilized folding machineries for in vitro refolding with the examples of high yield refolding of a ribonuclease A (RNase A and cyclohexanone monooxygenase (CHMO. Results We have generated refolding-facilitating media immobilized with three folding machineries, mini-chaperone (a monomeric apical domain consisting of residues 191–345 of GroEL and two foldases (DsbA and human peptidyl-prolyl cis-trans isomerase by mimicking oxidative refolding chromatography. For efficient and simple purification and immobilization simultaneously, folding machineries were fused with the positively-charged consecutive 10-arginine tag at their C-terminal. The immobilized folding machineries were fully functional when assayed in a batch mode. When the refolding-facilitating matrices were applied to the refolding of denatured and reduced RNase A and CHMO, both of which contain many cysteine and proline residues, RNase A and CHMO were recovered in 73% and 53% yield of soluble protein with full enzyme activity, respectively. Conclusion The refolding-facilitating media presented here could be a cost-efficient platform and should be applicable to refold a wide range of E. coli inclusion bodies in high yield with biological function.

  14. Chitosan based nanoparticles as protein carriers for efficient oral antigen delivery.

    Science.gov (United States)

    Gao, Ping; Xia, Guixue; Bao, Zixian; Feng, Chao; Cheng, Xiaojie; Kong, Ming; Liu, Ya; Chen, Xiguang

    2016-10-01

    This study aimed to investigate the efficacy of nanoparticles based on chitosan as a vehicle for oral antigen delivery in fish vaccination. Carboxymethyl chitosan/chitosan nanoparticles (CMCS/CS-NPs) loaded extracellular products (ECPs) of Vibrio anguillarum were successfully developed by ionic gelation method. The prepared ECPs-loaded CMCS/CS-NPs were characterized for various parameters including morphology, particle size (312±7.18nm), zeta potential (+17.4±0.38mV), loading efficiency (57.8±2.54%) and stability under the simulated gastrointestinal (GI) tract conditions in turbot. The in vitro profile showed that the cumulative release of ECPs from nanoparticles was higher in pH 7.4 (58%) than in pH 2.0 (37%) and pH 4.5 (29%) after 48h. Fluorescein isothiocyanate-labeled bovine serum albumin (FITC-BSA) was used as model protein antigen and encapsulated in CMCS/CS-NPs for investigating the biodistribution of antigen after oral delivery to turbot in 24h. Oral immunization of ECPs-loaded CMCS/CS-NPs group in turbot showed elevated specific antibody and higher concentrations of lysozyme activity and complement activity in fish serum than ECPs solution. CMCS/CS-NPs loaded with ECPs could enhance both adaptive and innate immune responses than the group treated with ECPs solution and suggested to be a potential antigen delivery system. PMID:27287772

  15. State Grid Batch Procurement Plan Review Based on ERP and ECP%基于 ERP、ECP 的国网批次物资计划审查工作探析

    Institute of Scientific and Technical Information of China (English)

    徐康

    2015-01-01

    The work of reviewing procurement plans based on ERP and ECP is time-consuming but important .The reviewing quality determines the work efficiency of all the following steps such as materials procurement , contract signing , materials supply and settlement .What′s more, it influences the bench-marking indexes to a great extent .The paper makes the analysis and conclusion on various factors existing in the process of reviewing the batch procurement plans of State Grid , tries to find solutions , makes out a set of efficient work procedures and therefore achieves the good results .%基于ERP、ECP的物资计划审查工作是一项繁忙而又重要的工作,计划审查质量的高低,决定后续物资采购、合同签订、物资供应及结算各个环节的工作效率,同时对同业对标指标影响很大. 文章针对国网总部批次物资计划审查过程中存在的各种因素进行分析总结,积极探讨解决方案,整理出一套行之有效的工作措施,并取得了较好的成效.

  16. Interactions of cationic polystyrene nanoparticles with marine bivalve hemocytes in a physiological environment: Role of soluble hemolymph proteins.

    Science.gov (United States)

    Canesi, Laura; Ciacci, Caterina; Fabbri, Rita; Balbi, Teresa; Salis, Annalisa; Damonte, Gianluca; Cortese, Katia; Caratto, Valentina; Monopoli, Marco P; Dawson, Kenneth; Bergami, Elisa; Corsi, Ilaria

    2016-10-01

    The bivalve Mytilus galloprovincialis has proven as a suitable model invertebrate for evaluating the potential impact of nanoparticles (NPs) in the marine environment. In particular, in mussels, the immune system represents a sensitive target for different types of NPs. In environmental conditions, both NP intrinsic properties and those of the receiving medium will affect particle behavior and consequent bioavailability/uptake/toxicity. However, the evaluation of the biological effects of NPs requires additional understanding of how, once within the organism, NPs interact at the molecular level with cells in a physiological environment. In mammalian systems, different NPs associate with serum soluble components, organized into a "protein corona", which affects particle interactions with target cells. However, no information is available so far on the interactions of NPs with biological fluids of aquatic organisms. In this work, the influence of hemolymph serum (HS) on the in vitro effects of amino modified polystyrene NPs (PS-NH2) on Mytilus hemocytes was investigated. Hemocytes were incubated with PS-NH2 suspensions in HS (1, 5 and 50µg/mL) and the results were compared with those obtained in ASW medium. Cell functional parameters (lysosomal membrane stability, oxyradical production, phagocytosis) were evaluated, and morphological changes were investigated by TEM. The activation state of the signalling components involved in Mytilus immune response (p38 MAPK and PKC) was determined. The results show that in the presence of HS, PS-NH2 increased cellular damage and ROS production with respect to ASW medium. The effects were apparently mediated by disregulation of p38 MAPK signalling. The formation of a PS-NH2-protein corona in HS was investigated by centrifugation, and 1D- gel electrophoresis and nano-HPLC-ESI-MS/MS. The results identified the Putative C1q domain containing protein (MgC1q6) as the only component of the PS-NH2 hard protein corona in Mytilus

  17. The open-close mechanism of M2 channel protein in influenza A virus:A computational study on the hydrogen bonds and cation-π interactions among His37 and Trp41

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The M2 protein from influenza A virus is a tetrameric ion channel. It was reported that the permeation of the ion channel is correlated with the hydrogen bond network among His37 residues and the cation-π interactions between His37 and Trp41. In the present study,the hydrogen bonding network of 4-methyl-imidazoles was built to mimic the hydrogen bonds between His37 residues,and the cation-π interactions between 4-methyl-imidazolium and indole systems were selected to represent the interac-tions between His37 and Trp41. Then,quantum chemistry calculations at the MP2/6-311G level were carried out to explore the properties of the hydrogen bonds and the cation-π interactions. The calcula-tion results indicate that the binding strength of the N-H···N hydrogen bond between imidazole rings is up to -6.22 kcal·mol-1,and the binding strength of the strongest cation-π interaction is up to -18.8 kcal·mol-1(T-shaped interaction) or -12.3 kcal·mol-1(parallel stacking interaction). Thus,the calcu-lated binding energies indicate that it is possible to control the permeation of the M2 ion channel through the hydrogen bond network and the cation-π interactions by altering the pH values.

  18. The open-close mechanism of M2 channel protein in influenza A virus: A computational study on the hydrogen bonds and cation-π interactions among His37 and Trp41

    Institute of Scientific and Technical Information of China (English)

    CHENG JiaGao; ZHU WeiLiang; WANG YanLi; YAN XiuHua; LI Zhong; TANG Yun; JIANG HuaLiang

    2008-01-01

    The M2 protein from influenza A virus is a tetrameric ion channel. It was reported that the permeation of the ion channel is correlated with the hydrogen bond network among His37 residues and the cation-π interactions between His37 and Trp41. In the present study, the hydrogen bonding network of 4-methyl-imidazoles was built to mimic the hydrogen bonds between His37 residues, and the cation-π interactions between 4-methyl-imidazolium and indole systems were selected to represent the interac-tions between His37 and Trp41. Then, quantum chemistry calculations at the MP2/6-311G** level were carried out to explore the properties of the hydrogen bonds and the cation-π interactions. The calculation results indicate that the binding strength of the N--H…N hydrogen bond between imidazole rings is up to -6.22 kcal·mol-1, and the binding strength of the strongest cation-π interaction is up to -18.8 kcal·mol-1 (T-shaped interaction) or -12.3 kcal·mol-1 (parallel stacking interaction). Thus, the calculated binding energies indicate that it is possible to control the permeation of the M2 ion channel through the hydrogen bond network and the cation-π interactions by altering the pH values.

  19. [Cow's milk protein allergy through human milk].

    Science.gov (United States)

    Denis, M; Loras-Duclaux, I; Lachaux, A

    2012-03-01

    Cow's milk protein allergy (CMPA) is the first allergy that affects infants. In this population, the incidence rate reaches 7.5%. The multiplicity and aspecificity of the symptoms makes its diagnosis sometimes complicated, especially in the delayed type (gastrointestinal, dermatological, and cutaneous). CMPA symptoms can develop in exclusively breastfed infants with an incidence rate of 0.5%. It, therefore, raises questions about sensitization to cow's milk proteins through breast milk. Transfer of native bovine proteins such as β-lactoglobulin into the breast milk is controversial: some authors have found bovine proteins in human milk but others point to cross-reactivity between human milk proteins and cow's milk proteins. However, it seems that a small percentage of dietary proteins can resist digestion and become potentially allergenic. Moreover, some authors suspect the transfer of some of these dietary proteins from the maternal bloodstream to breast milk, but the mechanisms governing sensitization are still being studied. Theoretically, CMPA diagnosis is based on clinical observations, prick-test or patch-test results, and cow's milk-specific IgE antibody concentration. A positive food challenge test usually confirms the diagnosis. No laboratory test is available to make a certain diagnosis, but the detection of eosinophil cationic protein (ECP) in the mother's milk, for example, seems to be advantageous since it is linked to CMA. Excluding cow's milk from the mother's diet is the only cure when she still wants to breastfeed. Usually, cow's milk proteins are reintroduced after 6 months of exclusion. Indeed, the prognosis for infants is very good: 80% acquire a tolerance before the age of 3 or 4 years. Mothers should not avoid dairy products during pregnancy and breastfeeding as preventive measures against allergy. PMID:22226014

  20. How Egg Case Proteins Can Protect Cuttlefish Offspring?

    Directory of Open Access Journals (Sweden)

    Valérie Cornet

    Full Text Available Sepia officinalis egg protection is ensured by a complex capsule produced by the female accessory genital glands and the ink bag. Our study is focused on the proteins constituting the main egg case. De novo transcriptomes from female genital glands provided essential databases for protein identification. A proteomic approach in SDS-PAGE coupled with MS unveiled a new egg case protein family: SepECPs, for Sepia officinalis Egg Case Proteins. N-glycosylation was demonstrated by PAS staining SDS-PAGE gels. These glycoproteins are mainly produced in the main nidamental glands. SepECPs share high sequence homology, especially in the signal peptide and the three cysteine-rich domains. SepECPs have a high number of cysteines, with conserved motifs involved in 3D-structure. SDS-PAGE showed that SepECPs could form dimers; this result was confirmed by TEM observations, which also revealed a protein network. This network is similar to the capsule network, and it associates these structural proteins with polysaccharides, melanin and bacteria to form a tight mesh. Its hardness and elasticity provide physical protection to the embryo. In addition, SepECPs also have bacteriostatic antimicrobial activity on GRAM- bacteria. By observing the SepECP / Vibrio aestuarianus complex in SEM, we demonstrated the ability of these proteins to agglomerate bacteria and thus inhibit their growth. These original proteins identified from the outer egg case ensure the survival of the species by providing physical and chemical protection to the embryos released in the environment without any maternal protection.

  1. 阳离子明胶蛋白助剂对双氧水分解率的影响%Effect of cationic gelatin protein on hydrogen peroxide decomposition rate

    Institute of Scientific and Technical Information of China (English)

    唐俊玲; 王雪燕

    2016-01-01

    For the purpose of improving the control of the hydrogen peroxide decomposition rate, the prediction of the bleaching results, and the optimization of cotton fabric bleaching process, a self-made cationic gelatin protein agent was used in cotton hydrogen peroxide bleaching and hydrogen peroxide decomposition rate was calculated. The influence of self-made cationic gelatin protein agent, stabilizing agent sodium silicate and activator TAED on the hydrogen peroxide decomposition rate was compared. The results showed that cationic gelatin protein could promote the decomposition of hydrogen peroxide effectively and the decomposition rate was closed to TAED under low temperature and low alkali. The cationic gelatin protein acted as an activator in bleaching process. It provided a theoretical basis for the cationic gelatin protein agent application in hydrogen peroxide bleaching with low temperature and low alkali.%为提高对棉织物漂白过程中双氧水分解速率的控制、漂白效果的预测及漂白工艺优化的理论指导作用,将自制的阳离子明胶蛋白助剂应用于棉织物双氧水漂白工艺中,计算双氧水分解速率,并与传统稳定剂硅酸钠及活化剂TAED对双氧水分解速率的影响对比。结果表明,在低温低碱条件下,阳离子明胶蛋白能有效促进双氧水的分解,分解率与TAED相近,说明阳离子明胶蛋白助剂在双氧水漂白过程中起到活化剂的作用,从而为阳离子明胶蛋白助剂在双氧水低温低碱漂白中的应用提供理论依据。

  2. Exploring new biological functions of amyloids: bacteria cell agglutination mediated by host protein aggregation.

    Directory of Open Access Journals (Sweden)

    Marc Torrent

    Full Text Available Antimicrobial proteins and peptides (AMPs are important effectors of the innate immune system that play a vital role in the prevention of infections. Recent advances have highlighted the similarity between AMPs and amyloid proteins. Using the Eosinophil Cationic Protein as a model, we have rationalized the structure-activity relationships between amyloid aggregation and antimicrobial activity. Our results show how protein aggregation can induce bacteria agglutination and cell death. Using confocal and total internal reflection fluorescence microscopy we have tracked the formation in situ of protein amyloid-like aggregates at the bacteria surface and on membrane models. In both cases, fibrillar aggregates able to bind to amyloid diagnostic dyes were detected. Additionally, a single point mutation (Ile13 to Ala can suppress the protein amyloid behavior, abolishing the agglutinating activity and impairing the antimicrobial action. The mutant is also defective in triggering both leakage and lipid vesicle aggregation. We conclude that ECP aggregation at the bacterial surface is essential for its cytotoxicity. Hence, we propose here a new prospective biological function for amyloid-like aggregates with potential biological relevance.

  3. The MprF protein is required for lysinylation of phospholipids in listerial membranes and confers resistance to cationic antimicrobial peptides (CAMPs) on Listeria monocytogenes

    NARCIS (Netherlands)

    Thedieck, Kathrin; Hain, Torsten; Mohamed, Walid; Tindall, Brian J; Nimtz, Manfred; Chakraborty, Trinad; Wehland, Jürgen; Jänsch, Lothar

    2006-01-01

    Pathogenic bacteria have to cope with defence mechanisms mediated by adaptive and innate immunity of the host cells. Cationic antimicrobial peptides (CAMPs) represent one of the most effective components of the host innate immune response. Here we establish the function of Lmo1695, a member of the V

  4. Cations and activated sludge floc structure

    OpenAIRE

    Park, Chul

    2002-01-01

    This research was designed to investigate the effect of cations on activated sludge characteristics and also to determine their influence on digestion performance. For this purpose, cations in solution and in floc were evaluated along with various activated sludge characteristics and the collected waste activated sludge underwent both anaerobic and aerobic digestion. It was found that large amounts of biopolymer (protein + polysaccharide) remained in the effluent of WWTP that received high in...

  5. Advances in Research on Plasma-Membrane Associated Cation-Bind-ing Proteins%细胞膜相联钙结合蛋白的结构和功能研究进展

    Institute of Scientific and Technical Information of China (English)

    何伟; 王斐; 闫海芳

    2014-01-01

    细胞膜相联钙结合蛋白(PCaP)是定位于细胞膜上的一类新的Ca2+结合蛋白。简要综述了PCaP的蛋白结构、调控Ca2+/磷脂酰肌醇3-磷酸信号通路的分子机制、调节微管微丝稳定的能力,以及其在植物顶端生长极性中的功能研究进展。%The plasma-membrane associated cation-binding protein(PCaP) of Arabidopsis thaliana is a kind of cation-binding protein which is located in plasma membrane. In this review, we mainly describled the advances re-search on the protein structure, the molecular mechanism of regulating Ca2+/PtdInsP(phosphatidylinositol 3-phos-phate) signaling pathways, the ability of adjusting microtube, and its biological functions in plant tip growth polari-ty of PCaP.

  6. Cationic lipid-formulated DNA vaccine against hepatitis B virus: immunogenicity of MIDGE-Th1 vectors encoding small and large surface antigen in comparison to a licensed protein vaccine.

    Directory of Open Access Journals (Sweden)

    Anne Endmann

    Full Text Available Currently marketed vaccines against hepatitis B virus (HBV based on the small (S hepatitis B surface antigen (HBsAg fail to induce a protective immune response in about 10% of vaccinees. DNA vaccination and the inclusion of PreS1 and PreS2 domains of HBsAg have been reported to represent feasible strategies to improve the efficacy of HBV vaccines. Here, we evaluated the immunogenicity of SAINT-18-formulated MIDGE-Th1 vectors encoding the S or the large (L protein of HBsAg in mice and pigs. In both animal models, vectors encoding the secretion-competent S protein induced stronger humoral responses than vectors encoding the L protein, which was shown to be retained mainly intracellularly despite the presence of a heterologous secretion signal. In pigs, SAINT-18-formulated MIDGE-Th1 vectors encoding the S protein elicited an immune response of the same magnitude as the licensed protein vaccine Engerix-B, with S protein-specific antibody levels significantly higher than those considered protective in humans, and lasting for at least six months after the third immunization. Thus, our results provide not only the proof of concept for the SAINT-18-formulated MIDGE-Th1 vector approach but also confirm that with a cationic-lipid formulation, a DNA vaccine at a relatively low dose can elicit an immune response similar to a human dose of an aluminum hydroxide-adjuvanted protein vaccine in large animals.

  7. The cation diffusion facilitator proteins MamB and MamM of Magnetospirillum gryphiswaldense have distinct and complex functions, and are involved in magnetite biomineralization and magnetosome membrane assembly

    DEFF Research Database (Denmark)

    Uebe, René; Junge, Katja; Henn, Verena;

    2011-01-01

    Magnetotactic bacteria form chains of intracellular membrane‐enclosed, nanometre‐sized magnetite crystals for navigation along the earth's magnetic field. The assembly of these prokaryotic organelles requires several specific polypeptides. Among the most abundant proteins associated...... including the PDZ1 domain of MamE. Whereas any genetic modification of MamB resulted in loss of function, site‐specific mutagenesis within MamM lead to increased formation of polycrystalline magnetite particles. A single amino acid substitution within MamM resulted in crystals consisting of haematite, which...... with the magnetosome membrane of Magnetospirillum gryphiswaldense are MamB and MamM, which were implicated in magnetosomal iron transport because of their similarity to the cation diffusion facilitator family. Here we demonstrate that MamB and MamM are multifunctional proteins involved in several steps of magnetosome...

  8. Live Transplantation in Children Antibody Production Against ِE. Coli Polypeptide (ECP) by ِDot Blotting and ELISA Methods for ECP Assay in Recombinant Drug and Patients Sera

    OpenAIRE

    A. Rabbani.; MH Sanati; Akrami, H.; G Ahangari

    2003-01-01

    Recombinant DNA technology made it possible to produce biological drugs and pharmaceutical companies produced recombinant human drugs. There have been reports on the formation of antibodies against residual host cell protein. For this reason, it is important to check the patients sera for antibodies which could possibly be induced by recombinant drug it self and/or by contaminating proteins of the host cell. The present report refers to the obtainment of polyspecific antisera directed against...

  9. Isolation of cross-linked peptides by diagonal strong cation exchange chromatography for protein complex topology studies by peptide fragment fingerprinting from large sequence databases

    NARCIS (Netherlands)

    H. Buncherd; W. Roseboom; B. Ghavim; W. Du; L.J. de Koning; C.G. de Koster; L. de Jong

    2014-01-01

    Knowledge of spatial proximity of amino acid residues obtained by chemical cross-linking and mass spectrometric analysis provides information about protein folding, protein-protein interactions and topology of macromolecular assemblies. We show that the use of bis(succinimidyl)-3-azidomethyl glutara

  10. Immunoradiometric assay for the determination of E. coli proteins in recombinant dna derived human growth hormone produced at IPEN-CNEN/SP

    International Nuclear Information System (INIS)

    An immunoradiometric assay (IRMA) for the determination of multiple antigens was set up in order to quantify E. coli (ECP) in lots of purified recombinant human growth hormone (rec-hGH). SDS-PAGE and Western Blotting techniques were carried out, in parallel, to confirm the results obtained by IRMA and to provide more information about the contaminants. Anti-ECP antibodies were obtained by rabbit immunization with ECP, which were submitted to the same purification process utilized for rec-hGH with the exception of the last step. A strain-process-specific assay was thus set up. The antiserum obtained was purified through an affinity column prepared with the same ECP used for immunization, this provided an highly sensitive assay (0,03 ng ECP/mL). This IRMA was shown to be specific, not presenting any cross reaction with hGH and studies carried out on precision, accuracy and linearity of response with dilution confirmed its validity as one of the fundamental purity tests for rec-hGH produced at IPEN-CNEN/SP, whose principles can be easily extended to the analysis of other similar products. These studies have also shown that the utilization of an affinity column, prepared with the described anti-ECP antiserum was very effective, providing rec-hGH lots with less then 10 parts per million (0,001%) of contaminating proteins. (author). 45 refs., 15 figs., 11 tabs

  11. Nearly 1000 Protein Identifications from 50 ng of Xenopus laevis Zygote Homogenate Using Online Sample Preparation on a Strong Cation Exchange Monolith Based Microreactor Coupled with Capillary Zone Electrophoresis.

    Science.gov (United States)

    Zhang, Zhenbin; Sun, Liangliang; Zhu, Guijie; Cox, Olivia F; Huber, Paul W; Dovichi, Norman J

    2016-01-01

    A sulfonate-silica hybrid strong cation exchange monolith microreactor was synthesized and coupled to a linear polyacrylamide coated capillary for online sample preparation and capillary zone electrophoresis-tandem mass spectrometry (CZE-MS/MS) bottom-up proteomic analysis. The protein sample was loaded onto the microreactor in an acidic buffer. After online reduction, alkylation, and digestion with trypsin, the digests were eluted with 200 mM ammonium bicarbonate at pH 8.2 for CZE-MS/MS analysis using 1 M acetic acid as the background electrolyte. This combination of basic elution and acidic background electrolytes results in both sample stacking and formation of a dynamic pH junction. 369 protein groups and 1274 peptides were identified from 50 ng of Xenopus laevis zygote homogenate, which is comparable with an offline sample preparation method, but the time required for sample preparation was decreased from over 24 h to less than 40 min. Dramatically improved performance was produced by coupling the reactor to a longer separation capillary (∼100 cm) and a Q Exactive HF mass spectrometer. 975 protein groups and 3749 peptides were identified from 50 ng of Xenopus protein using the online sample preparation method. PMID:26670623

  12. Structurally Distinct Cation Channelrhodopsins from Cryptophyte Algae.

    Science.gov (United States)

    Govorunova, Elena G; Sineshchekov, Oleg A; Spudich, John L

    2016-06-01

    Microbial rhodopsins are remarkable for the diversity of their functional mechanisms based on the same protein scaffold. A class of rhodopsins from cryptophyte algae show close sequence homology with haloarchaeal rhodopsin proton pumps rather than with previously known channelrhodopsins from chlorophyte (green) algae. In particular, both aspartate residues that occupy the positions of the chromophore Schiff base proton acceptor and donor, a hallmark of rhodopsin proton pumps, are conserved in these cryptophyte proteins. We expressed the corresponding polynucleotides in human embryonic kidney (HEK293) cells and studied electrogenic properties of the encoded proteins with whole-cell patch-clamp recording. Despite their lack of residues characteristic of the chlorophyte cation channels, these proteins are cation-conducting channelrhodopsins that carry out light-gated passive transport of Na(+) and H(+). These findings show that channel function in rhodopsins has evolved via multiple routes. PMID:27233115

  13. Molecular cloning, identifi-cation and characteristics of NYD-SP9: Gene coding pro-tein kinase presumably in-volved in spermatogenesis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Using cDNA microarray hybridization from a human testicular cDNA library, one gene exhibiting ten-fold difference at expression level between adult and embryo human testes was cloned and named NYD-SP9, which was believed to be involved in spermatogenesis. Southern blot hybridization results showed that NYD-SP9 expressed highly in testis but low in ovary. Protein motif analysis of this cDNA sequence revealed a cluster of phosphorylation sites, indicating its potential involvement in signal pathways during spermatogenesis. Furthermore, one transmembrane helix was predicted in N-terminal region, indicating that putative NYD-SP6 may be served as a transmembrane protein. The proximity of these potential phosphorylation sites to each other indicates that there may be interaction among these sites to regulate spermatogenesis. These findings suggested that protein kinase NYD-SP9 might play a role in male germ cell differentiation.

  14. Cationic spin probe reporting on thermal denaturation and complexation-decomplexation of BSA with SDS. Potential applications in protein purification processes.

    Science.gov (United States)

    Matei, Iulia; Ariciu, Ana Maria; Neacsu, Maria Victoria; Collauto, Alberto; Salifoglou, Athanasios; Ionita, Gabriela

    2014-09-25

    In this work, we present evidence on the suitability of spin probes to report on the thermal treatment of bovine serum albumin (BSA), in the temperature range 293-343 K, and indirectly monitor the release of sodium dodecyl sulfate (SDS) from its complex with BSA using a covalent gel with β-cyclodextrin (β-CD) in the network. The spin probes used, 5- and 7-doxyl-stearic acids (5-DSA, 7-DSA) or 4-(N,N'-dimethyl-N-hexadecyl)ammonium-2,2',6,6'-tetramethylpiperidine-1-oxyl iodide (CAT16), present similar, fatty acid-like structural features. Their continuous wave electron paramagnetic resonance (CW-EPR) spectra, however, reflect different dynamics when complexed with BSA: a restricted motion for 5-DSA, almost nonsensitive to the heating/cooling cycle, and a faster temperature-dependent dynamic motion for CAT16. Molecular docking allows us to rationalize these results by revealing the different binding modes of 5-DSA and CAT16. The EPR data on the temperature effect on BSA are supported by circular dichroism results projecting recovery, upon cooling, of the initial binding ability of BSA for samples heated to 323 K. The interactions occurring in BSA/SDS/β-CD systems are investigated by CW-EPR and FT-ESEEM spectroscopies. It is found that the covalent gel containing β-CD can efficiently remove SDS from the BSA/SDS complex. The gel is not permeable to BSA but it can encapsulate SDS, thus yielding the free protein in solution and allowing recovery of the native protein conformation. Collectively, the accrued knowledge supports potential applications in protein purification biotechnological processes.

  15. Role of extracellular cations in cell motility, polarity, and chemotaxis

    Directory of Open Access Journals (Sweden)

    Soll D

    2011-04-01

    Full Text Available David R Soll1, Deborah Wessels1, Daniel F Lusche1, Spencer Kuhl1, Amanda Scherer1, Shawna Grimm1,21Monoclonal Antibody Research Institute, Developmental Studies, Hybridoma Bank, Department of Biology, University of Iowa, Iowa City; 2Mercy Medical Center, Surgical Residency Program, Des Moines, Iowa, USAAbstract: The concentration of cations in the aqueous environment of free living organisms and cells within the human body influence motility, shape, and chemotaxis. The role of extracellular cations is usually perceived to be the source for intracellular cations in the process of homeostasis. The role of surface molecules that interact with extracellular cations is believed to be that of channels, transporters, and exchangers. However, the role of Ca2+ as a signal and chemoattractant and the discovery of the Ca2+ receptor have demonstrated that extracellular cations can function as signals at the cell surface, and the plasma membrane molecules they interact with can function as bona fide receptors that activate coupled signal transduction pathways, associated molecules in the plasma membrane, or the cytoskeleton. With this perspective in mind, we have reviewed the cationic composition of aqueous environments of free living cells and cells that move in multicellular organisms, most notably humans, the range of molecules interacting with cations at the cell surface, the concept of a cell surface cation receptor, and the roles extracellular cations and plasma membrane proteins that interact with them play in the regulation of motility, shape, and chemotaxis. Hopefully, the perspective of this review will increase awareness of the roles extracellular cations play and the possibility that many of the plasma membrane proteins that interact with them could also play roles as receptors.Keywords: extracellular cations, chemotaxis, transporters, calcium, receptors

  16. Do Cation-π Interactions Exist in Bacteriorhodopsin

    Institute of Scientific and Technical Information of China (English)

    HU Kun-Sheng; WANG Guang-Yu; HE Jin-An

    2001-01-01

    Metal ions are essential to the structure and physiological functions of bacteriorhodopsin. Experimental evidence suggests the existence of specific cation binding to the negatively charged groups of Asp85 and Asp212 via an electrostatic interaction. However, only using electrostatic force is not enough to explain the role of the metal cations because the carboxylate of Asp85 is well known to be protonated in the M intermediate. Considering the presence of some aromatic amino acid residues in the vicinity of the retinal pocket, the existence of cation-π interactions between the metal cation and aromatic amino acid residues is suggested. Obviously, introduction of this kind of interaction is conducive to understanding the effects of the metal cations and aromatic amino acid residues inside the protein on the structural stability and proton pumping of bacteriorhodopsin.

  17. 阳离子生物蛋白衍生物固色剂的合成及应用%Synthesis and application of cationic biological protein derivative fixing agent

    Institute of Scientific and Technical Information of China (English)

    刘元军; 赵晓明; 梁腾隆

    2016-01-01

    A quaternary ammonium salt cationic biological protein derivative fixing agent (WLS- 20) was prepared using waste feather protein and self- made reactive cationic crosslinking modification agent WLS as raw materials, which was applied in the fixation post- treatment of reactive dyed cotton fabric. Using white cloth staining degree (K/S value) of soaping post- treatment and soaping fastness as evaluation indexes, the ef⁃fects of mass ratio of abandoned feather protein and WLS, alkali agent dosage, reaction temperature and reac⁃tion time on the fixation result were investigated. The optimum synthesis conditions of fixing agent WLS- 20 was determined: the mass ratio of feather protein and WLS was 1∶16, sodium hydroxide dosage was 3% (on the mass of WLS), reacted at 65 ℃ for 4 h. The structure and performance of the agent was characterized. The results showed that the WLS- 20 had absorbance to UV light, and the maximum absorption wavelength is 195 nm. WLS- 20 additives dosage and absorbance had the best linear relationship under the maximum ab⁃sorption wavelength. WLS- 20 synthesized under the optimum conditions could reduce the white cloth stain⁃ing during soaping, and effectively improved the color fastness to washing and crocking of cotton fabric.%首先以废弃羽毛蛋白和自制反应性阳离子交联改性剂WLS为原料,制备一种季铵型阳离子生物蛋白衍生物固色剂WLS-20,再将其用于活性染料染色棉织物固色后处理中。以皂洗后处理时色布对白布沾色程度(测定K/S值)以及耐皂洗色牢度等为评价指标,研究了废弃羽毛蛋白粉与WLS质量比、碱剂用量、反应温度、反应时间等合成工艺条件对染色棉织物固色效果的影响,确定了固色剂WLS-20的最佳合成条件:羽毛蛋白与WLS质量比为1∶16,氢氧化钠用量为3%(对WLS质量),65℃恒温反应4 h,并对该助剂结构和性能进行了表征。研究结果表明

  18. Reactive dyes dyeing properties of modified CVC fabric with cationic gelatin protein agent%阳离子明胶蛋白改性 CVC 织物活性染料的染色性

    Institute of Scientific and Technical Information of China (English)

    徐华凤; 王雪燕

    2015-01-01

    CVC fabric is modified with sele‐made cationic gelatin protein agent .Then the best modified process conditions are optimized w hich are conducive to improving the dyeing perform‐ance of reactive dyes . And the salt‐free dyeing properties of modified CVC fabric are re‐searched .Compared with the unmodified CVC fabric dyeing with salt ,the salt‐free dyeing mod‐ified CVC fabric demonstrates a higher dyestuff up‐take ,K/S value and fixation rate .The fast‐ness to soaping is improved w hile the rubbing fastness slightly decreases ,w hich needs further study .%针对活性染料利用率低,染深色及盐用量多的问题,利用自制阳离子明胶蛋白助剂对CVC织物进行阳离子化改性,优化出有利于提高活性染料吸附上染性能的最佳改性工艺条件,并且研究了改性CVC织物活性染料无盐染色的性能。结果表明,改性CVC织物无盐染色可获得比未改性CVC织物常规加盐染色更高的上染百分率、K/S值、固色效率和皂洗牢度,但是摩擦牢度有轻微降低,需要进一步研究。

  19. Radiation chemistry of aromatic dimer radical cations

    International Nuclear Information System (INIS)

    π-π Interactions of aromatic molecules are paid attention much in many fields, especially biology, chemistry, and applied physics, represented as protein, DNA, electron donor-accepter complexes, charge transfers, and self assembly molecules. Aromatic molecules including benzene rings are the simplest case to study the π-π interactions. To interpret the charge resonance (CR) structure in the dimer radical cations, spectroscopic and ESR methods have been carried out. The spectroscopic study on the dimer radical ion of molecules with two chromophores would be profitable to identify the electronic and configurational properties. In this article, dynamics of the dimer radical cation of benzenes, polystyrenes, and resist polymers is described on the basis of direct observation of CR band by the nanosecond pulse radiolysis and low temperature γ-radiolysis methods. (author)

  20. Cationic Bolaamphiphiles for Gene Delivery

    Science.gov (United States)

    Tan, Amelia Li Min; Lim, Alisa Xue Ling; Zhu, Yiting; Yang, Yi Yan; Khan, Majad

    2014-05-01

    Advances in medical research have shed light on the genetic cause of many human diseases. Gene therapy is a promising approach which can be used to deliver therapeutic genes to treat genetic diseases at its most fundamental level. In general, nonviral vectors are preferred due to reduced risk of immune response, but they are also commonly associated with low transfection efficiency and high cytotoxicity. In contrast to viral vectors, nonviral vectors do not have a natural mechanism to overcome extra- and intracellular barriers when delivering the therapeutic gene into cell. Hence, its design has been increasingly complex to meet challenges faced in targeting of, penetration of and expression in a specific host cell in achieving more satisfactory transfection efficiency. Flexibility in design of the vector is desirable, to enable a careful and controlled manipulation of its properties and functions. This can be met by the use of bolaamphiphile, a special class of lipid. Unlike conventional lipids, bolaamphiphiles can form asymmetric complexes with the therapeutic gene. The advantage of having an asymmetric complex lies in the different purposes served by the interior and exterior of the complex. More effective gene encapsulation within the interior of the complex can be achieved without triggering greater aggregation of serum proteins with the exterior, potentially overcoming one of the great hurdles faced by conventional single-head cationic lipids. In this review, we will look into the physiochemical considerations as well as the biological aspects of a bolaamphiphile-based gene delivery system.

  1. Ion exchange behaviour of polymeric zirconium cations

    International Nuclear Information System (INIS)

    Polymeric zirconium cations formed in weakly acid solutions (pH2) are taken up strongly into macroporous cation exchange resins, while uptake into normal cation exchange resins (pore diameter about 1 nm) is low. Macroporous cation exchange resins loaded with polymeric Zr cations are shown to function as ligand exchange sorbents. (Authors)

  2. Cations bind only weakly to amides in aqueous solutions.

    Science.gov (United States)

    Okur, Halil I; Kherb, Jaibir; Cremer, Paul S

    2013-04-01

    We investigated salt interactions with butyramide as a simple mimic of cation interactions with protein backbones. The experiments were performed in aqueous metal chloride solutions using two spectroscopic techniques. In the first, which provided information about contact pair formation, the response of the amide I band to the nature and concentration of salt was monitored in bulk aqueous solutions via attenuated total reflection Fourier transform infrared spectroscopy. It was found that molar concentrations of well-hydrated metal cations (Ca(2+), Mg(2+), Li(+)) led to the rise of a peak assigned to metal cation-bound amides (1645 cm(-1)) and a decrease in the peak associated with purely water-bound amides (1620 cm(-1)). In a complementary set of experiments, the effect of cation identity and concentration was investigated at the air/butyramide/water interface via vibrational sum frequency spectroscopy. In these studies, metal ion-amide binding led to the ordering of the adjacent water layer. Such experiments were sensitive to the interfacial partitioning of cations in either a contact pair with the amide or as a solvent separated pair. In both experiments, the ordering of the interactions of the cations was: Ca(2+) > Mg(2+) > Li(+) > Na(+) ≈ K(+). This is a direct cationic Hofmeister series. Even for Ca(2+), however, the apparent equilibrium dissociation constant of the cation with the amide carbonyl oxygen was no tighter than ∼8.5 M. For Na(+) and K(+), no evidence was found for any binding. As such, the interactions of metal cations with amides are far weaker than the analogous binding of weakly hydrated anions.

  3. Electrohemical Properties of Carbon Nanotube Paste Electrodes Modified with Redox Cationic Dyes - doi: 10.4025/actascitechnol.v34i3.15250

    Directory of Open Access Journals (Sweden)

    Juliana Maria Ramos Antônio

    2012-05-01

    Full Text Available The present work describes the electrochemical behavior of cationic dyes (methylene blue and toluidine blue as electron mediators adsorbed in the multiwall carbon nanotubes paste in 0.5 KCl at pH 7.0 by using cyclic voltammetry. Based on midpoint potential [Em = (Eap + Ecp/2] and separation of cathodic and anodic peaks (ΔE, it was not observed interaction of different eletrolytes (LiCl, KCl, BaCl2, CaCl2, NaCl, NaNO3, Na2SO4 and NaClO4, with the cationic dyes by an ion exchange reaction and, as a consequence, absence of leaching of cationic dyes to the solution phase.  The kinetics of electron transfer on the surface electrode was not sufficiently fast showing a fairly resistence of carbon nanotube paste modified with the cationic dyes.  The midpoint potential and ΔE also were insentive to the pH range (4-8, confirming the protective effect of carbon nanotubes matrix, owing to strong interaction of between the latter and the nitrogen of nitrogen of cationic dyes with carbon nanotube matrix, minimizing the proton interaction under cationic dye. This result is very important for sensor/biosensor preparation, because the eletrooxidation behavior of the analyte will be only affected by its formal potencial shifting.  Carbon nanotubes proved to be an efficient solid matrix for the adsorption of mediator electron in comparison to the electrochemical behavior of free cationic dyes in solution phase.

  4. Strong and specific effects of cations on lysozyme chloride solubility.

    Science.gov (United States)

    Bénas, Philippe; Legrand, Laurent; Riès-Kautt, Madeleine

    2002-10-01

    The influence of salt nature and concentration on tetragonal lysozyme chloride crystal solubility is presented for a set of mono-, di- and trivalent cations (Cs(+), Rb(+), Mn(2+), Co(2+) and Yb(3+)). The results show that cations have as strong an effect on protein solubility as anions and that they present their own particular effects as co-ions. Indeed, after decreasing at low ionic strength, lysozyme solubility increases with high concentration of polyvalent cations, probably due to co-ion binding and therefore the concomitant increase of the net charge of the protein-salt complex. These new results are discussed in order to progress in the understanding of the crystallisation process at the atomic level. PMID:12351866

  5. Liquid-solid extraction of cationic metals by cationic amphiphiles

    International Nuclear Information System (INIS)

    In the field of selective separation for recycling of spent nuclear fuel, liquid-liquid extraction processes are widely used (PUREX, DIAMEX..) in industrial scale. In order to guarantee a sustainable nuclear energy for the forthcoming generations, alternative reprocessing techniques are under development. One of them bases on the studies from Heckmann et al in the 80's and consists in selectively precipitating actinides from aqueous waste solutions by cationic surfactants (liquid-solid extraction). This technique has some interesting advantages over liquid-liquid extraction techniques, because several steps are omitted like stripping or solvent washing. Moreover, the amount of waste is decreased considerably, since no contaminated organic solvent is produced. In this thesis, we have carried out a physico-chemical study to understand the specific interactions between the metallic cations with the cationic surfactant. First, we have analysed the specific effect of the different counter-ions (Cl-, NO3-, C2O42-) and then the effect of alkaline cations on the structural properties of the surfactant aggregation in varying thermodynamical conditions. Finally, different multivalent cations (Cu2+, Zn2+, UO22+, Fe3+, Nd3+, Eu3+, Th4+) were considered; we have concluded that depending on the anionic complex of these metals formed in acidic media, we can observe either an adsorption at the micellar interface or not. This adsorption has a large influence of the surfactant aggregation properties and determines the limits of the application in term of ionic strength, temperature and surfactant concentration. (author)

  6. Cationic speciation in nonaqueous media

    International Nuclear Information System (INIS)

    Electronic spectra of solutions of d transition elements in the superacids HF, H2SO4, HSO3F, and CF3SO3H and in chloroaluminate melts indicate that in acidic monaqueous media the elements are present as solvated cations, whereas in basic media the speciation is anionic, the same situation as in aqueous solutions. Further, in very highly acidic media, cations in very low oxidation states are stable (e.g., Ti2+), but these disproportionate on addition of base to the system. In this paper spectra, where available, of U, Np, and Pu in oxidation states III and IV in aqueous media, in protonic superacids, and in chloroaluminates are presented to postulate cationic speciation of these early actinides in highly acidic media

  7. Zebrafish ("Danio rerio") endomembrane antiporter similar to a yeast cation/H(+) transporter is required for neural crest development

    Science.gov (United States)

    CAtion/H (+) eXchangers (CAXs) are integral membrane proteins that transport Ca (2+) or other cations by exchange with protons. While several yeast and plant CAX proteins have been characterized, no functional analysis of a vertebrate CAX homologue has yet been reported. In this study, we further ch...

  8. Research progress in cation-π interactions

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Cation-π interaction is a potent intermolecular interaction between a cation and an aromatic system,which has been viewed as a new kind of binding force,as being compared with the classical interactions(e.g. hydrogen bonding,electrostatic and hydrophobic interactions). Cation-π interactions have been observed in a wide range of biological contexts. In this paper,we present an overview of the typical cation-π interactions in biological systems,the experimental and theoretical investigations on cation-π interactions,as well as the research results on cation-π interactions in our group.

  9. Research progress in cation-π interactions

    Institute of Scientific and Technical Information of China (English)

    CHENG JiaGao; LUO XiaoMin; YAN XiuHua; LI Zhong; TANG Yun; JIANG HuaLiang; ZHU WeiLiang

    2008-01-01

    Cation-π interaction is a potent intermolecular interaction between a cation and an aromatic system, which has been viewed as a new kind of binding force, as being compared with the classical interac-tions (e.g. hydrogen bonding, electrostatic and hydrophobic interactions). Cation-π interactions have been observed in a wide range of biological contexts. In this paper, we present an overview of the typi-cal cation-π interactions in biological systems, the experimental and theoretical investigations on cation-π interactions, as well as the research results on cation-π interactions in our group.

  10. Tripodal Receptors for Cation and Anion Sensors

    NARCIS (Netherlands)

    Kuswandi, Bambang; Nuriman,; Verboom, Willem; Reinhoudt, David N.

    2006-01-01

    This review discusses different types of artificial tripodal receptors for the selectiverecognition and sensing of cations and anions. Examples on the relationship between structure andselectivity towards cations and anions are described. Furthermore, their applications as potentiometricion sensing

  11. Features definition exchange cations in sedimentary rocks.

    OpenAIRE

    Bilec'ka V.A.

    2008-01-01

    The research method of determination of exchange cations in calcareous sedimentary rocks of different extractants, the influence of the ratio between the solid and liquid phases on extrusion exchange cations.

  12. Features definition exchange cations in sedimentary rocks.

    Directory of Open Access Journals (Sweden)

    Bilec'ka V.A.

    2008-05-01

    Full Text Available The research method of determination of exchange cations in calcareous sedimentary rocks of different extractants, the influence of the ratio between the solid and liquid phases on extrusion exchange cations.

  13. Cationic electrodepositable coating composition comprising lignin

    Science.gov (United States)

    Fenn, David; Bowman, Mark P; Zawacky, Steven R; Van Buskirk, Ellor J; Kamarchik, Peter

    2013-07-30

    A cationic electrodepositable coating composition is disclosed. The present invention in directed to a cationic electrodepositable coating composition comprising a lignin-containing cationic salt resin, that comprises (A) the reaction product of: lignin, an amine, and a carbonyl compound; (B) the reaction product of lignin, epichlorohydrin, and an amine; or (C) combinations thereof.

  14. Molecular cloning, characterization and expression analysis of tumor suppressor protein p53 from orange-spotted grouper, Epinephelus coioides in response to temperature stress.

    Science.gov (United States)

    Qi, Zeng-Hua; Liu, Yu-Feng; Luo, Sheng-Wei; Chen, Chu-Xian; Liu, Yuan; Wang, Wei-Na

    2013-11-01

    The tumor suppressor protein p53 is a critical component of cell cycle checkpoint responses. It upregulates the expression of cyclin-dependent kinase inhibitors in response to DNA damage and other cellular perturbations, and promotes apoptosis when DNA repair pathways are overwhelmed. In the present study, the cDNA of p53 from the orange-spotted grouper (Epinephelus coioides) (Ec-p53) was cloned by the combination of homology cloning and rapid amplification of cDNA ends (RACE) approaches. The full-length cDNA of Ec-p53 was of 1921 bp, including an open reading frame (ORF) of 1143 bp encoding a polypeptide of 380 amino acids with predicted molecular weight of 42.3 kDa and theoretical isoelectric point of 7.0. Quantitative real-time PCR (qRT-PCR) assays revealed that Ec-p53 was ubiquitously expressed in all the examined tissues but with high levels in intestine and liver of the orange-spotted grouper. In addition, we measured the DNA damage and apoptosis in the blood cells and the percentage of dead and damaged blood cells. Our results suggest that oxidative stress and DNA damage occurred in grouper in conditions where the temperature was 15 ± 0.5 °C. Furthermore, qRT-PCR and western blot confirmed that low temperature stress induced upregulation of Ec-p53 in the mRNA and protein levels. These results suggest that low temperature-induced oxidative stress may cause DNA damage or apoptosis, and cooperatively stimulate the expression of Ec-p53, which plays a critical role in immune defense and antioxidant responses.

  15. Organometallic cation-exchanged phyllosilicates

    OpenAIRE

    Fleming, Shay

    1991-01-01

    Organotin (IV) complexes formed between 0 01 M dimethyltin dichloride solutions prepared at pH 2 6 and 4 0, and trimethyltin chloride prepared at pH 3 4, with Na- 119 montmori 1lonite clay have been characterised using Sn Mflssbauer spectroscopy, X-ray diffraction, thermogravimetric analysis and water sorption isotherms Following cation exchange, Mttssbauer spectroscopy identified two tin species in the dimethyltin (IV)-exchanged clay prepared at pH 2 6 A cis specie...

  16. Use of laser induced photoacoustic spectroscopy (LIPAS) to determine equilibrium constants of cation-cation complexes

    International Nuclear Information System (INIS)

    Laser Induced PhotoAcoustic Spectroscopy (LIPAS) is a relatively new, photothermal technique to examine solutions. Studies in the past have shown it to be more sensitive than conventional absorption spectroscopy, while, yielding the same information thus allowing lower concentrations to be used. This study is using LIPAS to examine solutions to determine the equilibrium constants of cation-cation complexes. It has been found that actinyl(V) cations form cation-cation complexes with a variety of cations, including actinyl(VI) cations. The radioactive nature of the actinide elements requires special handling techniques and also require limits be placed on the amount of material that can be used. The sensitivity of some oxidation states of the actinides to oxygen also presents a problem. Preliminary results will be presented for actinyl(V)-actinyl(VI) cation-cation complexes that were studied using a remote LIPAS system incorporating fiber optics for transmission of laser signals

  17. The Free Tricoordinated Silyl Cation Problem

    Directory of Open Access Journals (Sweden)

    Čičak, H.

    2010-03-01

    Full Text Available As the importance and abundance of silicon in our environment is large, it has been thought that silicon might take the place of carbon in forming a host of similar compounds and silicon-based life. However, until today there is no experimental evidence for such a hypothesis and carbon is still unique among the elements in the vast number and variety of compounds it can form. Also, the corresponding derivatives of the two elements show considerable differences in their chemical properties.The essential debate concerning organosilicon chemistry relates to the existence of the free planar tricoordinated silyl cations in condensed phase (R3Si+, in analogy to carbocations (R3C+ which have been known and characterized as free species. Although silyl cations are thermodynamically more stable than their carbon analogs, they are very reactive due to their high inherent electrophilicity and the ability of hypervalent coordination. On the other hand, stabilization by inductive and hyperconjugative effects and larger steric effects of carbocations make them less sensitive to solvation or other environmental effects than silyl cations. Hence, observation of free silyl cations in the condensed phase proved extremely difficult and the actual problem is the question of the degree of the (remaining silyl cation character.The first free silyl cation, trimesitylsilyl cation, and in analogy with it tridurylsilyl cation, were synthesized by Lambert et al. Free silyl cations based on analogy to aromatic ions (homocyclopropenylium and tropylium have also been prepared. However, in these silyl cations the cationic character is reduced by internal π -conjugation. Čičak et al. prepared some silyl-cationic intermediates (Me3Si--CH≡CR+in solid state. With the help of quantum-mechanical calculations it was concluded that these adducts have much more silyl cation than carbocation character.

  18. Gas-phase folding and unfolding of cytochrome c cations.

    OpenAIRE

    Wood, T D; Chorush, R A; Wampler, F M; Little, D P; O'Connor, P B; McLafferty, F. W.

    1995-01-01

    Water is thought to play a dominant role in protein folding, yet gaseous multiply protonated proteins from which the water has been completely removed show hydrogen/deuterium (H/D) exchange behavior similar to that used to identify conformations in solution. Indicative of the gas-phase accessibility to D2O, multiply-charged (6+ to 17+) cytochrome c cations exchange at six (or more) distinct levels of 64 to 173 out of 198 exchangeable H atoms, with the 132 H level found at charge values 8+ to ...

  19. Preparation of oligodeoxynucleotide encapsulated cationic liposomes and release study with models of cellular membranes

    OpenAIRE

    Tamaddon AM.; Hosseini-Shirazi F.; Moghimi HR

    2007-01-01

    Cationic liposomes are used for cellular delivery of antisense oligodeoxynucleotide (AsODN), where release of encapsulated AsODN is mainly controlled by endocytosis and fusion mechanisms. In this investigation, it was tried to model such a release process that is difficult to evaluate in cell culture. For this purpose, an AsODN model (against protein kinase C-α) was encapsulated in a DODAP-containing cationic liposome and evaluated for size, zeta-potential, encapsulation and ODN stab...

  20. Circular dichroism and fluorescence spectroscopy of cysteinyl-tRNA synthetase from Halobacterium salinarum ssp. NRC-1 demonstrates that group I cations are particularly effective in providing structure and stability to this halophilic protein.

    Directory of Open Access Journals (Sweden)

    Christopher J Reed

    Full Text Available Proteins from extremophiles have the ability to fold and remain stable in their extreme environment. Here, we investigate the presence of this effect in the cysteinyl-tRNA synthetase from Halobacterium salinarum ssp. NRC-1 (NRC-1, which was used as a model halophilic protein. The effects of salt on the structure and stability of NRC-1 and of E. coli CysRS were investigated through far-UV circular dichroism (CD spectroscopy, fluorescence spectroscopy, and thermal denaturation melts. The CD of NRC-1 CysRS was examined in different group I and group II chloride salts to examine the effects of the metal ions. Potassium was observed to have the strongest effect on NRC-1 CysRS structure, with the other group I salts having reduced strength. The group II salts had little effect on the protein. This suggests that the halophilic adaptations in this protein are mediated by potassium. CD and fluorescence spectra showed structural changes taking place in NRC-1 CysRS over the concentration range of 0-3 M KCl, while the structure of E. coli CysRS was relatively unaffected. Salt was also shown to increase the thermal stability of NRC-1 CysRS since the melt temperature of the CysRS from NRC-1 was increased in the presence of high salt, whereas the E. coli enzyme showed a decrease. By characterizing these interactions, this study not only explains the stability of halophilic proteins in extremes of salt, but also helps us to understand why and how group I salts stabilize proteins in general.

  1. Afrikaans Syllabification Patterns

    Directory of Open Access Journals (Sweden)

    Tilla Fick

    2010-01-01

    Full Text Available In contrast to English, automatic hyphenation by computer of Afrikaans words is a problem that still needs to be addressed, since errors are still often encountered in printed text. An initial step in this task is the ability to automatically syllabify words. Since new words are created continuously by joining words, it is necessary to develop an “intelligent” technique for syllabification. As a first phase of the research, we consider only the orthographic information of words, and disregard both syntactic and morphological information. This approach allows us to use machine-learning techniques such as artificial neural networks and decision trees that are known for their pattern recognition abilities. Both these techniques are trained with isolated patterns consisting of input patterns and corresponding outputs (or targets that indicate whether the input pattern should be split at a certain position, or not. In the process of compiling a list of syllabified words from which to generate training data for the  syllabification problem, irregular patterns were identified. The same letter patterns are split differently in different words and complete words that are spelled identically are split differently due to meaning. We also identified irregularities in and between  the different dictionaries that we used. We examined the influence range of letters that are involved in irregularities. For example, for their in agter-ente and vaste-rente we have to consider three letters to the left of r to be certain where the hyphen should be inserted. The influence range of the k in verstek-waarde and kleinste-kwadrate is four to the left and three to the right. In an analysis of letter patterns in Afrikaans words we found that the letter e has the highest frequency overall (16,2% of all letters in the word list. The frequency of words starting with s is the highest, while the frequency of words ending with e is the highest. It is important to

  2. Two cationic peroxidases from cell walls of Araucaria araucana seeds.

    Science.gov (United States)

    Riquelme, A; Cardemil, L

    1995-05-01

    We have previously reported the purification and partial characterization of two cationic peroxidases from the cell walls of seeds and seedlings of the South American conifer, Araucaria araucana. In this work, we have studied the amino acid composition and NH2-terminal sequences of both enzymes. We also compare the data obtained from these analyses with those reported for other plant peroxidases. The two peroxidases are similar in their amino acid compositions. Both are particularly rich in glycine, which comprises more than 30% of the amino acid residues. The content of serine is also high, ca 17%. The two enzymes are different in their content of arginine, alanine, valine, phenylalanine and threonine. Both peroxidases have identical NH2-terminal sequences, indicating that the two proteins are genetically related and probably are isoforms of the same kind of peroxidase. The amino acid composition and NH2-terminal sequence analyses showed marked differences from the cationic peroxidases from turnip and horseradish. PMID:7786490

  3. A new classification paradigm of extracellular polymeric substances (EPS) in activated sludge: separation and characterization of exopolymers between floc level and microcolony level.

    Science.gov (United States)

    Wang, Bin-Bin; Chang, Qing; Peng, Dang-Cong; Hou, Yin-Ping; Li, Hui-Juan; Pei, Li-Ying

    2014-11-01

    Extracellular polymeric substances (EPS) play a crucial role in the formation of activated sludge flocs. However, until now, the EPS are rather classified by the method used for extraction than by a theoretical consideration of their function and composition. In this paper, a new classification paradigm of EPS was proposed, which offered a novel approach to identify the role of EPS in the formation of activated sludge flocs. The current study gave an exploration to distinguish the EPS in the floc level (extra-microcolony polymers, EMPS) and in the microcolony level (extra-cellular polymers, ECPS). It was found that cation exchange resin treatment is efficient to disintegrate the flocs for EMPS extraction, however, inefficient to disaggregate the microcolonies for ECPS harvesting. A two-steps extraction strategy (cation exchange resin treatment followed by ultrasonication-high speed centrifugation treatment) was suggested to separate these two types of EPS in activated sludge flocs and the physicochemical characteristics of EMPS and ECPS were compared. The protein/polysaccharide ratio of ECPS was higher than that of EMPS and the molecular weight of proteins in EMPS and ECPS were found to be different. The ECPS contained higher molecular weight proteins and more hydrophobic substances than the EMPS contained. The result of excitation-emission matrix fluorescence spectroscopy analysis also showed that the EMPS and the ECPS have different fluorescent expressions and the components of EMPS were more diverse than that of ECPS. All results reported herein demonstrated that two different types of exopolymers exist in the activated sludge flocs and the inter-particle forces for aggregation of activated sludge flocs are not identical between the floc level and the microcolony level. It suggested that cation bridging interactions are more crucial in floc level flocculation, while the entanglement and hydrophobic interactions are more important in microcolony level cohesion.

  4. Localization versus delocalization in diamine radical cations

    DEFF Research Database (Denmark)

    Brouwer, A.M.; Wiering, P.G.; Zwier, J.M.;

    1997-01-01

    The optical absorption spectrum of the radical cation of 1,4-diphenylpiperazine 2a shows a strong transition in the near-IR, and only a weak band at 445 nm, in the region where aniline radical cations normally absorb strongly. This indicates that the charge and spin are delocalized over the two...

  5. Tripodal Receptors for Cation and Anion Sensors

    Directory of Open Access Journals (Sweden)

    David N. Reinhoudt

    2006-08-01

    Full Text Available This review discusses different types of artificial tripodal receptors for the selectiverecognition and sensing of cations and anions. Examples on the relationship between structure andselectivity towards cations and anions are described. Furthermore, their applications as potentiometricion sensing are emphasised, along with their potential applications in optical sensors or optodes.

  6. Upper respiratory tract disease and bronchial asthma

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    2005201 Role of dynamic changes of blood eosinophilia, eosinophil cationic protein and IgE in children with asthma. LOU Jin-tu (楼金吐)?,et al. Children’s Hosp.Med Coll .Zhejiang Univ.Hangzhou 310003. Chin J Emerg Med,2005;14(1) :68-70. Objective: To explore the roles and clinical significance of eosinophilia (EOS) ,eosinophil cationic protein (ECP),IgE and dust mite-skin test in children with asthma. Methods: Peripheral blood amount of EOS,serum concentration of ECP and IgE were de-

  7. Cationic ruthenium alkylidene catalysts bearing phosphine ligands

    OpenAIRE

    Endo, Koji; Grubbs, Robert H.

    2016-01-01

    The discovery of highly active catalysts and the success of ionic liquid immobilized systems have accelerated attention to a new class of cationic metathesis catalysts. We herein report the facile syntheses of cationic ruthenium catalysts bear-ing bulky phosphine ligands. Simple ligand exchange using silver(I) salts of non-coordinating or weakly coordinating anions pro-vided either PPh3 or chelating Ph2P(CH2)nPPh2 (n = 2 or 3) ligated cationic catalysts. The structures of these newly reported...

  8. Cation locations and dislocations in zeolites

    Science.gov (United States)

    Smith, Luis James

    The focus of this dissertation is the extra-framework cation sites in a particular structural family of zeolites, chabazite. Cation sites play a particularly important role in the application of these sieves for ion exchange, gas separation, catalysis, and, when the cation is a proton, acid catalysis. Structural characterization is commonly performed through the use of powder diffraction and Rietveld analysis of powder diffraction data. Use of high-resolution nuclear magnetic resonance, in the study of the local order of the various constituent nuclei of zeolites, complements well the long-range order information produced by diffraction. Recent developments in solid state NMR techniques allow for increased study of disorder in zeolites particularly when such phenomena test the detection limits of diffraction. These two powerful characterization techniques, powder diffraction and NMR, offer many insights into the complex interaction of cations with the zeolite framework. The acids site locations in SSZ-13, a high silica chabazite, and SAPO-34, a silicoaluminophosphate with the chabazite structure, were determined. The structure of SAPO-34 upon selective hydration was also determined. The insensitivity of X-rays to hydrogen was avoided through deuteration of the acid zeolites and neutron powder diffraction methods. Protons at inequivalent positions were found to have different acid strengths in both SSZ-13 and SAPO-34. Other light elements are incorporated into zeolites in the form of extra-framework cations, among these are lithium, sodium, and calcium. Not amenable by X-ray powder diffraction methods, the positions of such light cations in fully ion-exchanged versions of synthetic chabazite were determined through neutron powder diffraction methods. The study of more complex binary cation systems were conducted. Powder diffraction and solid state NMR methods (MAS, MQMAS) were used to examine cation site preferences and dislocations in these mixed-akali chabazites

  9. Cycloaliphatic epoxide resins for cationic UV - cure

    International Nuclear Information System (INIS)

    This paper introduces the cyclo - aliphatic epoxide resins used for the various applications of radiation curing and their comparison with acrylate chemistry. Radiation curable coatings and inks are pre - dominantly based on acrylate chemistry but over the last few years, cationic chemistry has emerged successfully with the unique properties inherent with cyclo - aliphatic epoxide ring structures. Wide variety of cationic resins and diluents, the formulation techniques to achieve the desired properties greatly contributes to the advancement of UV - curing technology

  10. Test procedure for cation exchange chromatography

    International Nuclear Information System (INIS)

    The purpose of this test plan is to demonstrate the synthesis of inorganic antimonate ion exchangers and compare their performance against the standard organic cation exchangers. Of particular interest is the degradation rate of both inorganic and organic cation exchangers. This degradation rate will be tracked by determining the ion exchange capacity and thermal stability as a function of time, radiation dose, and chemical reaction

  11. Silica-based cationic bilayers as immunoadjuvants

    OpenAIRE

    Carmona-Ribeiro Ana M; da Costa Maria; Faquim-Mauro Eliana; Santana Mariana RA; Lincopan Nilton

    2009-01-01

    Abstract Background Silica particles cationized by dioctadecyldimethylammonium bromide (DODAB) bilayer were previously described. This work shows the efficiency of these particulates for antigen adsorption and presentation to the immune system and proves the concept that silica-based cationic bilayers exhibit better performance than alum regarding colloid stability and cellular immune responses for vaccine design. Results Firstly, the silica/DODAB assembly was characterized at 1 mM NaCl, pH 6...

  12. Steroids reduce local inflammatory mediator secretion and mucosal permeability in collagenous colitis patients

    Institute of Scientific and Technical Information of China (English)

    Yesuf Taha; Yngve Raab; Marie Carlson; Anders Larsson; Mikael L(o)rdal; Lars L(oo)f; Magnus Th(o)rn

    2006-01-01

    AIM: To study the effect of oral steroids upon clinical response and rectal mucosa secretion of eosinophil cationic protein (ECP), myeloperoxidase (MPO), basic fibroblast growth factor (bFGF), vascular endothelial growth factor (VEGF) and albumin in patients with collagenous colitis (CC).METHODS: A segmental perfusion technique was used to collect perfusates from rectum of CC patients once before and twice (one and four weeks) after the start of steroid treatment. Clinical data was monitored and ECP, MPO, bFGF, VEGF and albumin concentrations were analyzed by immunochemical methods in perfusates and in serum.RESULTS: Steroids reduced the number of bowel movements by more than five times within one week and all patients reported improved subjective wellbeing at wk 1 and 4. At the same time, the median concentrations of ECP, bFGF, VEGF and albumin in rectal perfusates decreased significantly. MPO values were above the detection limit in only 3 patients before treatment and in none during treatment. VEGF, bFGF,ECP and albumin concentrations correlated with each other with the exception of ECP and albumin. A decrease of serum ECP and VEGF concentrations was also seen even if the overtime reduction was not significant.CONCLUSION: Oral steroid treatment in CC patients induced a simultaneous reduction of bowel movements and rectal release of ECP, bFGF, VEGF and albumin,suggesting that these polypeptides and increased mucosal permeability are important components of the pathophysiology in collagenous colitis.

  13. Extracellular DNA chelates cations and induces antibiotic resistance in Pseudomonas aeruginosa biofilms.

    Directory of Open Access Journals (Sweden)

    Heidi Mulcahy

    2008-11-01

    Full Text Available Biofilms are surface-adhered bacterial communities encased in an extracellular matrix composed of DNA, bacterial polysaccharides and proteins, which are up to 1000-fold more antibiotic resistant than planktonic cultures. To date, extracellular DNA has been shown to function as a structural support to maintain Pseudomonas aeruginosa biofilm architecture. Here we show that DNA is a multifaceted component of P. aeruginosa biofilms. At physiologically relevant concentrations, extracellular DNA has antimicrobial activity, causing cell lysis by chelating cations that stabilize lipopolysaccharide (LPS and the outer membrane (OM. DNA-mediated killing occurred within minutes, as a result of perturbation of both the outer and inner membrane (IM and the release of cytoplasmic contents, including genomic DNA. Sub-inhibitory concentrations of DNA created a cation-limited environment that resulted in induction of the PhoPQ- and PmrAB-regulated cationic antimicrobial peptide resistance operon PA3552-PA3559 in P. aeruginosa. Furthermore, DNA-induced expression of this operon resulted in up to 2560-fold increased resistance to cationic antimicrobial peptides and 640-fold increased resistance to aminoglycosides, but had no effect on beta-lactam and fluoroquinolone resistance. Thus, the presence of extracellular DNA in the biofilm matrix contributes to cation gradients, genomic DNA release and inducible antibiotic resistance. DNA-rich environments, including biofilms and other infection sites like the CF lung, are likely the in vivo environments where extracellular pathogens such as P. aeruginosa encounter cation limitation.

  14. The mechanism of kaolin clay flocculation by a cation-independent bioflocculant produced by Chryseobacterium daeguense W6

    Directory of Open Access Journals (Sweden)

    Weijie Liu

    2015-03-01

    Full Text Available In recent years, several novel cation-independent bioflocculants have been reported, which can avoid the secondary contamination caused by addition of cations. However, compared with cation-dependent bioflocculants, the flocculating mechanism of cation-independent bioflocculants is largely unknown. In this study, a cation-independent bioflocculant MBF-W6 produced by Chryseobacterium daeguense W6 was used as a model to investigate the flocculating mechanism. The results showed that the major flocculating component of MBF-W6 is a complex of proteins and polysaccharides. The zeta potential results indicated that kaolin clay particles were not precipitated due to charge neutralization and the bridging mediated by cations did not play a major role in the flocculating process. These results are consistent with the fact that MBF-W6 is a cation-independent bioflocculant. Further scanning electron microscopic observation showed that MBF-W6 induced flocs formed tight packed structure, suggesting that the kaolin clay particles maybe directly attached and bridged by bioflocculant MBF-W6. In addition, we also found out that Fe3+ ions inhibit the flocculating activity of MBF-W6 by affecting –COO− and –NH groups. Therefore this study can improve our understanding on flocculating mechanism of cation-independent bioflocculants.

  15. Innate cation sensitivity in a semiconducting polymer.

    Science.gov (United States)

    Althagafi, Talal M; Algarni, Saud A; Grell, Martin

    2016-09-01

    Water-gated organic thin film transistors (OTFTs) using the hole transporting semiconducting polymer, poly(2,5-bis(3-hexadecylthiophen-2-yl)thieno[3,2-b]thiophene) (PBTTT), show an innate response of their threshold voltage to the addition of divalent metal cations to the gating water, without deliberately introducing an ion-sensitive component. A similar threshold response is shown for several divalent cations, but is absent for monovalent cations. Response is absent for transistors using the inorganic semiconductor ZnO, or the similar organic semiconductor poly(3-hexylthiophene) (rrP3HT), instead of PBTTT. We assign innate cation sensitivity to residues of the organometallic Pd(0) complex used as catalyst in PBTTT synthesis which bears strong resemblance to typical metal chelating agents. Organometallic Pd(0) residues are absent from ZnO, and also from rrP3HT which is polymerised with a different type of catalyst. However, when Pd(0) complex is deliberately added to rrP3HT casting solutions, resulting OTFTs also display threshold response to a divalent cation. PMID:27343580

  16. Forging Colloidal Nanostructures via Cation Exchange Reactions

    Science.gov (United States)

    2016-01-01

    Among the various postsynthesis treatments of colloidal nanocrystals that have been developed to date, transformations by cation exchange have recently emerged as an extremely versatile tool that has given access to a wide variety of materials and nanostructures. One notable example in this direction is represented by partial cation exchange, by which preformed nanocrystals can be either transformed to alloy nanocrystals or to various types of nanoheterostructures possessing core/shell, segmented, or striped architectures. In this review, we provide an up to date overview of the complex colloidal nanostructures that could be prepared so far by cation exchange. At the same time, the review gives an account of the fundamental thermodynamic and kinetic parameters governing these types of reactions, as they are currently understood, and outlines the main open issues and possible future developments in the field. PMID:26891471

  17. Cationically polymerizable monomers derived from renewable sources

    Energy Technology Data Exchange (ETDEWEB)

    Crivello, J.V.

    1992-10-01

    The objectives of this project are to design and synthesize novel monomers which orginate from renewable biological sources and to carry out their rapid, efficient, pollution-free and energy efficient cationic polymerization to useful products under the influence of ultraviolet light or heat. A summary of the results of the past year's research on cationically polymerizable monomers derived from renewable sources is presented. Three major areas of investigation corresponding to the different classes of naturally occurring starting materials were investigated; epoxidized terpenes and natural rubber and vinyl ethers from alcohols and carbohydrates.

  18. Mixed cation effect in sodium aluminosilicate glasses

    DEFF Research Database (Denmark)

    Kjeldsen, Jonas; Smedskjær, Morten Mattrup; Mauro, John C.;

    , network structure, and the resistances associated with the deformation processes in mixed cation glasses by partially substituting magnesium for calcium and calcium for lithium in sodium aluminosilicate glasses. We use Raman and 27Al NMR spectroscopies to obtain insights into the structural...... and topological features of these glasses and we use AFM to quantify the resistances associated with each deformation process under Vickers indentation. We demonstrate that the mixed cation effect manifests itself as a maximum in the amount of bonded tetrahedral units and as a minimum in liquid fragility index...

  19. Cation Effect on Copper Chemical Mechanical Polishing

    Institute of Scientific and Technical Information of China (English)

    WANG Liang-Yong; LIU Bo; SONG Zhi-Tang; FENG Song-Lin

    2009-01-01

    We examine the effect of cations in solutions containing benzotriazole (BTA) and H2O2 on copper chemical mechanical polishing (CMP). On the base of atomic force microscopy (AFM) and material removal rate (MRR) results, it is found that ammonia shows the highest MRR as well as good surface after CMP, while KOH demon-strates the worst performance. These results reveal a mechanism that sma//molecules with lone-pairs rather than molecules with steric effect and common inorganic cations are better for copper CMP process, which is indirectly confirmed by open circuit potential (OCP).

  20. Cation Selectivity in Biological Cation Channels Using Experimental Structural Information and Statistical Mechanical Simulation.

    Directory of Open Access Journals (Sweden)

    Justin John Finnerty

    Full Text Available Cation selective channels constitute the gate for ion currents through the cell membrane. Here we present an improved statistical mechanical model based on atomistic structural information, cation hydration state and without tuned parameters that reproduces the selectivity of biological Na+ and Ca2+ ion channels. The importance of the inclusion of step-wise cation hydration in these results confirms the essential role partial dehydration plays in the bacterial Na+ channels. The model, proven reliable against experimental data, could be straightforwardly used for designing Na+ and Ca2+ selective nanopores.

  1. Water adsorption on free cobalt cluster cations

    NARCIS (Netherlands)

    D.M. Kiawi; J.M. Bakker; J. Oomens; W.J. Buma; Z. Jamshidi; L. Visscher; L.B.F.M. Waters

    2015-01-01

    Cationic cobalt clusters complexed with water Con+-​H2O (n = 6-​20) are produced through laser ablation and investigated via IR multiple photon dissocn. (IR-​MPD) spectroscopy in the 200-​1700 cm-​1 spectral range. All spectra exhibit a resonance close to the 1595 cm-​1 frequency of the free water b

  2. Simultaneous anion and cation mobility in polypyrrole

    DEFF Research Database (Denmark)

    Skaarup, Steen; Bay, Lasse; Vidanapathirana, K.;

    2003-01-01

    Polypyrrole (PPy) polymer films permanently doped with large, immobile anion dodecyl benzene sulfonate (DBS) have been characterized by cyclic voltammetry in order to clarify the roles of cations and anions in the aqueous electrolyte as mobile ions in the film. Aqueous solutions of 0.05-0.1 M alk...

  3. Resonance raman studies of phenylcyclopropane radical cations

    NARCIS (Netherlands)

    Godbout, J.T.; Zuilhof, H.; Heim, G.; Gould, I.R.; Goodman, J.L.; Dinnocenzo, J.P.; Myers Kelley, A.

    2000-01-01

    Resonance Raman spectra of the radical cations of phenylcyclopropane and trans-1-phenyl-2-methylcyclopropane are reported. A near-UV pump pulse excites a photosensitizer which oxidizes the species of interest, and a visible probe pulse delayed by 35 ns obtains the spectrum of the radical ion. The tr

  4. Anionic/cationic complexes in hair care.

    Science.gov (United States)

    O'Lenick, Tony

    2011-01-01

    The formulation of cosmetic products is always more complicated than studying the individual components in aqueous solution. This is because there are numerous interactions between the components, which make the formulation truly more than the sum of the parts. This article will look at interactions between anionic and cationic surfactants and offer insights into how to use these interactions advantageously in making formulations.

  5. Cationic lipids and cationic ligands induce DNA helix denaturation: detection of single stranded regions by KMnO4 probing.

    Science.gov (United States)

    Prasad, T K; Gopal, Vijaya; Rao, N Madhusudhana

    2003-09-25

    Cationic lipids and cationic polymers are widely used in gene delivery. Using 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) as a cationic lipid, we have investigated the stability of the DNA in DOTAP:DNA complexes by probing with potassium permanganate (KMnO4). Interestingly, thymidines followed by a purine showed higher susceptibility to cationic ligand-mediated melting. Similar studies performed with other water-soluble cationic ligands such as polylysine, protamine sulfate and polyethyleneimine also demonstrated melting of the DNA but with variations. Small cations such as spermine and spermidine and a cationic detergent, cetyl trimethylammonium bromide, also rendered the DNA susceptible to modification by KMnO4. The data presented here provide direct proof for melting of DNA upon interaction with cationic lipids. Structural changes subsequent to binding of cationic lipids/ligands to DNA may lead to instability and formation of DNA bubbles in double-stranded DNA.

  6. Cation charge dependence of the forces driving DNA assembly.

    Science.gov (United States)

    DeRouchey, Jason; Parsegian, V Adrian; Rau, Donald C

    2010-10-20

    Understanding the strength and specificity of interactions among biologically important macromolecules that control cellular functions requires quantitative knowledge of intermolecular forces. Controlled DNA condensation and assembly are particularly critical for biology, with separate repulsive and attractive intermolecular forces determining the extent of DNA compaction. How these forces depend on the charge of the condensing ion has not been determined, but such knowledge is fundamental for understanding the basis of DNA-DNA interactions. Here, we measure DNA force-distance curves for a homologous set of arginine peptides. All forces are well fit as the sum of two exponentials with 2.4- and 4.8-Å decay lengths. The shorter-decay-length force is always repulsive, with an amplitude that varies slightly with length or charge. The longer-decay-length force varies strongly with cation charge, changing from repulsion with Arg¹ to attraction with Arg². Force curves for a series of homologous polyamines and the heterogeneous protein protamine are quite similar, demonstrating the universality of these forces for DNA assembly. Repulsive amplitudes of the shorter-decay-length force are species-dependent but nearly independent of charge within each species. A striking observation was that the attractive force amplitudes for all samples collapse to a single curve, varying linearly with the inverse of the cation charge. PMID:20959102

  7. Structural Insights into Mitochondrial Calcium Uniporter Regulation by Divalent Cations.

    Science.gov (United States)

    Lee, Samuel K; Shanmughapriya, Santhanam; Mok, Mac C Y; Dong, Zhiwei; Tomar, Dhanendra; Carvalho, Edmund; Rajan, Sudarsan; Junop, Murray S; Madesh, Muniswamy; Stathopulos, Peter B

    2016-09-22

    Calcium (Ca(2+)) flux into the matrix is tightly controlled by the mitochondrial Ca(2+) uniporter (MCU) due to vital roles in cell death and bioenergetics. However, the precise atomic mechanisms of MCU regulation remain unclear. Here, we solved the crystal structure of the N-terminal matrix domain of human MCU, revealing a β-grasp-like fold with a cluster of negatively charged residues that interacts with divalent cations. Binding of Ca(2+) or Mg(2+) destabilizes and shifts the self-association equilibrium of the domain toward monomer. Mutational disruption of the acidic face weakens oligomerization of the isolated matrix domain and full-length human protein similar to cation binding and markedly decreases MCU activity. Moreover, mitochondrial Mg(2+) loading or blockade of mitochondrial Ca(2+) extrusion suppresses MCU Ca(2+)-uptake rates. Collectively, our data reveal that the β-grasp-like matrix region harbors an MCU-regulating acidic patch that inhibits human MCU activity in response to Mg(2+) and Ca(2+) binding.

  8. Cation-cation interactions, magnetic communication and reactivity of the pentavalent uraniumion [U(NR)2]+

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, Liam P [Los Alamos National Laboratory; Schelter, Eric J [Los Alamos National Laboratory; Boncella, James M [Los Alamos National Laboratory; Yang, Ping [Los Alamos National Laboratory; Gsula, Robyn L [NON LANL; Scott, Brian L [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Kiplinger, Jacqueline L [Los Alamos National Laboratory; Batista, Enrique R [Los Alamos National Laboratory

    2009-01-01

    The dimeric bis(imido) uranium complex [{l_brace}U(NtBu)2(I)(tBu2bpy){r_brace}2] (see picture; U green, N blue, I red) has cation-cation interactions between [U(NR)2]+ ions. This f1-f1 system also displays f orbital communication between uranium(V) centers at low temperatures, and can be oxidized to generate uranium(VI) bis(imido) complexes.

  9. Cations Stiffen Actin Filaments by Adhering a Key Structural Element to Adjacent Subunits.

    Science.gov (United States)

    Hocky, Glen M; Baker, Joseph L; Bradley, Michael J; Sinitskiy, Anton V; De La Cruz, Enrique M; Voth, Gregory A

    2016-05-26

    Ions regulate the assembly and mechanical properties of actin filaments. Recent work using structural bioinformatics and site-specific mutagenesis favors the existence of two discrete and specific divalent cation binding sites on actin filaments, positioned in the long axis between actin subunits. Cation binding at one site drives polymerization, while the other modulates filament stiffness and plays a role in filament severing by the regulatory protein, cofilin. Existing structural methods have not been able to resolve filament-associated cations, and so in this work we turn to molecular dynamics simulations to suggest a candidate binding pocket geometry for each site and to elucidate the mechanism by which occupancy of the "stiffness site" affects filament mechanical properties. Incorporating a magnesium ion in the "polymerization site" does not seem to require any large-scale change to an actin subunit's conformation. Binding of a magnesium ion in the "stiffness site" adheres the actin DNase-binding loop (D-loop) to its long-axis neighbor, which increases the filament torsional stiffness and bending persistence length. Our analysis shows that bound D-loops occupy a smaller region of accessible conformational space. Cation occupancy buries key conserved residues of the D-loop, restricting accessibility to regulatory proteins and enzymes that target these amino acids. PMID:27146246

  10. Effects of Octylphenol and Bisphenol A on the Metal Cation Transporter Channels of Mouse Placentas

    Science.gov (United States)

    Lee, Jae-Hwan; Ahn, Changhwan; Kang, Hee Young; Hong, Eui-Ju; Hyun, Sang-Hwan; Choi, Kyung-Chul; Jeung, Eui-Bae

    2016-01-01

    Octylphenol (OP) and bisphenol A (BPA) are known as endocrine-disrupting chemicals (EDCs). During pregnancy, the expression of steroid hormone receptors is controlled by maternal and fetal nutrition. To evaluate the impact of EDCs during pregnancy, ethinyl estradiol (EE, 0.2 mg/kg/day), OP (50 mg/kg/day), and BPA (50 mg/kg/day) were administered to pregnant mice. The mRNA levels of TRPV6 (transient receptor potential cation channels in subfamily V, member 6) decreased significantly by EE and OP. The PMCA1 (ATPase, Ca++ transporting, plasma membrane 1) mRNA and protein levels decreased significantly by EE, OP, and BPA. CTR1 (solute carrier family 31, member 1) and ATP7A (ATPase, Cu++ transporting, alpha polypeptide) expression decreased significantly by EE, OP, and BPA. The mRNA levels of IREG1 (iron-regulated transporter, member 1) decreased significantly by EE. Hephaestin (HEPH) mRNA levels decreased significantly by EE, OP, and BPA, and protein levels decreased significantly by BPA. As a result of immunohistochemistry analysis, all cation transporter proteins were found in labyrinth of placenta. To confirm the cytosolic level of cations, levels of cation level in fetal serum were measured. EE, OP, and BPA significantly reduced serum calcium and copper levels, and iron levels were reduced by BPA. Taken together, some EDCs, such as OP and BPA, could modulate the calcium, copper, and iron ion-transporting channels during pregnancy. The fetus relies on the mother for ionic transportation, and, therefore, pregnant women should avoid exposure to cation-channel-disrupting chemicals. PMID:27690074

  11. Effects of Octylphenol and Bisphenol A on the Metal Cation Transporter Channels of Mouse Placentas

    Directory of Open Access Journals (Sweden)

    Jae-Hwan Lee

    2016-09-01

    Full Text Available Octylphenol (OP and bisphenol A (BPA are known as endocrine-disrupting chemicals (EDCs. During pregnancy, the expression of steroid hormone receptors is controlled by maternal and fetal nutrition. To evaluate the impact of EDCs during pregnancy, ethinyl estradiol (EE, 0.2 mg/kg/day, OP (50 mg/kg/day, and BPA (50 mg/kg/day were administered to pregnant mice. The mRNA levels of TRPV6 (transient receptor potential cation channels in subfamily V, member 6 decreased significantly by EE and OP. The PMCA1 (ATPase, Ca++ transporting, plasma membrane 1 mRNA and protein levels decreased significantly by EE, OP, and BPA. CTR1 (solute carrier family 31, member 1 and ATP7A (ATPase, Cu++ transporting, alpha polypeptide expression decreased significantly by EE, OP, and BPA. The mRNA levels of IREG1 (iron-regulated transporter, member 1 decreased significantly by EE. Hephaestin (HEPH mRNA levels decreased significantly by EE, OP, and BPA, and protein levels decreased significantly by BPA. As a result of immunohistochemistry analysis, all cation transporter proteins were found in labyrinth of placenta. To confirm the cytosolic level of cations, levels of cation level in fetal serum were measured. EE, OP, and BPA significantly reduced serum calcium and copper levels, and iron levels were reduced by BPA. Taken together, some EDCs, such as OP and BPA, could modulate the calcium, copper, and iron ion-transporting channels during pregnancy. The fetus relies on the mother for ionic transportation, and, therefore, pregnant women should avoid exposure to cation-channel-disrupting chemicals.

  12. Alkaline earth cation extraction from acid solution

    Science.gov (United States)

    Dietz, Mark; Horwitz, E. Philip

    2003-01-01

    An extractant medium for extracting alkaline earth cations from an aqueous acidic sample solution is described as are a method and apparatus for using the same. The separation medium is free of diluent, free-flowing and particulate, and comprises a Crown ether that is a 4,4'(5')[C.sub.4 -C.sub.8 -alkylcyclohexano]18-Crown-6 dispersed on an inert substrate material.

  13. Cation Permeability in Soybean Aleurone Layer

    OpenAIRE

    Noda, Hiroko; Fukuda, Mitsuru

    1998-01-01

    The permeation of water and ions into bean seeds is essential for processing and cooking of beans. The permeability of cations, K, Na, Ca, and Mg ions, into soybean seed tissue, especially aleurone layer, during water uptake was investigated to characterize the ion permeation into soybeans. Aleurone layers and seed coats contained relatively high concentration of endogenous K and Ca ions, and endogenous Ca ion, respectively. The amounts of Ca ion entered seed coats and aleurone layers were gr...

  14. Preparation of Weak Cation Exchange Packings Based on Monodisperse Poly (chloromethylstyrene-co-divinylbenzene) Particles and Its Chromatographic Properties

    Institute of Scientific and Technical Information of China (English)

    卫引茂; 陈强; 耿信笃

    2001-01-01

    Monodisperse poly ( chloromethylstyrene-co-divinylbenzene )particles were firstly prepared by a two-step swelling method.Based on this media, one kind of weak cation ion exchange packings was prepared. It was demonstrated that the prepared packings have comparative advantages for biopolymer separation with high column efficiency, low interstitial volume and low column backpressure, and have good resolution to proteins. The effects of salt concentration and pH of mobile phase on protein retentions were investigated. The properties of the weak cation ion exchange packings were evaluated by the unified retention model for mixed-mode interaction mechanison in ion exchange and hydrophobic interaction chromatography.

  15. Effect of Mechanical Agitation on Cationic Liposome Transport across an Unstirred Water Layer in Caco-2 Cells.

    Science.gov (United States)

    Kono, Yusuke; Iwasaki, Ayu; Matsuoka, Kenta; Fujita, Takuya

    2016-01-01

    To develop an effective oral delivery system for plasmid DNA (pDNA) using cationic liposomes, it is necessary to clarify the characteristics of uptake and transport of cationic liposome/pDNA complexes into the intestinal epithelium. In particular, evaluation of the involvement of an unstirred water layer (UWL), which is a considerable permeability barrier, in cationic liposome transport is very important. Here, we investigated the effects of a UWL on the transfection efficiency of cationic liposome/pDNA complexes into a Caco-2 cell monolayer. When Caco-2 cells were transfected with cationic liposome/pDNA complexes in shaking cultures to reduce the thickness of the UWL, gene expression was significantly higher in Caco-2 cells compared with static cultures. We also found that this enhancement of gene expression by shaking was not attributable to activation of transcription factors such as activator protein-1 and nuclear factor-kappaB (NF-κB). In addition, the increase in gene expression by mechanical agitation was observed at all charge ratios (1.5, 2.3, 3.1, 4.5) of cationic liposome/pDNA complexes. Transport experiments using Transwells demonstrated that mechanical agitation increased the uptake of cationic liposome/pDNA complexes by Caco-2 cells, whereas transport of the complexes across a Caco-2 cell monolayer did not occurr. Moreover, the augmentation of the gene expression of cationic liposome/pDNA complexes by shaking was observed in Madin-Darby canine kidney cells. These results indicate that a UWL greatly affects the uptake and transfection efficiency of cationic liposome/pDNA complexes into an epithelial monolayer in vitro. PMID:27476939

  16. Low cation coordination in oxide melts

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, Lawrie [State University of New York, Stony Brook; Benmore, Chris J [Argonne National Laboratory (ANL); Du, Jincheng [University of North Texas; Weber, Richard [Argonne National Laboratory (ANL); Neuefeind, Joerg C [ORNL; Tumber, Sonia [Materials Development, Inc., Evanston, IL; Parise, John B [Stony Brook University (SUNY)

    2014-01-01

    The complete set of Faber-Ziman partial pair distribution functions for a rare earth oxide liquid were measured for the first time by combining aerodynamic levitation, neutron diffraction, high energy x-ray diffraction and isomorphic substitution using Y2 O3 and Ho2 O3 melts. The average Y- O coordination is measured to be 5.5(2), which is significantly less than the octahedral coordination of crystalline Y2 O3 (or Ho2 O3 ). Investigation of high temperature La2 O3 , ZrO2 , SiO2 , and Al2 O3 melts by x-ray diffraction and molecular dynamics simulations also show lower-than-crystal cation- oxygen coordination. These measurements suggest a general trend towards lower M-O coordination compared to their crystalline counterparts. It is found that this coordination number drop is larger for lower field strength, larger radius cations and is negligible for high field strength (network forming) cations. These findings have broad implications for predicting the local structure and related physical properties of metal-oxide melts and oxide glasses.

  17. Low Cation Coordination in Oxide Melts

    Science.gov (United States)

    Skinner, L. B.; Benmore, C. J.; Weber, J. K. R.; Du, J.; Neuefeind, J.; Tumber, S. K.; Parise, J. B.

    2014-04-01

    The complete set of partial pair distribution functions for a rare earth oxide liquid are measured by combining aerodynamic levitation, neutron and x-ray diffraction on Y2O3, and Ho2O3 melts at 2870 K. The average Y-O (or Ho-O) coordination of these isomorphic melts is measured to be 5.5(2), which is significantly less than the octahedral coordination of crystalline Y2O3 (or Ho2O3). Investigation of La2O3, ZrO2, and Al2O3 melts by x-ray diffraction and molecular dynamics simulations also show lower-than-crystal cation-oxygen coordination. These measurements suggest a general trend towards lower coordination compared to their crystalline counterparts. It is found that the coordination drop is larger for lower field strength, larger radius cations and is negligible for high field strength (network forming) cations, such as SiO2. These findings have broad implications for predicting the local structure and related physical properties of metal-oxide melts and oxide glasses.

  18. Limited data speaker identification

    Indian Academy of Sciences (India)

    H S Jayanna; S R Mahadeva Prasanna

    2010-10-01

    In this paper, the task of identifying the speaker using limited training and testing data is addressed. Speaker identification system is viewed as four stages namely, analysis, feature extraction, modelling and testing. The speaker identification performance depends on the techniques employed in these stages. As demonstrated by different experiments, in case of limited training and testing data condition, owing to less data, existing techniques in each stage will not provide good performance. This work demonstrates the following: multiple frame size and rate (MFSR) analysis provides improvement in the analysis stage, combination of mel frequency cepstral coefficients (MFCC), its temporal derivatives $(\\Delta,\\Delta \\Delta)$, linear prediction residual (LPR) and linear prediction residual phase (LPRP) features provides improvement in the feature extraction stage and combination of learning vector quantization (LVQ) and gaussian mixture model – universal background model (GMM–UBM) provides improvement in the modelling stage. The performance is further improved by integrating the proposed techniques at the respective stages and combining the evidences from them at the testing stage. To achieve this, we propose strength voting (SV), weighted borda count (WBC) and supporting systems (SS) as combining methods at the abstract, rank and measurement levels, respectively. Finally, the proposed hierarchical combination (HC) method integrating these three methods provides significant improvement in the performance. Based on these explorations, this work proposes a scheme for speaker identification under limited training and testing data.

  19. Alkali cation specific adsorption onto fcc(111) transition metal electrodes.

    Science.gov (United States)

    Mills, J N; McCrum, I T; Janik, M J

    2014-07-21

    The presence of alkali cations in electrolyte solutions is known to impact the rate of electrocatalytic reactions, though the mechanism of such impact is not conclusively determined. We use density functional theory (DFT) to examine the specific adsorption of alkali cations to fcc(111) electrode surfaces, as specific adsorption may block catalyst sites or otherwise impact surface catalytic chemistry. Solvation of the cation-metal surface structure was investigated using explicit water models. Computed equilibrium potentials for alkali cation adsorption suggest that alkali and alkaline earth cations will specifically adsorb onto Pt(111) and Pd(111) surfaces in the potential range of hydrogen oxidation and hydrogen evolution catalysis in alkaline solutions.

  20. The Flocculating Cationic Polypetide from Moringa oleifera Seeds Damages Bacterial Cell Membranes by Causing Membrane Fusion.

    Science.gov (United States)

    Shebek, Kevin; Schantz, Allen B; Sines, Ian; Lauser, Kathleen; Velegol, Stephanie; Kumar, Manish

    2015-04-21

    A cationic protein isolated from the seeds of the Moringa oleifera tree has been extensively studied for use in water treatment in developing countries and has been proposed for use in antimicrobial and therapeutic applications. However, the molecular basis for the antimicrobial action of this peptide, Moringa oleifera cationic protein (MOCP), has not been previously elucidated. We demonstrate here that a dominant mechanism of MOCP antimicrobial activity is membrane fusion. We used a combination of cryogenic electron microscopy (cryo-EM) and fluorescence assays to observe and study the kinetics of fusion of membranes in liposomes representing model microbial cells. We also conducted cryo-EM experiments on E. coli cells where MOCP was seen to fuse the inner and outer membranes. Coarse-grained molecular dynamics simulations of membrane vesicles with MOCP molecules were used to elucidate steps in peptide adsorption, stalk formation, and fusion between membranes.

  1. Abnormal Expression of Cerebrospinal Fluid Cation Chloride Cotransporters in Patients with Rett Syndrome

    OpenAIRE

    Sofia Temudo Duarte; Judith Armstrong; Ana Roche; Carlos Ortez; Ana Pérez; Maria del Mar O'Callaghan; Antonina Pereira; Francesc Sanmartí; Aida Ormazábal; Rafael Artuch; Mercedes Pineda; Angels García-Cazorla

    2013-01-01

    OBJECTIVE: Rett Syndrome is a progressive neurodevelopmental disorder caused mainly by mutations in the gene encoding methyl-CpG-binding protein 2. The relevance of MeCP2 for GABAergic function was previously documented in animal models. In these models, animals show deficits in brain-derived neurotrophic factor, which is thought to contribute to the pathogenesis of this disease. Neuronal Cation Chloride Cotransporters (CCCs) play a key role in GABAergic neuronal maturation, and brain-derived...

  2. Complex Macromolecular Architectures by Living Cationic Polymerization

    KAUST Repository

    Alghamdi, Reem D.

    2015-05-01

    Poly (vinyl ether)-based graft polymers have been synthesized by the combination of living cationic polymerization of vinyl ethers with other living or controlled/ living polymerization techniques (anionic and ATRP). The process involves the synthesis of well-defined homopolymers (PnBVE) and co/terpolymers [PnBVE-b-PCEVE-b-PSiDEGVE (ABC type) and PSiDEGVE-b-PnBVE-b-PSiDEGVE (CAC type)] by sequential living cationic polymerization of n-butyl vinyl ether (nBVE), 2-chloroethyl vinyl ether (CEVE) and tert-butyldimethylsilyl ethylene glycol vinyl ether (SiDEGVE), using mono-functional {[n-butoxyethyl acetate (nBEA)], [1-(2-chloroethoxy) ethyl acetate (CEEA)], [1-(2-(2-(t-butyldimethylsilyloxy)ethoxy) ethoxy) ethyl acetate (SiDEGEA)]} or di-functional [1,4-cyclohexanedimethanol di(1-ethyl acetate) (cHMDEA), (VEMOA)] initiators. The living cationic polymerizations of those monomers were conducted in hexane at -20 0C using Et3Al2Cl3 (catalyst) in the presence of 1 M AcOEt base.[1] The PCEVE segments of the synthesized block terpolymers were then used to react with living macroanions (PS-DPE-Li; poly styrene diphenyl ethylene lithium) to afford graft polymers. The quantitative desilylation of PSiDEGVE segments by n-Bu4N+F- in THF at 0 °C led to graft co- and terpolymers in which the polyalcohol is the outer block. These co-/terpolymers were subsequently subjected to “grafting-from” reactions by atom transfer radical polymerization (ATRP) of styrene to afford more complex macromolecular architectures. The base assisted living cationic polymerization of vinyl ethers were also used to synthesize well-defined α-hydroxyl polyvinylether (PnBVE-OH). The resulting polymers were then modified into an ATRP macro-initiator for the synthesis of well-defined block copolymers (PnBVE-b-PS). Bifunctional PnBVE with terminal malonate groups was also synthesized and used as a precursor for more complex architectures such as H-shaped block copolymer by “grafting-from” or

  3. Aggregate Formed by a Cationic Fluorescence Probe

    Institute of Scientific and Technical Information of China (English)

    TIAN, Juan; SANG, Da-Yong; JI, Guo-Zhen

    2007-01-01

    The aggregation behavior of a cationic fluorescence probe 10-(4,7,10,13,16-pentaoxa-1-azacyclooctadecyl-methyl)anthracen-9-ylmethyl dodecanoate (1) was observed and studied by a fluorescence methodology in acidic and neutral conditions. By using the Py scale, differences between simple aggregates and micelles have been discussed. The stability of simple aggregates was discussed in terms of hydrophobic interaction and electrostatic repulsion. The absence of excimer emission of the anthrancene moiety of probe 1 in neutral condition was attributed to the photoinduced electron transfer mechanism instead of photodimerization.

  4. The Role of Cationic Polypeptides in Modulating HIV-1 Infection of the Cervicovaginal Mucosa

    Directory of Open Access Journals (Sweden)

    Amy Liese Cole

    2014-11-01

    Full Text Available The mucosa and overlying fluid of the female reproductive tract (FRT are portals for the heterosexual transmission of HIV-1. Toward the ongoing development of topically applied microbicides and mucosal vaccines against HIV-1, it is evermore important to understand how the dynamic FRT mucosa is involved in controlling transmission and infection of HIV-1. Cationic peptides and proteins are the principal innate immune effector molecules of mucosal surfaces, and interact in a combinatorial fashion to modulate HIV-1 infection of the cervix and vagina. While cationic peptides and proteins have historically been categorized as antimicrobial or have other host-benefitting roles, an increasing number of these molecules have been found to augment HIV-1 infection and potentially antagonize host defense. Complex environmental factors such as hormonal fluctuations and/or bacterial and viral co-infections provide additional challenges to both experimentation and interpretation of results. In the context of heterosexual transmission of HIV-1, this review explores how various cationic peptides and proteins participate in modulating host defense against HIV-1 of the cervicovaginal mucosa.

  5. The Role of Cationic Polypeptides in Modulating HIV-1 Infection of the Cervicovaginal Mucosa

    Science.gov (United States)

    Cole, Amy Liese; Cole, Alexander M.

    2014-01-01

    The mucosa and overlying fluid of the female reproductive tract (FRT) are portals for the heterosexual transmission of HIV-1. Toward the ongoing development of topically applied microbicides and mucosal vaccines against HIV-1, it is evermore important to understand how the dynamic FRT mucosa is involved in controlling transmission and infection of HIV-1. Cationic peptides and proteins are the principal innate immune effector molecules of mucosal surfaces, and interact in a combinatorial fashion to modulate HIV-1 infection of the cervix and vagina. While cationic peptides and proteins have historically been categorized as antimicrobial or have other host-benefitting roles, an increasing number of these molecules have been found to augment HIV-1 infection and potentially antagonize host defense. Complex environmental factors such as hormonal fluctuations and/or bacterial and viral co-infections provide additional challenges to both experimentation and interpretation of results. In the context of heterosexual transmission of HIV-1, this review explores how various cationic peptides and proteins participate in modulating host defense against HIV-1 of the cervicovaginal mucosa. PMID:27025760

  6. Transient receptor potential (TRP gene superfamily encoding cation channels

    Directory of Open Access Journals (Sweden)

    Pan Zan

    2011-01-01

    Full Text Available Abstract Transient receptor potential (TRP non-selective cation channels constitute a superfamily, which contains 28 different genes. In mammals, this superfamily is divided into six subfamilies based on differences in amino acid sequence homology between the different gene products. Proteins within a subfamily aggregate to form heteromeric or homomeric tetrameric configurations. These different groupings have very variable permeability ratios for calcium versus sodium ions. TRP expression is widely distributed in neuronal tissues, as well as a host of other tissues, including epithelial and endothelial cells. They are activated by environmental stresses that include tissue injury, changes in temperature, pH and osmolarity, as well as volatile chemicals, cytokines and plant compounds. Their activation induces, via intracellular calcium signalling, a host of responses, including stimulation of cell proliferation, migration, regulatory volume behaviour and the release of a host of cytokines. Their activation is greatly potentiated by phospholipase C (PLC activation mediated by coupled GTP-binding proteins and tyrosine receptors. In addition to their importance in maintaining tissue homeostasis, some of these responses may involve various underlying diseases. Given the wealth of literature describing the multiple roles of TRP in physiology in a very wide range of different mammalian tissues, this review limits itself to the literature describing the multiple roles of TRP channels in different ocular tissues. Accordingly, their importance to the corneal, trabecular meshwork, lens, ciliary muscle, retinal, microglial and retinal pigment epithelial physiology and pathology is reviewed.

  7. Evolutionary and structural perspectives of plant cyclic nucleotide-gated cation channels

    KAUST Repository

    Zelman, Alice K.

    2012-05-29

    Ligand-gated cation channels are a frequent component of signaling cascades in eukaryotes. Eukaryotes contain numerous diverse gene families encoding ion channels, some of which are shared and some of which are unique to particular kingdoms. Among the many different types are cyclic nucleotide-gated channels (CNGCs). CNGCs are cation channels with varying degrees of ion conduction selectivity. They are implicated in numerous signaling pathways and permit diffusion of divalent and monovalent cations, including Ca2+ and K+. CNGCs are present in both plant and animal cells, typically in the plasma membrane; recent studies have also documented their presence in prokaryotes. All eukaryote CNGC polypeptides have a cyclic nucleotide-binding domain and a calmodulin binding domain as well as a six transmembrane/one pore tertiary structure. This review summarizes existing knowledge about the functional domains present in these cation-conducting channels, and considers the evidence indicating that plant and animal CNGCs evolved separately. Additionally, an amino acid motif that is only found in the phosphate binding cassette and hinge regions of plant CNGCs, and is present in all experimentally confirmed CNGCs but no other channels was identified. This CNGC-specific amino acid motif provides an additional diagnostic tool to identify plant CNGCs, and can increase confidence in the annotation of open reading frames in newly sequenced genomes as putative CNGCs. Conversely, the absence of the motif in some plant sequences currently identified as probable CNGCs may suggest that they are misannotated or protein fragments. 2012 Zelman, Dawe, Gehring and Berkowitz.

  8. Cationic Antimicrobial Polymers and Their Assemblies

    Directory of Open Access Journals (Sweden)

    Ana Maria Carmona-Ribeiro

    2013-05-01

    Full Text Available Cationic compounds are promising candidates for development of antimicrobial agents. Positive charges attached to surfaces, particles, polymers, peptides or bilayers have been used as antimicrobial agents by themselves or in sophisticated formulations. The main positively charged moieties in these natural or synthetic structures are quaternary ammonium groups, resulting in quaternary ammonium compounds (QACs. The advantage of amphiphilic cationic polymers when compared to small amphiphilic molecules is their enhanced microbicidal activity. Besides, many of these polymeric structures also show low toxicity to human cells; a major requirement for biomedical applications. Determination of the specific elements in polymers, which affect their antimicrobial activity, has been previously difficult due to broad molecular weight distributions and random sequences characteristic of radical polymerization. With the advances in polymerization control, selection of well defined polymers and structures are allowing greater insight into their structure-antimicrobial activity relationship. On the other hand, antimicrobial polymers grafted or self-assembled to inert or non inert vehicles can yield hybrid antimicrobial nanostructures or films, which can act as antimicrobials by themselves or deliver bioactive molecules for a variety of applications, such as wound dressing, photodynamic antimicrobial therapy, food packing and preservation and antifouling applications.

  9. Cobalt 60 cation exchange with mexican clays

    International Nuclear Information System (INIS)

    Mexican clays can be used to remove radioactive elements from contaminated aqueous solutions. Cation exchange experiments were performed with 60 Co radioactive solution. In the present work the effect of contact time on the sorption of Co 2+ was studied. The contact time in hydrated montmorillonite was from 5 to 120 minutes and in dehydrated montmorillonite 5 to 1400 minutes. The Co 2+ uptake value was, in hydrated montmorillonite, between 0.3 to 0.85 m eq/g and in dehydrated montmorillonite, between 0.6 to 1.40 m eq/g. The experiments were done in a pH 5.1 to 5.7 and normal conditions. XRD patterns were used to characterize the samples. The crystallinity was determined by X-ray Diffraction and it was maintained before and after the cation exchange. DTA thermo grams showed the temperatures of the lost humidity and crystallization water. Finally, was observed that dehydrated montmorillonite adsorb more cobalt than hydrated montmorillonite. (Author)

  10. Photodissociation of Cerium Oxide Nanocluster Cations.

    Science.gov (United States)

    Akin, S T; Ard, S G; Dye, B E; Schaefer, H F; Duncan, M A

    2016-04-21

    Cerium oxide cluster cations, CexOy(+), are produced via laser vaporization in a pulsed nozzle source and detected with time-of-flight mass spectrometry. The mass spectrum displays a strongly preferred oxide stoichiometry for each cluster with a specific number of metal atoms x, with x ≤ y. Specifically, the most prominent clusters correspond to the formula CeO(CeO2)n(+). The cluster cations are mass selected and photodissociated with a Nd:YAG laser at either 532 or 355 nm. The prominent clusters dissociate to produce smaller species also having a similar CeO(CeO2)n(+) formula, always with apparent leaving groups of (CeO2). The production of CeO(CeO2)n(+) from the dissociation of many cluster sizes establishes the relative stability of these clusters. Furthermore, the consistent loss of neutral CeO2 shows that the smallest neutral clusters adopt the same oxidation state (IV) as the most common form of bulk cerium oxide. Clusters with higher oxygen content than the CeO(CeO2)n(+) masses are present with much lower abundance. These species dissociate by the loss of O2, leaving surviving clusters with the CeO(CeO2)n(+) formula. Density functional theory calculations on these clusters suggest structures composed of stable CeO(CeO2)n(+) cores with excess oxygen bound to the surface as a superoxide unit (O2(-)). PMID:27035210

  11. Superparamagnetic cation-exchange adsorbents for bioproduct recovery from crude process liquors by high-gradient magnetic fishing

    DEFF Research Database (Denmark)

    Heebøll-Nielsen, Anders; Justesen, S.F.L; Hobley, Timothy John;

    2004-01-01

    Different routes were screened for the preparation of superparamagnetic cation-exchange adsorbents for the capture of proteins using high-gradient magnetic fishing. Starting from a polyglutaraldehyde-coated base particle, the most successful of these involved attachment of sulphite to oligomers...

  12. Ground state of naphthyl cation: Singlet or triplet?

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, Achintya Kumar; Vaval, Nayana, E-mail: np.vaval@ncl.res.in; Pal, Sourav, E-mail: s.pal@ncl.res.in [Physical Chemistry Division, CSIR-National Chemical Laboratory, Pune 411008 (India); Manohar, Prashant U. [Department of Chemistry, BITS Pilani, Pilani Campus (India)

    2014-03-21

    We present a benchmark theoretical investigation on the electronic structure and singlet-triplet(S-T) gap of 1- and 2-naphthyl cations using the CCSD(T) method. Our calculations reveal that the ground states of both the naphthyl cations are singlet, contrary to the results obtained by DFT/B3LYP calculations reported in previous theoretical studies. However, the triplet states obtained in the two structural isomers of naphthyl cation are completely different. The triplet state in 1-naphthyl cation is (π,σ) type, whereas in 2-naphthyl cation it is (σ,σ{sup ′}) type. The S-T gaps in naphthyl cations and the relative stability ordering of the singlet and the triplet states are highly sensitive to the basis-set quality as well as level of correlation, and demand for inclusion of perturbative triples in the coupled-cluster ansatz.

  13. Influence of interlayer cations on organic intercalation of montmorillonite.

    Science.gov (United States)

    Wu, Limei; Liao, Libing; Lv, Guocheng

    2015-09-15

    The influence of the types of interlayer cations on organic intercalation of montmorillonite (Mt) was studied in this paper. The distribution of Na(+), K(+), Mg(2+), Ca(2+) and Fe(3+) in montmorillonite interlayer, their interaction with structure layers and the effect of interlayer cations on the basal spacing of Mt, the amount of binding water for different interlayer cations and the binding force between them were investigated systematically. 1-Hexadecy1-3-methylimidazolium chloride monohydrate (C16mimCl) was intercalated into montmorillonites with different interlayer cations. The influence of interlayer cations on organic intercalation was investigated. Molecular dynamics (MD) modeling was used to speculate the interlayer microstructures of the organically intercalated Mt with different interlayer cations. These simulations help to predict the microstructure of organo-Mt and guide their relevant engineering applications. PMID:26001131

  14. Bespoke cationic nano-objects via RAFT aqueous dispersion polymerisation

    OpenAIRE

    Williams, M.; Penfold, NJW; Lovett, JR; Warren, NJ; Douglas, CWI; Doroshenko, N; Verstraete, P; Smets, J; Armes, SP

    2016-01-01

    A range of cationic diblock copolymer nanoparticles are synthesised via polymerisation-induced self-assembly (PISA) using a RAFT aqueous dispersion polymerisation formulation. The cationic character of these nanoparticles can be systematically varied by utilising a binary mixture of two macro-CTAs, namely non-ionic poly(glycerol monomethacrylate) (PGMA) and cationic poly[2-(methacryloyloxy)ethyl]trimethylammonium chloride (PQDMA), with poly(2-hydroxypropyl methacrylate) (PHPMA) being selected...

  15. Development of Recombinant Cationic Polymers for Gene Therapy Research

    OpenAIRE

    Canine, Brenda F.; Hatefi, Arash

    2010-01-01

    Cationic polymers created through recombinant DNA technology have the potential to fill a void in the area of gene delivery. The recombinant cationic polymers to be discussed here are amino acid based polymers synthesized in E.coli with the purpose to not only address the major barriers to efficient gene delivery but offer safety, biodegradability, targetability and cost-effectiveness. This review helps the readers to get a better understanding about the evolution of recombinant cationic poly...

  16. Small angle neutron scattering studies on the interaction of cationic surfactants with bovine serum albumin

    Indian Academy of Sciences (India)

    Nuzhat Gull; S Chodankar; V K Aswal; Kabir-Ud-Din

    2008-11-01

    The structure of the protein–surfactant complex of bovine serum albumin (BSA) and cationic surfactants has been studied by small angle neutron scattering. At low concentrations, the CTAB monomers are observed to bind to the protein leading to an increase in its size. On the other hand at high concentrations, surfactant molecules aggregate along the unfolded polypeptide chain of the protein resulting in the formation of a fractal structure representing a necklace model of micelle-like clusters randomly distributed along the polypeptide chain. The fractal dimension as well as the size and number of micelles attached to the complex have been determined.

  17. Hydration Structure of the Quaternary Ammonium Cations

    KAUST Repository

    Babiaczyk, Wojtek Iwo

    2010-11-25

    Two indicators of the hydropathicity of small solutes are introduced and tested by molecular dynamics simulations. These indicators are defined as probabilities of the orientation of water molecules\\' dipoles and hydrogen bond vectors, conditional on a generalized distance from the solute suitable for arbitrarily shaped molecules. Using conditional probabilities, it is possible to distinguish features of the distributions in close proximity of the solute. These regions contain the most significant information on the hydration structure but cannot be adequately represented by using, as is usually done, joint distance-angle probability densities. Our calculations show that using our indicators a relative hydropathicity scale for the interesting test set of the quaternary ammonium cations can be roughly determined. © 2010 American Chemical Society.

  18. Univalent-cation-elicited acidification by yeasts.

    Science.gov (United States)

    Kotyk, A; Georghiou, G

    1994-08-01

    Addition of univalent cations to sugar-metabolizing Saccharomyces cerevisiae, Schizosaccharomyces pombe and Lodderomyces elongisporus brought about a powerful acidification of the external medium with rates up to nearly 20 nmol H+ per min per mg dry wt. in S. cerevisiae, over 15 nmol in S. pombe, and 4.7 nmol in L. elongisporus. These rates were as much as 20 times, 5.5 times and 10.3 times, respectively. higher than in the absence of K+. Use of galactose-induced cells, of H(+)-ATPase-deficient mutants and observations over the entire growth curve indicated that the K+ effect on H+ extrusion is not connected with the H(+)-ATPase function as such but rather depends on metabolic reactions producing ATP. The effect has apparently nothing to do with the electrical potential across the plasma membrane. PMID:7804140

  19. Retention of Cationic Starch onto Cellulose Fibres

    Science.gov (United States)

    Missaoui, Mohamed; Mauret, Evelyne; Belgacem, Mohamed Naceur

    2008-08-01

    Three methods of cationic starch titration were used to quantify its retention on cellulose fibres, namely: (i) the complexation of CS with iodine and measurement of the absorbency of the ensuing blue solution by UV-vis spectroscopy; (ii) hydrolysis of the starch macromolecules followed by the conversion of the resulting sugars to furan-based molecules and quantifying the ensuing mixture by measuring their absorbance at a Ι of 490 nm, using the same technique as previous one and; finally (iii) hydrolysis of starch macromolecules by trifluoro-acetic acid and quantification of the sugars in the resulting hydrolysates by high performance liquid chromatography. The three methods were found to give similar results within the range of CS addition from 0 to 50 mg per g of cellulose fibres.

  20. Capturing dynamic cation hopping in cubic pyrochlores

    Science.gov (United States)

    Brooks Hinojosa, Beverly; Asthagiri, Aravind; Nino, Juan C.

    2011-08-01

    In direct contrast to recent reports, density functional theory predicts that the most stable structure of Bi2Ti2O7 pyrochlore is a cubic Fd3¯m space group by accounting for atomic displacements. The displaced Bi occupies the 96g(x,x,z) Wyckoff position with six equivalent sites, which create multiple local minima. Using nudged elastic band method, the transition states of Bi cation hopping between equivalent minima were investigated and an energy barrier between 0.11 and 0.21 eV was determined. Energy barriers associated with the motion of Bi between equivalent sites within the 96g Wyckoff position suggest the presence of dielectric relaxation in Bi2Ti2O7.

  1. Interaction of actinide cations with synthetic polyelectrolytes

    International Nuclear Information System (INIS)

    The binding of Am+3, Th+4 and UO2+2 to polymaleic acid, polyethylenemaleic acid and polymethylvinylethermaleic acid has been measured by a solvent extraction technique at 250C and either 0.02 or 0.10 M ionic strength. The solutions were buffered over a pH range such that the percent of carboxylate groups ionized ranged from 25 to 74%. The binding was described by two constants, β1 and β2, which were evaluated after correction for complexation of the actinide cations by acetate and hydrolysis. For comparable degrees of ionization, all three polyelectrolytes showed similar binding strengths. In general, these results indicated that the binding of actinides to these synthetic polyelectrolytes is basically similar to that of natural polyelectrolytes such as humic and fulvic acids. (orig.)

  2. Antiviral effect of cationic compounds on bacteriophages

    Directory of Open Access Journals (Sweden)

    Mai Huong eChatain-Ly

    2013-03-01

    Full Text Available The antiviral activity of several cationic compounds - cetytrimethylammonium (CTAB, chitosan, nisin and lysozyme - was investigated on the bacteriophage c2 (DNA head and non-contractile tail infecting Lactococcus strains and the bacteriophage MS2 (F-specific RNA infecting E.coli. Firstly, these activities were evaluated in a phosphate buffer pH 7- 10 mM. The CTAB had a virucidal effect on the Lactococcus bacteriophages, but not on the MS2. After 1 min of contact with 0.125 mM CTAB, the c2 population was reduced from 6 log(pfu/mL to 1,5 log(pfu/mL and completely deactivated at 1 mM. On the contrary, chitosan inhibited the MS2 more than it did the bacteriophages c2. No antiviral effect was observed for the nisin or the lysozyme on bacteriophages after 1 min of treatment. A 1 and 2.5 log reduction was respectively observed for nisin and lysozyme when the treatment time increased (5 or 10 min. These results showed that the antiviral effect depended both on the virus and structure of the antimicrobial compounds. The antiviral activity of these compounds was also evaluated in different physico-chemical conditions and in complex matrices. The antiviral activity of CTAB was impaired in acid pH and with an increase of the ionic strength. These results might be explained by the electrostatic interactions between cationic compounds and negatively charged particles such as bacteriophages or other compounds in a matrix. Milk proved to be protective suggesting the components of food could interfere with antimicrobial compounds.

  3. Quantum effects in cation interactions with first and second coordination shell ligands in metalloproteins.

    Science.gov (United States)

    Ngo, Van; da Silva, Mauricio C; Kubillus, Maximilian; Li, Hui; Roux, Benoît; Elstner, Marcus; Cui, Qiang; Salahub, Dennis R; Noskov, Sergei Yu

    2015-10-13

    Despite decades of investigations, the principal mechanisms responsible for the high affinity and specificity of proteins for key physiological cations K(+), Na(+), and Ca(2+) remain a hotly debated topic. At the core of the debate is an apparent need (or lack thereof) for an accurate description of the electrostatic response of the charge distribution in a protein to the binding of an ion. These effects range from partial electronic polarization of the directly ligating atoms to long-range effects related to partial charge transfer and electronic delocalization effects. While accurate modeling of cation recognition by metalloproteins warrants the use of quantum-mechanics (QM) calculations, the most popular approximations used in major biomolecular simulation packages rely on the implicit modeling of electronic polarization effects. That is, high-level QM computations for ion binding to proteins are desirable, but they are often unfeasible, because of the large size of the reactive-site models and the need to sample conformational space exhaustively at finite temperature. Several solutions to this challenge have been proposed in the field, ranging from the recently developed Drude polarizable force-field for simulations of metalloproteins to approximate tight-binding density functional theory (DFTB). To delineate the usefulness of different approximations, we examined the accuracy of three recent and commonly used theoretical models and numerical algorithms, namely, CHARMM C36, the latest developed Drude polarizable force fields, and DFTB3 with the latest 3OB parameters. We performed MD simulations for 30 cation-selective proteins with high-resolution X-ray structures to create ensembles of structures for analysis with different levels of theory, e.g., additive and polarizable force fields, DFTB3, and DFT. The results from DFT computations were used to benchmark CHARMM C36, Drude, and DFTB3 performance. The explicit modeling of quantum effects unveils the key

  4. Fortifi cation of white fl at bread with sprouted red kidney bean (Phaseolus vulgaris

    Directory of Open Access Journals (Sweden)

    Kiruthika Viswanathan

    2014-03-01

    Full Text Available Background. Protein quantity in diet including the digestibility and bioavailability of protein is of importance to eradicate undernutrition in developing countries. Bread protein is an incomplete source as it lacks an essential amino acid lysine. When they are combined with other plant foods like pulses and legumes, they become a complete source of protein. Since bread is most common staple food the objective of this study is to fortify bread with legumes in order to increase the total protein content of bread to 13-15% which is required to meet at least 1/3rd of protein requirement of an adult recommended daily allowance. Material and methods. Fortifi cation of fl at bread was done by adding sprouted red kidney bean flour (Phaseolus vulgaris at 5, 15 and 25% to white fl our. The composite bread was analysed for crude protein and in vitro protein digestibility using the Kjeldahl and pepsin-pancreatin method. Results. The protein content of raw beans showed trivial increase on soaking for 17h and sprouting for 3 days. On the other hand, a remarkable increase was observed in protein digestibility i.e., 8% and 11% respectively. The protein content of control and composite breads increased gradually at 1% and protein digestibility decreased by 12% from control. This is due to the presence of dietary fi bers which bind with protein and inhibit its digestibility. Conclusion. The study infers that sprouting the beans for 72 h did not show any remarkable increase in protein content but a signifi cant increase in invitro protein digestibility was observed. Overall, breads made using 15% legume fl our was comparatively equal in protein content, with overall acceptable quality.

  5. The Effect of Hydration on the Cation-π Interaction Between Benzene and Various Cations

    Indian Academy of Sciences (India)

    VIKASH DHINDHWAL; N SATHYAMURTHY

    2016-10-01

    The effect of hydration on cation-π interaction in Mq+ BmWn (B = benzene; W = water; Mq+ =Na⁺, K⁺, Mg²⁺, Ca²⁺, Al³⁺, 0 ≤ n,m ≤ 4, 1≤ m + n ≤ 4) complexes has been investigated using ab initio quantum chemical methods. Interaction energy values computed at the MP2 level of theory using the 6-31G(d,p) basis set reveal a qualitative trend in the relative affinity of different cations for benzene and water in these complexes. The π–cloud thickness values for benzene have also been estimated for these systems.

  6. Crystal structure of channelrhodopsin, a light-gated cation channel - all cations lead through the monomer.

    Science.gov (United States)

    Kato, Hideaki E; Nureki, Osamu

    2013-01-01

    Channelrhodopsin (ChR) is a light-gated cation channel derived from green algae. Since the inward flow of cations triggers the neuron firing, neurons expressing ChRs can be optically controlled even within freely moving mammals. Although ChR has been broadly applied to neuro-science research, little is known about its molecular mechanisms. We determined the crystal structure of chimeric ChR at 2.3 Å resolution and revealed its molecular architecture. The integration of structural, electrophysio-logical, and computational analyses provided insight into the molecular basis for the channel function of ChR, and paved the way for the principled design of ChR variants with novel properties. PMID:27493541

  7. The geometry and efficacy of cation-pi interactions in a diagonal position of a designed beta-hairpin.

    Science.gov (United States)

    Tatko, Chad D; Waters, Marcey L

    2003-11-01

    Cation-pi interactions are common in proteins, but their contribution to the stability and specificity of protein structure has not been well established. In this study, we examined the impact of cation-pi interactions in a diagonal position of a beta-hairpin peptide through comparison of the interaction of Phe or Trp with Lys or Arg. The diagonal interactions ranged from -0.20 to -0.48 kcal/mole. Our experimental values for the diagonal cation-pi interactions are similar to those found in alpha-helical studies. Upfield shifting of the Lys and Arg side chains indicates that the geometries of cation-pi interactions adopted in the 12-residue beta-hairpin are comparable to those found in protein structures. The Lys was found to interact through the polarized Cepsilon, and the Arg is stacked against the aromatic ring of Phe or Trp. Folding of these peptides was found to be enthalpically favorable (DeltaH degrees equals approximately -3 kcal/mole) and entropically unfavorable (DeltaS degrees equals approximately -8 cal mole(-1) K(-1)).

  8. In vivo toxicity of cationic micelles and liposomes

    DEFF Research Database (Denmark)

    Knudsen, Kristina Bram; Northeved, Helle; Ek, Pramod Kumar;

    2015-01-01

    This study investigated toxicity of nanocarriers comprised of cationic polymer and lipid components often used in gene and drug delivery, formulated as cationic micelles and liposomes. Rats were injected intravenously with 10, 25 or 100 mg/kg and sacrificed after 24 or 48 h, or 24 h after the las...

  9. Stable polyfluorinated cycloalkenyl cations and their NMR spectra

    International Nuclear Information System (INIS)

    New stable 1-methoxyperfluoro-2-ethylcyclobutenyl, 1-methoxyperfluoro-2-methylcyclo-pentenyl, and 1-methoxyperfluoro-2-ethylcyclohexenyl cations were obtained by the action of antimony pentafluoride on the corresponding olefins. The distribution of the charges in the investigated polyfluorinated cycloalkenyl cations was investigated by 13C NMR method

  10. Photodynamic Inactivation of Bacteria and Biofilms Using Cationic Bacteriochlorins

    Science.gov (United States)

    Meerovich, G. A.; Tiganova, I. G.; Makarova, E. A.; Meerovich, I. G.; Romanova Ju., M.; Tolordova, E. R.; Alekseeva, N. V.; Stepanova, T. V.; Yu, Koloskova; Luk'anets, E. A.; Krivospitskaya, N. V.; Sipailo, I. P.; Baikova, T. V.; Loschenov, V. B.; Gonchukov, S. A.

    2016-02-01

    This work is devoted to the study of two new synthetic bacteriochlorins with four and eight cationic substitutes as the photosensitizers in the photodynamic process. The spectral and antibacterial properties of these photosensitizers in saline solution were investigated. It is shown, that the aggregation ability decreases and the antibacterial efficiency grows as the cationic substitute number increases.

  11. Effects of metallic cations in the beryl flotation

    International Nuclear Information System (INIS)

    The beryl zeta potential in microelectrophoretic cell is studied in the presence of neutral electrolyte, cations of calcium, magnesium and iron. The petroleum sulfonate is used how collector in Hallimond tube. Hydroxy complex of metallic cations seems activate the ore and precipitates of colloidal metallic hidroxies seems lower him when added to the mixture. (M.A.C.)

  12. Inhibition of hepatic fibrosis with artificial microRNA using ultrasound and cationic liposome-bearing microbubbles.

    Science.gov (United States)

    Yang, D; Gao, Y-H; Tan, K-B; Zuo, Z-X; Yang, W-X; Hua, X; Li, P-J; Zhang, Y; Wang, G

    2013-12-01

    We sought to investigate the antifibrotic effects of an artificial microRNA (miRNA) targeting connective tissue growth factor (CTGF) using the ultrasound-targeted cationic liposome-bearing microbubble destruction gene delivery system. Cationic liposomes were conjugated with microbubbles using a biotin-avidin system. Plasmids carrying the most effective artificial miRNA sequences were delivered by ultrasound-targeted cationic liposome-bearing microbubble destruction gene delivery system to rats with hepatic fibrosis. The results show that this method of gene delivery effectively transported the plasmids to the rat liver. The artificial miRNA reduced hepatic fibrosis pathological alterations as well as the protein and mRNA expressions of CTGF and transforming growth factor β1. Furthermore, the CTGF gene silencing decreased the levels of type I collagen and α-smooth muscle actin (Pliposome-bearing microbubble destruction may be an efficacious therapeutic method to ameliorate hepatic fibrosis.

  13. Cation-selective transporters are critical to the AMPK-mediated antiproliferative effects of metformin in human breast cancer cells.

    Science.gov (United States)

    Cai, Hao; Zhang, Yunhui; Han, Tianxiang Kevin; Everett, Ruth S; Thakker, Dhiren R

    2016-05-01

    The antidiabetic drug metformin exerts antineoplastic effects against breast cancer and other cancers. One mechanism by which metformin is believed to exert its anticancer effect involves activation of its intracellular target, adenosine monophosphate-activated protein kinase (AMPK), which is also implicated in the antidiabetic effect of metformin. It is proposed that in cancer cells, AMPK activation leads to inhibition of the mammalian target of rapamycin (mTOR) and the downstream pS6K that regulates cell proliferation. Due to its hydrophilic and cationic nature, metformin requires cation-selective transporters to enter cells and activate AMPK. This study demonstrates that expression levels of cation-selective transporters correlate with the antiproliferative and antitumor efficacy of metformin in breast cancer. Metformin uptake and antiproliferative activity were compared between a cation-selective transporter-deficient human breast cancer cell line, BT-20, and a BT-20 cell line that was engineered to overexpress organic cation transporter 3 (OCT3), a representative of cation-selective transporters and a predominant transporter in human breast tumors. Metformin uptake was minimal in BT-20 cells, but increased by >13-fold in OCT3-BT20 cells, and its antiproliferative potency was >4-fold in OCT3-BT20 versus BT-20 cells. This increase in antiproliferative activity was associated with greater AMPK phosphorylation and decreased pS6K phosphorylation in OCT3-BT20 cells. In vitro data were corroborated by in vivo observations of significantly greater antitumor efficacy of metformin in xenograft mice bearing OCT3-overexpressing tumors versus low transporter-expressing wildtype tumors. Collectively, these findings establish a clear relationship between cation-selective transporter expression, the AMPK-mTOR-pS6K signaling cascade, and the antiproliferative activity of metformin in breast cancer. PMID:26669511

  14. Cation-selective transporters are critical to the AMPK-mediated antiproliferative effects of metformin in human breast cancer cells.

    Science.gov (United States)

    Cai, Hao; Zhang, Yunhui; Han, Tianxiang Kevin; Everett, Ruth S; Thakker, Dhiren R

    2016-05-01

    The antidiabetic drug metformin exerts antineoplastic effects against breast cancer and other cancers. One mechanism by which metformin is believed to exert its anticancer effect involves activation of its intracellular target, adenosine monophosphate-activated protein kinase (AMPK), which is also implicated in the antidiabetic effect of metformin. It is proposed that in cancer cells, AMPK activation leads to inhibition of the mammalian target of rapamycin (mTOR) and the downstream pS6K that regulates cell proliferation. Due to its hydrophilic and cationic nature, metformin requires cation-selective transporters to enter cells and activate AMPK. This study demonstrates that expression levels of cation-selective transporters correlate with the antiproliferative and antitumor efficacy of metformin in breast cancer. Metformin uptake and antiproliferative activity were compared between a cation-selective transporter-deficient human breast cancer cell line, BT-20, and a BT-20 cell line that was engineered to overexpress organic cation transporter 3 (OCT3), a representative of cation-selective transporters and a predominant transporter in human breast tumors. Metformin uptake was minimal in BT-20 cells, but increased by >13-fold in OCT3-BT20 cells, and its antiproliferative potency was >4-fold in OCT3-BT20 versus BT-20 cells. This increase in antiproliferative activity was associated with greater AMPK phosphorylation and decreased pS6K phosphorylation in OCT3-BT20 cells. In vitro data were corroborated by in vivo observations of significantly greater antitumor efficacy of metformin in xenograft mice bearing OCT3-overexpressing tumors versus low transporter-expressing wildtype tumors. Collectively, these findings establish a clear relationship between cation-selective transporter expression, the AMPK-mTOR-pS6K signaling cascade, and the antiproliferative activity of metformin in breast cancer.

  15. Effects of Metal Ion Adduction on the Gas-Phase Conformations of Protein Ions

    OpenAIRE

    Flick, Tawnya G.; Merenbloom, Samuel I.; Williams, Evan R.

    2013-01-01

    Changes in protein ion conformation as a result of nonspecific adduction of metal ions to the protein during electrospray ionization (ESI) from aqueous solutions were investigated using traveling wave ion mobility spectrometry (TWIMS). For all proteins examined, protein cations (and in most cases anions) with nonspecific metal ion adducts are more compact than the fully protonated (or deprotonated) ions with the same charge state. Compaction of protein cations upon nonspecific metal ion bindi...

  16. Repurposing Cationic Amphiphilic Antihistamines for Cancer Treatment

    DEFF Research Database (Denmark)

    Ellegaard, Anne-Marie; Dehlendorff, Christian; Vind, Anna C.;

    2016-01-01

    Non-small cell lung cancer (NSCLC) is one of the deadliest cancers worldwide. In search for new NSCLC treatment options, we screened a cationic amphiphilic drug (CAD) library for cytotoxicity against NSCLC cells and identified several CAD antihistamines as inducers of lysosomal cell death. We the...... of loratadine, astemizole and ebastine sensitized NSCLC cells to chemotherapy and reverted multidrug resistance in NSCLC, breast and prostate cancer cells. Thus, CAD antihistamines may improve the efficacy of cancer chemotherapy...... then performed a cohort study on the effect of CAD antihistamine use on mortality of patients diagnosed with non-localized cancer in Denmark between 1995 and 2011. The use of the most commonly prescribed CAD antihistamine, loratadine, was associated with significantly reduced all-cause mortality among patients...... with non-localized NSCLC or any non-localized cancer when compared with use of non-CAD antihistamines and adjusted for potential confounders. Of the less frequently described CAD antihistamines, astemizole showed a similar significant association with reduced mortality as loratadine among patients with any...

  17. Repurposing Cationic Amphiphilic Antihistamines for Cancer Treatment

    Directory of Open Access Journals (Sweden)

    Anne-Marie Ellegaard

    2016-07-01

    Full Text Available Non-small cell lung cancer (NSCLC is one of the deadliest cancers worldwide. In search for new NSCLC treatment options, we screened a cationic amphiphilic drug (CAD library for cytotoxicity against NSCLC cells and identified several CAD antihistamines as inducers of lysosomal cell death. We then performed a cohort study on the effect of CAD antihistamine use on mortality of patients diagnosed with non-localized cancer in Denmark between 1995 and 2011. The use of the most commonly prescribed CAD antihistamine, loratadine, was associated with significantly reduced all-cause mortality among patients with non-localized NSCLC or any non-localized cancer when compared with use of non-CAD antihistamines and adjusted for potential confounders. Of the less frequently described CAD antihistamines, astemizole showed a similar significant association with reduced mortality as loratadine among patients with any non-localized cancer, and ebastine use showed a similar tendency. The association between CAD antihistamine use and reduced mortality was stronger among patients with records of concurrent chemotherapy than among those without such records. In line with this, sub-micromolar concentrations of loratadine, astemizole and ebastine sensitized NSCLC cells to chemotherapy and reverted multidrug resistance in NSCLC, breast and prostate cancer cells. Thus, CAD antihistamines may improve the efficacy of cancer chemotherapy.

  18. Repurposing Cationic Amphiphilic Antihistamines for Cancer Treatment.

    Science.gov (United States)

    Ellegaard, Anne-Marie; Dehlendorff, Christian; Vind, Anna C; Anand, Atul; Cederkvist, Luise; Petersen, Nikolaj H T; Nylandsted, Jesper; Stenvang, Jan; Mellemgaard, Anders; Østerlind, Kell; Friis, Søren; Jäättelä, Marja

    2016-07-01

    Non-small cell lung cancer (NSCLC) is one of the deadliest cancers worldwide. In search for new NSCLC treatment options, we screened a cationic amphiphilic drug (CAD) library for cytotoxicity against NSCLC cells and identified several CAD antihistamines as inducers of lysosomal cell death. We then performed a cohort study on the effect of CAD antihistamine use on mortality of patients diagnosed with non-localized cancer in Denmark between 1995 and 2011. The use of the most commonly prescribed CAD antihistamine, loratadine, was associated with significantly reduced all-cause mortality among patients with non-localized NSCLC or any non-localized cancer when compared with use of non-CAD antihistamines and adjusted for potential confounders. Of the less frequently described CAD antihistamines, astemizole showed a similar significant association with reduced mortality as loratadine among patients with any non-localized cancer, and ebastine use showed a similar tendency. The association between CAD antihistamine use and reduced mortality was stronger among patients with records of concurrent chemotherapy than among those without such records. In line with this, sub-micromolar concentrations of loratadine, astemizole and ebastine sensitized NSCLC cells to chemotherapy and reverted multidrug resistance in NSCLC, breast and prostate cancer cells. Thus, CAD antihistamines may improve the efficacy of cancer chemotherapy. PMID:27333030

  19. Therapeutic potential of cationic steroid antibacterials.

    Science.gov (United States)

    Salmi, Chanaz; Brunel, Jean M

    2007-08-01

    Antibiotics were one of the great health successes of the 20th century. Antibiotics, both naturally derived and synthetic, have resulted in huge decreases in both morbidity and mortality from bacterial infections. As a consequence, the 'antibiotic age' has changed public expectations about the results of infectious disease. However, this has led to high levels of inappropriate prescribing, where antibiotics may be administered to fulfil patient expectations rather than for clinical benefit. Along with unwise uses in agriculture and elsewhere, this has contributed to recent rises in numbers of antibiotic-resistant bacteria. As a result, many commentators have described this as the end of the antibiotic age and the term 'superbug' has entered the common vocabulary for multi-drug-resistant bacteria such as vancomycin-resistant Enterococcus, multi-drug-resistant Staphylococcus aureus and multi-drug-resistant Pseudomonas aeruginosa. In this context, an attractive approach for the development of antibacterial agents is the use of a new class of cationic steroidal compounds mimicking polymyxin activities. The permeabilization properties of these agents of the outer membranes of Gram-negative bacteria are reported in this review, as well as a discussion of literature results. PMID:17685865

  20. Competitive Effects of 2+ and 3+ Cations on DNA Compaction

    CERN Document Server

    Tongu, C; Yoshikawa, Y; Zinchenko, A A; Chen, N; Yoshikawa, K

    2016-01-01

    By using single-DNA observation with fluorescence microscopy, we observed the effects of divalent and trivalent cations on the higher-order structure of giant DNA (T4 DNA with 166 kbp). It was found that divalent cations, such as Mg(2+) and Ca(2+), inhibit DNA compaction induced by a trivalent cation, spermidine (SPD(3+)). On the other hand, in the absence of SPD(3+), divalent cations cause the shrinkage of DNA. These experimental observations are inconsistent with the well-established Debye-Huckel scheme regarding the shielding effect of counter ions, which is given as the additivity of contributions of cations with different valences. We interpreted the competition between 2+ and 3+ cations in terms of the change in the translational entropy of the counter ions before and after the folding transition of DNA. For the compaction with SPD(3+), we considered the increase in translational entropy due to the ion-exchange of the intrinsic monovalent cations condensing on a highly-charged polyelectrolyte, double-st...

  1. Competitive Solvation of the Imidazolium Cation by Water and Methanol

    CERN Document Server

    Chaban, Vitaly

    2014-01-01

    Imidazolium-based ionic liquids are widely used in conjunction with molecular liquids for various applications. Solvation, miscibility and similar properties are of fundamental importance for successful implementation of theoretical schemes. This work reports competitive solvation of the 1,3-dimethylimidazolium cation by water and methanol. Employing molecular dynamics simulations powered by semiempirical Hamiltonian (electronic structure level of description), the local structure nearly imidazolium cation is described in terms of radial distribution functions. Although water and methanol are chemically similar, water appears systematically more successful in solvating the 1,3-dimethylimidazolium cation. This result fosters construction of future applications of the ternary ion-molecular systems.

  2. Pyridine radical cation and its fluorine substituted derivatives

    Science.gov (United States)

    Bondybey, V.E.; English, J.H.; Shiley, R.H.

    1982-01-01

    The spectra and relaxation of the pyridine cation and of several of its fluorinated derivatives are studied in low temperature Ne matrices. The ions are generated by direct photoionization of the parent compounds. Of the compounds studied, laser induced → and → fluorescence is observed only for the 2, 6‐difluoropyridine cation. The analysis of the spectrum indicates that the ion is planar both in the and states. The large variety in the spectroscopic and relaxation behavior of fluoropyridine radical cations is explained in terms of their electronic structure and of the differential shifts of the individual electronic states caused by the fluorine substitution.

  3. Eosinophil cationic protein stimulates and major basic protein inhibits airway mucus secretion

    DEFF Research Database (Denmark)

    Lundgren, J D; Davey, R T; Lundgren, B;

    1991-01-01

    Possible roles of eosinophil (EO) products in modulating the release of mucus from airway explants were investigated. Cell- and membrane-free lysates from purified human EOs (1 to 20 x 10(5)) caused a dose-dependent release of respiratory glycoconjugates (RGC) from cultured feline tracheal explants...

  4. Chapter 17 - Engineering cationic liposome siRNA complexes for in vitro and in vivo delivery.

    Science.gov (United States)

    Podesta, Jennifer E; Kostarelos, Kostas

    2009-01-01

    RNA interference, the sequence-specific silencing of gene expression by introduction of short interfering RNA (siRNA) is a powerful tool that that the potential to act as a therapeutic agent and the advantage of decreasing toxic effects on normal tissue sometimes seen with conventional treatments i.e. small molecule inhibitors. Naked, unmodified siRNA is poorly taken up by cells and is subject to degradation when exposed to blood proteins during systemic administration. It has also been shown to produce non-specific immune response as well as having the potential to generate 'off-target' effects. Therefore there is a requirement for a delivery system to not only protect the siRNA and facilitate its uptake, but additionally to offer the potential for targeted delivery with an aim of exploiting the high specificity afforded by RNA interference. Cationic liposomes are the most studied, non-viral delivery system used for nucleic acid delivery. As such, the use of cationic liposomes is promising for siRNA for delivery. Furthermore, polyethylene glycol (PEG) can be incorporated into the liposome formulation to create sterically stabilized or 'stealth' liposomes. Addition of PEG can reduce recognition by the reticuloendothelial system (RES) thereby prolonging circulation time. Here we describe a methodology for the complexation of siRNA with cationic liposomes and PEGylated liposomes using two protocols: mixing and encapsulation. Moreover, the different formulations are compared head to head to demonstrate their efficacy for gene silencing.

  5. Regioselective synthesis of cationic 6-deoxy-6-(N,N,N-trialkylammonio)curdlan derivatives.

    Science.gov (United States)

    Zhang, Ruoran; Liu, Shu; Edgar, Kevin J

    2016-01-20

    Curdlan, a bioactive β-1,3-glucan, is of intense interest for pharmaceutical and biomedical applications. Cationic derivatives of curdlan and other polysaccharides are especially attractive for their potential to interact in controlled fashion with proteins, among many other possible applications, but relatively few methods exist for their synthesis. Herein we report a regioselective method for preparation of cationic, water-soluble 6-(N,N,N-trialkylammonio)-6-deoxycurdlan salts by reaction of 6-bromo-6-deoxycurdlan and its 2,4-O-diesters with trialkylamines. Dimethyl sulfoxide was identified as the optimal solvent for this nucleophilic displacement to produce cationic curdlan derivatives (80 °C, 24h), providing maximum degree of triethylammonium substitution (DS) of 0.89, exclusively at the C-6 position. 6-Bromo-6-deoxycurdlan was also reacted with heterocyclic amines such as pyridine and imidazole, providing ammonium-substituted curdlan derivatives with substantial DS (0.66 and 0.86, respectively). The new combination of regioselective Furuhata bromination and bromine displacement under optimized conditions with tertiary amines provides access to quaternized curdlan derivatives that possess high, permanent positive charge and are readily water-soluble, properties that indicate potential application promise including for mucoadhesion, permeation enhancement, and delivery of genes and anionic drugs. Regioselectivity and DS of those curdlan ammonium derivatives were quantified by means of (1)H NMR, (13)C NMR and FTIR spectroscopic methods and by elemental analysis. PMID:26572378

  6. Recharging cationic DNA complexes with highly charged polyanions for in vitro and in vivo gene delivery.

    Science.gov (United States)

    Trubetskoy, V S; Wong, S C; Subbotin, V; Budker, V G; Loomis, A; Hagstrom, J E; Wolff, J A

    2003-02-01

    The intravenous delivery of plasmid DNA complexed with either cationic lipids (CL) or polyethyleneimine (PEI) enables high levels of foreign gene expression in lung. However, these cationic DNA complexes cause substantial toxicity. The present study found that the inclusion of polyacrylic acid (pAA) with DNA/polycation and DNA/CL complexes prevented the serum inhibition of the transfection complexes in cultured cells. The mechanism mediating this increase seems to involve both particle size enlargement due to flocculation and electrostatic shielding from opsonizing serum proteins. The use of pAA also increased the levels of lung expression in mice in vivo substantially above the levels achieved with just binary complexes of DNA and linear PEI (lPEI) or CL and reduced their toxicity. Also, the use of a "chaser" injection of pAA 30 min after injection of the ternary DNA/lPEI/pAA complexes further aided this effort to reduce toxicity while not affecting foreign gene expression. By optimizing the amount of pAA, lPEI, and DNA within the ternary complexes and using the "chaser" injection, substantial levels of lung expression were obtained while avoiding adverse effects in lung or liver. These developments will aid the use of cationic DNA complexes in animals and for eventual human gene therapy.

  7. Zeaxanthin Radical Cation Formation in Minor Light-Harvesting Complexes of Higher Plant Antenna

    Energy Technology Data Exchange (ETDEWEB)

    Avenson, Thomas H.; Ahn, Tae Kyu; Zigmantas, Donatas; Niyogi, Krishna K.; Li, Zhirong; Ballottari, Matteo; Bassi, Roberto; Fleming, Graham R.

    2008-01-31

    Previous work on intact thylakoid membranes showed that transient formation of a zeaxanthin radical cation was correlated with regulation of photosynthetic light-harvesting via energy-dependent quenching. A molecular mechanism for such quenching was proposed to involve charge transfer within a chlorophyll-zeaxanthin heterodimer. Using near infrared (880-1100 nm) transient absorption spectroscopy, we demonstrate that carotenoid (mainly zeaxanthin) radical cation generation occurs solely in isolated minor light-harvesting complexes that bind zeaxanthin, consistent with the engagement of charge transfer quenching therein. We estimated that less than 0.5percent of the isolated minor complexes undergo charge transfer quenching in vitro, whereas the fraction of minor complexes estimated to be engaged in charge transfer quenching in isolated thylakoids was more than 80 times higher. We conclude that minor complexes which bind zeaxanthin are sites of charge transfer quenching in vivo and that they can assume Non-quenching and Quenching conformations, the equilibrium LHC(N)<--> LHC(Q) of which is modulated by the transthylakoid pH gradient, the PsbS protein, and protein-protein interactions.

  8. Refolding of Denatured/Reduced Lysozyme Using Weak-Cation Exchange Chromatography

    Institute of Scientific and Technical Information of China (English)

    Yan WANG; Bo Lin GONG; Xin Du GENG

    2003-01-01

    Oxidative refolding of the denatured/reduced lysozyme was investigated by using weak-cation exchange chromatography (WCX). The stationary phase of WCX binds to the reduced lysozyme and prevented it from forming intermolecular aggregates. At the same time urea and ammonium sulfate were added to the mobile phase to increase the elution strength for lysozyme. Ammonium sulfate can more stabilize the native protein than a common eluting agent, sodium chloride. Refolding of lysozyme by using this WCX is successfully. It was simply carried out to obtain a completely and correctly refolding of the denatured lysozyme at high concentration of 20.0 mg/mL.

  9. Isomerization of propargyl cation to cyclopropenyl cation: Mechanistic elucidations and effects of lone pair donors

    Indian Academy of Sciences (India)

    Zodinpuia Pachuau; Kiew S Kharnaior; R H Duncan Lyngdoh

    2013-03-01

    This ab initio study examines two pathways (one concerted and the other two-step) for isomerization of the linear propargyl cation to the aromatic cyclopropenyl cation, also probing the phenomenon of solvation of this reaction by simple lone pair donors (NH3, H2O, H2S and HF) which bind to the substrate at two sites. Fully optimized geometries at the B3LYP/6-31G(d) level were used, along with single point QCISD(T)/6-311+G(d,p) and accurate G3 level calculations upon the DFT optimized geometries. For the unsolvated reaction, the two-step second pathway is energetically favoured over the one-step first pathway. Lone pair donor affinity for the various C3H$^{+}_{3}$ species follows the uniform order NH3 > H2S>H2O>HF. The activation barriers for the solvated isomerizations decrease in the order HF>H2O>H2S>NH3 for both pathways. The number of lone pairs on the donor heteroatom as well as the heteroatom electronegativity are factors related to both these trends. Compared to the unsolvated cases, the solvated reactions have transition states which are usually ‘later’ in position along the reaction coordinate, validating the Hammond postulate.

  10. Delivery of Therapeutic siRNA to the CNS Using Cationic and Anionic Liposomes.

    Science.gov (United States)

    Bender, Heather R; Kane, Sarah; Zabel, Mark D

    2016-07-23

    Prion diseases result from the misfolding of the normal, cellular prion protein (PrP(C)) to an abnormal protease resistant isomer called PrP(Res). The emergence of prion diseases in wildlife populations and their increasing threat to human health has led to increased efforts to find a treatment for these diseases. Recent studies have found numerous anti-prion compounds that can either inhibit the infectious PrP(Res) isomer or down regulate the normal cellular prion protein. However, most of these compounds do not cross the blood brain barrier to effectively inhibit PrP(Res) formation in brain tissue, do not specifically target neuronal PrP(C), and are often too toxic to use in animal or human subjects. We investigated whether siRNA delivered intravascularly and targeted towards neuronal PrP(C) is a safer and more effective anti-prion compound. This report outlines a protocol to produce two siRNA liposomal delivery vehicles, and to package and deliver PrP siRNA to neuronal cells. The two liposomal delivery vehicles are 1) complexed-siRNA liposome formulation using cationic liposomes (LSPCs), and 2) encapsulated-siRNA liposome formulation using cationic or anionic liposomes (PALETS). For the LSPCs, negatively charged siRNA is electrostatically bound to the cationic liposome. A positively charged peptide (RVG-9r [rabies virus glycoprotein]) is added to the complex, which specifically targets the liposome-siRNA-peptide complexes (LSPCs) across the blood brain barrier (BBB) to acetylcholine expressing neurons in the central nervous system (CNS). For the PALETS (peptide addressed liposome encapsulated therapeutic siRNA), the cationic and anionic lipids were rehydrated by the PrP siRNA. This procedure results in encapsulation of the siRNA within the cationic or anionic liposomes. Again, the RVG-9r neuropeptide was bound to the liposomes to target the siRNA/liposome complexes to the CNS. Using these formulations, we have successfully delivered PrP siRNA to Ach

  11. Cloning and first functional characterization of a plant cyclic nucleotide-gated cation channel

    Energy Technology Data Exchange (ETDEWEB)

    Leng, Q.; Mercier, R.W.; Yao, W.; Berkowitz, G.A.

    1999-11-01

    Cyclic nucleotide-gated (cng) non-selective cation channels have been cloned from a number of animal systems. These channels are characterized by direct gating upon cAMO or cGMO binding to the intracellular portion of the channel protein, which leads to an increase in channel conductance. Animal cng channels are involved in signal transduction systems; they translate stimulus-induced changes in cytosolic cyclic nucleotide into altered cell membrane potential and/or cation flux as part of a signal cascade pathway. Putative plant homologs of animal cng channels have been identified. However, functional characterization (i.e., demonstration of cyclic-nucleotide-dependent ion currents) of a plant cng channel has not yet been accomplished. The authors report the cloning and first functional characterization of a plant member of this family of ion channels. The Arabidopsis cDNA AtCNGC2 encodes a polypeptide with deduced homology to the {alpha}-subunit of animal channels, and facilitates cyclic nucleotide-dependent cation currents upon expression in a number of heterologous systems. AtCNGC2 expression in a yeast mutant lacking a low-affinity K{sup +} uptake system complements growth inhibition only when lipophilic nucleotides are present in the culture medium. Voltage clamp analysis indicates that Xenopus lawvis oocytes injected with AtCNGC2 cRNA demonstrate cyclic-nucleotide-dependent, inward-rectifying K{sup +} currents. Human embryonic kidney cells (HEK293) transfected with AtCNGC2 cDNA demonstrate increased permeability to Ca{sup 2+} only in the presence of lipophilic cyclic nucleotides. The evidence presented here supports the functional classification of AtCNGC2 as a cyclic-nucleotide-gated cation channel, and presents the first direct evidence identifying a plant member of this ion channel family.

  12. DFT study on the cycloreversion of thietane radical cations.

    Science.gov (United States)

    Domingo, Luis R; Pérez-Ruiz, Raúl; Argüello, Juan E; Miranda, Miguel A

    2011-06-01

    The molecular mechanism of the cycloreversion (CR) of thietane radical cations has been analyzed in detail at the UB3LYP/6-31G* level of theory. Results have shown that the process takes place via a stepwise mechanism leading to alkenes and thiobenzophenone; alternatively, formal [4+2] cycloadducts are obtained. Thus, the CR of radical cations 1a,b(•+) is initiated by C2-C3 bond breaking, giving common intermediates INa,b. At this stage, two reaction pathways are feasible involving ion molecule complexes IMCa,b (i) or radical cations 4a,b(•+) (ii). Calculations support that 1a(•+) follows reaction pathway ii (leading to the formal [4+2] cycloadducts 5a). By contrast, 1b(•+) follows pathway i, leading to trans-stilbene radical cation (2b(•+)) and thiobenzophenone.

  13. Degradation Mechanism of Cationic Red X-GRL by Ozonation

    Institute of Scientific and Technical Information of China (English)

    Wei Rong ZHAO; Xin Hua XU; Hui Xiang SHI; Da Hui WANG

    2003-01-01

    The degradation mechanism of Cationic Red X-GRL was investigated when the intermediates, the nitrate ion and the pH were analyzed in the ozonation. The degradation of the Cationic Red X-GRL includes the de-auxochrome stage, the decolour stage, and the decomposition of fragment stage. During the degradation process, among the six nitrogen atoms of Cationic Red X-GRL, one is transferred into a nitrate ion, one becomes the form of an amine compound, and the rest four are transformed into two molecules of nitrogen. In the course of the ozonation of Cationic Red X-GRL, the direct attack of ozone is the main decolour effect.

  14. Condensation of nonstochiometric DNA/polycation complexes by divalent cations.

    Science.gov (United States)

    Budker, Vladimir; Trubetskoy, Vladimir; Wolff, Jon A

    2006-12-15

    This study found that divalent cations induced the further condensation of partially condensed DNA within nonstochiometric polycation complexes. The addition of a few mmol of a divalent cation such as calcium reduced by half the inflection point at which DNA became fully condensed by poly-L-lysine (PLL) and a variety of other polycations. The effect on DNA condensation was initially observed using a new method, which is based on the concentration-dependent self-quenching of fluorescent moieties (e.g., rhodamine) covalently linked to the DNA backbone at relatively high densities. Additional analyses, which employed ultracentrifugation, dynamic light scattering, agarose gel electrophoresis, and atomic force microscopy, confirmed the effect of divalent cations. These results provide an additional accounting of the process by which divalent cations induce greater chromatin compaction that is based on the representation of chromatin fibers as a nonstoichiometric polyelectrolyte complex. They also offer a new approach to assemble nonviral vectors for gene therapy.

  15. Sulfometuron incorporation in cationic micelles adsorbed on montmorillonite

    OpenAIRE

    Mishael, Y. G.; Undabeytia López, Tomás; Rytwo, Giora; Papahadjopoulos Sternberg, B.; Rubin, Baruch; Nir, Shlomo

    2002-01-01

    The aim of this study was to understand the interactions between alkylammonium cations present as monomers and micelles and a clay mineral, montmorillonite, to develop slow release formulations of anionic herbicides, such as sulfometuron (SFM) whose leaching in soils is an environmental and economic problem. In the proposed formulation the herbicide is incorporated in positively charged micelles of quaternary amine cations, which in turn adsorb on the negatively charged clay. The adsorption o...

  16. Microscopic Theory of Cation Exchange in CdSe Nanocrystals

    OpenAIRE

    Ott, Florian D.; Spiegel, Leo L.; Norris, David J.; Erwin, Steven C.

    2014-01-01

    Although poorly understood, cation-exchange reactions are increasingly used to dope or transform colloidal semiconductor nanocrystals (quantum dots). We used density-functional theory and kinetic Monte Carlo simulations to develop a microscopic theory that explains structural, optical, and electronic changes observed experimentally in Ag-cation-exchanged CdSe nanocrystals. We find that Coulomb interactions, both between ionized impurities and with the polarized nanocrystal surface, play a key...

  17. Migration of Cations and Anions in Amorphous Polymer Electrolytes

    Institute of Scientific and Technical Information of China (English)

    N.A.Stolwijk; S.H.Obeidi; M.Wiencierz

    2007-01-01

    1 Results Polymer electrolytes are used as ion conductors in batteries and fuel cells.Simple systems consist of a polymer matrix complexing an inorganic salt and are fully amorphous at the temperatures of interest.Both cations and anions are mobile and contribute to charge transport.Most studies on polymer electrolytes use the electrical conductivity to characterize the ion mobility.However,conductivity measurements cannot discriminate between cations and anions.This paper reports some recent results fr...

  18. Mercury release from deforested soils triggered by base cation enrichment.

    Science.gov (United States)

    Farella, N; Lucotte, M; Davidson, R; Daigle, S

    2006-09-01

    The Brazilian Amazon has experienced considerable colonization in the last few decades. Family agriculture based on slash-and-burn enables millions of people to live in that region. However, the poor nutrient content of most Amazonian soils requires cation-rich ashes from the burning of the vegetation biomass for cultivation to be successful, which leads to forest ecosystem degradation, soil erosion and mercury contamination. While recent studies have suggested that mercury present in soils was transferred towards rivers upon deforestation, little is known about the dynamics between agricultural land-use and mercury leaching. In this context, the present study proposes an explanation that illustrates how agricultural land-use triggers mercury loss from soils. This explanation lies in the competition between base cations and mercury in soils which are characterized by a low adsorption capacity. Since these soils are naturally very poor in base cations, the burning of the forest biomass suddenly brings high quantities of base cations to soils, destabilizing the previous equilibrium amongst cations. Base cation enrichment triggers mobility in soil cations, rapidly dislocating mercury atoms. This conclusion comes from principal component analyses illustrating that agricultural land-use was associated with base cation enrichment and mercury depletion. The overall conclusions highlight a pernicious cycle: while soil nutrient enrichment actually occurs through biomass burning, although on a temporary basis, there is a loss in Hg content, which is leached to rivers, entering the aquatic chain, and posing a potential health threat to local populations. Data presented here reflects three decades of deforestation activities, but little is known about the long-term impact of such a disequilibrium. These findings may have repercussions on our understanding of the complex dynamics of deforestation and agriculture worldwide. PMID:16781764

  19. Modulatory role of bivalent cations on reward system.

    Science.gov (United States)

    Nechifor, M; Chelărescu, D

    2008-01-01

    Bivalent cations (Ca, Mg, Zn, Mn etc.) modulate activity of reward system (RS). At physiologic levels they may influence all components of RS. There are influenced behavioral reactions at physiological stimuli and all essential elements of drug dependence (compulsive intake of substance, craving, reinforcement, withdrawal syndrom, relapse and reinstatement of intake) The fact that some cations (e.g. calcium) enhance some of the aspects of drug dependence and others (e.g. magnesium, zinc) decrease intensity of this process show that ratio between intra- and extracellular in the brain of these cations is important for the function of RS. Among actions of different cations at the level of RS there are important differences. Their mecahanism of action are common in part and specific in other. It is important the fact that modulatory action appear at physiologic cation concentrations (that could be reached at therapeutic doses). Modulatory action is related to ratio between concetrations of different bivalent cations and is exerted both in normal or pathologic conditions.

  20. Synthesis and characterisation of cationically modified phospholipid polymers.

    Science.gov (United States)

    Lewis, Andrew L; Berwick, James; Davies, Martyn C; Roberts, Clive J; Wang, Jin-Hai; Small, Sharon; Dunn, Anthony; O'Byrne, Vincent; Redman, Richard P; Jones, Stephen A

    2004-07-01

    Phospholipid-like copolymers based on 2-(methacryloyloxyethyl) phosphorylcholine were synthesised using monomer-starved free radical polymerisation methods and incorporating cationic charge in the form of the choline methacrylate monomer in amounts varying from 0 to 30 wt%, together with a 5 wt% silyl cross-linking agent in order to render them water-insoluble once thermally cured. Characterisation using a variety of techniques including nuclear magnetic resonance spectroscopy, high-pressure liquid chromatography and gel permeation chromatography showed the cationic monomer did not interfere with the polymerisation and that the desired amount of charge had been incorporated. Gravimetric and differential scanning calorimetry methods were used to evaluate the water contents of polymer membranes cured at 70 degrees C, which was seen to increase with increasing cation content, producing materials with water contents ranging from 50% to 98%. Surface plasmon resonance indicated that the coatings swelled rapidly in water, the rate and extent of swelling increasing with increasing cation level. Dynamic contact angle showed that coatings of all the polymers possessed a hydrophobic surface when dry in air, characteristic of the alkyl chains expressed at the surface (>100 degrees advancing angle). Rearrangement of the hydrophilic groups to the surface occurred once wet, to produce highly wettable surfaces with a decrease in advancing angle with increasing cation content. Atomic force microscopy showed all polymer films to be smooth with no features in topographical or phase imaging. Mechanical properties of the dry films were also unaffected by the increase in cation content.

  1. Complexation Between Cationic Diblock Copolymers and Plasmid DNA

    Science.gov (United States)

    Jung, Seyoung; Reineke, Theresa; Lodge, Timothy

    Deoxyribonucleic acids (DNA), as polyanions, can spontaneously bind with polycations to form polyelectrolyte complexes. When the polycation is a diblock copolymer with one cationic block and one uncharged hydrophilic block, the polyelectrolyte complexes formed with plasmid DNA (pDNA) are often colloidally stable, and show great promise in the field of polymeric gene therapy. While the resulting properties (size, stability, and toxicity to biological systems) of the complexes have been studied for numerous cationic diblocks, the fundamentals of the pDNA-diblock binding process have not been extensively investigated. Herein, we report how the cationic block content of a diblock influences the pDNA-diblock interactions. pDNA with 7164 base pairs and poly(2-deoxy-2-methacrylamido glucopyranose)-block-poly(N-(2-aminoethyl) methacrylamide) (PMAG-b-PAEMA) are used as the model pDNA and cationic diblock, respectively. To vary the cationic block content, two PMAG-b-PAEMA copolymers with similar PMAG block lengths but distinct PAEMA block lengths and a PAEMA homopolymer are utilized. We show that the enthalpy change from pDNA-diblock interactions is dependent on the cationic diblock composition, and is closely associated with both the binding strength and the pDNA tertiary structure.

  2. Tunable states of interlayer cations in two-dimensional materials

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K.; Numata, K. [Department of Environmental Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Dai, W. [Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), College of Chemistry, Nankai University, Tianjin 300071 (China); Hunger, M. [Institute of Chemical Technology, University of Stuttgart, 70550 Stuttgart (Germany)

    2014-03-31

    The local state of cations inside the Ångstrom-scale interlayer spaces is one of the controlling factors for designing sophisticated two-dimensional (2D) materials consisting of 2D nanosheets. In the present work, the molecular mechanism on how the interlayer cation states are induced by the local structures of the 2D nanosheets is highlighted. For this purpose, the local states of Na cations in inorganic 2D materials, in which the compositional fluctuations of a few percent are introduced in the tetrahedral and octahedral units of the 2D nanosheets, were systematically studied by means of {sup 23}Na magic-angle-spinning (MAS) nuclear magnetic resonance (NMR) and {sup 23}Na multiple-quantum MAS (MQMAS) NMR spectroscopy. In contrast with an uniform distribution of Na cations expected so far, various well-defined cation states sensitive to the local structures of the 2D nanosheets were identified. The tunability of the interlayer cation states along with the local structure of the 2D nanosheets, as the smallest structural unit of the 2D material, is discussed.

  3. Novel Cationic Carotenoid Lipids as Delivery Vectors of Antisense Oligonucleotides for Exon Skipping in Duchenne Muscular Dystrophy

    Directory of Open Access Journals (Sweden)

    Vassilia Partali

    2012-01-01

    Full Text Available Duchenne Muscular Dystrophy (DMD is a common, inherited, incurable, fatal muscle wasting disease caused by deletions that disrupt the reading frame of the DMD gene such that no functional dystrophin protein is produced. Antisense oligonucleotide (AO-directed exon skipping restores the reading frame of the DMD gene, and truncated, yet functional dystrophin protein is expressed. The aim of this study was to assess the efficiency of two novel rigid, cationic carotenoid lipids, C30-20 and C20-20, in the delivery of a phosphorodiamidate morpholino (PMO AO, specifically designed for the targeted skipping of exon 45 of DMD mRNA in normal human skeletal muscle primary cells (hSkMCs. The cationic carotenoid lipid/PMO-AO lipoplexes yielded significant exon 45 skipping relative to a known commercial lipid, 1,2-dimyristoyl-sn-glycero-3-ethylphosphocholine (EPC.

  4. Effects of metal ion adduction on the gas-phase conformations of protein ions.

    Science.gov (United States)

    Flick, Tawnya G; Merenbloom, Samuel I; Williams, Evan R

    2013-11-01

    Changes in protein ion conformation as a result of nonspecific adduction of metal ions to the protein during electrospray ionization (ESI) from aqueous solutions were investigated using traveling wave ion mobility spectrometry (TWIMS). For all proteins examined, protein cations (and in most cases anions) with nonspecific metal ion adducts are more compact than the fully protonated (or deprotonated) ions with the same charge state. Compaction of protein cations upon nonspecific metal ion binding is most significant for intermediate charge state ions, and there is a greater reduction in collisional cross section with increasing number of metal ion adducts and increasing ion valency, consistent with an electrostatic interaction between the ions and the protein. Protein cations with the greatest number of adducted metal ions are no more compact than the lowest protonated ions formed from aqueous solutions. These results show that smaller collisional cross sections for metal-attached protein ions are not a good indicator of a specific metal-protein interaction in solution because nonspecific metal ion adduction also results in smaller gaseous protein cation cross sections. In contrast, the collisional cross section of α-lactalbumin, which specifically binds one Ca(2+), is larger for the holo-form compared with the apo-form, in agreement with solution-phase measurements. Because compaction of protein cations occurs when metal ion adduction is nonspecific, elongation of a protein cation may be a more reliable indicator that a specific metal ion-protein interaction occurs in solution.

  5. Accumulation of small protein molecules in a macroscopic complex coacervate

    NARCIS (Netherlands)

    Lindhoud, S.; Claessens, M.M.A.E.

    2016-01-01

    To obtain insight into the accumulation of proteins into macroscopic complex coacervate phases, the lysozyme concentration in complex coacervates containing the cationic polyelectrolyte poly-(N,N dimethylaminoethyl methacrylate) and the anionic polyelectrolyte polyacrylic acid was investigated as a

  6. Insulin receptor activation and down-regulation by cationic lipid transfection reagents

    Directory of Open Access Journals (Sweden)

    Renström Ing-Marie

    2004-01-01

    Full Text Available Abstract Background Transfection agents comprised of cationic lipid preparations are widely used to transfect cell lines in culture with specific recombinant complementary DNA molecules. We have found that cells in culture are often resistant to stimulation with insulin subsequent to treatment with transfection agents such as LipofectAMINE 2000™ and FuGENE-6™. This is seen with a variety of different readouts, including insulin receptor signalling, glucose uptake into muscle cells, phosphorylation of protein kinase B and reporter gene activity in a variety of different cell types Results We now show that this is due in part to the fact that cationic lipid agents activate the insulin receptor fully during typical transfection experiments, which is then down-regulated. In attempts to circumvent this problem, we investigated the effects of increasing concentrations of LipofectAMINE 2000™ on insulin receptor phosphorylation in Chinese hamster ovary cells expressing the human insulin receptor. In addition, the efficiency of transfection that is supported by the same concentrations of transfection reagent was studied by using a green fluorescent protein construct. Our data indicate that considerably lower concentrations of LipofectAMINE 2000™ can be used than are recommended by the manufacturers. This is without sacrificing transfection efficiency markedly and avoids the problem of reducing insulin receptor expression in the cells. Conclusion Widely-used cationic lipid transfection reagents cause a state of insulin unresponsiveness in cells in culture due to fully activating and subsequently reducing the expression of the receptor in cells. This phenomenon can be avoided by reducing the concentration of reagent used in the transfection process.

  7. 植物Cation/H+反向转运蛋白研究进展%Characteristics of Cation/H+ Antiporters in Plants

    Institute of Scientific and Technical Information of China (English)

    单喆; 张欣欣; 高野哲夫; 柳参奎

    2012-01-01

    CAX是一种通过质子梯度产生的能量运输协调再分配钙离子(Ca2+)等阳离子的转运蛋白,是Ca2+/Cation antiporter (CaCA)大家族的一个分化枝.植物CAXs属于CAX三大类的Ⅰ型CAX.大部分植物CAXs有11个跨膜区(TM)和5个典型的功能域,即N-端自抑制区域(NRR)、C-端功能区域、Ca2+功能域(CaD)、C功能域和D功能域.其中NRR存在于大部分CAX中,调节CAX的功能.以下综述了近年来国内外对CAX类蛋白的研究成果与进展,涉及到CAX家族的命名,亚家族的分类,CAX组织表达及亚细胞定位,特别是CAX的转运活性等研究.加强对CAX的研究对调节植物生长、提高农作物养分吸收和减轻土壤中污染物等有重要作用.%Cation/H+ antiporters (CAXs) are a group of proteins that efflux Ca2+ and other cations to maintain optimal ionic concentrations in cells, which are energized by the proton gradient. It is one of the five families that constitute the Ca2/cation antiporter (CaCA) superfamily. Plant CAXs is the type I of three major categories. Plant CAXs are characterized by 11 transmembrane (TM) domains and 5 regulatory domains-that is N-terminal autoinhi-bitory domains (NRR), C-terminal domains, Ca2+ domain (CaD), C domain and D domain, and NRR exists in most CAXs to regulate the function of CAX. In this paper, the research progress in the classification, location, structure and function of CAXs in plants is reviewed, especially in the transporter activity of CAXs. The studies of CAXs play an important role in regulating plant growth, increasing crop nutrient uptake and reducing pollutants in soil.

  8. Role of the plasma membrane transporter of organic cations OCT1 and its genetic variants in modern liver pharmacology.

    Science.gov (United States)

    Lozano, Elisa; Herraez, Elisa; Briz, Oscar; Robledo, Virginia S; Hernandez-Iglesias, Jorge; Gonzalez-Hernandez, Ana; Marin, Jose J G

    2013-01-01

    Changes in the uptake of many drugs by the target cells may dramatically affect the pharmacological response. Thus, downregulation of SLC22A1, which encodes the organic cation transporter type 1 (OCT1), may affect the response of healthy hepatocytes and liver cancer cells to cationic drugs, such as metformin and sorafenib, respectively. Moreover, the overall picture may be modified to a considerable extent by the preexistence or the appearance during the pathogenic process of genetic variants. Some rare OCT1 variants enhance transport activity, whereas other more frequent variants impair protein maturation, plasma membrane targeting or the function of this carrier, hence reducing intracellular active drug concentrations. Here, we review current knowledge of the role of OCT1 in modern liver pharmacology, which includes the use of cationic drugs to treat several diseases, some of them of great clinical relevance such as diabetes and primary liver cancer (cholangiocarcinoma and hepatocellular carcinoma). We conclude that modern pharmacology must consider the individual evaluation of OCT1 expression/function in the healthy liver and in the target tissue, particularly if this is a tumor, in order to predict the lack of response to cationic drugs and to be able to design individualized pharmacological treatments with the highest chances of success.

  9. Integrated and Ecological Crop Protection (I/ECP)

    NARCIS (Netherlands)

    Sukkel, W.; Garcia Diaz, A.

    2002-01-01

    Information on integrated/ecological crop protection, which is the prevention or minimisation of economical damage to crops caused by harmful species with a minimum of negative effects on the environment. The main elements of an integrated strategy are: Prevention; Establish need of treatment; Treat

  10. A covalent attraction between two molecular cation TTF·~+

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The optimized structure of the tetrathiafulvalence radical-cation dimer(TTF·+-TTF·+) with all-real frequencies is obtained at MP2/6-311G level,which exhibits the attraction between two molecular cation TTF·+.The new attraction interaction is a 20-center-2-electron intermolecular covalent π /π bonding with a telescope shape.The covalent π /π bonding has the bonding energy of about -21 kcal·mol-1 and is concealed by the Coulombic repulsion between two TTF·+ cations.This intermolecular covalent attraction also influences the structure of the TTF·+ subunit,i.e.,its molecular plane is bent by an angle θ=5.6°.This work provides new knowledge on intermolecular interaction.

  11. Cationic lipids delay the transfer of plasmid DNA to lysosomes.

    Science.gov (United States)

    Wattiaux, R; Jadot, M; Laurent, N; Dubois, F; Wattiaux-De Coninck, S

    1996-10-14

    Plasmid 35S DNA, naked or associated with different cationic lipid preparations was injected to rats. Subcellular distribution of radioactivity in the liver one hour after injection, was established by centrifugation methods. Results show that at that time, 35S DNA has reached lysosomes. On the contrary, when 35S DNA was complexed with lipids, radioactivity remains located in organelles whose distribution after differential and isopycnic centrifugation, is clearly distinct from that of arylsulfatase, lysosome marker enzyme. Injection of Triton WR 1339, a specific density perturbant of lysosomes, four days before 35S DNA injection causes a density decrease of radioactivity bearing structures, apparent one hour after naked 35S DNA injection but visible only after more than five hours, when 35S DNA associated with a cationic lipid is injected. These observations show that cationic lipids delay the transfer to lysosomes, of plasmid DNA taken up by the liver.

  12. Cationization of Alpha-Cellulose to Develop New Sustainable Products

    Directory of Open Access Journals (Sweden)

    Ana Moral

    2015-01-01

    Full Text Available Papermaking has been using high quantities of retention agents, mainly cationic substances and organic compounds such as polyamines. The addition of these agents is related to economic and environmental issues, increasing contamination of the effluents. The aim of this work is to develop a cationic polymer for papermaking purposes based on the utilization of alpha-cellulose. The cationization of mercerized alpha-cellulose with 3-chloro-2-hydroxypropyltrimethylammonium chloride (CHPTAC is governed by a pseudo-second-order reaction. The initial amorphous fraction of cellulose is reacted with CHPTAC until the equilibrium value of nitrogen substitution is reached. Nitrogen is incorporated as a quaternary ammonium group in the polymer. Also, the kinetic constant increased with decreasing crystallinity index, showing the importance of the previous alkalization stage. The use of modified natural polysaccharides is a sustainable alternative to synthetic, nonbiodegradable polyelectrolytes and thus is desirable with a view to developing new products and new processes.

  13. Theoretical Studies on the Interactions of Cations with Diazine

    Institute of Scientific and Technical Information of China (English)

    CHEN Xing; WU Wen-Peng; ZHANG Jing-Lai; CAO Ze-Xing

    2006-01-01

    Density functional theory and MP2 calculations have been used to determine the geometries, stabilities, binding energies, and dissociative properties of cation-diazine complexes Mn+-C4H4N2 (Mn+ = Li+, B+, Al+, Be2+, Mg2+, Ca2+). The calculated results indicate that most complexes are stable except the π complexes of Ca2+-pyridazine, Ca2+-pyrazine, Al+-pyrimidine and Al+-pyrimidine. The σ complexes are generally much more stable than their π counterparts. Among the π complexes, the cation-pyrazine π complexes have slightly higher stability. The nature of the ion-molecule interactions has been discussed by the natural bond orbital analysis and frontier molecular orbital interactions. In these σ complexes, there is stronger covalent interaction between B+ and diazine. In the selected π complexes, B+ and Be2+ have stronger covalent interaction with diazine, while the other cations mainly have electrostatic interaction with diazine.

  14. Surface hopping investigation of the relaxation dynamics in radical cations

    Energy Technology Data Exchange (ETDEWEB)

    Assmann, Mariana; Matsika, Spiridoula, E-mail: smatsika@temple.edu [Department of Chemistry, Temple University, Philadelphia, Pennsylvania 19122 (United States); Weinacht, Thomas [Department of Physics, Stony Brook University, Stony Brook, New York 11794 (United States)

    2016-01-21

    Ionization processes can lead to the formation of radical cations with population in several ionic states. In this study, we examine the dynamics of three radical cations starting from an excited ionic state using trajectory surface hopping dynamics in combination with multiconfigurational electronic structure methods. The efficiency of relaxation to the ground state is examined in an effort to understand better whether fragmentation of cations is likely to occur directly on excited states or after relaxation to the ground state. The results on cyclohexadiene, hexatriene, and uracil indicate that relaxation to the ground ionic state is very fast in these systems, while fragmentation before relaxation is rare. Ultrafast relaxation is facilitated by the close proximity of electronic states and the presence of two- and three-state conical intersections. Examining the properties of the systems in the Franck-Condon region can give some insight into the subsequent dynamics.

  15. A covalent attraction between two molecular cation TTF·~+

    Institute of Scientific and Technical Information of China (English)

    WANG FangFang; WANG Yi; WANG BingQiang; WANG YinFeng; MA Fang; Li ZhiRu

    2009-01-01

    The optimized structure of the tetrathiafulvalence radical-cation dimer (TTF·~+-TTF·~+) with all-real frequencies is obtained at MP2/6-311G level,which exhibits the attraction between two molecular cation TTF·~+.The new attraction interaction is a 20-center-2-electron intermolecular covalent π/π bonding with a telescope shape.The covalent π/π bonding has the bonding energy of about-21 kcal·mol~(-1) and is concealed by the Coulombic repulsion between two TTF·~+ cations.This intermolecular covalent attraction also influences the structure of the TTF·~+ subunit,I.e.,its molecular plane is bent by an angle θ=5.6°.This work provides new knowledge on intermolecular interaction.

  16. Low-Temperature Cationic Rearrangement in a Bulk Metal Oxide.

    Science.gov (United States)

    Li, Man-Rong; Retuerto, Maria; Stephens, Peter W; Croft, Mark; Sheptyakov, Denis; Pomjakushin, Vladimir; Deng, Zheng; Akamatsu, Hirofumi; Gopalan, Venkatraman; Sánchez-Benítez, Javier; Saouma, Felix O; Jang, Joon I; Walker, David; Greenblatt, Martha

    2016-08-16

    Cationic rearrangement is a compelling strategy for producing desirable physical properties by atomic-scale manipulation. However, activating ionic diffusion typically requires high temperature, and in some cases also high pressure in bulk oxide materials. Herein, we present the cationic rearrangement in bulk Mn2 FeMoO6 at unparalleled low temperatures of 150-300 (o) C. The irreversible ionic motion at ambient pressure, as evidenced by real-time powder synchrotron X-ray and neutron diffraction, and second harmonic generation, leads to a transition from a Ni3 TeO6 -type to an ordered-ilmenite structure, and dramatic changes of the electrical and magnetic properties. This work demonstrates a remarkable cationic rearrangement, with corresponding large changes in the physical properties in a bulk oxide at unprecedented low temperatures. PMID:27203790

  17. 522 Association between Eosinophilic Airway Inflammation and Persistent Airflow Limitation in Asthmatic Children

    OpenAIRE

    Lee, Yong Ju; Lee, Hyun Hee; Kim, Kyung Won; Sohn, Myung Hyun; Kim, Kyu-Earn

    2012-01-01

    Background Eosinophilic airway inflammation contributes to persistent airflow limitation in adults with severe asthma. We aimed to evaluate the association between eosinophilic inflammation in induced sputum and pulmonary function, and persistent airflow limitation in children. Methods A total of 92 asthmatic children and 72 control children were enrolled in this study. Eosinophil count (%) and eosinophil cationic protein (ECP) levels were measured in induced sputum. We performed spirometry a...

  18. Eosinophilic activation in cystic fibrosis.

    OpenAIRE

    Koller, D. Y.; Götz, M.; Eichler, I; Urbanek, R

    1994-01-01

    BACKGROUND--The neutrophil is a potent contributor to pulmonary destruction in cystic fibrosis. Since eosinophils also possess destructive potential the involvement of eosinophils in cystic fibrosis has been investigated. METHODS--Eosinophil numbers and levels of eosinophil cationic protein (ECP), a marker of eosinophil activation, were determined in the serum of 42 patients with cystic fibrosis and in the sputum of 10 of them. To determine neutrophil activation levels of myeloperoxidase (MPO...

  19. Modeling cation exchange using EQ3/6

    International Nuclear Information System (INIS)

    Geochemical modeling codes must be able to predict solid-solution and ion-exchange behavior of zeolites and smectites in order to design and assess strategies for containing and cleaning up toxic and/or radioactive wastes. Cation-exchange and solid-solution models have been implemented in the EQ3/6 geochemical modeling package and used to predict the composition of clinoptilolite under a variety of conditions. Published free energies of cation exchange on clinoptilolite at 25 degrees C were combined with the calorimetric data for clinoptilolite to derive free energies of formation of the component end members of a solid solution in which mixing is allowed only on the exchange site. The solid-solution model and component end-member data were incorporated into EQ3/6 and its data base. An option to treat cation exchange independently of the solid-solution model was also developed and implemented in EQ3/6. This option allows the user to model mixed-phase exchangers, multisite exchangers, and systems in which the exchanger is not in overall equilibrium with the solution. Two open-quotes idealclose quotes cation-exchange conventions [Vanselow (mole fraction) and Gapon (equivalent fraction)] are currently implemented in the code. A description of the cation-exchange models and their implementation into EQ3/6 is presented, and the relationship between the exchange formalisms and the solid-solution models is discussed. The advantages and limitations of the models and currently available thermodynamic data are addressed by comparing cation-exchange compositions of clinoptilolites with (1) published binary exchange data; (2) compositions of coexisting clinoptilolites and formation waters at Yucca Mountain; and (3) experimental sorption isotherms of Cs and Sr on zeolitized tuff

  20. THE APPLICATION OF CATIONIC POLYACRYLAMIDE AS DRAINAGE AND RETENTION AIDS

    Institute of Scientific and Technical Information of China (English)

    Jin Wang; Kefu Chen; Fushan Chen; Chuanshan Zhao; Rendang Yang

    2004-01-01

    Cationic polyacrylamide (CPAM) which was prepared through complex initiation system in laboratory and cationic polyacrylamide (Ciba) were used as retention and drainage aids for bleached wheat straw pulp. The influences of (polydiallyldimethlammonium chloride) PDADMAC and PDADMAC/CPAM on Zeta potential and drainability of pulp was investigated. The dual drainage and retention systems such as CPAM/modified bentonite, CPAM/colloidal SiO2,as well as their comparison between the two systems were discussed, and the optimal dosages of additives were determined. The results showed that: the complex systems can further enhance filler retention,drainability of pulp and strength properties of paper.

  1. Cationically polymerizable monomers derived from renewable sources. Annual performance report

    Energy Technology Data Exchange (ETDEWEB)

    Crivello, J.V.

    1992-10-01

    The objectives of this project are to design and synthesize novel monomers which orginate from renewable biological sources and to carry out their rapid, efficient, pollution-free and energy efficient cationic polymerization to useful products under the influence of ultraviolet light or heat. A summary of the results of the past year`s research on cationically polymerizable monomers derived from renewable sources is presented. Three major areas of investigation corresponding to the different classes of naturally occurring starting materials were investigated; epoxidized terpenes and natural rubber and vinyl ethers from alcohols and carbohydrates.

  2. Radiation-induced cationic curing of vinyl ethers

    International Nuclear Information System (INIS)

    Recently there has been an increasing interest in nonacrylate radiation-curable coatings. Vinyl ethers are particularly reactive under cationic polymerization reaction conditions. The high efficiency of the photoacid initiators combined with the high reactivity of vinyl ether monomers makes this a potentially very useful system. This chapter discusses the preparation of vinyl ethers, introduces vinyl ether-functional monomers and oligomers, describes radiation-induced cationic polymerization of vinyl ethers, and discusses various coating systems. Throughout the chapter, an emphasis is placed on radiation-curable coating applications. 64 refs., 5 figs., 11 tabs

  3. Cationic Polybutyl Cyanoacrylate Nanoparticles for DNA Delivery

    Directory of Open Access Journals (Sweden)

    Jinghua Duan

    2009-01-01

    Full Text Available To enhance the intracellular delivery potential of plasmid DNA using nonviral vectors, we used polybutyl cyanoacrylate (PBCA and chitosan to prepare PBCA nanoparticles (NPs by emulsion polymerization and prepared NP/DNA complexes through the complex coacervation of nanoparticles with the DNA. The object of our work is to evaluate the characterization and transfection efficiency of PBCA-NPs. The NPs have a zeta potential of 25.53 mV at pH 7.4 and size about 200 nm. Electrophoretic analysis suggested that the NPs with positive charges could protect the DNA from nuclease degradation and cell viability assay showed that the NPs exhibit a low cytotoxicity to human hepatocellular carcinoma (HepG2 cells. Qualitative and quantitative analysis of transfection in HepG2 cells by the nanoparticles carrying plasmid DNA encoding for enhanced green fluorescent protein (EGFP-N1 was done by digital fluorescence imaging microscopy system and fluorescence-activated cell sorting (FACS. Qualitative results showed highly efficient expression of GFP that remained stable for up to 96 hours. Quantitative results from FACS showed that PBCA-NPs were significantly more effective in transfecting HepG2 cells after 72 hours postincubation. The results of this study suggested that PBCA-NPs have favorable properties for nonviral delivery.

  4. NMR Structure and CD Titration with Metal Cations of Human Prion α2-Helix-Related Peptides

    Directory of Open Access Journals (Sweden)

    Luisa Ronga

    2007-01-01

    Full Text Available The 173–195 segment corresponding to the helix 2 of the C-globular prion protein domain could be one of several “spots” of intrinsic conformational flexibility. In fact, it possesses chameleon conformational behaviour and gathers several disease-associated point mutations. We have performed spectroscopic studies on the wild-type fragment 173–195 and on its D178N mutant dissolved in trifluoroethanol to mimic the in vivo system, both in the presence and in the absence of metal cations. NMR data showed that the structure of the D178N mutant is characterized by two short helices separated by a kink, whereas the wild-type peptide is fully helical. Both peptides retained these structural organizations, as monitored by CD, in the presence of metal cations. NMR spectra were however not in favour of the formation of definite ion-peptide complexes. This agrees with previous evidence that other regions of the prion protein are likely the natural target of metal cation binding.

  5. SINK OR SWIM? DEBT REVIEW'S AMBIVALENT "LIFELINE" ---- A SECOND SEQUEL TO "… A TALE OF TWO JUDGMENTS" NEDBANK V ANDREWS (240/2011 2011 ZAECPEHC 29 (10 May 2011; FIRSTRAND BANK LTD V EVANS 2011 4 SA 597 (KZD AND FIRSTRAND BANK LTD V JANSE VAN RENSBURG 2012 2 All SA 186 (ECP

    Directory of Open Access Journals (Sweden)

    L Steyn

    2012-11-01

    Full Text Available The interface between the National Credit Act 34 of 2005 and the Insolvency Act 24 of 1936 has been the object of our courts' attention in a number of recent cases including Ex parte Ford and Two Similar Cases 2009 3 SA 376 (WCC, Investec Bank Ltd v Mutemeri 2010 1 SA 265 (GSJ, Naidoo v ABSA Bank Ltd 2010 4 SA 597 (SCA and, more recently, Nedbank v Andrews (240/2011 2011 ZAECPEHC 29 (10 May 2011, FirstRand Bank Ltd v Evans 2011 4 597 (KZD and FirstRand Bank Ltd v Janse van Rensburg 2012 2 All SA 186 (ECP. The question raised in all of the three most recent cases was whether or not a debtor's application for debt review in terms of the National Credit Act constitutes an "act of insolvency" in terms of section 8 of the Insolvency Act, upon which a creditor may rely in an application for the compulsory sequestration of the debtor's estate. If it does, it would mean that by resorting to the debt relief measures provided by the National Credit Act a debtor commits the very act on which a creditor may base an application for a sequestration order which, if granted, will render the debtor's estate insolvent and bring about the liquidation of his assets. From the debtor's perspective, this is probably precisely the situation that he seeks to avert by applying for debt review. Further, sequestration would frustrate the stated purpose of the National Credit Act, which is that debtors should take responsibility for their debts by satisfying them in full. Concurrent creditors might also ultimately receive a dividend which falls far short of what is due to them. The question of whether a debtor's resorting to debt review may or should be the very act that triggers his estate's sequestration and its attendant consequences is an important issue, the treatment of which impacts significantly on the efficacy of the South African consumer debt relief system. This article analyses the most recent judgments and considers whether or not statutory regulation of the

  6. Cation trapping by cellular acidic compartments: Beyond the concept of lysosomotropic drugs

    Energy Technology Data Exchange (ETDEWEB)

    Marceau, François, E-mail: francois.marceau@crchul.ulaval.ca [Centre de recherche en rhumatologie et immunologie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1V 4G2 (Canada); Bawolak, Marie-Thérèse [Centre de recherche en rhumatologie et immunologie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1V 4G2 (Canada); Lodge, Robert [Centre de recherche en infectiologie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1V 4G2 (Canada); Bouthillier, Johanne; Gagné-Henley, Angélique [Centre de recherche en rhumatologie et immunologie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1V 4G2 (Canada); Gaudreault, René C. [Unité des Biotechnologies et de Bioingénierie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1L 3L5 (Canada); Morissette, Guillaume [Centre de recherche en rhumatologie et immunologie, Centre Hospitalier Universitaire de Québec, Québec QC, Canada G1V 4G2 (Canada)

    2012-02-15

    “Lysosomotropic” cationic drugs are known to concentrate in acidic cell compartments due to low retro-diffusion of the protonated molecule (ion trapping); they draw water by an osmotic mechanism, leading to a vacuolar response. Several aspects of this phenomenon were recently reexamined. (1) The proton pump vacuolar (V)-ATPase is the driving force of cationic drug uptake and ensuing vacuolization. In quantitative transport experiments, V-ATPase inhibitors, such as bafilomycin A1, greatly reduced the uptake of cationic drugs and released them in preloaded cells. (2) Pigmented or fluorescent amines are effectively present in a concentrated form in the large vacuoles. (3) Consistent with V-ATPase expression in trans-Golgi, lysosomes and endosomes, a fraction of the vacuoles is consistently labeled with trans-Golgi markers and protein secretion and endocytosis are often inhibited in vacuolar cells. (4) Macroautophagic signaling (accumulation of lipidated and membrane-bound LC3 II) and labeling of the large vacuoles by the autophagy effector LC3 were consistently observed in cells, precisely at incubation periods and amine concentrations that cause vacuolization. Vacuoles also exhibit late endosome/lysosome markers, because they may originate from such organelles or because macroautophagosomes fuse with lysosomes. Autophagosome persistence is likely due to the lack of resolution of autophagy, rather than to nutritional deprivation. (5) Increased lipophilicity decreases the threshold concentration for the vacuolar and autophagic cytopathology, because simple diffusion into cells is limiting. (6) A still unexplained mitotic arrest is consistently observed in cells loaded with amines. An extended recognition of relevant clinical situations is proposed for local or systemic drug administration.

  7. Preparation of Functional Soybean Protein Isolate

    Institute of Scientific and Technical Information of China (English)

    Liu Zhitong; Li Xiaolian; Zhao Guangming

    2000-01-01

    Soybean protein isolate(SPI)is a high purity soybean protein product. Its protein content is over 90% .A popular processing method is alkali dissolution and acid precipitation. This method can produce various functional SPIs by changing the temperature, pH, types of alkali and acid, and by different pretreatment and post transformation treatment. The properties addressed in this paper would open a big market for the appli cation of SPI.

  8. Preparation of Functional Soybean Protein Isolate

    Institute of Scientific and Technical Information of China (English)

    Liuzhitong; LiXiaolian; 等

    2000-01-01

    Soybean protein isolate(SPI) is a high purity soybean protein product.Its protein content is over 90%.A popular processing method is alkali dissolution and acid precipitation.This method can produce various functional SPIs by changing the temperature,pH,types of alkali and acid,and by different pretreatment and post transformation treatment.The properties addressed in this paper would open a big market for the appli cation of SPI.

  9. Crystal structure of channelrhodopsin, a light-gated cation channel – all cations lead through the monomer –

    OpenAIRE

    Kato, Hideaki E.; Nureki, Osamu

    2013-01-01

    Channelrhodopsin (ChR) is a light-gated cation channel derived from green algae. Since the inward flow of cations triggers the neuron firing, neurons expressing ChRs can be optically controlled even within freely moving mammals. Although ChR has been broadly applied to neuro-science research, little is known about its molecular mechanisms. We determined the crystal structure of chimeric ChR at 2.3 Å resolution and revealed its molecular architecture. The integration of structural, electrophys...

  10. Planar Homotropenylium Cation : A Transition State with Reversed Aromaticity

    NARCIS (Netherlands)

    Gibson, Christopher M.; Havenith, Remco W. A.; Fowler, Patrick W.; Jenneskens, Leonardus W.

    2015-01-01

    In contrast to the equilibrium structure of the homoaromatic C-s homotropenylium cation, C8H9+ (1), which supports a pinched diatropic ring current, the C(2)v transition state (2) for inversion of the methylene bridge of 1 is antiaromatic and supports a two-lobe paratropic pi current, as detected by

  11. Inward Cationic Diffusion and Percolation Transition in Glass-Ceramics

    DEFF Research Database (Denmark)

    Smedsklaer, Morten Mattrup; Yue, Yuanzheng; Mørup, Steen

    2010-01-01

    We show the quantitative correlation between the degree of crystallization and the cationic diffusion extent in iron-containing diopside glass–ceramics at the glass transition temperature. We find a critical degree of crystallization, above which the diffusion extent sharply drops with the degree...

  12. Cationic zinc enolates as highly active catalysts for acrylate polymerization.

    Science.gov (United States)

    Garner, Logan E; Zhu, Hongping; Hlavinka, Mark L; Hagadorn, John R; Chen, Eugene Y-X

    2006-11-22

    Unprecedented cationic zinc enolates have been generated by a novel activation route involving the amido to imino ligand transformation with B(C6F5)3, structurally characterized, and utilized as highly active catalysts for the production of high molecular weight polyacrylates at ambient temperature. PMID:17105289

  13. Cationic amphiphilic non-hemolytic polyacrylates with superior antibacterial activity.

    Science.gov (United States)

    Punia, Ashish; He, Edward; Lee, Kevin; Banerjee, Probal; Yang, Nan-Loh

    2014-07-01

    Acrylic copolymers with appropriate compositions of counits having cationic charge with 2-carbon and 6-carbon spacer arms can show superior antibacterial activities with concomitant very low hemolytic effect. These amphiphilic copolymers represent one of the most promising synthetic polymer antibacterial systems reported. PMID:24854366

  14. Biosorption of radiocesium by deinococcus radiodurans influenced by cations

    International Nuclear Information System (INIS)

    Deinococcus radiodurans has a strong ability to withstand high doses of radiation, which makes it as an ideal candidate for bioremediation of sites contaminated with radionuclides and toxic chemicals. However, no data is available on whether D. radiodurans has a specific sorption capacity to radiocesium for bioremediation purpose. The radiocesium biosorption capacity of live cells of D. radiodurans in the presence of other interfering cations was investigated. The maximum biosorption capacity of radiocesium by D. radiodurans in equilibrium state was about 2,100 kBq/kg (fresh weight basis). Among the tested monovalent cations, NH4+ had the strongest antagonism on 134Cs biosorption for D. radiodurans. However, this antagonism could only be observed at a concentration as high as 100 mmol/L. Divalent cations, such as Ca2+ and Pb2+ could reduced the biosorption of radiocesium by D. radiodurans. Al3+ and Cr3+ were cytotoxic to D. radiodurans cells, the growth of D. radiodurans cells was inhibited when the concentrations of these cations were greater than 1 mmol/L. (authors)

  15. Cation Hydration Constants by Proton NMR: A Physical Chemistry Experiment.

    Science.gov (United States)

    Smith, Robert L.; And Others

    1988-01-01

    Studies the polarization effect on water by cations and anions. Describes an experiment to illustrate the polarization effect of sodium, lithium, calcium, and strontium ions on the water molecule in the hydration spheres of the ions. Analysis is performed by proton NMR. (MVL)

  16. Versatile cation transport in imidazolium based polymerized ionic liquids

    Science.gov (United States)

    Evans, Christopher; Segalman, Rachel

    Polymerized ionic liquids (PIL) with tethered imidazolium groups are able to conduct a diverse array of cations relevant for energy applications. The well-known complexation of imidazolium with transition metals is exploited to bind ions such as H +, Li+, Cu2+, and Ni2+ by doping the neutral PIL with the appropriate Cation-TFSI- salt. Conductivities were first determined via AC impedance indicating that H+ salts lead to the highest conductivity (due to low ion mass and potential Grotthus mechanism) followed by Cu2+, Li+, Ag+, and Ni2+. The equilibrium constant for imidazolium complexation is larger for Cu2+ relative to Li-, Ag-, and Ni-imidazolium complexes leading to greater salt dissociation and higher conductivities. For LiTFSI and CuTFSI2 salts, metallic lithium or copper electrodes were employed in battery cells to pass a steady DC current and confirm that the cations are in fact carrying current. Interestingly, the divalent Cu2+ also ionically crosslinks the polymer leading to a plateau in the viscosity. Thus, divalent ions provide an unique route to high conductivity, high modulus polymeric electrolytes. Future studies involving ZnTFSI2 and MgTFSI2 for battery applications are proposed to examine how versatile the PIL platform is for cation transport.

  17. Metal Cations in G-Quadruplex Folding and Stability

    Science.gov (United States)

    Bhattacharyya, Debmalya; Mirihana Arachchilage, Gayan; Basu, Soumitra

    2016-09-01

    This review is focused on the structural and physico-chemical aspects of metal cation coordination to G-Quadruplexes (GQ) and their effects on GQ stability and conformation. G-Quadruplex structures are non-canonical secondary structures formed by both DNA and RNA. G-quadruplexes regulate a wide range of important biochemical processes. Besides the sequence requirements, the coordination of monovalent cations in the GQ is essential for its formation and determines the stability and polymorphism of GQ structures. The nature, location and dynamics of the cation coordination and their impact on the overall GQ stability are dependent on several factors such as the ionic radii, hydration energy and the bonding strength to the O6 of guanines. The intracellular monovalent cation concentration and the localized ion concentrations determine the formation of GQs and can potentially dictate their regulatory roles. A wide range of biochemical and biophysical studies on an array of GQ enabling sequences have generated at a minimum the knowledge base that allows us to often predict the stability of GQs in presence of the physiologically relevant metal ions, however, prediction of conformation of such GQs is still out of the realm.

  18. Structure and Reactivity of the Cysteine Methyl Ester Radical Cation

    NARCIS (Netherlands)

    Osburn, S.; Steill, J. D.; Oomens, J.; O' Hair, R. A. J.; Van Stipdonk, M.; Ryzhov, V.

    2011-01-01

    The structure and reactivity of the cysteine methyl ester radical cation, CysOMe(center dot+), have been examined in the gas phase using a combination of experiment and density functional theory (DFT) calculations. CysOMe(center dot+) undergoes rapid ion molecule reactions with dimethyl disulfide, a

  19. Cationic Organic/Inorganic Hybrids and Their Swelling Properties

    Institute of Scientific and Technical Information of China (English)

    E. S. Dragan; L. Ghimici; M. Cazacu

    2005-01-01

    @@ 1Introduction Specific properties of poly(dimethylsiloxanes), such as low glass transition temperature, low surface energy, good insulating properties, biological and chemical inertness, high diffusion coefficient of gases, make them very attractive for practical applications in the daily life. However, there is a great interest last time in the preparation of ionic organic/inorganic materials with new properties for new applications. Quaternary ammonium salt(QAS) groups included in siloxane copolymers could induce new interesting properties such as:permanent fungicidal and bactericidal properties, which make them very attractive as materials for sanitary applications, improved selectivity coefficients of the gas-separation membranes, ion-exchange properties and so forth. So far, QAS groups have been located in the side chain[1,2]. Our interest was focused on the preparation of some novel cationic polysiloxane copolymers containing QAS groups of both integral type and pendent type[3,4]. Our objectives for the present study concern the synthesis of some cationic organic/siloxane hybrid materials with swelling properties controlled by both the nature of cationic organic component and the ratio between the organic and inorganic counterparts. Such cationic hybrid materials could be of interest for the preparation of new stimuli-responsive hydrogels[5,6].

  20. Cation exchange interaction between antibiotic ciprofloxacin and montmorillonite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chih-Jen [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Department of Geosciences, National Taiwan University, Taipei 10617, Taiwan (China); Li, Zhaohui, E-mail: li@uwp.edu [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Department of Geosciences, University of Wisconsin - Parkside, Kenosha, WI 53144 (United States); Jiang, Wei-Teh, E-mail: atwtj@mail.ncku.edu.tw [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China); Jean, Jiin-Shuh; Liu, Chia-Chuan [Department of Earth Sciences, National Cheng Kung University, 1 University Road, Tainan 70101, Taiwan (China)

    2010-11-15

    Exploring the interactions between antibiotics and soils/minerals is of great importance in resolving their fate, transport, and elimination in the environment due to their frequent detection in wastewater, river water, sewage sludge and soils. This study focused on determining the adsorption properties and mechanisms of interaction between antibiotic ciprofloxacin and montmorillonite (SAz-1), a swelling dioctahedral mineral with Ca{sup 2+} as the main interlayer cation. In acidic and neutral aqueous solutions, a stoichiometric exchange between ciprofloxacin and interlayer cations yielded an adsorption capacity as high as 330 mg/g, corresponding to 1.0 mmol/g. When solution pH was above its pK{sub a2} (8.7), adsorption of ciprofloxacin was greatly reduced due to the net repulsion between the negatively charged clay surfaces and the ciprofloxacin anion. The uptake of ciprofloxacin expanded the basal spacing (d{sub 001}) of montmorillonite from 15.04 to 17.23 A near its adsorption capacity, confirming cation exchange within the interlayers in addition to surface adsorption. Fourier transform infrared results further suggested that the protonated amine group of ciprofloxacin in its cationic form was electrostatically attracted to negatively charged sites of clay surfaces, and that the carboxylic acid group was hydrogen bonded to the basal oxygen atoms of the silicate layers. The results indicate that montmorillonite is an effective sorbent to remove ciprofloxacin from water.

  1. Cation exchange interaction between antibiotic ciprofloxacin and montmorillonite

    International Nuclear Information System (INIS)

    Exploring the interactions between antibiotics and soils/minerals is of great importance in resolving their fate, transport, and elimination in the environment due to their frequent detection in wastewater, river water, sewage sludge and soils. This study focused on determining the adsorption properties and mechanisms of interaction between antibiotic ciprofloxacin and montmorillonite (SAz-1), a swelling dioctahedral mineral with Ca2+ as the main interlayer cation. In acidic and neutral aqueous solutions, a stoichiometric exchange between ciprofloxacin and interlayer cations yielded an adsorption capacity as high as 330 mg/g, corresponding to 1.0 mmol/g. When solution pH was above its pKa2 (8.7), adsorption of ciprofloxacin was greatly reduced due to the net repulsion between the negatively charged clay surfaces and the ciprofloxacin anion. The uptake of ciprofloxacin expanded the basal spacing (d001) of montmorillonite from 15.04 to 17.23 A near its adsorption capacity, confirming cation exchange within the interlayers in addition to surface adsorption. Fourier transform infrared results further suggested that the protonated amine group of ciprofloxacin in its cationic form was electrostatically attracted to negatively charged sites of clay surfaces, and that the carboxylic acid group was hydrogen bonded to the basal oxygen atoms of the silicate layers. The results indicate that montmorillonite is an effective sorbent to remove ciprofloxacin from water.

  2. Fusion Pore Diameter Regulation by Cations Modulating Local Membrane Anisotropy

    Directory of Open Access Journals (Sweden)

    Doron Kabaso

    2012-01-01

    Full Text Available The fusion pore is an aqueous channel that is formed upon the fusion of the vesicle membrane with the plasma membrane. Once the pore is open, it may close again (transient fusion or widen completely (full fusion to permit vesicle cargo discharge. While repetitive transient fusion pore openings of the vesicle with the plasma membrane have been observed in the absence of stimulation, their frequency can be further increased using a cAMP-increasing agent that drives the opening of nonspecific cation channels. Our model hypothesis is that the openings and closings of the fusion pore are driven by changes in the local concentration of cations in the connected vesicle. The proposed mechanism of fusion pore dynamics is considered as follows: when the fusion pore is closed or is extremely narrow, the accumulation of cations in the vesicle (increased cation concentration likely leads to lipid demixing at the fusion pore. This process may affect local membrane anisotropy, which reduces the spontaneous curvature and thus leads to the opening of the fusion pore. Based on the theory of membrane elasticity, we used a continuum model to explain the rhythmic opening and closing of the fusion pore.

  3. Two different cationic positions in Cu-SSZ-13?

    Energy Technology Data Exchange (ETDEWEB)

    Kwak, Ja Hun; Zhu, Haiyang; Lee, Jong H.; Peden, Charles HF; Szanyi, Janos

    2012-04-18

    H2-TPR and FTIR were used to characterize the Cu ions present in Cu-SSZ-13 zeolite at different ion exchange levels. The results obtained are consistent with the presence of Cu ions in two distinct cationic positions of the SSZ-13 framework.

  4. Two different cationic positions in Cu-SSZ-13?

    Science.gov (United States)

    Hun Kwak, Ja; Zhu, Haiyang; Lee, Jong H; Peden, Charles H F; Szanyi, János

    2012-05-16

    H(2)-TPR and FTIR were used to characterize the nature of the Cu ions present in the Cu-SSZ-13 zeolite at different ion exchange levels. The results obtained are consistent with the presence of Cu ions at two distinct cationic positions in the SSZ-13 framework. PMID:22473309

  5. Metal Cations in G-Quadruplex Folding and Stability

    Science.gov (United States)

    Bhattacharyya, Debmalya; Mirihana Arachchilage, Gayan; Basu, Soumitra

    2016-01-01

    This review is focused on the structural and physicochemical aspects of metal cation coordination to G-Quadruplexes (GQ) and their effects on GQ stability and conformation. G-quadruplex structures are non-canonical secondary structures formed by both DNA and RNA. G-quadruplexes regulate a wide range of important biochemical processes. Besides the sequence requirements, the coordination of monovalent cations in the GQ is essential for its formation and determines the stability and polymorphism of GQ structures. The nature, location, and dynamics of the cation coordination and their impact on the overall GQ stability are dependent on several factors such as the ionic radii, hydration energy, and the bonding strength to the O6 of guanines. The intracellular monovalent cation concentration and the localized ion concentrations determine the formation of GQs and can potentially dictate their regulatory roles. A wide range of biochemical and biophysical studies on an array of GQ enabling sequences have generated at a minimum the knowledge base that allows us to often predict the stability of GQs in the presence of the physiologically relevant metal ions, however, prediction of conformation of such GQs is still out of the realm. PMID:27668212

  6. Copper cation removal in an electrokinetic cell containing zeolite.

    Science.gov (United States)

    Elsayed-Ali, Omar H; Abdel-Fattah, Tarek; Elsayed-Ali, Hani E

    2011-01-30

    Zeolites are used in environmental remediation of soil or water to immobilize or remove toxic materials by cation exchange. An experiment was conducted to test the use a low electric field to direct the toxic cations towards the zeolite. An electrokinetic cell was constructed using carbon electrodes. Synthetic Linde Type A (LTA) zeolite was placed in the cell. Copper(II) chloride dissolved in water was used as a contaminant. The Cu(2+) concentration was measured for ten hours with and without an applied electric field. The removal of the Cu(2+) ions was accelerated by the applied field in the first two hours. For longer time, the electric field did not improve the removal rate of the Cu(2+) ions. The presence of zeolite and applied electric field complicates the chemistry near the cathode and causes precipitation of Cu(2+) ions as copper oxide on the surface of the zeolite. With increased electric field the zeolite farther away from the cathode had little cation exchange due to the higher drift velocity of the Cu(2+) ions. The results also show that, in the LTA Zeolite A pellets, the cation exchange of Cu is limited to a shell of several tens of micrometers. PMID:21109348

  7. Peak metamorphic temperatures from cation diffusion zoning in garnet

    DEFF Research Database (Denmark)

    Smit, Matthijs Arjen; Scherer, Erik; Mezger, Klaus

    2013-01-01

    A model that relates the characteristic diffusion length and average cooling rate to peak temperature was developed for chemical diffusion in spherical geometries on the basis of geospeedometry principles and diffusion theory. The model is quantitatively evaluated for cation diffusion profiles in...

  8. Gene delivery by cationic lipid vectors : overcoming cellular barriers

    NARCIS (Netherlands)

    Zuhorn, Inge S; Engberts, Jan B F N; Hoekstra, Dirk

    2007-01-01

    Non-viral vectors such as cationic lipids are capable of delivering nucleic acids, including genes, siRNA or antisense RNA into cells, thus potentially resulting in their functional expression. These vectors are considered as an attractive alternative for virus-based delivery systems, which may suff

  9. Cr/nanodiamond composite plating with cobalt cation additive

    Institute of Scientific and Technical Information of China (English)

    Viet-Hue NGUYEN; Thi-Nam HOANG; Ngoc-Phong NGUYEN; Sik-Chol KWON; Man KIM; Joo-Yul LEE

    2009-01-01

    The effect of cationic additive on Cr/nanodiamond plating was studied. Chromium plating was performed in Sargent bath. Morphology of deposit was observed by scanning electron microscope(SEM); microhardness by hardness tester; wear rate by tribometer; amount of diamond in deposit by combustion method and passivity by potentiodynamic scan. Experimental results show that in the presence of cobalt cation, the amount of nanodiamond particle in the deposit is increased. With increasing diamond particle amount, the metallurgical, mechanical and electrochemical properties of Cr/nanodiamond deposit are improved. However, this improvement seems to be constrained. In the presence of 10 g/L of nanodiamond powder and 2.5 g/L of cobalt cation in the bath, the amount of diamond particle in deposit is increased by 4 times; and wear rate of Cr-Co/nanodiamond deposit is decreased by 2-3 times as compared with pure Cr/deposit. The passive current of Cr-Co/nanodiamond composite deposit is decreased from 18 to 8 ìA. The morphology of Cr/nanodiamond is smooth remarkably in the presence of cobalt cation.

  10. New cation-exchange membranes for hyperfiltration processes

    NARCIS (Netherlands)

    Velden, van der P.M.; Smolders, C.A.

    1977-01-01

    A new route for the preparation of cation exchange membranes from polystyrene-polyisoprene-polystyrene (SIS) block copolymers has been studied, using N-chlorosulfonyl isocyanate. At temperatures of 0° to 20°C, N-chlorosulfonyl isocyanate reacts readily with the olefin group in polyisoprenes, resulti

  11. Fibrin solubilizing properties of certain anionic and cationic detergents.

    Science.gov (United States)

    Chakrabarty, S

    1989-08-15

    The fibrinolytic (fibrin dissolving) properties of several anionic, cationic, nonionic and zwitterionic detergents were assessed in an in vitro fibrin agarose assay. Of the 4 anionic detergents tested, only sodium dodecyl sulfate (SDS) was found to be fibrinolytic. SDS was fibrinolytic either in the absence or presence of factor XIII. Four other cationic detergents were found to possess similar fibrinolytic properties. These cationic detergents were cetyltrimethylammonium bromide (CTAB), mix alkyltrimethyl ammonium bromide (MTAB), hexadecyltrimethylammonium bromide (HTAB) and cetylpyridium chloride (CPC). The nonionic (digitonin, triton X-100/tween 20) and zeitterionic (CHAPS, zeittergent 3-08) detergents were not fibrinolytic. Detergents mediated fibrinolysis, unlike that of tissue type plasminogen activator and urokinase, was independent of the presence of plasminogen. Non-detergents such as polyethylene glycol and highly charged compounds such as poly-1-lysine and poly-1-glutamic acid were not fibrinolytic. Fibrinolytic activity was observed for SDS and the cationic detergents at concentrations ranging from 0.1-10 percent. The effects of these fibrinolytic detergents (SDS, CTAB, MTAB, HTAB and CPC) on clot formation and on pre-formed clots were then assessed, using freshly drawn human venous blood. Incorporation of these detergents into blood inhibited the formation of clots in a concentration dependent manner. The detergents were also able to dissolve pre-formed clots in a similar fashion. SDS was found to be most potent in these properties. PMID:2510356

  12. Cationic polymers for nuclaic acid delivery to tumors

    NARCIS (Netherlands)

    Wolf, H.K. de

    2007-01-01

    In the field of cancer gene therapy, the use of gene carrier systems is considered indispensable. Cationic polymers are able to effectively condense plasmid DNA to nano-sized particles, further referred to as polyplexes. Compared to free DNA, polyplexes have shown improved nuclease-resistance, a mor

  13. Predictive model of cationic surfactant binding to humic substances

    NARCIS (Netherlands)

    Ishiguro, M.; Koopal, L.K.

    2011-01-01

    The humic substances (HS) have a high reactivity with other components in the natural environment. An important factor for the reactivity of HS is their negative charge. Cationic surfactants bind strongly to HS by electrostatic and specific interaction. Therefore, a surfactant binding model is devel

  14. Interactions between liposomes and cations in aqueous solution.

    Science.gov (United States)

    Ruso, Juan M; Besada, Lina; Martínez-Landeira, Pablo; Seoane, Laura; Prieto, Gerardo; Sarmiento, Félix

    2003-05-01

    An investigation on the dependence of electrophoretic mobilities of unilamellar vesicles of phosphatidylcholine-cholesterol-phosphatidylinositol (PC-Chol-PI) on the concentration of several cations with variations in the relation charge/radius in the range Na+, K+, Cs+, Mg2+, Ca2+, Ba2+, Al3+, and La3+ has been realized. Plots of zeta potential against ion concentration exhibit a maximum for all the cations under study, the position of the maximum is greatly affected by the charge of the ion. From the feature of these plots two phenomenon were observed: an initial binding of cations into the slipping plane for ion concentration below the maximum and a phenomenon of vesicle association for concentration above the maximum. To confirm these observations measurements on dynamic light scattering were performed to obtain the corresponding size distribution of the liposomes at different ion concentrations. Finally the ability of the Stern isotherm to describe the adsorption of the cations to vesicles was tested by two methods. The two main parameters of the theory: the total number of adsorption sites per unit area, N1, and the equilibrium constant, K; (and consequently the free energy of adsorption, deltaG0ads) were calculated for the different ions, showing good agreement. The equilibrium constants of adsorption have been found to obey a linear relationship with ion radius the slope of which decreases with the ion charge.

  15. Photo-fragmentation spectroscopy of benzylium and 1-phenylethyl cations

    Energy Technology Data Exchange (ETDEWEB)

    Féraud, Géraldine; Dedonder-Lardeux, Claude; Jouvet, Christophe, E-mail: christophe.jouvet@univ-amu.fr [Physique des Interactions Ioniques et Moleculaires, UMR CNRS 7345, Aix-Marseille Université, Avenue Escadrille Normandie-Niémen, 13397 Marseille Cedex 20 (France); Soorkia, Satchin [Institut des Sciences Moléculaires d’Orsay, CNRS UMR 8214, Université Paris Sud 11, 91405 Orsay Cedex (France)

    2014-01-14

    The electronic spectra of cold benzylium (C{sub 6}H{sub 5}-CH{sub 2}{sup +}) and 1-phenylethyl (C{sub 6}H{sub 5}-CH-CH{sub 3}{sup +}) cations have been recorded via photofragment spectroscopy. Benzylium and 1-phenylethyl cations produced from electrosprayed benzylamine and phenylethylamine solutions, respectively, were stored in a cryogenically cooled quadrupole ion trap and photodissociated by an OPO laser, scanned in parts of the UV and visible regions (600–225 nm). The electronic states and active vibrational modes of the benzylium and 1-phenylethyl cations as well as those of their tropylium or methyl tropylium isomers have been calculated with ab initio methods for comparison with the spectra observed. Sharp vibrational progressions are observed in the visible region while the absorption features are much broader in the UV. The visible spectrum of the benzylium cation is similar to that obtained in an argon tagging experiment [V. Dryza, N. Chalyavi, J. A. Sanelli, and E. J. Bieske, J. Chem. Phys. 137, 204304 (2012)], with an additional splitting assigned to Fermi resonances. The visible spectrum of the 1-phenylethyl cation also shows vibrational progressions. For both cations, the second electronic transition is observed in the UV, around 33 000 cm{sup −1} (4.1 eV) and shows a broadened vibrational progression. In both cases the S{sub 2} optimized geometry is non-planar. The third electronic transition observed around 40 000 cm{sup −1} (5.0 eV) is even broader with no apparent vibrational structures, which is indicative of either a fast non-radiative process or a very large change in geometry between the excited and the ground states. The oscillator strengths calculated for tropylium and methyl tropylium are weak. Therefore, these isomeric structures are most likely not responsible for these absorption features. Finally, the fragmentation pattern changes in the second and third electronic states: C{sub 2}H{sub 2} loss becomes predominant at higher

  16. Structure of a cation-bound multidrug and toxic compound extrusion transporter

    Energy Technology Data Exchange (ETDEWEB)

    He, Xiao; Szewczyk, Paul; Karyakin, Andrey; Evin, Mariah; Hong, Wen-Xu; Zhang, Qinghai; Chang, Geoffrey (Scripps)

    2010-10-26

    Transporter proteins from the MATE (multidrug and toxic compound extrusion) family are vital in metabolite transport in plants, directly affecting crop yields worldwide. MATE transporters also mediate multiple-drug resistance (MDR) in bacteria and mammals, modulating the efficacy of many pharmaceutical drugs used in the treatment of a variety of diseases. MATE transporters couple substrate transport to electrochemical gradients and are the only remaining class of MDR transporters whose structure has not been determined. Here we report the X-ray structure of the MATE transporter NorM from Vibrio cholerae determined to 3.65 {angstrom}, revealing an outward-facing conformation with two portals open to the outer leaflet of the membrane and a unique topology of the predicted 12 transmembrane helices distinct from any other known MDR transporter. We also report a cation-binding site in close proximity to residues previously deemed critical for transport. This conformation probably represents a stage of the transport cycle with high affinity for monovalent cations and low affinity for substrates.

  17. Preparation and characterization of high capacity, strong cation-exchange fiber based adsorbents.

    Science.gov (United States)

    Schwellenbach, Jan; Taft, Florian; Villain, Louis; Strube, Jochen

    2016-05-20

    Motivated by the demand for more economical capture and polishing steps in downstream processing of protein therapeutics, a novel strong cation-exchange chromatography stationary phase based on polyethylene terephthalate (PET) high surface area short-cut fibers is presented. The fiber surface is modified by grafting glycidyl methacrylate (GMA) via surface-initiated atom transfer radical polymerization (SI-ATRP) and a subsequent derivatization leading to sulfonic acid groups. The obtained cation-exchange fibers have been characterized and compared to commercially available resin and membrane based adsorbers. High volumetric static binding capacities for lysozyme (90mg/mL) and polyclonal human IgG (hIgG, 92mg/mL) were found, suggesting an efficient multi-layer binding within the grafted hydrogel layer. A packed bed of randomly orientated fibers has been tested for packing efficiency, permeability and chromatographic performance. High dynamic binding capacities for lysozyme (50mg/mL) and hIgG (54mg/mL) were found nearly independent of the bed-residence time, revealing a fast mass-transport mechanism. Height equivalent to a theoretical plate (HETP) values in the order of 0.1 cm and a peak asymmetry factor (AF) of 1.8 have been determined by tracer experiments. Additionally inverse size-exclusion chromatography (iSEC) revealed a bimodal structure within the fiber bed, consisting of larger transport channels, formed by the voidage between the fibers, and a hydrogel layer with porous properties. PMID:27106396

  18. Cationic albumin-conjugated chelating agent as a novel brain drug delivery system in neurodegeneration.

    Science.gov (United States)

    Kamalinia, Golnaz; Khodagholi, Fariba; Shaerzadeh, Fatemeh; Tavssolian, Faranak; Chaharband, Farkhondeh; Atyabi, Fatemeh; Sharifzadeh, Mohammad; Amini, Mohsen; Dinarvand, Rassoul

    2015-11-01

    The critical role of metal ions and in particular iron in oxidative stress and protein aggregation offers chelation therapy as a sensible pharmaceutical strategy in oxidative stress-induced neuronal damages. In this research, we conjugated an iron-chelating agent, deferasirox, to cationized human serum albumin molecules in order to develop a novel brain delivery system for the management of neurodegenerative disorders due to the significant role of oxidative stress-induced neuronal injury in such diseases. Cationized albumin is known to be able to transport to brain tissue via adsorptive-mediated transcytosis. The developed structures were molecularly characterized, and their conjugation ratio was determined. PC12 cell line was utilized to evaluate the neuroprotective features of these newly developed molecules in the presence of hydrogen peroxide neuronal damage and to identify the mechanisms behind the observed neuronal protection including apoptotic and autophagic pathways. Furthermore, a rat model of Alzheimer's disease was utilized to evaluate the impact of conjugated structures in vivo. Data analysis revealed that the conjugated species were able to hinder apoptotic cell death while enhancing autophagic process. The developed conjugated species were also able to attenuate amyloid beta-induced learning deficits when administered peripherally.

  19. Purification of urokinase by combined cation exchanger and affinity chromatographic cartridges.

    Science.gov (United States)

    Hou, K C; Zaniewski, R

    1990-02-23

    Crude urokinase from human urine processed through foam flotation and ammonium sulfate precipitation containing 720 National Health Institute Committee on Thrombolytic Agents U/mg activity was purified by an SP cation exchanger followed by a zinc-chelated affinity chromatographic cartridge. The cartridges were of a radial-flow type formed by using acrylic and cellulose composite matrices. The high rigidity of the matrix structure permits fast flow of protein solutions (liters per minute) and thus allows processing of a large volume of crude urokinase under low operating pressures. A greater than six-fold increase in specific enzyme activity of urokinase was achieved by adsorbing and eluting 1 l of a 3 mg/ml crude urokinase solution on an SP cartridge. The eluent was further purified by passing through a zinc-chelated affinity cartridge to achieve greater than a eighteen-fold increase in urokinase specific activity. This report demonstrates the combined use of a cation exchanger with zinc-chelated chromatographic cartridges in purifying urokinase on a relatively large scale. The relationship between the amount of zinc chelated in the matrix to its effect on urokinase purification is also discussed. PMID:2329161

  20. The adsorption of amino acids and cations onto goethite: a prebiotic chemistry experiment.

    Science.gov (United States)

    Farias, Ana Paula S F; Carneiro, Cristine E A; de Batista Fonseca, Inês C; Zaia, Cássia T B V; Zaia, Dimas A M

    2016-06-01

    Few prebiotic chemistry experiments have assessed the adsorption of biomolecules by iron oxide-hydroxides. The present work investigated the effects of cations in artificial seawaters on the adsorption of Gly, α-Ala and β-Ala onto goethite, and vice versa. Goethite served to concentrate K and Mg cations from solution; these effects could have played important roles in peptide nucleoside formation. Goethite showed low adsorption of Gly and α-Ala. On the other hand, β-Ala (a non-protein amino acid) was highly adsorbed by goethite. Because Gly and α-Ala are the most common amino acids in living beings, and iron oxide-hydroxides are widespread on Earth, additional iron oxides should be studied. Increased ionic strength in artificial seawaters decreased the adsorption of amino acids by goethite. Because Na was highly abundant in the artificial seawater, it showed the highest effect on amino acid adsorption. β-Ala increased the adsorption of K and Ca by goethite, this effect could have been important for peptide synthesis. PMID:26984319

  1. Structure and function studies of cationic lipid non-viral gene delivery systems

    Science.gov (United States)

    Slack, Nelle Lynn

    which measure protein synthesized as a result of reporter gene expression, demonstrate that, for complexes containing univalent cationic lipids (CL), the overall structure of the carrier and membrane charge density may be important variables for designing an efficient carrier. Results from multivalent CL containing complexes show transfection efficiency dependence on membrane charge density and lipid geometric packing shape may be universal in vitro.

  2. Pharmacology of the human cell voltage-dependent cation channel. Part II: inactivation and blocking

    DEFF Research Database (Denmark)

    Bennekou, Poul; Barksmann, Trine L.; Kristensen, Berit I.;

    2004-01-01

    Human red cells; Nonselective voltage-dependent cation channel; NSVDC channel; Thiol group reagents......Human red cells; Nonselective voltage-dependent cation channel; NSVDC channel; Thiol group reagents...

  3. Star-like superalkali cations featuring planar pentacoordinate carbon.

    Science.gov (United States)

    Guo, Jin-Chang; Tian, Wen-Juan; Wang, Ying-Jin; Zhao, Xue-Feng; Wu, Yan-Bo; Zhai, Hua-Jin; Li, Si-Dian

    2016-06-28

    Superalkali cations, known to possess low vertical electron affinities (VEAs), high vertical detachment energies, and large highest occupied molecular orbital (HOMO)-lowest unoccupied molecular orbital (LUMO) energy gaps, are intriguing chemical species. Thermodynamically, such species need to be the global minima in order to serve as the promising targets for experimental realization. In this work, we propose the strategies of polyhalogenation and polyalkalination for designing the superalkali cations. By applying these strategies, the local-minimum planar pentacoordinate carbon (ppC) cluster CBe5 can be modified to form a series of star-like superalkali ppC or quasi-ppC CBe5X5 (+) (X = F, Cl, Br, Li, Na, K) cations containing a CBe5 moiety. Polyhalogenation and polyalkalination on the CBe5 unit may help eliminate the high reactivity of bare CBe5 molecule by covering the reactive Be atoms with noble halogen anions and alkali cations. Computational exploration of the potential energy surfaces reveals that the star-like ppC or quasi-ppC CBe5X5 (+) (X = F, Cl, Br, Li, Na, K) clusters are the true global minima of the systems. The predicted VEAs for CBe5X5 (+) range from 3.01 to 3.71 eV for X = F, Cl, Br and 2.12-2.51 eV for X = Li, Na, K, being below the lower bound of the atomic ionization potential of 3.89 eV in the periodic table. Large HOMO-LUMO energy gaps are also revealed for the species: 10.76-11.07 eV for X = F, Cl, Br and 4.99-6.91 eV for X = Li, Na, K. These designer clusters represent the first series of superalkali cations with a ppC center. Bonding analyses show five Be-X-Be three-center two-electron (3c-2e) σ bonds for the peripheral bonding, whereas the central C atom is associated with one 6c-2e π bond and three 6c-2e σ bonds, rendering (π and σ) double aromaticity. Born-Oppenheimer molecular dynamics simulations indicate that the CBe5 motif is robust in the clusters. As planar hypercoordination carbon species are often thermodynamically

  4. Star-like superalkali cations featuring planar pentacoordinate carbon

    Science.gov (United States)

    Guo, Jin-Chang; Tian, Wen-Juan; Wang, Ying-Jin; Zhao, Xue-Feng; Wu, Yan-Bo; Zhai, Hua-Jin; Li, Si-Dian

    2016-06-01

    Superalkali cations, known to possess low vertical electron affinities (VEAs), high vertical detachment energies, and large highest occupied molecular orbital (HOMO)-lowest unoccupied molecular orbital (LUMO) energy gaps, are intriguing chemical species. Thermodynamically, such species need to be the global minima in order to serve as the promising targets for experimental realization. In this work, we propose the strategies of polyhalogenation and polyalkalination for designing the superalkali cations. By applying these strategies, the local-minimum planar pentacoordinate carbon (ppC) cluster CBe5 can be modified to form a series of star-like superalkali ppC or quasi-ppC CBe5X5+ (X = F, Cl, Br, Li, Na, K) cations containing a CBe5 moiety. Polyhalogenation and polyalkalination on the CBe5 unit may help eliminate the high reactivity of bare CBe5 molecule by covering the reactive Be atoms with noble halogen anions and alkali cations. Computational exploration of the potential energy surfaces reveals that the star-like ppC or quasi-ppC CBe5X5+ (X = F, Cl, Br, Li, Na, K) clusters are the true global minima of the systems. The predicted VEAs for CBe5X5+ range from 3.01 to 3.71 eV for X = F, Cl, Br and 2.12-2.51 eV for X = Li, Na, K, being below the lower bound of the atomic ionization potential of 3.89 eV in the periodic table. Large HOMO-LUMO energy gaps are also revealed for the species: 10.76-11.07 eV for X = F, Cl, Br and 4.99-6.91 eV for X = Li, Na, K. These designer clusters represent the first series of superalkali cations with a ppC center. Bonding analyses show five Be-X-Be three-center two-electron (3c-2e) σ bonds for the peripheral bonding, whereas the central C atom is associated with one 6c-2e π bond and three 6c-2e σ bonds, rendering (π and σ) double aromaticity. Born-Oppenheimer molecular dynamics simulations indicate that the CBe5 motif is robust in the clusters. As planar hypercoordination carbon species are often thermodynamically unstable and

  5. Soaking Hexammine Cations into RNA Crystals to Obtain Derivatives for Phasing Diffraction Data.

    Science.gov (United States)

    Batey, Robert T; Kieft, Jeffrey S

    2016-01-01

    Solving a novel RNA structure by x-ray crystallography requires a means to obtain initial phase estimates. This is a challenge because many of the tools available for solving protein structures are not available for RNA. We have developed a reliable means to use hexammine cations to address this challenge. The process involves engineering the RNA to introduce a reliable hexammine binding site into the structure, then soaking crystals of these RNAs with an iridium (III) or cobalt (III) compound in a "directed soaking" strategy. Diffraction data obtained from these crystals then can be used in SAD or MAD phasing. In many cases, suitable derivatives can be obtained by soaking the hexammine into RNA crystals that have not been engineered. Considerations for using this method and example protocols are presented. PMID:26227046

  6. Evaluation of cationic micropeptides derived from the innate immune system as inhibitors of marine biofouling.

    Science.gov (United States)

    Trepos, Rozenn; Cervin, Gunnar; Pile, Claire; Pavia, Henrik; Hellio, Claire; Svenson, Johan

    2015-01-01

    A series of 13 short synthetic amphiphilic cationic micropeptides, derived from the antimicrobial iron-binding innate defence protein lactoferrin, have been evaluated for their capacity to inhibit the marine fouling process. The whole biofouling process was studied and microfouling organisms such as marine bacteria and microalgae were included as well as the macrofouling barnacle Balanus improvisus. In total 19 different marine fouling organisms (18 microfoulers and one macrofouler) were included and both the adhesion and growth of the microfoulers were investigated. It was shown that the majority of the peptides inhibited barnacle cyprid settlement via a reversible nontoxic mechanism, with IC50 values as low as 0.5 μg ml(-1). Six peptides inhibited adhesion and growth of microorganisms. Two of these were particularly active against the microfoulers with MIC-values ranging between 0.01 and 1 μg ml(-1), which is comparable with the commercial reference antifoulant SeaNine.

  7. The effect of multivalent cations and Tau on paclitaxel-stabilized microtubule assembly, disassembly, and structure.

    Science.gov (United States)

    Safinya, Cyrus R; Chung, Peter J; Song, Chaeyeon; Li, Youli; Ewert, Kai K; Choi, Myung Chul

    2016-06-01

    In this review we describe recent studies directed at understanding the formation of novel nanoscale assemblies in biological materials systems. In particular, we focus on the effects of multivalent cations, and separately, of microtubule-associated protein (MAP) Tau, on microtubule (MT) ordering (bundling), MT disassembly, and MT structure. Counter-ion directed bundling of paclitaxel-stabilized MTs is a model electrostatic system, which parallels efforts to understand MT bundling by intrinsically disordered proteins (typically biological polyampholytes) expressed in neurons. We describe studies, which reveal an unexpected transition from tightly spaced MT bundles to loose bundles consisting of strings of MTs as the valence of the cationic counter-ion decreases from Z=3 to Z=2. This transition is not predicted by any current theories of polyelectrolytes. Notably, studies of a larger series of divalent counter-ions reveal strong ion specific effects. Divalent counter-ions may either bundle or depolymerize paclitaxel-stabilized MTs. The ion concentration required for depolymerization decreases with increasing atomic number. In a more biologically related system we review synchrotron small angle x-ray scattering (SAXS) studies on the effect of the Tau on the structure of paclitaxel-stabilized MTs. The electrostatic binding of MAP Tau isoforms leads to an increase in the average radius of microtubules with increasing Tau coverage (i.e. a re-distribution of protofilament numbers in MTs). Finally, inspired by MTs as model nanotubes, we briefly describe other more robust lipid-based cylindrical nanostructures, which may have technological applications, for example, in drug encapsulation and delivery. PMID:26684364

  8. The Influence of Cationization on the Dyeing Performance of Cotton Fabrics with Direct Dyes

    Directory of Open Access Journals (Sweden)

    M. F. Shahin

    2015-08-01

    Full Text Available The effect of cationic modification of cotton fabrics, using cationic agent (Chromatech 9414 on direct dyeing characteristics was studied in this work. Cationization of cotton fabric at different conditions (pH, cationic agent concentration, temperature and time was investigated and the optimum conditions were determined . Nitrogen content of cotton samples pretreated with cationic agent was indicated. The results showed that increasing cationic agent concentration lead to higher nitrogen content on cotton fabric . The cationized cotton fabrics were dyed with two direct dyes (C.I. Direct Yellow 142 - C.I. Direct red 224 and the results were compared to untreated cotton fabrics. The parameters which may affect the dyeing process such as dye concn., addition of salt, time and temperature of dyeing were studied. The dyeing results illustrate that cationization improves the fabric dyeability compared to the uncationized cotton and the magnitude of increase in colour depth depends on the nitrogen content of the cationized cotton fabric .The results also refer to possibility of dyeing cationized cotton fabric with direct dyes without addition of electrolytes to give colour strength higher than that achieved on uncationized cotton using conventional dyeing method .Another important advantage of cationic treatment is in the saving of dye concn., energy ,dyeing time , rinse water and subsequently saving of waste water treatment , and finally minimizes the environmental pollution . The changes in surface morphology of fibres after cationization were identified by various methods such as wettability and scanning with the electron microscope. Different fastness properties were evaluated.

  9. Gene vectors based on DOEPC/DOPE mixed cationic liposomes : a physicochemical study

    NARCIS (Netherlands)

    Munoz-Ubeda, Monica; Rodriguez-Pulido, Alberto; Nogales, Aurora; Llorca, Oscar; Quesada-Perez, Manuel; Martin-Molina, Alberto; Aicart, Emilio; Junquera, Elena

    2011-01-01

    A double approach, experimental and theoretical, has been followed to characterize from a physicochemical standpoint the compaction process of DNA by means of cationic colloidal aggregates. The colloidal vectors are cationic liposomes constituted by a mixture of a novel cationic lipid, 1,2-dioleoyl-

  10. Structure of heavy cation molecules: from experiment to simulation

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, C.; Fillaux, C.; Guilbaud, P.; Guillaumont, D.; Moisy, P. [CEA Marcoule DEN/DRCP/SCPS, 30207 Bagnols sur Ceze (France); Conradson, S.D. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Di Giandomenico, V.; Le Naour, C.; Simoni, E. [IPN Orsay, 91405 Orsay (France); Hennig, C. [Forschungszentrum Rossendorf, ROBL at ESRF, 38043 Grenoble (France)

    2008-07-01

    For industrial, environmental and public health purposes, actinide chemistry has been the subject of considerable efforts since the 50's. Aqueous redox chemistry, ionic selective recognition, uptake by specific biomolecules or compartments of the geosphere are some of the major fields of investigation. The physical-chemical properties of the actinide elements strongly depend on the 5f/6d electronic configuration. X-ray photons are an ideal spectroscopic tool for structure and bonding in actinide molecules. At high photon energies, actinide Extended X-ray Absorption Fine Structure (EXAFS) is a structural probe of the cation coordination sphere. Furthermore, coupling EXAFS with molecular dynamics or quantum chemical calculations leads to a better description of the 'cation in its close environment', like polyhedron, disorder, solvent effects etc.. (authors)

  11. Characterisation of heavy cations from dysprosium to plutonium

    International Nuclear Information System (INIS)

    For industrial, environmental and public health purposes, actinide chemistry has been the subject of considerable efforts since the 50's. Aqueous redox chemistry, ionic selective recognition, uptake by specific biomolecules or compartments of the geosphere are some of the major fields of investigation. The physical-chemical properties of the actinide and lanthanide elements strongly depend on the frontier orbital electronic configuration. This paper is divided in two parts. In the first one, coupling XAS with molecular dynamics allows to take into account solvent and disorder effects while fitting the EXAFS data of aqueous uranyl and dysprosium cations. In the second one EXAFS structural parameters of oxo-cations from protactinium to plutonium are compared to quantum chemical calculations. (authors)

  12. Cation conductivity monitoring in cycling plants. A new approach

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Randy C. [Swan Analytical USA, Wheeling, IL (United States)

    2012-09-15

    Due to substantial fuel costs, environmental issues, and economic impact, there has been increased pressure in recent years to reduce start-up times for all units, particularly combined cycle units. Any shortening of the time between start-up and reaching full load is of paramount importance. Cation conductivity is still the decisive measurement for the start-up of the steam turbine and the focus is now on how fast the cation conductivity results are available and how reliable they are. The time necessary to obtain correct and representative analysis values is greatly influenced by the design of the sampling and monitoring system. Employing various measures for the optimization of continuous monitoring equipment and employing optimally designed analyzers can reduce the response time of the instrumentation by more than half, thus providing significant economic rewards. The costs of the improvements are negligible compared to the benefits of reducing the time operating in bypass mode.

  13. Microstructure characterization and cation distribution of nanocrystalline cobalt ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Abbas, Y.M., E-mail: ymabbas@live.com [Suez Canal University, Faculty of Science, Physics Department, Ismailia (Egypt); Mansour, S.A.; Ibrahim, M.H. [Suez Canal University, Faculty of Science, Physics Department, Ismailia (Egypt); Ali, Shehab E., E-mail: shehab_physics@yahoo.com [Suez Canal University, Faculty of Science, Physics Department, Ismailia (Egypt)

    2011-11-15

    Nanocrystalline cobalt ferrite has been synthesized using two different methods: ceramic and co-precipitation techniques. The nanocrystalline ferrite phase has been formed after 3 h of sintering at 1000 deg. C. The structural and microstructural evolutions of the nanophase have been studied using X-ray powder diffraction and the Rietveld method. The refinement result showed that the type of the cationic distribution over the tetrahedral and octahedral sites in the nanocrystalline lattice is partially an inverse spinel. The transmission electronic microscope analysis confirmed the X-ray results. The magnetic properties of the samples were characterized using a vibrating sample magnetometer. - Highlights: > The refinement result showed that the cationic distribution over the sites in the lattice is partially an inverse spinel. > The transmission electronic microscope analysis confirmed the X-ray results. > The magnetic properties of the samples were characterized using a vibrating sample magnetometer.

  14. Aggregation behavior of quaternary salt based cationic surfactants

    International Nuclear Information System (INIS)

    The aggregation behavior of pure cationic surfactants (quaternary salts) in water has been studied by electrical conductivity (at 293.15-333.15K), surface tension, dye solubilization and viscosity measurements (at 303.15K). Critical micelle concentrations (CMCs), degree of counter ion dissociation (β), aggregation number and sphere-to-rod transition for cationic surfactants are reported. Using law of mass action model, the thermodynamic parameters, viz. Gibbs energy (ΔGm-bar ), enthalpy (ΔHm-bar ) and entropy (ΔSm-bar ) were evaluated. The plots of differential conductivity (dk/dc)T,P, versus the total surfactant concentration enables us to determine the CMC values more precisely than the conventional method. Surfactants with longer hydrocarbon chain are adapted to rodlike micelle better than to a spherical micelle. The data are explained in terms of molecular characteristics of surfactants viz. nonpolar chain length, polar head group size and counter ion

  15. Structure of ionic liquids with cationic silicon-substitutions

    Science.gov (United States)

    Wu, Boning; Shirota, Hideaki; Lall-Ramnarine, Sharon; Castner, Edward W.

    2016-09-01

    Significantly lower viscosities result when a single alkyl carbon is replaced by a silicon atom on the side chain of an ionic liquid cation. To further explore this effect, we compare liquid structure factors measured using high-energy X-ray scattering and calculated using molecular dynamics simulations. Four ionic liquids are studied that each has a common anion, bis(trifluoromethylsulfonyl)amide ( NTf2 - ). The four cations for this series of NTf2 - -anion ionic liquids are 1-methyl-3-trimethylsilylmethylimidazolium (Si-mim+), 1-methyl-3-neopentylimidazolium (C-mim+), 1-methyl-3-pentamethyldisiloxymethylimidazolium (SiOSi-mim+), and 1-methyl-1-trimethylsilylmethylpyrrolidinium (Si-pyrr+). To achieve quantitative agreement between the structure factors measured using high-energy X-ray scattering and molecular dynamics simulations, new transferable parameters for silicon were calibrated and added to the existing force fields.

  16. Mobility of alkali cations in polypyrrole-dodecyl sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Kupila, E.L. [Department of Chemistry, University of Turku, 20500 Turku (Finland); Kankare, J. [Department of Chemistry, University of Turku, 20500 Turku (Finland)

    1995-03-01

    Due to the immobility of the large dodecyl sulfate anion, the mobile ions in polypyrrole-dodecyl sulfate are small ions from the solution. Virgin PP-dodecyl sulfate does not contain other ionic species, but already the first reduction causes the incorporation of cations into the membrane. Using in situ AC conductimetry on a double-band platinum electrode, we show that the insertion of cations from the solution into the PP membrane proceeds as a non-conducting zone advancing from the solution interface toward the substrate. The model allows to estimate ion mobilities in the membrane giving 8.6x10{sup -7}cm{sup 2}s{sup -1}V{sup -1} for K{sup +}. (orig.)

  17. Removal of both cationic and anionic contaminants by amphoteric starch.

    Science.gov (United States)

    Peng, Huanlong; Zhong, Songxiong; Lin, Qintie; Yao, Xiaosheng; Liang, Zhuoying; Yang, Muqun; Yin, Guangcai; Liu, Qianjun; He, Hongfei

    2016-03-15

    A novel amphoteric starch incorporating quaternary ammonium and phosphate groups was applied to investigate the efficiency and mechanism of cationic and anionic contaminant treatment. Its flocculation abilities for kaolin suspension and copper-containing wastewater were evaluated by turbidity reduction and copper removal efficiency, respectively. And the kinetics of formation, breakage and subsequent re-formation of aggregates were monitored using a Photometric Dispersion Analyzer (PDA) and characterized by flocculation index (FI). The results showed that amphoteric starch possessed the advantages of being lower-dosages-consuming and being stronger in shear resistance than cationic starch, and exhibited a good flocculation efficiency over a wide pH range from 3.0 to 11.0. PMID:26794754

  18. Sulfonated polyvinyl chloride fibers for cation-exchange microextraction.

    Science.gov (United States)

    Xu, Li; Lee, Hian Kee

    2009-09-18

    Polyvinyl chloride (PVC) fiber was derivatized by concentrated sulfuric acid to yield sulfonated PVC (PVC-SO3H). The PVC-SO3H fiber had dual properties as a sorbent, based on cation-exchange and hydrophobicity. In the present study, the novel fiber was used directly as an individual device for extraction purposes in the cation-exchange microextraction of anaesthetics, followed by high-performance liquid chromatography-UV analysis. The results demonstrated that this PVC-SO3H fiber-based microextraction afforded convenient operation and cost-effective application to basic analytes. The limits of detection for four anaesthetics ranged from 1.2 to 6.0 ng/mL. No carryover (because of its disposable usage), and no loss of sorbent phase (which normally occurs in stir-bar sorptive extraction) during extraction were observed.

  19. Intracellular NHX-Type Cation/H+ Antiporters inPlants

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    Cells depend on the homeostatic maintenance of pHwithin specific cellular compartments to ensure optimalconditions for metabolic and enzymatic processes as wellas protein structure and function. In the animal secre-tory pathway, cells maintain distinct luminal pHs withinvarious compartments (Paroutis et al., 2004). Among themany molecular players that contribute to pH and ionhomeostasis in plants, Na+(K+)/H+ exchangers (also knownas NHX-type cation/H+ antiporters) appear to be particu-larly important for the regulation of a wide variety ofphysiological processes, including cell expansion, cellvolume regulation, osmotic adjustment, pH regulation,membrane trafficking, protein processing, and cellularstress responses (Pardo et al., 2006; Rodriguez-Rosaleset al., 2009; Bassil et al., 2012). In plants, NHX antiportersappeared early in evolution and are ubiquitously encodedmembers of the CPA1 cation/H+ antiporters subgroupthat belongs to the large family of monovalent cation/H+ transporters CPA (Brett et al., 2005). NHX antiport-ers are found, thus far, in all sequenced plant genomes(Bassil et al., 2012; Chanroj et al., 2012). In Arabidopsis,the NHX family consists of eight isoforms, six of whichare intracellular (AtNHXl-AtNHX6), located either to thevacuole (AtNHXl to AtNHX4) or endosomes (AtNHX5 andAtNHX6) and an additional two more divergent members(AtNHX7/SOSl and AtNHX8) at the plasma membrane(Bassil et al., 2012). Orthologous sequences in each of thethree classes (plasma membrane, vacuolar, or endosomal)appear in all sequenced genomes, suggesting that distinctfunctional NHX classes appeared early in evolution andmay have conserved roles that are compartment-specific(Bassil et al., 2012). Emerging new evidence highlightsthe importance of particular intracellular NHX antiport-ers in the regulation of vesicular and vacuolar pH andK+ homeostasis. Vacuolar NHXs are needed to maintainK+ homeostasis

  20. Structure, spectra and dynamics of alkali cation microhydration clusters

    OpenAIRE

    Schulz, Franziska

    2005-01-01

    The main focus of this work was the theoretical investigation of alkali cation microhydration clusters with sodium, potassium, and caesium as central ion and up to 24 water molecules per cluster. Structures were obtained applying global geometry optimisation, using a specialised version of genetic algorithms and the common TIP4P/OPLS model potential. The global and most important local minimum energy structures have been investigated and the results obtained constitute a first complete and sy...

  1. Identification of bilinear systems using differential evolution algorithm

    Indian Academy of Sciences (India)

    Saban Ozer; Hasan Zorlu

    2011-06-01

    In this work, a novel identification method based on differential evolution algorithm has been applied to bilinear systems and its performance has been compared to that of genetic algorithm. Box–Jenkins system and different type bilinear systems have been identified using differential evolution and genetic algorithms. The simulation results have shown that bilinear systems can be successfully and efficiently identified using these algorithms.

  2. THE CHARACTERISTICS OF HIGH MOLECULAR WEIGHT CATIONIC POLYACRYLAMIDE

    Institute of Scientific and Technical Information of China (English)

    Hongjie Zhang; Huiren Hu; Fushan Chen

    2004-01-01

    In this paper, the cationic polyacrylamide (CPAM)with high molecular weight was prepared in aqueous solution through a complex initiator system. The CPAM was characterized by Fourier transform infrared spectroscopy (FTIR) and 13C nuclear magnetic resonance spectroscopy (13C NMR), and the charge density of the CPAM was determined by colloid titration. The results obtained indicated that the copolymerization technology used in the experiment was successful.

  3. Collectins and Cationic Antimicrobial Peptides of the Respiratory Epithelia

    OpenAIRE

    Grubor, B.; Meyerholz, D. K.; Ackermann, M R

    2006-01-01

    The respiratory epithelium is a primary site for the deposition of microorganisms that are acquired during inspiration. The innate immune system of the respiratory tract eliminates many of these potentially harmful agents preventing their colonization. Collectins and cationic antimicrobial peptides are antimicrobial components of the pulmonary innate immune system produced by respiratory epithelia, which have integral roles in host defense and inflammation in the lung. Synthesis and secretion...

  4. Natural zeolite reactivity towards ozone: The role of compensating cations

    International Nuclear Information System (INIS)

    Highlights: ► Chemical and thermal treatment enhances catalytic activity of natural zeolite. ► Modified natural zeolite exhibits high stability after thermal treatment. ► Reducing the compensating cation content leads to an increase on ozone abatement. ► Surface active atomic oxygen was detected using the DRIFT technique. ► The highest reactivity toward ozone was performed by NH4Z3 zeolite sample. - Abstract: Among indoor pollutants, ozone is recognised to pose a threat to human health. Recently, low cost natural zeolites have been applied as alternative materials for ozone abatement. In this work, the effect of compensating cation content of natural zeolite on ozone removal is studied. A Chilean natural zeolite is used here as starting material. The amount of compensating cations in the zeolite framework was modified by ion exchange using an ammonium sulphate solution (0.1 mol L−1). Characterisation of natural and modified zeolites were performed by X-ray powder diffraction (XRD), nitrogen adsorption at 77 K, elemental analysis, X-ray fluorescence (XRF), thermogravimetric analysis coupled with mass spectroscopy (TGA-MS), and temperature-programmed desorption of ammonia (NH3-TPD). Ozone adsorption and/or decomposition on natural and modified zeolites were studied by diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS). Results show that the zeolite compensating cation content affects ozone interaction with zeolite active sites. Ammonium ion-exchange treatments followed by thermal out-gassing at 823 K, reduces ozone diffusion resistance inside the zeolite framework, increasing ozone abatement on zeolite surface active sites. Weak and strong Lewis acid sites of zeolite surface are identified here as the main active sites responsible of ozone removal.

  5. Natural zeolite reactivity towards ozone: The role of compensating cations

    Energy Technology Data Exchange (ETDEWEB)

    Valdes, Hector, E-mail: hvaldes@ucsc.cl [Laboratorio de Tecnologias Limpias (F. Ingenieria), Universidad Catolica de la Santisima Concepcion, Alonso de Ribera 2850, Concepcion (Chile); Alejandro, Serguei; Zaror, Claudio A. [Departamento de Ingenieria Quimica (F. Ingenieria), Universidad de Concepcion, Concepcion (Chile)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer Chemical and thermal treatment enhances catalytic activity of natural zeolite. Black-Right-Pointing-Pointer Modified natural zeolite exhibits high stability after thermal treatment. Black-Right-Pointing-Pointer Reducing the compensating cation content leads to an increase on ozone abatement. Black-Right-Pointing-Pointer Surface active atomic oxygen was detected using the DRIFT technique. Black-Right-Pointing-Pointer The highest reactivity toward ozone was performed by NH4Z3 zeolite sample. - Abstract: Among indoor pollutants, ozone is recognised to pose a threat to human health. Recently, low cost natural zeolites have been applied as alternative materials for ozone abatement. In this work, the effect of compensating cation content of natural zeolite on ozone removal is studied. A Chilean natural zeolite is used here as starting material. The amount of compensating cations in the zeolite framework was modified by ion exchange using an ammonium sulphate solution (0.1 mol L{sup -1}). Characterisation of natural and modified zeolites were performed by X-ray powder diffraction (XRD), nitrogen adsorption at 77 K, elemental analysis, X-ray fluorescence (XRF), thermogravimetric analysis coupled with mass spectroscopy (TGA-MS), and temperature-programmed desorption of ammonia (NH{sub 3}-TPD). Ozone adsorption and/or decomposition on natural and modified zeolites were studied by diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS). Results show that the zeolite compensating cation content affects ozone interaction with zeolite active sites. Ammonium ion-exchange treatments followed by thermal out-gassing at 823 K, reduces ozone diffusion resistance inside the zeolite framework, increasing ozone abatement on zeolite surface active sites. Weak and strong Lewis acid sites of zeolite surface are identified here as the main active sites responsible of ozone removal.

  6. Proton and sodium cation affinities of harpagide: a computational study.

    Science.gov (United States)

    Colas, Cyril; Bouchonnet, Stéphane; Rogalewicz-Gilard, Françoise; Popot, Marie-Agnès; Ohanessian, Gilles

    2006-06-15

    The aim of this work was to estimate the proton and sodium cation affinities of harpagide (Har), an iridoid glycoside responsible for the antiinflammatory properties of the medicinal plant Harpagophytum. Monte Carlo conformational searches were performed at the semiempirical AM1 level to determine the most stable conformers for harpagide and its protonated and Na+-cationized forms. The 10 oxygen atoms of the molecule were considered as possible protonation and cationization sites. Geometry optimizations were then refined at the DFT B3LYP/6-31G level from the geometries of the most stable conformers found. Final energetics were obtained at the B3LYP/6-311+G(2d,2p)//B3LYP/6-31G level. The proton and sodium ion affinities of harpagide have been estimated at 223.5 and 66.0 kcal/mol, respectively. Since harpagide mainly provides HarNa+ ions in electrospray experiments, the DeltarG298 associated with the reaction of proton/sodium exchange between Har and methanol, MeOHNa+ + HarH+ --> MeOH2+ + HarNa+ (1), has been calculated; it has been estimated to be 1.9 kcal/mol. Complexing a methanol molecule to each reagent and product of reaction 1 makes the reaction become exothermic by 1.7 kcal/mol. These values are in the limit of the accuracy of the method and do not allow us to conclude definitely whether the reaction is endo- or exothermic, but, according to these very small values, the cation exchange reaction is expected to proceed easily in the final stages of the ion desolvation process. PMID:16759142

  7. Effect of cationic polyelectrolytes addition in cement cohesion

    OpenAIRE

    Edison Albert Zuluaga-Hernández; Bibian A Hoyos

    2014-01-01

    Here is studied the variation in cohesion of cement main phase (C-S-H) as a result of cationic polyelectrolytes addition (quaternary amines spermine and norspermidine). Cohesion study was carried out by molecular simulation techniques (Monte Carlo) using a primitive model in a canonical ensemble (NVT). The proposed model takes into account the influence of ionic size of each particle and the addition of polyelectrolytes with different charge number and separation. The results obtained show th...

  8. Interactions of microfibrillated cellulose and cellulosic fines with cationic polyelectrolytes

    OpenAIRE

    Taipale, Tero

    2010-01-01

    The overall aim of this work was to produce and characterize different types of cellulosic fines and microfibrillated cellulose; to study their interactions with high molar mass cationic polyelectrolytes; and to demonstrate novel examples of their utilization. The work was performed, and its results discussed mainly from papermaking point of view, but the results are also well applicable in other fields of industry. Cellulosic fines are an essential component of papermaking fiber suspens...

  9. Synthesis of cationic star polymers by simplified electrochemically mediated ATRP

    Directory of Open Access Journals (Sweden)

    P. Chmielarz

    2016-10-01

    Full Text Available Cyclodextrin-based cationic star polymers were synthesized using β-cyclodextrin (β-CD core, and 2-(dimethylamino ethyl methacrylate (DMAEMA as hydrophilic arms. Star-shaped polymers were prepared via a simplified electrochemically mediated ATRP (seATRP under potentiostatic and galvanostatic conditions. The polymerization results showed molecular weight (MW evolution close to theoretical values, and maintained narrow molecular weight distribution (MWD of obtained stars. The rate of the polymerizations was controlled by applying more positive potential values thereby suppressing star-star coupling reactions. Successful chain extension of the ω-functional arms with a hydrophobic n-butyl acrylate (BA formed star block copolymers and confirmed the living nature of the β-CD-PDMAEMA star polymers prepared by seATRP. Novelty of this work is that the β-CD-PDMAEMA-b-PBA cationic star block copolymers were synthesized for the first time via seATRP procedure, utilizing only 40 ppm of catalyst complex. The results from 1H NMR spectral studies support the formation of cationic star (copolymers.

  10. Selective Facet Reactivity During Cation Exchange in Cadmium Sulfide Nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Sadtler, Bryce; Demchenko, Denis; Zheng, Haimei; Hughes, Steven; Merkle, Maxwell; Dahmen, Ulrich; Wang, Lin-Wang; Alivisatos, A. Paul

    2008-12-18

    The partial transformation of ionic nanocrystals through cation exchange has been used to synthesize nanocrystal heterostructures. We demonstrate that the selectivity for cation exchange to take place at different facets of the nanocrystal plays an important role in determining the resulting morphology of the binary heterostructure. In the case of copper I (Cu+) cation exchange in cadmium sulfide (CdS) nanorods, the reaction starts preferentially at the ends of the nanorods such that copper sulfide (Cu2S) grows inwards from either end. The resulting morphology is very different from the striped pattern obtained in our previous studies of silver I (Ag+) exchange in CdS nanorods where non-selective nucleation of silver sulfide (Ag2S) occurs. From interface formation energies calculated for several models of epitaxialconnections between CdS and Cu2S or Ag2S, we infer the relative stability of each interface during the nucleation and growth of Cu2S or Ag2S within the CdS nanorods. The epitaxial connections of Cu2S to the end facets of CdS nanorods minimize the formation energy, making these interfaces stable throughout the exchange reaction. However, as the two end facets of wurtzite CdS nanorods are crystallographically nonequivalent, asymmetric heterostructures can be produced.

  11. Mono- and di-cationic hydrido boron compounds.

    Science.gov (United States)

    Ghadwal, Rajendra S; Schürmann, Christian J; Andrada, Diego M; Frenking, Gernot

    2015-08-28

    Brønsted acid HNTf2 (Tf = SO2CF3) mediated dehydrogenative hydride abstraction from (L(1))BH3 () and (L(2))BH3 () (L(1) = IPrCH2 = 1,3-(2,6-di-isopropylphenyl)imidazol-2-methylidene (); L(2) = SIPrCH2 = 1,3-(2,6-di-isopropylphenyl)imidazolidin-2-methylidiene ()) affords thermally stable hydride bridged mono-cationic hydrido boron compounds [{(L(1))BH2}2(μ-H)](NTf2) () and [{(L(2))BH2}2(μ-H)](NTf2) (). Furthermore, hydride abstraction yields di-cationic hydrido boron compounds [{(L(1))BH}2(μ-H)2](NTf2)2 () and [{(L(2))BH}2(μ-H)2](NTf2)2 (). Unique cationic boron compounds with CH2BH2(μ-H)BH2CH2 ( and ) and CH2BH(μ-H)2BHCH2 ( and ) moieties feature a 3c-2e bond and have been fully characterized. Interesting electronic and structural features of compounds are analysed using spectroscopic, crystallographic, and computational methods. PMID:26200103

  12. Solidification cracking in austenitic stainless steel welds

    Indian Academy of Sciences (India)

    V Shankar; T P S Gill; S L Mannan; S Sundaresan

    2003-06-01

    Solidification cracking is a significant problem during the welding of austenitic stainless steels, particularly in fully austenitic and stabilized compositions. Hot cracking in stainless steel welds is caused by low-melting eutectics containing impurities such as S, P and alloy elements such as Ti, Nb. The WRC-92 diagram can be used as a general guide to maintain a desirable solidification mode during welding. Nitrogen has complex effects on weld-metal microstructure and cracking. In stabilized stainless steels, Ti and Nb react with S, N and C to form low-melting eutectics. Nitrogen picked up during welding significantly enhances cracking, which is reduced by minimizing the ratio of Ti or Nb to that of C and N present. The metallurgical propensity to solidification cracking is determined by elemental segregation, which manifests itself as a brittleness temperature range or BTR, that can be determined using the varestraint test. Total crack length (TCL), used extensively in hot cracking assessment, exhibits greater variability due to extraneous factors as compared to BTR. In austenitic stainless steels, segregation plays an overwhelming role in determining cracking susceptibility.

  13. Transformation of anthracene on various cation-modified clay minerals.

    Science.gov (United States)

    Li, Li; Jia, Hanzhong; Li, Xiyou; Wang, Chuanyi

    2015-01-01

    In this study, anthracene was employed as a probe to explore the potential catalytic effect of clay minerals in soil environment. Clay minerals saturated with various exchangeable cations were tested. The rate of anthracene transformation follows the order: Fe-smectite > Cu-smectite > Al-smectite ≈ Ca-smectite ≈ Mg-smectite ≈ Na-smectite. This suggests that transition-metal ions such as Fe(III) play an important role in anthracene transformation. Among Fe(III)-saturated clays, Fe(III)-smectite exhibits the highest catalytic activity followed by Fe(III)-illite, Fe(III)-pyrophyllite, and Fe(III)-kaolinite, which is in agreement with the interlayer Fe(III) content. Moreover, effects by two common environmental factors, pH and relative humidity (RH), were evaluated. With an increase in pH or RH, the rate of anthracene transformation decreases rapidly at first and then is leveled off. GC-MS analysis identifies that the final product of anthracene transformation is 9,10-anthraquinone, a more bioavailable molecule compared to anthracene. The transformation process mainly involves cation-π bonding, electron transfer leading to cation radical, and further oxidation by chemisorbed O2. The present work provides valuable insights into the abiotic transformation and the fate of PAHs in the soil environment and the development of contaminated land remediation technologies.

  14. Cationic lipid membranes-specific interactions with counter-ions

    International Nuclear Information System (INIS)

    Lipids bearing net electric charges in their hydrophilic headgroups are ubiquitous in biological membranes. Recently, the interest in cationic lipids has surged because of their potential as non-viral transfection vectors. In order to utilize cationic lipids in transfer of nucleic acids and to elucidate the role of charged lipids in cellular membranes in general, their complex interactions within the membrane and with the molecules in the surrounding media need to be thoroughly characterized. Yet, even interactions between monovalent counter-ions and charged lipids are inadequately understood. We studied the interactions of the cationic gemini surfactant (2R,3R)-2,3-dimethoxy-1,4- bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide (RR-1) with chloride, bromide, fluoride, and iodide as counter-ions by differential scanning calorimetry and Langmuir balance. Chloride interacts avidly with RR-1, efficiently condensing the monolayer, decreasing the collapse pressure, and elevating the main transition temperature. With bromide and iodide clearly different behaviour was observed, indicating specific interactions between RR-1 and these counter-ions. Moreover, with fluoride as a counter-ion and in pure water identical results were obtained, demonstrating inefficient electrostatic screening of the headgroups of RR-1 and suggesting fluoride being depleted on the surface of RR-1 membranes

  15. Cationic lipid membranes-specific interactions with counter-ions

    Energy Technology Data Exchange (ETDEWEB)

    Ryhaenen, Samppa J; Saeily, V Matti J; Kinnunen, Paavo K J [Helsinki Biophysics and Biomembrane Group, Institute of Biomedicine, Biomedicum, University of Helsinki, PO Box 63 (Haartmaninkatu 8), Helsinki FIN-00014 (Finland)

    2006-07-19

    Lipids bearing net electric charges in their hydrophilic headgroups are ubiquitous in biological membranes. Recently, the interest in cationic lipids has surged because of their potential as non-viral transfection vectors. In order to utilize cationic lipids in transfer of nucleic acids and to elucidate the role of charged lipids in cellular membranes in general, their complex interactions within the membrane and with the molecules in the surrounding media need to be thoroughly characterized. Yet, even interactions between monovalent counter-ions and charged lipids are inadequately understood. We studied the interactions of the cationic gemini surfactant (2R,3R)-2,3-dimethoxy-1,4- bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide (RR-1) with chloride, bromide, fluoride, and iodide as counter-ions by differential scanning calorimetry and Langmuir balance. Chloride interacts avidly with RR-1, efficiently condensing the monolayer, decreasing the collapse pressure, and elevating the main transition temperature. With bromide and iodide clearly different behaviour was observed, indicating specific interactions between RR-1 and these counter-ions. Moreover, with fluoride as a counter-ion and in pure water identical results were obtained, demonstrating inefficient electrostatic screening of the headgroups of RR-1 and suggesting fluoride being depleted on the surface of RR-1 membranes.

  16. Specific cationic emission of cisplatin following ionization by swift protons

    Science.gov (United States)

    Moretto-Capelle, Patrick; Champeaux, Jean-Philippe; Deville, Charlotte; Sence, Martine; Cafarelli, Pierre

    2016-05-01

    We have investigated collision-induced ionization and fragmentation by 100 keV protons of the radio sensitizing molecule cisplatin, which is used in cancer treatments. A large emission of HCl+ and NH2+ is observed, but surprisingly, no cationic fragments containing platinum are detected, in contrast to ionization-dissociation induced by electronic collision. Theoretical investigations show that the ionization processes take place on platinum and on chlorine atoms. We propose new ionization potentials for cisplatin. Dissociation limits corresponding to the measured fragmentation mass spectrum have been evaluated and the theoretical results show that the non-observed cationic fragments containing platinum are mostly associated with low dissociation energies. We have also investigated the reaction path for the hydrogen transfer from the NH3 group to the Cl atom, as well as the corresponding dissociation limits from this tautomeric form. Here again the cations containing platinum correspond to lower dissociation limits. Thus, the experimental results suggest that excited states, probably formed via inner-shell ionization of the platinum atom of the molecule, correlated to higher dissociation limits are favored.

  17. Naphthoxy Bounded Ferrocenium Salts as Cationic Photoinitiators for Epoxy Photopolymerization

    Directory of Open Access Journals (Sweden)

    Zh. Q. Li

    2009-01-01

    Full Text Available To improve the absorption and the bulk of arene ligands, two naphthoxy bounded ferrocenium salts as new cationic photoinitiators, (η6-α-naphthoxybenzene (η5-cyclopentadienyl iron hexafluorophosphate (NOFC-1 and (η6-β-naphthoxybenzene (η5-cyclopentadienyl iron hexafluorophosphate (NOFC-2, were synthesized, characterized, and studied. NOFC-1 and NOFC-2 were prepared by the reaction of nucleophilic substitution (SNAr with naphthol and chlorobenzene-cyclopentadienyliron salt. Their activity as cationic photoinitiators was studied using real-time infrared spectroscopy. The results obtained showed that NOFC-1 and NOFC-2 are capable of photoinitiating the cationic polymerization of epoxy monomer directly on irradiation with long-wavelength UV light (365 nm. Comparative studies also demonstrated that they exhibited better efficiency than cyclopentadienyl-Fe-cymene hexafluorophosphate (I-261. When NOFC-1 and NOFC-2 were used to efficiently initiate polymerization of epoxide, both rate of polymerization and final conversion increased using benzoyl peroxide (BPO as sensitizer. DSC studies showed that NOFC-1 and NOFC-2 photoinitiators in epoxides possess good thermal stability in the absence of light.

  18. Effect of heavy metal cations on the activity of cathepsin D (in vitro study) Effect of heavy metal cations on the activity of cathepsin D (in vitro study)

    OpenAIRE

    Alicja Karwowska; Radosław Łapiński; Marek Gacko; Ewa Grzegorczyk; Joanna Żurawska; Jan K. Karczewski

    2012-01-01

    We studied the effect of heavy metal cations: Fe 2+, Cu2+, Zn2+, Cd2+, Hg2+, Pb2+ on the activity of
    cathepsin D in human aorta homogenate and blood serum. The concentration of cations was 1 mmol/l. Hemoglobin
    was the cathepsin D substrate. The activity of cathepsin D was determined at pH 3.5. Only Hg2+ cations
    inhibit the activity of cathepsin D. Cations Hg2+ damage lysosomes and release cathepsin D from these organelles.We studied the effect of heavy metal c...

  19. A colorimetric aptasensor for the diagnosis of malaria based on cationic polymers and gold nanoparticles.

    Science.gov (United States)

    Jeon, Weejeong; Lee, Seonghwan; Manjunatha, D H; Ban, Changill

    2013-08-01

    Malaria, a major burden of disease caused by parasites of the genus Plasmodium, is widely spread in tropical and subtropical regions. Here, we have successfully developed a diagnostic technique for malaria. The proposed method is based on the interaction among the Plasmodium lactate dehydrogenase (pLDH), which is a biomarker for malaria, and pL1 aptamer against Plasmodium vivax lactate dehydrogenase (PvLDH) and Plasmodium falciparum lactate dehydrogenase (PfLDH). In addition, the cationic polymers, poly(diallyldimethylammonium chloride) (PDDA) and poly(allylamine hydrochloride) (PAH), aggregate gold nanoparticles (AuNPs) that should be possible to observe the change in color from red to blue, which depends on the concentration of pLDH. Using this aptasensor, pLDH proteins were successfully detected with low detection limits. Moreover, the specificity test proved that the aptasenor is very specific in targeting proteins over other interfering proteins. In addition, the pLDH from infected blood samples of the two main species of malaria were also detected. The limits of detection for P. vivax were determined as 80 parasites/μl for PDDA and 74 parasites/μl for PAH. The aptasenor has great advantages that can simply and rapidly diagnose malaria. Thus, the developed aptasensor for detection of pLDH can offer an effective and sensitive diagnosis of malaria.

  20. Preparation of Medium Cation Exchange Stationary Phase of Polymeric Matrix and Their Chromatographic Properties

    Institute of Scientific and Technical Information of China (English)

    CHEN,Gang; GONG,Bo-Lin; BAI,Quan; GENG,Xin-Du

    2007-01-01

    Based on the monodisperse poly(glycidyl methacrylate-co-ethylenedimethacrylate) beads (PGMA/EDMA) with macropore as a medium, a new hydrophilic medium cation exchange (MCX) stationary phase for HPLC was synthesized by a new chemically modified method. The stationary phase was evaluated with the property of ion exchange, separability, reproducibility, hydrophilicity, effect of salt concentration, salt types, column loading and pH on the separation and retention of proteins in detail. It was found that it follows ion exchange chromatographic (IEC)retention mechanism. The measured bioactivity recovery for lysozyme was (96±5)%. The dynamic protein loading capacity of the synthesized MCX packings was 21.8 mg/g. Five proteins were almost completely separated within 6.0 min at a flow rate of 4 mL/min using the synthesized MCX resin. The MCX resin was also used for the rapid separation and purification of lysozyme from egg white with only one step. The purity and specific bioactivity of the purified lysozyme was found more than 95% and 70345 U/mg, respectively.

  1. Protein scissors: Photocleavage of proteins at specific locations

    Indian Academy of Sciences (India)

    Challa V Kumar; Apinya Buranaprapuk; Jyotsna Thota

    2002-12-01

    Site-specific photocleavage of hen egg lysozyme and bovine serum albumin (BSA) by N-(L-phenylalanine)-4(1-pyrene)butyramide (Py-Phe) is investigated in detail with respect to its efficiency, dependence on oxygen, and radical quenchers. Binding of Py-Phe to BSA follows a biphasic process with two binding sites per protein. The photocleavage was achieved upon irradiating a mixture of protein, Py-Phe and Co(III)hexammine (CoHA) at 344 nm. No protein cleavage was observed in the absence of Py-Phe, or CoHA, or light. Photocleavage of BSA was inhibited by degassing or by the addition of radical quenchers such as ethanol. In addition, the photoreaction was quenched by electron donors such as ethanolamine. This result was corroborated by the flash photolysis studies where the cation radical derived from the probe is also quenched by ethanolamine with an equivalent rate constant. Quenching of the singlet excited state of Py-Phe by CoHA followed by the reaction of the resulting pyrenyl cation radical with the protein backbone is the suggested mechanism of protein cleavage. The origin of the specificity of photocleavage is discussed and specificity is valuable in targeting desired sites of proteins with small molecules.

  2. Protein (Viridiplantae): 226492000 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :4857 3398:4857 4447:4104 4734:4104 38820:4104 4479:4104 147370:3083 147369:3083 147429:3083 4575:1399 4577:1399 tobamovirus multipli...cation-like protein Zea mays MRRELASPLATAAAATAGASFSAAASLRGWWDDVNESPQWQDGAFFSLAAAYAL

  3. Crystal structure of channelrhodopsin, a light-gated cation channel – all cations lead through the monomer –

    Science.gov (United States)

    Kato, Hideaki E.; Nureki, Osamu

    2013-01-01

    Channelrhodopsin (ChR) is a light-gated cation channel derived from green algae. Since the inward flow of cations triggers the neuron firing, neurons expressing ChRs can be optically controlled even within freely moving mammals. Although ChR has been broadly applied to neuro-science research, little is known about its molecular mechanisms. We determined the crystal structure of chimeric ChR at 2.3 Å resolution and revealed its molecular architecture. The integration of structural, electrophysio-logical, and computational analyses provided insight into the molecular basis for the channel function of ChR, and paved the way for the principled design of ChR variants with novel properties. PMID:27493541

  4. Ultrasonic dyeing of cationized cotton fabric with natural dye. Part 1: cationization of cotton using Solfix E.

    Science.gov (United States)

    Kamel, M M; El Zawahry, M M; Ahmed, N S E; Abdelghaffar, F

    2009-02-01

    The dyeing of cationized cotton fabric with Solfix E using colouring matter extracted from Cochineal dye has been studied using both conventional and ultrasonic techniques. Factors affecting dye extraction such as ultrasound power, particle size, extraction temperature and time were studied. The results indicated that the extraction by ultrasound at 300 W was more effective at lower temperature and time than conventional extraction. The effect of various factors of dye bath such as pH, salt concentration, ultrasound power, dyeing time and temperature were investigated. The colour strength values obtained were found to be higher with ultrasound than with conventional techniques. The results of fastness properties of the dyed fabrics were fair to good. The scanning electron microscope (SEM) images of the morphological and X-ray analyzes were measured for cationized cotton fabrics dyed with both conventional and ultrasound methods, thus showing the sonicator efficiency. PMID:18812264

  5. Adsorption of reovirus to clay minerals: effects of cation-exchange capacity, cation saturation, and surface area.

    OpenAIRE

    Lipson, S M; Stotzky, G

    1983-01-01

    The adsorption of reovirus to clay minerals has been reported by several investigators, but the mechanisms defining this association have been studied only minimally. The purpose of this investigation was to elucidate the mechanisms involved with this interaction. More reovirus type 3 was adsorbed, in both distilled and synthetic estuarine water, by low concentrations of montmorillonite than by comparable concentrations of kaolinite containing a mixed complement of cations on the exchange com...

  6. Effects of Hofmeister salt series on gluten network formation: Part I. Cation series.

    Science.gov (United States)

    Tuhumury, H C D; Small, D M; Day, L

    2016-12-01

    Different cationic salts were used to investigate the effects of the Hofmeister salt series on gluten network formation. The effects of cationic salts on wheat flour dough mixing properties, the rheological and the chemical properties of the gluten extracted from the dough with different respective salts, were investigated. The specific influence of different cationic salts on the gluten structure formation during dough mixing, compared to the sodium ion, were determined. The effects of different cations on dough and gluten of different flours mostly followed the Hofmeister series (NH4(+), K(+), Na(+), Mg(2+) and Ca(2+)). The impacts of cations on gluten structure and dough rheology at levels tested were relatively small. Therefore, the replacement of sodium from a technological standpoint is possible, particularly by monovalent cations such as NH4(+), or K(+). However the levels of replacement need to take into account sensory attributes of the cationic salts. PMID:27374596

  7. An efficient nonviral gene-delivery vector based on hyperbranched cationic glycogen derivatives

    Directory of Open Access Journals (Sweden)

    Liang X

    2014-01-01

    rats was evaluated to identify the safety and transfection efficiency. Results: The hyperbranched cationic glycogen derivatives conjugated with DMAPA and AEPZ residues were synthesized. They exhibited better blood compatibility and lower cytotoxicity when compared to branched polyethyleneimine (bPEI. They were able to bind and condense pDNA to form the complexes of 100–250 nm in size. The transfection efficiency of the DMAPA-Glyp/pDNA complexes was higher than those of the AEPZ-Glyp/pDNA complexes in both the 293T and CNE2 cells, and almost equal to those of bPEI. Furthermore, pDNA could be more safely delivered to the blood vessels in brain tissue of Sprague Dawley rats by the DMAPA-Glyp derivatives, and then expressed as green fluorescence protein, compared with the control group. Conclusion: The hyperbranched cationic glycogen derivatives, especially the DMAPA-Glyp derivatives, showed high gene-transfection efficiency, good blood compatibility, and low cytotoxicity when transfected in vitro and in vivo, which are novel potential nonviral gene vectors. Keywords: glycogen, blood compatibility, cytotoxicity, gene delivery

  8. Selective separation of beta-lactoglobulin from sweet whey using CGAs generated from the cationic surfactant CTAB.

    Science.gov (United States)

    Fuda, Elisabeth; Bhatia, Divesh; Pyle, D L; Jauregi, Paula

    2005-06-01

    The selective separation of whey proteins was studied using colloidal gas aphrons generated from the cationic surfactant cetyl trimethyl ammonium bromide (CTAB). From the titration curves obtained by zeta potential measurements of individual whey proteins, it was expected to selectively adsorb the major whey proteins, i.e., bovine serum albumin, alpha-lactalbumin, and beta-lactoglobulin to the aphrons and elute the remaining proteins (lactoferrin and lactoperoxidase) in the liquid phase. A number of process parameters including pH, ionic strength, and mass ratio of surfactant to protein (M(CTAB)/M(TP)) were varied in order to evaluate their effect on protein separation. Under optimum conditions (2 mmol/l CTAB, M(CTAB)/M(TP) = 0.26-0.35, pH 8, and ionic strength = 0.018 mol/l), 80-90% beta-lactoglobulin was removed from the liquid phase as a precipitate, while about 75% lactoferrin and lactoperoxidase, 80% bovine serum albumin, 95% immunoglobulin, and 65% alpha-lactalbumin were recovered in the liquid fraction. Mechanistic studies using zeta potential measurements and fluorescence spectroscopy proved that electrostatic interactions modulate only partially the selectivity of protein separation, as proteins with similar surface charges do not separate to the same extent between the two phases. The selectivity of recovery of beta-lactoglobulin probably occurs in two steps: the first being the selective interaction of the protein with opposite-charged surfactant molecules by means of electrostatic interactions, which leads to denaturation of the protein and subsequent formation and precipitation of the CTAB-beta-lactoglobulin complex. This is followed by the separation of CTAB-beta-lactoglobulin aggregates from the bulk liquid by flotation in the aphron phase. In this way, CGAs act as carriers which facilitate the removal of protein precipitate. PMID:15816026

  9. Brain-derived neurotrophic factor genes transfect rat bone marrow mesenchymal stem cells based on cationic polymer vector

    Institute of Scientific and Technical Information of China (English)

    Zunsheng Zhang; Kun Zan; Yonghai Liu; Xia Shen

    2009-01-01

    BACKGROUND: Gene therapy is an effective expression of genes within target cells after transferring exogenous target genes. Both vector selection and transfection method are important factors for gene transfection. An ideal gene vector is required for a high transfusion of target gene and an exact introduction of target gene into specific target cells so as to express gene products. OBJECTIVE: To study the expression of mRNA and protein after transfecting rat bone marrow mesenchymal stem cells (BMSCs) with brain-derived neurotrophic factor (BDNF) genes based on cationic polymer vector. DESIGN, TIME AND SETTING: A randomized, controlled in vitro study using gene engineering, performed at the Neurobiology Laboratory, Xuzhou Medical College between October 2007 and April 2008. MATERIALS: PcDNA3.1 BDNF was obtained from Youbiai Biotechnological Company, Beijing and cationic polymer vector used was the SofastTM gene transfection reagent that was made by Taiyangma Biotechnological Co., Ltd., Xiamen. METHODS: BMSCs extracted from six Sprague Dawley (SD) rats aged 1 month were isolated and cultured in vitro. Third passage BMSCs were inoculated on a 6-well culture plate at the density of 1×106 cells/L. At about 80% confluence, BMSCs were transfected with PcDNA3.1-BDNF (2 μg) combined with SofastTM gene transfection reagent (6 μg) (BDNF group) or with PcDNA3.1 (2 μg) combined with SofastTM gene transfection reagent (6 μg) (blank vector group). Cells that were not transfected with any reagents but still cultured under primary culture conditions were used as a non-transfection group.MAIN OUTCOME MEASURES: Enzyme linked immunosorbent assay was used to measure time efficiency of BMSC-secreted BDNF protein. Twenty-four hours after gene transfection, RT-PCR was used to detect expression of BDNF mRNA in the BMSCs. Immunohistochemistry was used to determine expression of BDNF protein in the BMSCs.RESULTS: BDNF protein expression was detected at day 1 after gene transfection

  10. Effect of heavy metal cations on the activity of cathepsin D (in vitro study Effect of heavy metal cations on the activity of cathepsin D (in vitro study

    Directory of Open Access Journals (Sweden)

    Alicja Karwowska

    2012-10-01

    Full Text Available We studied the effect of heavy metal cations: Fe 2+, Cu2+, Zn2+, Cd2+, Hg2+, Pb2+ on the activity of
    cathepsin D in human aorta homogenate and blood serum. The concentration of cations was 1 mmol/l. Hemoglobin
    was the cathepsin D substrate. The activity of cathepsin D was determined at pH 3.5. Only Hg2+ cations
    inhibit the activity of cathepsin D. Cations Hg2+ damage lysosomes and release cathepsin D from these organelles.We studied the effect of heavy metal cations: Fe 2+, Cu2+, Zn2+, Cd2+, Hg2+, Pb2+ on the activity of
    cathepsin D in human aorta homogenate and blood serum. The concentration of cations was 1 mmol/l. Hemoglobin
    was the cathepsin D substrate. The activity of cathepsin D was determined at pH 3.5. Only Hg2+ cations
    inhibit the activity of cathepsin D. Cations Hg2+ damage lysosomes and release cathepsin D from these organelles.

  11. Electronic spectra of isolated cations in supersonic jets by mass-selected ion-dip spectroscopy. Cations of benzene, p-difluorobenzene, and 1,3,5-trifluorobenzene

    Science.gov (United States)

    Tsuchiya, Yuko; Fujii, Masaaki; Ito, Mitsuo

    1989-06-01

    The electronic transitions of the cations of benzene, p-difluorobenzene (p-DFB), and 1,3,5-trifluorobenzene (1,3,5-TFB) have been measured by mass-selected ion-dip spectroscopy which utilizes the dissociation of a parent cation in an excited state. This spectroscopy was successfully applied to the vibrational level selected cation in the ground electronic state which was prepared by 1+1 REMPI (resonant enhanced multiphoton ionization) of the neutral molecule in a supersonic jet. For all the cations, the spectra due to the transition from the ground state to the excited π,π state were observed. Ion-dip spectra having sharp vibrational structures were found for p-DFB and 1,3,5-TFB cations, while a broad spectrum was observed for a benzene cation. It was also found that the vibrational structure of the ion-dip spectrum of the 1,3,5-TFB cation is quite different from that of the fluorescence excitation spectrum. The assignments of the ion-dip spectra and dissociation mechanisms of the excited cations will be discussed.

  12. Reduced hepatic uptake and intestinal excretion of organic cations in mice with a targeted disruption of the organic cation transporter 1 (Oct1 [Slc22a1]) gene

    NARCIS (Netherlands)

    Jonker, JW; Wagenaar, E; Mol, CAAM; Buitelaar, M; Koepsell, H; Smit, JW; Schinkel, AH

    2001-01-01

    The polyspecific organic cation transporter 1 (OCT1 [SLC22A1]) mediates facilitated transport of small (hydrophilic) organic cations. OCT1 is localized at the basolateral membrane of epithelial cells in the liver, kidney, and intestine and could therefore be involved in the elimination of endogenous

  13. Cations form sequence selective motifs within DNA grooves via a combination of cation-pi and ion-dipole/hydrogen bond interactions.

    Directory of Open Access Journals (Sweden)

    Mikaela Stewart

    Full Text Available The fine conformational subtleties of DNA structure modulate many fundamental cellular processes including gene activation/repression, cellular division, and DNA repair. Most of these cellular processes rely on the conformational heterogeneity of specific DNA sequences. Factors including those structural characteristics inherent in the particular base sequence as well as those induced through interaction with solvent components combine to produce fine DNA structural variation including helical flexibility and conformation. Cation-pi interactions between solvent cations or their first hydration shell waters and the faces of DNA bases form sequence selectively and contribute to DNA structural heterogeneity. In this paper, we detect and characterize the binding patterns found in cation-pi interactions between solvent cations and DNA bases in a set of high resolution x-ray crystal structures. Specifically, we found that monovalent cations (Tl⁺ and the polarized first hydration shell waters of divalent cations (Mg²⁺, Ca²⁺ form cation-pi interactions with DNA bases stabilizing unstacked conformations. When these cation-pi interactions are combined with electrostatic interactions a pattern of specific binding motifs is formed within the grooves.

  14. Intranasal Delivery of Cationic PLGA Nano/Microparticles- Loaded FMDV DNA Vaccine Encoding IL-6 Elicited Protective Immunity against FMDV Challenge

    OpenAIRE

    Gang Wang; Li Pan; Yongguang Zhang; Yonglu Wang; Zhongwang Zhang; Jianliang Lü; Peng Zhou; Yuzhen Fang; Shoutian Jiang

    2011-01-01

    Mucosal vaccination has been demonstrated to be an effective means of eliciting protective immunity against aerosol infections of foot and mouth disease virus (FMDV) and various approaches have been used to improve mucosal response to this pathogen. In this study, cationic PLGA (poly(lactide-co-glycolide)) nano/microparticles were used as an intranasal delivery vehicle as a means administering FMDV DNA vaccine encoding the FMDV capsid protein and the bovine IL-6 gene as a means of enhancing m...

  15. The malaria parasite cation ATPase PfATP4 and its role in the mechanism of action of a new arsenal of antimalarial drugs

    OpenAIRE

    Natalie Jane Spillman; Kiaran Kirk

    2015-01-01

    The intraerythrocytic malaria parasite, Plasmodium falciparum, maintains a low cytosolic Na+ concentration and the plasma membrane P-type cation translocating ATPase ‘PfATP4’ has been implicated as playing a key role in this process. PfATP4 has been the subject of significant attention in recent years as mutations in this protein confer resistance to a growing number of new antimalarial compounds, including the spiroindolones, the pyrazoles, the dihydroisoquinolones, and a number of the antim...

  16. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO3 single crystals has been studied by means of 18O2/16O2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The data

  17. Novel compound, organic cation transporter 3 detection agent and organic cation transporter 3 activity inhibitor, WO2015002150 A1: a patent evaluation.

    Science.gov (United States)

    Hu, Tao; Wang, Li; Pan, Xiaolei; Qi, Hualin

    2016-08-01

    Increasing pharmacological studies have demonstrated that organic cation transporter 3 (OCT3) plays an important role in controlling the extracellular concentrations of released monoamine neurotransmitter, suggesting that OCT3 might be a promising target in the treatment of depression. As a consequence, compounds showing inhibitory effects on the function of OCT3 have the potential for depression treatment. The current patent WO2015002150 A1 described the synthesis of 59 novel guanidine derivatives. All investigated compounds exhibited significant inhibitory effects (41.9-88.2%) on human OCT3 activity at 30 µM, using human OCT3-transfected human embryonic kidney 293 cell. Concentration-response curves (IC50 values) were determined for seven compounds with higher inhibition potency from the initial screening. IC50 values ranged from 1.9 to 24 µM. In addition, the concentration of these compound in aqueous solution with artificial membranes containing human OCT3 protein was measured. The concentration of compound 6 (SR-2045) was significantly reduced in the presence of human OCT3. Therefore, these compounds have the potential to be further developed as novel antidepressant and human OCT3 detection agent. Future investigations are needed to study the pharmacokinetic and pharmacological properties of these compounds and potential interaction with other transporters. PMID:27097290

  18. Holographic Grating Formation in Cationic Photopolymers with Dark Reaction

    Institute of Scientific and Technical Information of China (English)

    WEI Hao-Yun; CAO Liang-Cai; GU Claire; XU Zhen-Feng; HE Ming-Zhao; HE Qing-Sheng; HE Shu-Rong; JIN Guo-Fan

    2006-01-01

    @@ We propose a new formula to describe the dynamics of holographic grating formation under low intensity pulse exposures in cationic photopolymers, in which the dark reaction contributes dominantly to the grating strength.The formula is based on the living polymerization mechanism and the diffusion-free approximation. The analytical solution indicates that the grating formation time depends on the termination rate constant, while the final grating strength depends linearly on the total exposure energy. These theoretical predictions are verified experimentally using the Aprilis HMC-400μm photopolymer. The results can provide guidelines for the control and optimization of the holographic recording conditions in practical applications.

  19. Stretch-activated cation channel from larval bullfrog skin

    OpenAIRE

    Hillyard, Stanley D.; Willumsen, Niels J.; Marrero, Mario B.

    2010-01-01

    Cell-attached patches from isolated epithelial cells from larval bullfrog skin revealed a cation channel that was activated by applying suction (−1 kPa to −4.5 kPa) to the pipette. Activation was characterized by an initial large current spike that rapidly attenuated to a stable value and showed a variable pattern of opening and closing with continuing suction. Current–voltage plots demonstrated linear or inward rectification and single channel conductances of 44–56 pS with NaCl or KCl Ringer...

  20. Extracytoplasmic Stress Responses Induced by Antimicrobial Cationic Polyethylenimines

    OpenAIRE

    Lander, Blaine A.; Checchi, Kyle D.; Koplin, Stephen A.; Smith, Virginia F.; Domanski, Tammy L.; Isaac, Daniel D.; Lin, Shirley

    2012-01-01

    The ability of an antimicrobial, cationic polyethylenimine (PEI+) to induce the three known extracytoplasmic stress responses of Escherichia coli was quantified. Exposure of E. coli to PEI+ in solution revealed specific, concentration-dependent induction of the Cpx extracytoplasmic cellular stress response, ~2.0-2.5 fold at 320 μg/mL after 1.5 hours without significant induction of the σE or Bae stress responses. In comparison, exposure of E. coli to a non-antimicrobial polymer, polyethylene ...

  1. Incorporation of Monovalent Cations in Sulfate Green Rust

    DEFF Research Database (Denmark)

    Christiansen, B. C.; Dideriksen, K.; Katz, A.;

    2014-01-01

    Green rust is a naturally occurring layered mixed-valent ferrous-ferric hydroxide, which can react with a range of redox-active compounds. Sulfate-bearing green rust is generally thought to have interlayers composed of sulfate and water. Here, we provide evidence that the interlayers also contain...... with water showed that Na+ and K+ were structurally fixed in the interlayer, whereas Rb+ and Cs+ could be removed, resulting in a decrease in the basal layer spacing. The incorporation of cations in the interlayer opens up new possibilities for the use of sulfate green rust for exchange reactions with both...

  2. Spontaneous Superlattice Formation in Nanorods through PartialCation Exchange

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, Richard D.; Sadtler, Bryce; Demchenko, Denis O.; Erdonmez, Can K.; Wang, Lin-Wang; Alivisatos, A. Paul

    2007-03-14

    Lattice mismatch strains are widely known to controlnanoscale pattern formation in heteroepitaxy, but such effects have notbeen exploited in colloidal nanocrystal growth. We demonstrate acolloidal route to synthesizing CdS-Ag2S nanorod superlattices throughpartial cation exchange. Strain induces the spontaneous formation ofperiodic structures. Ab initio calculations of the interfacial energy andmodeling of strain energies show that these forces drive theself-organization. The nanorod superlattices exhibit high stabilityagainst ripening and phase mixing. These materials are tunablenear-infrared emitters with potential applications as nanometer-scaleoptoelectronic devices.

  3. Spectroscopy and interactions of metal and metal cation complexes

    OpenAIRE

    Plowright, Richard J.

    2010-01-01

    The work in this thesis looks at the spectroscopy and interactions of metals and metal cation complexes. There are two aspects of this vast subject that are considered: the electronic spectroscopy of Au-RG complexes and the ion-molecule chemistry of metals important in the mesosphere-lower thermosphere (MLT) region of the atmosphere. The spectroscopy of the molecular states in the vicinity of the strong Au 2P3/2, 1/2 ← 2S1/2 atomic transition, have been studied for the Au-RG (RG = Ne, Ar...

  4. Blackbody-induced radiative dissociation of cationic SF 6 clusters

    DEFF Research Database (Denmark)

    Toker, Jonathan; Rahinov, I.; Schwalm, D.;

    2012-01-01

    The stability of cationic SF5+(SF6)n−1 clusters was investigated by measuring their blackbody-induced radiative dissociation (BIRD) rates. The clusters were produced in a supersonic expansion ion source and stored in an electrostatic ion-beam trap at room temperature, where their abundances...... and lifetimes were measured. Using the “master equation” approach, relative binding energies of an SF6 unit in the clusters could be extracted from the storage-time dependence of the survival probabilities. The results allow for a deeper insight into the effect of a localized charge on the structure...... and stability of SF6-based clusters....

  5. Synthesis of Branch Fluorinated Cationic Surfactant and Surface Properties

    Directory of Open Access Journals (Sweden)

    Hongke Wu

    2014-01-01

    Full Text Available A novel fluorinated quaternary ammonium salt cationic surfactant N,N,N-trimethyl-2-[[4-[[3,4,4,4-tetrafluoro-2-[1,2,2,2-tetrafluoro-1-(trifluoromethylethyl]-1,3-bis(tri-fluoromethyl-1-buten-1-yl]oxy]-benzoyl]amino]-iodide (FQAS was synthesized successfully, and its structure was characterized by FTIR, 1H-NMR, 19F-NMR, and MS. The surface activities of FQAS and the effect of temperature, electrolyte, and combination with hydrocarbon surfactant were investigated. The results showed that FQAS exhibited excellent surface activity and combination with hydrocarbon surfactant.

  6. A NEW METHOD TO SYNTHESIZE THE CATIONIC GRAFT STARCH

    Institute of Scientific and Technical Information of China (English)

    Lin Li; Bingyue Liu; Yafeng Cao

    2004-01-01

    The cationic graft copolymer was synthesized by reversed phase emulsion copolymerization of starch with diallydimethyl ammoniumlchlorid (DADMAC)and acrylamide (AM). The copolymerization was carried out using (NH4)2S2O8-NH2CONH2 redox as initiator and selecting Span-20 as emulsifier. The effects of emulsifier content in oil phase, volume ratio of oil to water, initiator concentration and mole ratio of DADMAC to AM on the graft copolymerization were discussed. The optimum condition of synthetics was found with the orthogonal test method.

  7. Searching for Naphthalene Cation Absorption in the Interstellar Medium

    Science.gov (United States)

    Searles, Justin M.; Destree, Joshua D.; Snow, Theodore P.; Salama, Farid; York, Donald G.; Dahlstrom, Julie

    2011-05-01

    Interstellar naphthalene cations (C10H+ 8) have been proposed by a study to be the carriers of a small number of diffuse interstellar bands (DIBs). Using an archive of high signal-to-noise spectra obtained at the Apache Point Observatory, we used two methods to test the hypothesis. Both methods failed to detect significant absorption at lab wavelengths of interstellar spectra with laboratory spectra. We thereby conclude that C10H+ 8 is not a DIB carrier in typical reddened sight lines.

  8. SEARCHING FOR NAPHTHALENE CATION ABSORPTION IN THE INTERSTELLAR MEDIUM

    International Nuclear Information System (INIS)

    Interstellar naphthalene cations (C10H+8) have been proposed by a study to be the carriers of a small number of diffuse interstellar bands (DIBs). Using an archive of high signal-to-noise spectra obtained at the Apache Point Observatory, we used two methods to test the hypothesis. Both methods failed to detect significant absorption at lab wavelengths of interstellar spectra with laboratory spectra. We thereby conclude that C10H+8 is not a DIB carrier in typical reddened sight lines.

  9. Protic Cationic Oligomeric Ionic Liquids of the Urethane Type

    DEFF Research Database (Denmark)

    Shevchenko, V. V.; Stryutsky, A. V.; Klymenko, N. S.;

    2014-01-01

    Protic oligomeric cationic ionic liquids of the oligo(ether urethane) type are synthesized via the reaction of an isocyanate prepolymer based on oligo(oxy ethylene)glycol with M = 1000 with hexamethylene-diisocyanate followed by blocking of the terminal isocyanate groups with the use of amine...... derivatives of imidazole, pyridine, and 3-methylpyridine and neutralization of heterocycles with ethanesulfonic acid and p-toluenesulfonic acid. The structures and properties of the synthesized oligomeric ionic liquids substantially depend on the structures of the ionic groups. They are amorphous at room...

  10. Graphene oxide-cationic polymer conjugates: Synthesis and application as gene delivery vectors.

    Science.gov (United States)

    Teimouri, Mohsen; Nia, Azadeh Hashem; Abnous, Khalil; Eshghi, Hossein; Ramezani, Mohammad

    2016-01-01

    Nanomedicine as the interface between nanotechnology and medical sciences is a new area that has attracted the attention of vast groups of researchers. Carbon nanomaterials are common platform for synthesis of nanoparticles for biomedical applications due to their low cytotoxicity and feasible internalization into mammalian cell lines (Yang et al., 2007; Arora et al., 2014; Oh and Park, 2014). Synthesis of vectors based on various cationic polymers polyethylenimine (PEI), polypropylenimine (PPI) and polyamidoamine (PAMAM) and their derivatives were considered as a strategy for transferring plasmid DNA and treatment of genetic diseases. Considering the low cytotoxicity of graphene, chemical modification of its surface has led to fabrication of novel gene delivery systems based on graphene and graphene oxide. Herein we report the synthesis of three groups of vectors based on conjugation of graphene oxide (GO) with alkylated derivatives of three different cationic polymers (polyethylenimine (PEI), polypropylenimine (PPI) and polyamidoamine (PAMAM)) through different linkers including surface carboxyl group, glycine and spermidine. Two main challenges in design of gene delivery vectors is decreasing cytotoxicity while improving the transfection efficiency. All synthesized vectors showed significantly lower cellular toxicity compared to bare polymer. A plasmid encoding green fluorescent protein (GFP) was used to evaluate the transfection efficiency of nanoparticles both qualitatively using live cell fluorescent imaging and quantitatively using flow cytometry and each vector was compared to its polymer base. Most successful conjugation strategy was observed in the case of PEI conjugates among which most efficient vector was PEI-GO conjugate bearing glycine linker. This vector was 9 fold more effective in terms of the percent of EGFP transfected cells. PMID:27072918

  11. Preparation of oligodeoxynucleotide encapsulated cationic liposomes and release study with models of cellular membranes

    Directory of Open Access Journals (Sweden)

    Tamaddon AM.

    2007-05-01

    Full Text Available Cationic liposomes are used for cellular delivery of antisense oligodeoxynucleotide (AsODN, where release of encapsulated AsODN is mainly controlled by endocytosis and fusion mechanisms. In this investigation, it was tried to model such a release process that is difficult to evaluate in cell culture. For this purpose, an AsODN model (against protein kinase C-α was encapsulated in a DODAP-containing cationic liposome and evaluated for size, zeta-potential, encapsulation and ODN stability. Vesicular models of outer layer and total plasma membranes and early and late endosomal membranes were developed, based on lipid content and pH, using ether injection method. ODN release was determined by the fluorescence dequenching of encapsulated FITC-ODN. Zeta potential, size and ODN encapsulation efficiency of the prepared liposomes were -2.49 ± 7.15 mV, 108.4 nm and 73% respectively. ODN protection was 3-4 times more than that of conventional liposome/ODN complexation method. There was a correlation between model concentration and percent of ODN release. At 7.5 µM, the percent of released ODN was 76% for the cholesterol-free model of the late endosome and 16% for the early endosomal membrane; while the release was less than 11% for the models of plasma membrane. ODN release increased with temperature in the range of 4-37◦C for the late endosomal model, but not for others, possibly due to their high cholesterol contents or acidic pH. The interaction was fast and completed within 5 minutes and didn’t change in the range of 5-60 minutes. Our data are in agreement with published cell culture studies and reveal that cell-liposomes interaction can be modeled by lamellar membranes.

  12. Characterisation of a transgenic mouse expressing R122H human cationic trypsinogen

    Directory of Open Access Journals (Sweden)

    Mössner Joachim

    2006-10-01

    Full Text Available Abstract Background The R122H mutation of the cationic trypsinogen was found in patients with hereditary pancreatitis. A transgenic animal carrying this mutation could be useful as a genetic model system of pancreatitis. Methods Mice transgenic for the human R122H cationic trypsinogen were generated using the -205 fragment of the rat elastase promoter. The presence of the transgene was assayed in the DNA, in pancreatic mRNA and in zymogen granule lysates. Serum levels of amylase, lipase and cytokines (MCP-1, IL-6 were monitored and the histological appearance of the tissue was investigated. Pancreatitis was induced by 7 hourly injections of 50 μg/kg cerulein. The procedure was repeated twice weekly for 10 consecutive weeks. The animals were sacrificed 24 (n = 8 and 48 hours (n = 8 after the first injection and at the end of the whole treatment (n = 7. Results The transgene was detected at the genomic level and in pancreatic mRNA. The corresponding protein was found in low amounts in zymogen granule lysates. R122H mice showed elevated pancreatic lipase, but there was no spontaneous development of pancreatitis within 18 months. After induction of pancreatitis, levels of lipase (after 24 hours and amylase (after 48 hours were higher in R122H mice compared to controls. Repeated treatment with cerulein resulted in a slightly more severe pancreatitis in R122H animals. Amylase, lipase, and the cytokine levels were similar to controls. Conclusion The R122H transgenic mouse failed to develop a spontaneous pancreatitis but a repeatedly provoked cerulein-induced pancreatitis led to a slightly more severe pancreatitis. The rather small difference in comparison to controls could be due to the low expression of the transgene in the mouse pancreas.

  13. Morphological and nanomechanical behavior of supported lipid bilayers on addition of cationic surfactants.

    Science.gov (United States)

    Lima, Lia M C; Giannotti, Marina I; Redondo-Morata, Lorena; Vale, M Luísa C; Marques, Eduardo F; Sanz, Fausto

    2013-07-30

    The addition of surfactants to lipid bilayers is important for the modulation of lipid bilayer properties (e.g., in protein reconstitution and development of nonviral gene delivery vehicles) and to provide insight on the properties of natural biomembranes. In this work, the thermal behavior, organization, and nanomechanical stability of model cationic lipid-surfactant bilayers have been investigated. Two different cationic surfactants, hexadecyltrimethylammonium bromide (CTAB) and a novel derivative of the amino acid serine (Ser16TFAc), have been added (up to 50 mol %) to both liposomes and supported lipid bilayers (SLBs) composed by the zwitterionic phospholipid DPPC. The thermal phase behavior of mixed liposomes has been probed by differential scanning calorimetry (DSC), and the morphology and nanomechanical properties of mixed SLBs by atomic force microscopy-based force spectroscopy (AFM-FS). Although DSC thermograms show different results for the two mixed liposomes, when both are deposited on mica substrates similar trends on the morphology and the mechanical response of the lipid-surfactant bilayers are observed. DSC thermograms indicate microdomain formation in both systems, but while CTAB decreases the degree of organization on the liposome bilayer, Ser16TFAc ultimately induces the opposite effect. Regarding the AFM-FS studies, they show that microphase segregation occurs for these systems and that the effect is dependent on the surfactant content. In both SLB systems, different microdomains characterized by their height and breakthrough force Fb are formed. The molecular organization and composition is critically discussed in the light of our experimental results and literature data on similar lipid-surfactant systems. PMID:23782267

  14. Intense pseudotransport of a cationic drug mediated by vacuolar ATPase: Procainamide-induced autophagic cell vacuolization

    International Nuclear Information System (INIS)

    Cationic drugs frequently exhibit large apparent volumes of distribution, consistent with various forms of cellular sequestration. The contributions of organelles and metabolic processes that may mimic drug transport were defined in human vascular smooth muscle cells. We hypothesized that procainamide-induced vacuolar cytopathology is driven by intense pseudotransport mediated by the vacuolar (V)-ATPase and pursued the characterization of vesicular trafficking alterations in this model. Large amounts of procainamide were taken up by intact cells (maximal in 2 h, reversible upon washout, apparent KM 4.69 mM; fluorometric determination of cell-associated drug). Procainamide uptake was extensively prevented or reversed by pharmacological inhibition of the V-ATPase with bafilomycin A1 or FR 167356, decreased at low extracellular pH and preceded vacuolar cell morphology. However, the uptake of procainamide was unaffected by mitochondrial poisons that reduced the uptake of rhodamine 6G. Large vacuoles induced by millimolar procainamide were labeled with the late endosome/lysosome markers Rab7 and CD63 and the autophagy effector LC3; their osmotic formation (but not procainamide uptake) was reduced by extracellular mannitol and parallel to LC3 II formation. Procainamide-induced vacuolization is associated with defective endocytosis of fluorophore-labeled bovine serum albumin, but not with induction of the unfolded protein response. The contents of a vacuole subset slowly (≥ 24 h) become positive for Nile red staining (phospholipidosis-like response). V-ATPase-driven ion trapping is a form of intense cation pseudotransport that concerns the uncharged form of the drugs, and is associated with a vacuolar, autophagic and evolutive cytopathology and profound effects on vesicular trafficking

  15. Bioactive substance accumulation and septic complications in a burn trauma patient: effect of perioperative blood transfusion?

    DEFF Research Database (Denmark)

    Nielsen, H J; Reimert, C M; Dybkjaer, E;

    1997-01-01

    Evidence has emerged that suggests adverse effects to perioperative homologous blood transfusion are related to the age of the blood products. Recently, time-dependent accumulation of bioactive substances in red cell suspensions, standard platelet concentrates and fresh frozen plasma during storage...... cationic protein (ECP), eosinophil protein X (EPX), neutrophil myeloperoxidase (MPO) and interleukin 6 (IL-6) were drawn frequently from the patient before, during and after the operations, and from all transfused red cell, platelet and fresh frozen plasma units. Urine was sampled every hour during...... the first operation for analyses of ECP and EPX excretion. All analyses were performed by ELISA and RIA methods, and results compared to patient outcome. The patient received a total of 48 and 8 SAGM blood, 6 and 0 platelet and 12 and 4 fresh frozen plasma units at the two operations, respectively...

  16. Increased eosinophil activity in acute Plasmodium falciparum infection - association with cerebral malaria

    DEFF Research Database (Denmark)

    Kurtzhals, J A; Reimert, C M; Tette, E;

    1998-01-01

    To assess the eosinophil response to Plasmodium falciparum infection a cohort of initially parasite-free Ghanaian children was followed for 3 months. Seven of nine children who acquired an asymptomatic P. falciparum infection showed increase in eosinophil counts, while a decrease was found in seven...... of nine children with symptomatic malaria, and no change was observed in 14 children who remained parasite-free. In a hospital-based study, paediatric patients with cerebral malaria (CM), severe anaemia (SA), or uncomplicated malaria (UM) had uniformly low eosinophil counts during the acute illness...... followed by eosinophilia 30 days after cure. Plasma levels of eosinophil cationic protein (ECP) and eosinophil protein X (EPX) were measured as indicators of eosinophil activation. In spite of the low eosinophil counts, ECP levels were increased on day 0 and significantly higher in patients with CM...

  17. Charge-dependent dissociation of insulin cations via ion/ion electron transfer

    Science.gov (United States)

    Liu, Jian; Gunawardena, Harsha P.; Huang, Teng-Yi; McLuckey, Scott A.

    2008-10-01

    The dissociation reactions of various charge states of insulin cations obtained directly from nano-electrospray were investigated as a result of ion/ion electron transfer from azobenzene anions. Data were collected with and without simultaneous ion trap collisional excitation of the first generation charge-reduced product during the ion/ion reaction period. Neither separation of the two constituent chains nor cleavages within the loop defined by the disulfide bridges were observed under normal electron transfer dissociation (ETD) conditions for any of the charge states studied. However, substantial sequence coverage (exocyclic region: 82.6%; entire protein: 38.8%) outside the ring structure was obtained for insulin +6, while only limited coverage (exocyclic: 43.5%; entire protein: 20.4%) was observed for insulin +5 and no dissociation, aside from low abundance side-chain losses, was noted for insulin +4 and +3 in the normal ETD spectra. When the first generation charge-reduced precursor ions were subjected to collisional activation during the ion/ion reaction period, higher sequence coverages were obtained for both insulin +5 (entire protein: 34.7%) and +4 (entire protein: 20.4%) with backbone cleavages occurring within the loop defined by the disulfide bonds. Dissociation of insulin +3 was not significantly improved by the additional activation. Separation of the two constituent chains resulting from cleavages of both of the two disulfide bridges that link the chains was observed for insulin +6, +5, and +4 when the charge-reduced species were activated. The dissociation of disulfide linkages in this study suggests that as the charge state decreases, disulfide bond cleavages dominate over N-C[alpha] bond cleavages in the electron transfer dissociation process.

  18. Temperature-controlled interaction of thermosensitive polymer-modified cationic liposomes with negatively charged phospholipid membranes.

    Science.gov (United States)

    Kono, K; Henmi, A; Takagishi, T

    1999-09-21

    To obtain cationic liposomes of which affinity to negatively charged membranes can be controlled by temperature, cationic liposomes consisting of 3beta-[N-(N', N'-dimethylaminoethane)carbamoyl]cholesterol and dioleoylphosphatidylethanolamine were modified with poly(N-acryloylpyrrolidine), which is a thermosensitive polymer exhibiting a lower critical solution temperature (LCST) at ca. 52 degrees C. The unmodified cationic liposomes did not change its zeta potential between 20-60 degrees C. The polymer-modified cationic liposomes revealed much lower zeta potential values below the LCST of the polymer than the unmodified cationic liposomes. However, their zeta potential increased significantly above this temperature. The unmodified cationic liposomes formed aggregates and fused intensively with anionic liposomes consisting of egg yolk phosphatidylcholine and phosphatidic acid in the region of 20-60 degrees C, due to the electrostatic interaction. In contrast, aggregation and fusion of the polymer-modified cationic liposomes with the anionic liposomes were strongly suppressed below the LCST. However, these interactions were enhanced remarkably above the LCST. In addition, the polymer-modified cationic liposomes did not cause leakage of calcein from the anionic liposomes below the LCST, but promoted the leakage above this temperature as the unmodified cationic liposomes did. Temperature-induced conformational change of the polymer chains from a hydrated coil to a dehydrated globule might affect the affinity of the polymer-modified cationic liposomes to the anionic liposomes. PMID:10561483

  19. Abnormal expression of cerebrospinal fluid cation chloride cotransporters in patients with Rett syndrome.

    Directory of Open Access Journals (Sweden)

    Sofia Temudo Duarte

    Full Text Available OBJECTIVE: Rett Syndrome is a progressive neurodevelopmental disorder caused mainly by mutations in the gene encoding methyl-CpG-binding protein 2. The relevance of MeCP2 for GABAergic function was previously documented in animal models. In these models, animals show deficits in brain-derived neurotrophic factor, which is thought to contribute to the pathogenesis of this disease. Neuronal Cation Chloride Cotransporters (CCCs play a key role in GABAergic neuronal maturation, and brain-derived neurotrophic factor is implicated in the regulation of CCCs expression during development. Our aim was to analyse the expression of two relevant CCCs, NKCC1 and KCC2, in the cerebrospinal fluid of Rett syndrome patients and compare it with a normal control group. METHODS: The presence of bumetanide sensitive NKCC1 and KCC2 was analysed in cerebrospinal fluid samples from a control pediatric population (1 day to 14 years of life and from Rett syndrome patients (2 to 19 years of life, by immunoblot analysis. RESULTS: Both proteins were detected in the cerebrospinal fluid and their levels are higher in the early postnatal period. However, Rett syndrome patients showed significantly reduced levels of KCC2 and KCC2/NKCC1 ratio when compared to the control group. CONCLUSIONS: Reduced KCC2/NKCC1 ratio in the cerebrospinal fluid of Rett Syndrome patients suggests a disturbed process of GABAergic neuronal maturation and open up a new therapeutic perspective.

  20. Stress regulated members of the plant organic cation transporter family are localized to the vacuolar membrane

    Directory of Open Access Journals (Sweden)

    Koch Wolfgang

    2008-07-01

    Full Text Available Abstract Background In Arabidopsis six genes group into the gene family of the organic cation transporters (OCTs. In animals the members of the OCT-family are mostly characterized as polyspecific transporters involved in the homeostasis of solutes, the transport of monoamine neurotransmitters and the transport of choline and carnitine. In plants little is known about function, localisation and regulation of this gene family. Only one protein has been characterized as a carnitine transporter at the plasma membrane so far. Findings We localized the five uncharacterized members of the Arabidopsis OCT family, designated OCT2-OCT6, via GFP fusions and protoplast transformation to the tonoplast. Expression analysis with RNA Gel Blots showed a distinct, organ-specific expression pattern of the individual genes. With reporter gene fusion of four members we analyzed the tissue specific distribution of OCT2, 3, 4, and 6. In experiments with salt, drought and cold stress, we could show that AtOCT4, 5 and 6 are up-regulated during drought stress, AtOCT3 and 5 during cold stress and AtOCT 5 and 6 during salt stress treatments. Conclusion Localisation of the proteins at the tonoplast and regulation of the gene expression under stress conditions suggests a specific role for the transporters in plant adaptation to environmental stress.

  1. Surface Charge Density Determines the Efficiency of Cationic Gemini Surfactant Based Lipofection

    Science.gov (United States)

    Ryhänen, Samppa J.; Säily, Matti J.; Paukku, Tommi; Borocci, Stefano; Mancini, Giovanna; Holopainen, Juha M.; Kinnunen, Paavo K. J.

    2003-01-01

    The efficiencies of the binary liposomes composed of 1,2-dimyristoyl-sn-glycero-3-phosphocholine and cationic gemini surfactant, (2S,3R)-2,3-dimethoxy-1,4-bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide as transfection vectors, were measured using the enhanced green fluorescent protein coding plasmid and COS-1 cells. Strong correlation between the transfection efficiency and lipid stoichiometry was observed. Accordingly, liposomes with XSR−1 ≥ 0.50 conveyed the enhanced green fluorescent protein coding plasmid effectively into cells. The condensation of DNA by liposomes with XSR−1 > 0.50 was indicated by static light scattering and ethidium bromide intercalation assay, whereas differential scanning calorimetry and fluorescence anisotropy of diphenylhexatriene revealed stoichiometry dependent reorganization in the headgroup region of the liposome bilayer, in alignment with our previous Langmuir-balance study. Surface charge density and the organization of positive charges appear to determine the mode of interaction of DNA with (2S,3R)-2,3-dimethoxy-1,4-bis(N-hexadecyl-N,N-dimethylammonium)butane dibromide/1,2-dimyristoyl-sn-glycero-3-phosphocholine liposomes, only resulting in DNA condensation when XSR−1 > 0.50. Condensation of DNA in turn seems to be required for efficient transfection. PMID:12524311

  2. Cationic Polyphosphazene Vesicles for Cancer Immunotherapy by Efficient in Vivo Cytokine IL-12 Plasmid Delivery.

    Science.gov (United States)

    Gao, Menghua; Zhu, Xiumei; Wu, Liping; Qiu, Liyan

    2016-06-13

    To circumvent the severe toxicity of the systemic delivery of IL-12 protein and the limits of local administration of IL-12 gene, we constructed a polymersome system for systemic delivery of recombinant murine IL-12 plasmid (pmIL-12) based on amphiphilic polyphosphazenes containing weakly cationic N,N-diisopropylethylenediamine (DPA) as hydrophobic groups and monomethoxy poly(ethylene glycol) (mPEG) as hydrophilic tails. By simple dialysis method, pmIL-12 was successfully loaded into polymersomes due to the combination effect of physical encapsulation and electrostatic interaction. This pmIL-12 polymersome delivery system was validated with good biocompatibility and stability despite of serum protein and DNase challenging. The results of in vivo antitumor experiments showed that intravenous injection of pmIL-12 polymersomes achieved significant suppression of tumor growth in BALB/c mice bearing CT-26 colon carcinoma. The analysis revealed that the mechanism was related to the antitumor immune response induced by efficient transfection of pmIL-12 polymersomes, which maybe involved lymphocytes infiltration and angiogenic inhibition at the tumor site. PMID:27192398

  3. Isolation of lactoperoxidase using different cation exchange resins by batch and column procedures.

    Science.gov (United States)

    Fweja, Leonard Wt; Lewis, Michael J; Grandison, Alistair S

    2010-08-01

    Lactoperoxidase (LP) was isolated from whey protein by cation-exchange using Carboxymethyl resin (CM-25C) and Sulphopropyl Toyopearl resin (SP-650C). Both batch and column procedures were employed and the adsorption capacities and extraction efficiencies were compared. The resin bed volume to whey volume ratios were 0.96:1.0 for CM-25C and 0.64:1.0 for SP-650 indicating higher adsorption capacity of SP-650 compared with CM-25C. The effluent LP activity depended on both the enzyme activity in the whey and the amount of whey loaded on the column within the saturation limits of the resin. The percentage recovery was high below the saturation point and fell off rapidly with over-saturation. While effective recovery was achieved with column extraction procedures, the recovery was poor in batch procedures. The whey-resin contact time had little impact on the enzyme adsorption. SDS PAGE and HPLC analyses were also carried out, the purity was examined and the proteins characterised in terms of molecular weights. Reversed phase HPLC provided clear distinction of the LP and lactoferrin (LF) peaks. The enzyme purity was higher in column effluents compared with batch effluents, judged on the basis of the clarity of the gel bands and the resolved peaks in HPLC chromatograms.

  4. Involvement of Transient Receptor Potential Cation Channel Vanilloid 1 (TRPV1) in Myoblast Fusion.

    Science.gov (United States)

    Kurosaka, Mitsutoshi; Ogura, Yuji; Funabashi, Toshiya; Akema, Tatsuo

    2016-10-01

    The mechanisms that underlie the complex process of muscle regeneration after injury remain unknown. Transient receptor potential cation channel vanilloid 1 (TRPV1) is expressed in several cell types, including skeletal muscle, and is activated by high temperature and by certain molecules secreted during tissue inflammation. Severe inflammation and local temperature perturbations are induced during muscle regeneration, which suggests that TRPV1 might be activated and involved in the process. The aim of this study, was to clarify the role of TRPV1 in the myogenic potential of satellite cells responsible for muscle regeneration. We found that mRNA and protein levels of TRPV1 increased during regeneration after cardiotoxin (CTX)-induced muscle injury in mice. Using isolated mouse satellite cells (i.e., myoblasts), we observed that activation of TRPV1 by its agonist capsaicin (CAP) augmented myogenin protein levels. Whereas CAP did not alter myoblast proliferation, it facilitated myoblast fusion (evaluated using myonucleii number per myotube and fusion index). In contrast, suppression of TRPV1 by siRNA impaired myoblast fusion. Using mice, we also demonstrated that intramuscular injection of CAP facilitated muscle repair after CTX-induced muscle injury. Moreover, we showed that these roles of TRPV1 might be mediated by interleukin-4 and calcium signaling during myoblast fusion. Collectively, these results suggest that TRPV1 underlies normal myogenesis through promotion of myoblast fusion. J. Cell. Physiol. 231: 2275-2285, 2016. © 2016 Wiley Periodicals, Inc. PMID:26892397

  5. Heat-induced stabilization of the nuclear matrix is independent of divalent cations and high versus low salt extraction

    International Nuclear Information System (INIS)

    The authors devised a method to determine the structural integrity of the nuclear matrix. Nuclear matrices are prepared from exponentially growing cultures of control or heat shocked (450, 30') HeLa cells by DNase I digestion and high (3M) salt extraction of isolated nuclei. After staining with Fluorescein isothiocyanate for protein and Propidium Iodide for double stranded nuclei acids, these parameters and forward angle light scatter are quantitated simultaneously by a flow cytometer. PI quantitation indicates that matrices from heated cells are 2-4 fold more resistant to ribonuclease than those from control cells. This result suggests that the excess protein accumulated in the matrix due to heat shock may mask associated RNA from nucleolytic attack. In the absence of divalent cations (Mg/sup 2+/ and Ca/sup 2+/) matrices from heated cells remain RNase resistant but those from control cells lose all particulate integrity as a result of exposure to RNase. The RNase resistance of matrices from heat shocked cells is also evident when DNase I treated nuclei are extracted by a low salt procedure which has been shown to eliminate randomization of matrix associated DNA sequences due to high salt (Cell 39:223,1984). Thus the nuclease protection of double stranded RNA due to heat is not an artifact of salt-induced randomization of matrix associated DNA sequences. Heat also overcomes the divalent cation requirement for matrix stability after RNase treatment

  6. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    International Nuclear Information System (INIS)

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500-bar C in the vacancy range below 4mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially

  7. Cationic zinc organyls as precatalysts for hydroamination reactions.

    Science.gov (United States)

    Chilleck, Maren A; Hartenstein, Larissa; Braun, Thomas; Roesky, Peter W; Braun, Beatrice

    2015-02-01

    The cationic zinc triple-decker complex [Zn2 Cp*3 ](+) [BAr(F) 4 ](-) (BAr(F) 4 =B(3,5-(CF3 )2 C6 H3 )4 ) exhibits catalytic activity in intra- and intermolecular hydroamination reactions in the absence of a cocatalyst. These hydroaminations presumably proceed through the activation of the C-C multiple bond of the alkene or alkyne by a highly electrophilic zinc species, which is formed upon elimination of the Cp* ligands. The reaction of [Zn2 Cp*3 ](+) [BAr(F) 4 ](-) with henylacetylene gives the hydrocarbonation product (Cp*)(Ph)CCH2 , which might be formed via a similar reaction pathway. Additionally, several other structurally well-defined cationic zinc organyls have been examined as precatalysts for intermolecular hydroamination reactions without the addition of a cocatalyst. These studies reveal that the highest activity is achieved in the absence of any donor ligands. The neutral complex [ZnCp(2S) 2 ] (Cp(2S) =C5 Me4 (CH2 )2 SMe) shows a remarkably high catalytic activity in the presence of a Brønsted acid. PMID:25522205

  8. Metal cations inserted in vanadium-oxide nanotubes

    International Nuclear Information System (INIS)

    Vanadium-oxide nanotubes (VO x-NTs) consist of nanosize cylinders of thin, easily bent vanadyl (VO x) wall chains, which are open at both ends. Surfactant molecules (e.g. C12H27N) can be easily trapped in the interior of the nanotube walls. The structure of as-synthesized VO x-NTs are observed to collapse to an amorphous vanadium oxide at temperatures greater than 250 deg, C. This happens, even under a protective atmosphere. This property makes the VO x-NTs unusable as a catalyst at temperatures between 400-500 deg, C, which is the temperature range where many applications would exist. In order to increase the thermal stability of VO x-NTs several exchange reactions have been used to modify the original nanotubes. In these reactions metallic cations (Cd2+, Co2+, Mn2+ or Zn2+) were introduced. It was observed that that the morphology of the nanotubes remained unchanged after the exchange reactions were performed. In order to characterize the exchanged VO x-NTs the following analytic techniques were used: scanning electron microscopy, X-ray powder diffraction, Fourier transform infrared, particle-induced X-ray emission and Rutherford backscattering spectrometry. The results showed that the VO x-NTs exchanged with metallic cations have preserved their tubular morphology. However, it has not been possible to fully perform a 100% efficient exchange reaction

  9. Cationic Nanocylinders Promote Angiogenic Activities of Endothelial Cells

    Directory of Open Access Journals (Sweden)

    Jung Bok Lee

    2016-01-01

    Full Text Available Polymers have been used extensively taking forms as scaffolds, patterned surface and nanoparticle for regenerative medicine applications. Angiogenesis is an essential process for successful tissue regeneration, and endothelial cell–cell interaction plays a pivotal role in regulating their tight junction formation, a hallmark of angiogenesis. Though continuous progress has been made, strategies to promote angiogenesis still rely on small molecule delivery or nuanced scaffold fabrication. As such, the recent paradigm shift from top-down to bottom-up approaches in tissue engineering necessitates development of polymer-based modular engineering tools to control angiogenesis. Here, we developed cationic nanocylinders (NCs as inducers of cell–cell interaction and investigated their effect on angiogenic activities of human umbilical vein endothelial cells (HUVECs in vitro. Electrospun poly (l-lactic acid (PLLA fibers were aminolyzed to generate positively charged NCs. The aninolyzation time was changed to produce two different aspect ratios of NCs. When HUVECs were treated with NCs, the electrostatic interaction of cationic NCs with negatively charged plasma membranes promoted migration, permeability and tubulogenesis of HUVECs compared to no treatment. This effect was more profound when the higher aspect ratio NC was used. The results indicate these NCs can be used as a new tool for the bottom-up approach to promote angiogenesis.

  10. Cationic gadolinium chelate for magnetic resonance imaging of cartilaginous defects.

    Science.gov (United States)

    Nwe, Kido; Huang, Ching-Hui; Qu, Feini; Warden-Rothman, Robert; Zhang, Clare Y; Mauck, Robert L; Tsourkas, Andrew

    2016-05-01

    The ability to detect meniscus defects by magnetic resonance arthrography (MRA) can be highly variable. To improve the delineation of fine tears, we synthesized a cationic gadolinium complex, (Gd-DOTA-AM4 )(2+) , that can electrostatically interact with Glycosaminoglycans (GAGs). The complex has a longitudinal relaxivity (r1) of 4.2 mM(-1) s(-1) and is highly stable in serum. Its efficacy in highlighting soft tissue tears was evaluated in comparison to a clinically employed contrast agent (Magnevist) using explants obtained from adult bovine menisci. In all cases, Gd-DOTA-AM4 appeared to improve the ability to detect the soft tissue defect by providing increased signal intensity along the length of the tear. Magnevist shows a strong signal near the liquid-meniscus interface, but much less contrast is observed within the defect at greater depths. This provides initial evidence that cationic contrast agents can be used to improve the diagnostic accuracy of MRA. Copyright © 2016 John Wiley & Sons, Ltd.

  11. High and rapid alkali cation storage in ultramicroporous carbonaceous materials

    Science.gov (United States)

    Yun, Young Soo; Lee, Seulbee; Kim, Na Rae; Kang, Minjee; Leal, Cecilia; Park, Kyu-Young; Kang, Kisuk; Jin, Hyoung-Joon

    2016-05-01

    To achieve better supercapacitor performance, efforts have focused on increasing the specific surface area of electrode materials to obtain higher energy and power density. The control of pores in these materials is one of the most effective ways to increase the surface area. However, when the size of pores decreases to a sub-nanometer regime, it becomes difficult to apply the conventional parallel-plate capacitor model because the charge separation distance (d-value) of the electrical double layer has a similar length scale. In this study, ultramicroporous carbonaceous materials (UCMs) containing sub-nanometer-scale pores are fabricated using a simple in situ carbonization/activation of cellulose-based compounds containing potassium. The results show that alkali cations act as charge carriers in the ultramicropores (<0.7 nm), and these materials can deliver high capacitances of ∼300 F g-1 at 0.5 A g-1 and 130 F g-1, even at a high current rate of 65 A g-1 in an aqueous medium. In addition, the UCM-based symmetric supercapacitors are stable over 10,000 cycles and have a high energy and power densities of 8.4 Wh kg-1 and 15,000 W kg-1, respectively. This study provides a better understanding of the effects of ultramicropores in alkali cation storage.

  12. Cation distribution and magnetic properties of natural chromites

    Energy Technology Data Exchange (ETDEWEB)

    Rais, A.; Yousif, A.A.; Al-shihi, M.H.; Al-rawas, A.D.; Gismelseed, A.M.; El-zain, M.E. [Department of Physics, College of Science, Sultan Qaboos University (Oman)

    2003-10-01

    Ten specimens of chromites from Oman ophiolites have been studied using magnetic susceptibility {chi} measurements, Moessbauer spectroscopy (MS), Scanning electron microscopy (SEM), and X-ray diffraction (XRD). XRD shows that all samples have a face-centered cubic spinel structure. MS analysis and SEM data at room temperature enabled to derive the chemical formula and the cations distribution among tetrahedral (A1 and A2) and octahedral (B) sites. For all specimens, paramagnetic variations of 1/{chi} with the temperature T show a systematic curve bending at a critical temperature T{sub 0}, which indicates a change of the effective paramagnetic moment {mu}{sub eff}. This deviation from Curie-Weiss law is interpreted as due to spin inversion of a fraction {delta} of Cr{sup 3+} cations located in the octahedral sites of the spinel structure. This interpretation is supported by a decrease in the Moessbauer peak areas of Fe{sup 2+} located in A1 sites from 300 to 80 K at the expense of Fe{sup 2+} located in A2 sites. The values of {delta} and {mu}{sub eff} for each specimen are calculated by fitting this model separately to the experimental 1/{chi} versus T above and below T{sub 0}. (Abstract Copyright [2003], Wiley Periodicals, Inc.)

  13. Cationic Polyene Phospholipids as DNA Carriers for Ocular Gene Therapy

    Directory of Open Access Journals (Sweden)

    Susana Machado

    2014-01-01

    Full Text Available Recent success in the treatment of congenital blindness demonstrates the potential of ocular gene therapy as a therapeutic approach. The eye is a good target due to its small size, minimal diffusion of therapeutic agent to the systemic circulation, and low immune and inflammatory responses. Currently, most approaches are based on viral vectors, but efforts continue towards the synthesis and evaluation of new nonviral carriers to improve nucleic acid delivery. Our objective is to evaluate the efficiency of novel cationic retinoic and carotenoic glycol phospholipids, designated C20-18, C20-20, and C30-20, to deliver DNA to human retinal pigmented epithelium (RPE cells. Liposomes were produced by solvent evaporation of ethanolic mixtures of the polyene compounds and coformulated with 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE or cholesterol (Chol. Addition of DNA to the liposomes formed lipoplexes, which were characterized for binding, size, biocompatibility, and transgene efficiency. Lipoplex formulations of suitable size and biocompatibility were assayed for DNA delivery, both qualitatively and quantitatively, using RPE cells and a GFP-encoding plasmid. The retinoic lipoplex formulation with DOPE revealed a transfection efficiency comparable to the known lipid references 3β-[N-(N′,N′-dimethylaminoethane-carbamoyl]-cholesterol (DC-Chol and 1,2-dioleoyl-sn-glycero-3-ethylphosphocholine (EPC and GeneJuice. The results demonstrate that cationic polyene phospholipids have potential as DNA carriers for ocular gene therapy.

  14. Dendrisomes: vesicular structures derived from a cationic lipidic dendron.

    Science.gov (United States)

    Al-Jamal, Khuloud T; Sakthivel, Thiagarajan; Florence, Alexander T

    2005-01-01

    The behavior of a novel synthetic lipidic cationic lysine-based dendron (partial dendrimer) in aqueous media and its ability, with and without cholesterol, to self-assemble into higher order structures was studied to gain an understanding of these structures as potential drug carriers. The dendron was prepared by solid-phase peptide synthesis. A reverse-phase evaporation (REV) technique was used to prepare cationic vesicular aggregates of the dendron with different molar ratios of cholesterol. The size and zeta potential of these supramolecular aggregates or "dendrisomes" was determined by photon correlation spectroscopy (PCS). Dendrisome morphology and thermotropic properties were studied by transmission electron microscopy (TEM) and differential scanning calorimetry (DSC). Radiolabeled penicillin G was used as a model of a negatively charged water-soluble compound to investigate the encapsulation efficiency of the dendrisomes. In vitro release of the drug was determined using as a comparator a REV liposome formulation. Dendrisomes of all compositions have higher encapsulation efficiencies and slower release rates compared to the comparator. Cholesterol was found both to increase the size of the aggregates from around 310 to 560 nm and to increase shape irregularities, but did not change the positive zeta potential, in the order of +50 mV, of the dendrisomes. Cholesterol decreases penicillin G entrapment efficiency but increases solute leakage at 25 degrees C. PMID:15761934

  15. Source of Lake Vostok Cations Constrained with Strontium Isotopes

    Science.gov (United States)

    Lyons, William; Welch, Kathleen; Priscu, John; Tranter, Martyn; Royston-Bishop, George

    2016-08-01

    Lake Vostok is the largest sub-glacial lake in Antarctica. The primary source of our current knowledge regarding the geochemistry and biology of the lake comes from the analysis of refrozen lake water associated with ice core drilling. Several sources of dissolved ions and particulate matter to the lake have been proposed, including materials from the melted glacier ice, the weathering of underlying geological materials, hydrothermal activity and underlying, ancient evaporitic deposits. A sample of Lake Vostok Type 1 accretion ice has been analyzed for its 87Sr/86Sr signature as well as its major cation and anion and Sr concentrations. The strontium isotope ratio of 0.71655 and the Ca/Sr ratio in the sample strongly indicate that the major source of the Sr is from aluminosilicate minerals from the continental crust. These data imply that at least a portion of the other cations in the Type 1 ice also are derived from continental crustal materials and not hydrothermal activity, the melted glacier ice, or evaporitic sources.

  16. Diffusion of anions and cations in compacted sodium bentonite

    International Nuclear Information System (INIS)

    The thesis presents the results of studies on the diffusion mechanisms of anions and cations in compacted sodium bentonite, which is planned to be used as a buffer material in nuclear waste disposal in Finland. The diffusivities and sorption factors were determined by tracer experiments. The pore volume accessible to chloride, here defined as effective porosity, was determined as a function of bentonite density and electrolyte concentration in water, and the Stern-Gouy double-layer model was used to explain the observed anion exclusion. The sorption of Cs+ and Sr2+ was studied in loose and compacted bentonite samples as a function of the electrolyte concentration in solution. In order to obtain evidence of the diffusion of exchangeable cations, defined as surface diffusion, the diffusivities of Cs+ and Sr2+ in compacted bentonite were studied as a function of the sorption factor, which was varied by electrolyte concentration in solution. The measurements were performed both by a non-steady state method and by a through-diffusion method. (89 refs., 35 fig., 4 tab.)

  17. Lethal bacterial trap: Cationic surface for endodontic sealing.

    Science.gov (United States)

    Kesler Shvero, Dana; Zaltsman, Nathan; Weiss, Ervin I; Polak, David; Hazan, Ronen; Beyth, Nurit

    2016-02-01

    Insoluble antibacterial cationic nanoparticles have been previously shown to have potent and long-lasting antibacterial properties. Our tested hypothesis was that root canal pathogens will be attracted to and eliminated when exposed to epoxy resin-based surfaces incorporating cationic nanoparticles. In our research, an epoxy resin-based surface incorporating quaternary ammonium polyethyleneimine (QPEI) nanoparticles was evaluated. Surface characterization was performed using atomic force microscopy and X-ray photoelectron spectra. The surface anti-Enterococcus faecalis effect was evaluated in an anti-gravitational model. Cell membrane potential, viability, biofilm thickness, and biomass were tested using flow cytometry and confocal laser scanning microscopy. Additionally, the antibiofilm activity of the bacterial supernatant was assessed. The surface characterization showed QPEI nanoparticle embedment on the modified sealer. The epoxy resin-based surface incorporating the QPEI nanoparticles actively attracted bacteria, causing membrane destabilization, and bacterial death. The supernatant of bacteria pre-exposed to QPEI showed an antibacterial effect. In conclusion, the tested epoxy resin-based surface incorporating QPEI nanoparticles traps and kills bacteria. The nanoparticles attracted bacteria, reducing their viability, and promoting cell death. PMID:26418438

  18. Influence of a cationic polysaccharide on starch functionality.

    Science.gov (United States)

    Raguzzoni, Josiane C; Delgadillo, Ivonne; Lopes da Silva, José A

    2016-10-01

    Fundamental rheology, differential scanning calorimetry and infrared spectroscopy have been used to evaluate the effect of a cationic polysaccharide, chitosan, on the gelatinization, gel formation and retrogradation of maize starch samples, under acidic aqueous conditions. Moderate acidic conditions (0.1molL(-1) acetic acid) have shown a (slight) positive effect on starch gelatinization process and structure development. The presence of chitosan increased the DSC onset gelatinization temperature and also shifted the onset of the storage modulus increase to higher temperatures. Formation of the starch gel, mainly gelation of the leached-out amylose, is somehow hindered by the presence of the cationic polysaccharide and, therefore, the retrogradation of starch at very early stage can be delayed by addition of chitosan. However, long-term retrogradation was slightly increased. FTIR pectroscopy did not reveal any significant interaction between both polysaccharides what is in accordance with the observed rheological behavior. Small additions of chitosan to starch-rich systems may be a useful strategy to obtain new textures with novel phase transition behaviors. PMID:27312647

  19. USING COLLOIDAL LAYERED DOUBLE HYDROXIDES AS CATIONIC MICROPARTICULATE COMPONENT

    Institute of Scientific and Technical Information of China (English)

    Songlin Wang; Wenxia Liu

    2004-01-01

    Layered double hydroxides consisting of layers with cationic charges may be potential candidates of cationic microparticles forming synergetic retention effect with anionic polyacrylamide. In this work, the layered double hydroxides with various molar ratios of Mg/Al were synthesized by co-precipitation of magnesium chloride and aluminum chloride and peptized by intense washing with water. The chemical formula, particle size, Zeta potential of the layered double hydroxide were analyzed. It was found that positively charged magnesium aluminum hydroxide with particle diameter in nanoparticle size could be prepared. The Zeta potential and particle size vary with the feed molar ratio of Mg/Al and the peptizing process, respectively. The Zeta potential is also pH dependent. The retention experiments carried out on DDJ show that when used together with anionic polyacrylamide, the positively charged colloidal double hydroxide greatly improves the retention of reed pulps. The chemical formula, particle size and Zeta potential of the colloidal double hydroxide all affect its retention behavior.

  20. Role of Reverse Divalent Cation Diffusion in Forward Osmosis Biofouling.

    Science.gov (United States)

    Xie, Ming; Bar-Zeev, Edo; Hashmi, Sara M; Nghiem, Long D; Elimelech, Menachem

    2015-11-17

    We investigated the role of reverse divalent cation diffusion in forward osmosis (FO) biofouling. FO biofouling by Pseudomonas aeruginosa was simulated using pristine and chlorine-treated thin-film composite polyamide membranes with either MgCl2 or CaCl2 draw solution. We related FO biofouling behavior-water flux decline, biofilm architecture, and biofilm composition-to reverse cation diffusion. Experimental results demonstrated that reverse calcium diffusion led to significantly more severe water flux decline in comparison with reverse magnesium permeation. Unlike magnesium, reverse calcium permeation dramatically altered the biofilm architecture and composition, where extracellular polymeric substances (EPS) formed a thicker, denser, and more stable biofilm. We propose that FO biofouling was enhanced by complexation of calcium ions to bacterial EPS. This hypothesis was confirmed by dynamic and static light scattering measurements using extracted bacterial EPS with the addition of either MgCl2 or CaCl2 solution. We observed a dramatic increase in the hydrodynamic radius of bacterial EPS with the addition of CaCl2, but no change was observed after addition of MgCl2. Static light scattering revealed that the radius of gyration of bacterial EPS with addition of CaCl2 was 20 times larger than that with the addition of MgCl2. These observations were further confirmed by transmission electron microscopy imaging, where bacterial EPS in the presence of calcium ions was globular, while that with magnesium ions was rod-shaped.

  1. Cationic gadolinium chelate for magnetic resonance imaging of cartilaginous defects.

    Science.gov (United States)

    Nwe, Kido; Huang, Ching-Hui; Qu, Feini; Warden-Rothman, Robert; Zhang, Clare Y; Mauck, Robert L; Tsourkas, Andrew

    2016-05-01

    The ability to detect meniscus defects by magnetic resonance arthrography (MRA) can be highly variable. To improve the delineation of fine tears, we synthesized a cationic gadolinium complex, (Gd-DOTA-AM4 )(2+) , that can electrostatically interact with Glycosaminoglycans (GAGs). The complex has a longitudinal relaxivity (r1) of 4.2 mM(-1) s(-1) and is highly stable in serum. Its efficacy in highlighting soft tissue tears was evaluated in comparison to a clinically employed contrast agent (Magnevist) using explants obtained from adult bovine menisci. In all cases, Gd-DOTA-AM4 appeared to improve the ability to detect the soft tissue defect by providing increased signal intensity along the length of the tear. Magnevist shows a strong signal near the liquid-meniscus interface, but much less contrast is observed within the defect at greater depths. This provides initial evidence that cationic contrast agents can be used to improve the diagnostic accuracy of MRA. Copyright © 2016 John Wiley & Sons, Ltd. PMID:26853708

  2. Effect of cationic monomer on properties of fluorinated acrylate latex

    Institute of Scientific and Technical Information of China (English)

    Li Jun Chen

    2012-01-01

    Cationic fluorinated acrylate latex was prepared via semi-continuous emulsion copolymerization of cationic monomer and other monomers.The resultant latex and its film were characterized with dynamic light scattering detector and contact angle meter.Influences of amount of DMDAAC on the properties of resultant latex and its film were investigated in detail.Results show that the particle size of the latex has the minimum value and the zeta potential of the latex is increased when the amount of DMDAAC is increased.In addition,the particle size of the latex is unimodal distribution when the amount of DMDAAC is not more than 2.5%.However,the particle size of the latex is bimodal distribution when the amount of DMDAAC is more than 2.5%.The contact angle is varied slightly with the increase of amount of DMDAAC when it is not more than 2.5%.Nevertheless,the contact angle is decreased with the increase of the amount of DMDAAC when it is more than 25%.

  3. Role of Reverse Divalent Cation Diffusion in Forward Osmosis Biofouling.

    Science.gov (United States)

    Xie, Ming; Bar-Zeev, Edo; Hashmi, Sara M; Nghiem, Long D; Elimelech, Menachem

    2015-11-17

    We investigated the role of reverse divalent cation diffusion in forward osmosis (FO) biofouling. FO biofouling by Pseudomonas aeruginosa was simulated using pristine and chlorine-treated thin-film composite polyamide membranes with either MgCl2 or CaCl2 draw solution. We related FO biofouling behavior-water flux decline, biofilm architecture, and biofilm composition-to reverse cation diffusion. Experimental results demonstrated that reverse calcium diffusion led to significantly more severe water flux decline in comparison with reverse magnesium permeation. Unlike magnesium, reverse calcium permeation dramatically altered the biofilm architecture and composition, where extracellular polymeric substances (EPS) formed a thicker, denser, and more stable biofilm. We propose that FO biofouling was enhanced by complexation of calcium ions to bacterial EPS. This hypothesis was confirmed by dynamic and static light scattering measurements using extracted bacterial EPS with the addition of either MgCl2 or CaCl2 solution. We observed a dramatic increase in the hydrodynamic radius of bacterial EPS with the addition of CaCl2, but no change was observed after addition of MgCl2. Static light scattering revealed that the radius of gyration of bacterial EPS with addition of CaCl2 was 20 times larger than that with the addition of MgCl2. These observations were further confirmed by transmission electron microscopy imaging, where bacterial EPS in the presence of calcium ions was globular, while that with magnesium ions was rod-shaped. PMID:26503882

  4. Growth Hormone Therapy Is Safe and Effective in Patients with Lysinuric Protein Intolerance

    OpenAIRE

    Niinikoski, Harri; Lapatto, Risto; Nuutinen, Matti; Tanner, Laura; Simell, Olli; Näntö-Salonen, Kirsti

    2011-01-01

    Background: Lysinuric protein intolerance (LPI) is an autosomal recessive cationic amino acid transport defect characterized by episodes of postprandial hyperammonemias and spontaneous protein aversion. Subnormal growth is common in spite of appropriate nutritional therapy. Growth hormone (GH) therapy promotes appetite, protein synthesis and accretion, but its possible growth-promoting effects and safety in patients with LPI are poorly known.

  5. Protein Foods

    Science.gov (United States)

    ... Text Size: A A A Listen En Español Protein Foods Foods high in protein such as fish, ... the vegetarian proteins, whether they have carbohydrate. Best Protein Choices The best choices are: Plant-based proteins ...

  6. A Novel Method for the Determination of Membrane Hydration Numbers of Cations in Conducting Polymers

    DEFF Research Database (Denmark)

    Jafeen, M.J.M.; Careem, M.A.; Skaarup, Steen

    2012-01-01

    Polypyrrole polymer films doped with the large, immobile dodecy lbenzene sulfonate anions operating in alkali halide aqueous electroly tes has beenused as a novel physico-chemical environment to develop a more direct way of obtaining reliable values for the hydration numbers of cations. Simultane......Polypyrrole polymer films doped with the large, immobile dodecy lbenzene sulfonate anions operating in alkali halide aqueous electroly tes has beenused as a novel physico-chemical environment to develop a more direct way of obtaining reliable values for the hydration numbers of cations...... reduction process. The goal was to investigate both the effects of cation size and of cation charge. The membrane hydration number values obtained by this simple and direct method for a number of cations are: The hydration number for all of these cations seems to follow the same simple relation....

  7. Flexible polyelectrolyte conformation in the presence of cationic and anionic surfactants

    Science.gov (United States)

    Passos, C. B.; Kuhn, P. S.; Diehl, A.

    2015-11-01

    In this work we have studied the conformation of flexible polyelectrolyte chains in the presence of cationic and anionic surfactant molecules. We developed a simple theoretical model for the formation of the polyelectrolyte-cationic surfactant complexes and mixed micelles formed by cationic and anionic surfactant molecules, in the framework of the Debye-Hückel-Bjerrum-Manning and Flory theories, with the hydrophobic interaction included explicitly as an effective short-ranged attraction between the surfactant hydrocarbon tails. This simple model allows us to calculate the extension of the polyelectrolyte-cationic surfactant complexes as a function of the anionic surfactant concentration, for different types of cationic and anionic surfactant molecules. A discrete conformational transition from a collapsed state to an elongated coil was found, for all surfactant chain lengths we have considered, in agreement with the experimental observations for the unfolding of ​DNA-cationic surfactant complexes.

  8. Atomistic understanding of cation exchange in PbS nanocrystals using simulations with pseudoligands

    Science.gov (United States)

    Fan, Zhaochuan; Lin, Li-Chiang; Buijs, Wim; Vlugt, Thijs J. H.; van Huis, Marijn A.

    2016-05-01

    Cation exchange is a powerful tool for the synthesis of nanostructures such as core-shell nanocrystals, however, the underlying mechanism is poorly understood. Interactions of cations with ligands and solvent molecules are systematically ignored in simulations. Here, we introduce the concept of pseudoligands to incorporate cation-ligand-solvent interactions in molecular dynamics. This leads to excellent agreement with experimental data on cation exchange of PbS nanocrystals, whereby Pb ions are partially replaced by Cd ions from solution. The temperature and the ligand-type control the exchange rate and equilibrium composition of cations in the nanocrystal. Our simulations reveal that Pb ions are kicked out by exchanged Cd interstitials and migrate through interstitial sites, aided by local relaxations at core-shell interfaces and point defects. We also predict that high-pressure conditions facilitate strongly enhanced cation exchange reactions at elevated temperatures. Our approach is easily extendable to other semiconductor compounds and to other families of nanocrystals.

  9. Advance chromatin extraction enhances performance and productivity of cation exchange chromatography-based capture of Immunoglobulin G monoclonal antibodies.

    Science.gov (United States)

    Nian, Rui; Gagnon, Pete

    2016-07-01

    The impact of host cell-derived chromatin was investigated on the performance and productivity of cation exchange chromatography as a method for capture-purification of an IgG monoclonal antibody. Cell culture supernatant was prepared for loading by titration to pH 6.0, dilution with water to a conductivity of 4mS/cm, then microfiltration to remove solids. DNA content was reduced 99% to 30ppm, histone host cell protein content by 76% to 6300ppm, non-histone host cell protein content by 15% to 321,000ppm, and aggregates from 33% to 15%. IgG recovery was 83%. An alternative preparation was performed, adding octanoic acid, allantoin, and electropositive particles to the harvest at pH 5.3, then removing solids. DNA content was reduced to<1 ppb, histones became undetectable, non-histones were reduced to 24,000ppm, and aggregates were reduced to 2.4%. IgG recovery was 95%. This treatment increased dynamic capacity (DBC) of cation exchange capture to 173g/L and enabled the column to reduce non-histone host proteins to 671ppm. Step recovery was 99%. A single multimodal polishing step further reduced them to 15ppm and aggregates to <0.1%. Overall process recovery was 89%. Productivity at feed stream IgG concentrations of 5-10g/L was roughly double the productivity of a same-size protein A column with a DBC of 55g/L. PMID:27247214

  10. Tryptophan fluorescence quenching by alkaline earth metal cations in deionized bacteriorhodopsin.

    Science.gov (United States)

    Wang, G; Wang, A J; Hu, K S

    2000-12-01

    Tryptophan quenching by the addition of alkaline earth metal cations to deionized bacteriorhodopsin suspensions was determined. The results show that the addition of cation primarily quenches fluorescence from surface tryptophan residues. The quenched intensity exhibits a 1/R dependence, where R is the ionic radius of the corresponding metal ion. This observation results from a stronger energy transfer coupling between the tryptophan and the retinal. The membrane curvature may be involved as a result of cations motion and correlated conformational changes. PMID:11332888

  11. Removal of metal cations from wastewater using recycled wool-based non-woven material

    OpenAIRE

    MAJA RADETIC; DARINKA RADOJEVIC; VESNA ILIC; DRAGAN JOCIC; DRAGAN POVRENOVIC; BRANISLAV POTKONJAK; NEVENA PUAC; PETAR JOVANCIC

    2007-01-01

    In this study, the effect of low-temperature air plasma, biopolymer chitosan and hydrogen peroxide treatment of recycled wool-based non-woven material on metal cation uptake was investigated. Recycled wool-based material either as an untreated or modified material showed ability to bind all investigated metal cations in the following order: Pb2+>Cu2+>Zn2+>Co2+. Material performed good selectivity due to distinct sorption rates of studied metal cations.

  12. The interaction of gold and silver nanoparticles with a range of anionic and cationic dyes

    OpenAIRE

    Kitching, H; Kenyon, A. J.; Parkin, I. P.

    2014-01-01

    We describe the synthesis of charge-stabilised gold and silver nanoparticles by a modified Turkevich method and their interaction with a selection of cationic and anionic dyes. It was found that gold nanoparticles interact strongly with cationic dyes and in some cases enhanced absorption was observed by UV-visible spectroscopy. It is also shown that addition of cationic dyes to gold nanoparticles triggers aggregation of the nanoparticles into large, micrometre-scale clusters. Simultaneous fra...

  13. Resistance to Ag(I) Cations in Bacteria: Environments, Genes and Proteins

    OpenAIRE

    Silver, Simon; Gupta, Amit; Matsui, Kazuaki; Lo, Jeng-Fan

    1999-01-01

    Bacterial resistance to Ag(I) has been reported periodically with isolates from many environments where toxic levels of silver might be expected to occur, but initial reports were limited to the occurrence of resistant bacteria. The availability of silver-resistance conferring DNA sequences now allow genetic and mechanistic studies that had basically been missing. The genes determining Ag(I) resistance were sequenced from a plasmid found in a burn ward isolate. The 14.2 kb determinant contain...

  14. Lactoferrin, myeloperoxidase, lysozyme and eosinophil cationic protein in exudate in delayed type hypersensitivity

    DEFF Research Database (Denmark)

    Lerche, A; Bisgaard, H; Christensen, J D;

    1988-01-01

    allergic patients with nickel challenge in the chamber medium showed a time-dependent increase of mononuclear cells, eosinophils and basophils and a concomitant decrease of polymorphonuclear granulocytes, characteristic of a combined specific and unspecific inflammation. The morphology of the exudate...

  15. Influence of competing inorganic cations on the ion exchange equilibrium of the monovalent organic cation metoprolol on natural sediment.

    Science.gov (United States)

    Niedbala, Anne; Schaffer, Mario; Licha, Tobias; Nödler, Karsten; Börnick, Hilmar; Ruppert, Hans; Worch, Eckhard

    2013-02-01

    The aim of this study was to systematically investigate the influence of the mono- and divalent inorganic ions Na(+) and Ca(2+) on the sorption behavior of the monovalent organic cation metoprolol on a natural sandy sediment at pH=7. Isotherms for the beta-blocker metoprolol were obtained by sediment-water batch tests over a wide concentration range (1-100000 μg L(-1)). Concentrations of the competing inorganic ions were varied within freshwater relevant ranges. Data fitted well with the Freundlich sorption model and resulted in very similar Freundlich exponents (n=0.9), indicating slightly non-linear behavior. Results show that the influence of Ca(2+) compared to Na(+) is more pronounced. A logarithmic correlation between the Freundlich coefficient K(Fr) and the concentration or activity of the competing inorganic ions was found allowing the prediction of metoprolol sorption on the investigated sediment at different electrolyte concentrations. Additionally, the organic carbon of the sediment was completely removed for investigating the influence of organic matter on the sorption of metoprolol. The comparison between the experiments with and without organic carbon removal revealed no significant contribution of the organic carbon fraction (0.1%) to the sorption of metoprolol on the in this study investigated sediment. Results of this study will contribute to the development of predictive models for the transport of organic cations in the subsurface.

  16. Effect of heavy metal cations on the activity of cathepsin D (in vitro study).

    Science.gov (United States)

    Karwowska, Alicja; Łapiński, Radosław; Gacko, Marek; Grzegorczyk, Ewa; Żurawska, Joanna; Karczewski, Jan K

    2012-01-01

    We studied the effect of heavy metal cations: Fe²⁺, Cu²⁺, Zn²⁺, Cd²⁺, Hg²⁺, Pb²⁺ on the activity of cathepsin D in human aorta homogenate and blood serum. The concentration of cations was 1 mmol/l. Hemoglobin was the cathepsin D substrate. The activity of cathepsin D was determined at pH 3.5. Only Hg²⁺ cations inhibit the activity of cathepsin D. Cations Hg²⁺ damage lysosomes and release cathepsin D from these organelles. PMID:23042275

  17. Effects of aluminum and other cations on the structure of brain and liver chromatin.

    Science.gov (United States)

    Walker, P R; LeBlanc, J; Sikorska, M

    1989-05-01

    The reactivity of aluminum and several other divalent and trivalent metallic cations toward chromatin from rat brain and liver has been investigated. Two criteria are used to determine the relative reactivity of these cations toward chromatin. The first involves the ability of the ions to compact the chromatin fibers to the point where chromatin precipitates. The second criterion measures the ability of cations to interfere with the accessibility of exogenous structural probes (nucleases) to chromatin. Of the divalent cations tested, nickel, cobalt, zinc, cadmium, and mercury were the most reactive toward chromatin, on the basis of their ability to induce precipitation of chromatin in the micromolar concentration range. The divalent cations magnesium, calcium, copper, strontium, and barium were much less effective, although all cations precipitate chromatin if their concentration is increased. Of the trivalent cations tested, aluminum, indium, and gallium were very effective precipitants, whereas iron and scandium were without effect at the concentrations tested. Of all the cations tested, aluminum was the most reactive. Aluminum's ability to alter the structure of chromatin was investigated further by testing its ability to interfere with nuclease accessibility. This test confirmed that aluminum does induce considerable changes in chromatin structure at micromolar concentrations. Furthermore, chromatin from cortical areas of the brain was much more sensitive to aluminum than chromatin from liver. These results are discussed in light of the known toxicity of these cations, with particular emphasis on the possible role of aluminum in Alzheimer's disease. PMID:2752000

  18. SANS study on the complex of cationic micelles and anionic polyelectrolytes

    International Nuclear Information System (INIS)

    We investigated the complex of cationic micelles and anionic polyelectrolytes. The cationic micelles have the composition of nonionic surfactant, Octa-ethyleneglycol mono n-tetradecyl ether (C14E8) and cationic surfactant, Tetradecyltrimethylammonium Bromide (TTAB), and the polyelectrolyte is Poly Styrene Sulfonic Acid, Sodium Salt (Mw.= 73900, PSS80k). By the charge interaction, they formed the complexes in the aqueous solution. This complex was studied by Small Angle Neutron Scattering (SANS). SANS study showed that the size distribution changed by the cationic surfactant-to-polyelectrolyte charge ratio. The structure of this complex was also studied

  19. Cationic polystyrene nanospheres induce autophagic cell death through the induction of endoplasmic reticulum stress

    Science.gov (United States)

    Chiu, Hui-Wen; Xia, Tian; Lee, Yu-Hsuan; Chen, Chun-Wan; Tsai, Jui-Chen; Wang, Ying-Jan

    2014-12-01

    Nanoparticles (NPs) have been used to produce a wide range of products that have applications in imaging and drug delivery in medicine. Due to their chemical stability, well-controlled sizes and surface charges, polystyrene (PS) NPs have been developed as biosensors and drug delivery carriers. However, the possible adverse biological effects and underlying mechanisms are still unclear. Recently, autophagy has been implicated in the regulation of cell death. In this study, we evaluated a library of PS NPs with different surface charges. We found that NH2-labeled polystyrene (NH2-PS) nanospheres were highly toxic with enhanced uptake in macrophage (RAW 264.7) and lung epithelial (BEAS-2B) cells. Furthermore, NH2-PS could induce autophagic cell death. NH2-PS increased autophagic flux due to reactive oxygen species (ROS) generation and endoplasmic reticulum (ER) stress caused by misfolded protein aggregation. The inhibition of ER stress decreased cytotoxicity and autophagy in the NH2-PS-treated cells. In addition, the Akt/mTOR and AMPK signaling pathways were involved in the regulation of NH2-PS-triggered autophagic cell death. These results suggest an important role of autophagy in cationic NP-induced cell death and provide mechanistic insights into the inhibition of the toxicity and safe material design.Nanoparticles (NPs) have been used to produce a wide range of products that have applications in imaging and drug delivery in medicine. Due to their chemical stability, well-controlled sizes and surface charges, polystyrene (PS) NPs have been developed as biosensors and drug delivery carriers. However, the possible adverse biological effects and underlying mechanisms are still unclear. Recently, autophagy has been implicated in the regulation of cell death. In this study, we evaluated a library of PS NPs with different surface charges. We found that NH2-labeled polystyrene (NH2-PS) nanospheres were highly toxic with enhanced uptake in macrophage (RAW 264.7) and lung

  20. Probing the Complementarity of FAIMS and Strong Cation Exchange Chromatography in Shotgun Proteomics

    Science.gov (United States)

    Creese, Andrew J.; Shimwell, Neil J.; Larkins, Katherine P. B.; Heath, John K.; Cooper, Helen J.

    2013-03-01

    High field asymmetric waveform ion mobility spectrometry (FAIMS), also known as differential ion mobility spectrometry, coupled with liquid chromatography tandem mass spectrometry (LC-MS/MS) offers benefits for the analysis of complex proteomics samples. Advantages include increased dynamic range, increased signal-to-noise, and reduced interference from ions of similar m/ z. FAIMS also separates isomers and positional variants. An alternative, and more established, method of reducing sample complexity is prefractionation by use of strong cation exchange chromatography. Here, we have compared SCX-LC-MS/MS with LC-FAIMS-MS/MS for the identification of peptides and proteins from whole cell lysates from the breast carcinoma SUM52 cell line. Two FAIMS approaches are considered: (1) multiple compensation voltages within a single LC-MS/MS analysis (internal stepping) and (2) repeat LC-MS/MS analyses at different and fixed compensation voltages (external stepping). We also consider the consequence of the fragmentation method (electron transfer dissociation or collision-induced dissociation) on the workflow performance. The external stepping approach resulted in a greater number of protein and peptide identifications than the internal stepping approach for both ETD and CID MS/MS, suggesting that this should be the method of choice for FAIMS proteomics experiments. The overlap in protein identifications from the SCX method and the external FAIMS method was ~25 % for both ETD and CID, and for peptides was less than 20 %. The lack of overlap between FAIMS and SCX highlights the complementarity of the two techniques. Charge state analysis of the peptide assignments showed that the FAIMS approach identified a much greater proportion of triply-charged ions.

  1. Endosomolytic reducible polymeric electrolytes for cytosolic protein delivery

    OpenAIRE

    Tian, Li; Kang, Han Chang; Bae, You Han

    2013-01-01

    Despite the numerous vital functions of proteins in the cytosolic compartment, less attention has been paid to the delivery of protein drugs to the cytosol than to the plasma membrane. To address this issue and effectively deliver charged proteins into the cytoplasm, we used endosomolytic, thiol-triggered degradable polyelectrolytes as carriers. The cationic, reducible polyelectrolyte RPC-bPEI0.8kDa2 was synthesized by the oxidative polymerization of thiolated branched polyethyleneimine (bPEI...

  2. Cation-Induced Coiling of Vanadium Pentoxide Nanobelts

    Directory of Open Access Journals (Sweden)

    Liu Jun

    2010-01-01

    Full Text Available Abstract Single-crystalline V2O5·xH2O nanorings and microloops were chemically assembled via an ion-induced chemical spinning route in the designed hydrothermal system. The morphology and structure of products were investigated by means of scanning electron microscopy (SEM and transmission electron microscopy (TEM. X-ray powder diffraction (XRD measurement, energy-dispersive X-ray spectroscopy (EDS microanalysis and thermal gravimetric analysis (TGA revealed that the composition of nanorings and microloops is V2O5·1·1H2O. For these oxide nanorings and microloops, the cation-induced coiling growth mechanism of vanadium pentoxide nanobelts has been proposed on the basis of crystallographic structure of vanadium pentoxide. Our proposed chemical spinning process and the rational solution-phase synthesis route can also be extended to prepare novel 1D materials with layered or more complex structures.

  3. A spectroscopic study of interaction of cationic dyes with heparin

    Directory of Open Access Journals (Sweden)

    R. Nandini

    2010-01-01

    Full Text Available The interaction of two cationic dyes namely, acridine orange and pinacyanol chloride with an anionic polyelectrolyte, heparin, has been investigated by spectrophotometric method.The polymer induced metachromasy in the dyes resulting in the shift of the absorption maxima of the dyes towards shorter wavelengths. The stability of the complexes formed between acridine orange and heparin was found to be lesser than that formed between pinacyanol chloride and heparin. This fact was further confirmed by reversal studies using alcohols, urea and surfactants. The interaction of acridine orange with heparin has also been investigated fluorimetrically.The interaction parameters revealed that binding between acridine orange and heparin arises due to electrostatic interaction while that between pinacyanol chloride and heparin is found to involve both electrostatic and hydrophobic forces. The effect of the structure of the dye in inducing metachromasy has also been discussed.

  4. Ion dynamics in cationic lipid bilayer systems in saline solutions

    DEFF Research Database (Denmark)

    Miettinen, Markus S; Gurtovenko, Andrey A; Vattulainen, Ilpo;

    2009-01-01

    concentration on the dynamical properties of these cationic lipid bilayer systems. We find that, despite the fact that DMPCs form complexes via Na(+) ions that bind to the lipid carbonyl oxygens, NaCl concentration has a rather minute effect on lipid diffusion. We also find the dynamics of Cl(-) and Na(+) ions...... at the water-membrane interface to differ qualitatively. Cl(-) ions have well-defined characteristic residence times of nanosecond scale. In contrast, the binding of Na(+) ions to the carbonyl region appears to lack a characteristic time scale, as the residence time distributions displayed power-law features....... As to lateral dynamics, the diffusion of Na(+) ions within the water-membrane interface consists of two qualitatively different modes of motion: very slow diffusion when ions are bound to DMPC, punctuated by fast rapid jumps when detached from the lipids. Overall, the prolonged dynamics of the Na(+) ions...

  5. Investigation on the aggregation properties of cationic [60]fullerene derivative

    Institute of Scientific and Technical Information of China (English)

    WANG Guanwu; ZHAO Guoxia; YAN Lifeng

    2004-01-01

    The UV-Vis spectra, HRTEM and AFM images of cationic fullerene derivative 1 with ammonium head group directly connected to C60 skeleton in tetrahydrofuran (THF)-water (H2O) binary mixtures and in pure H2O were investigated. It was found that the UV-Vis spectra of ammonium 1 in the THF-H2O mixtures with THF% ≥ 20% were nearly overlapped, while those with THF% < 20% showed broadened and red-shifted peaks, indicating the formation of aggregates. Corresponding to the UV-Vis spectral changes,the solvatochromism of ammonium 1 in THF-H2O mixtures was observed. Ammonium 1 in binary THF-H2O mixtures existing as the monomer state could aggregate upon prolonged standing. Higher temperature and lower concentration speeded up the aggregation process.

  6. Ab initio study of the transition-metal carbene cations

    Institute of Scientific and Technical Information of China (English)

    李吉海; 冯大诚; 冯圣玉

    1999-01-01

    The geometries and bonding characteristics of the first-row transition-metal carbene cations MCH2+ were investigated by ab initio molecular orbital theory (HF/LANL2DZ). All of MCH2+ are coplanar. In the closed shell structures the C bonds to M with double bonds; while in the open shell structures the partial double bonds are formed, because one of the σ and π orbitals is singly occupied. It is mainly the π-type overlap between the 2px orbital of C and 4px, 3dxz, orbitals of M+ that forms the π orbitals. The dissociation energies of C—M bond appear in periodic trend from Sc to Cu. Most of the calculated bond dissociation energies are close to the experimental ones.

  7. Quantitative mapping of intracellular cations in the human amniotic membrane

    Science.gov (United States)

    Moretto, Ph.; Llabador, Y.; Simonoff, M.; Razafindrabe, L.; Bara, M.; Guiet-Bara, A.

    1993-05-01

    The effect of magnesium and taurine on the permeability of cell membranes to monovalent cations has been investigated using the Bordeaux nuclear microprobe. PIXE and RBS techniques have been used to provide quantitative measurements and ion distributions in the isolated amniotic membrane. This physiological model for cellular exchanges allowed us to reveal the distribution of most elements involved in cellular pathways and the modifications under different experimental conditions of incubation in physiological fluids. The PIXE microanalysis provided an original viewpoint on these mechanisms. Following this first study, the amnion compact lamina was found to play a role which was not, up to now, taken into account in the interpretation of electrophysiological experimentations. The release of some ionic species, such as K +, from the epithelial cells, during immersion in isotonic fluids, could have been hitherto underestimated.

  8. Modulation of mechanosensitive calcium-selective cation channels by temperature

    Science.gov (United States)

    Ding, J. P.; Pickard, B. G.

    1993-01-01

    Gating of associations of mechanosensitive Ca(2+)-selective cation co-channels in the plasmalemma of onion epidermis has a strong and unusual temperature dependence. Tension-dependent activity rises steeply as temperature is lowered from 25 degrees C to about 6 degrees C, but drops to a low level at about 5 degrees C. Under the conditions tested (with Mg2+ and K+ at the cytosolic face of outside-out membrane patches), promotion results both from more bursting at all observed linkage levels and from longer duration of bursts of co-channels linked as quadruplets and quintuplets. Co-channel conductance decreases linearly, but only modestly, with declining temperature. It is proposed that these and related mechanosensitive channels may participate in a variety of responses to temperature, including thermonasty, thermotropism, hydrotropism, and both cold damage and cold acclimation.

  9. Interpnictogen cations: exploring new vistas in coordination chemistry.

    Science.gov (United States)

    Robertson, Alasdair P M; Gray, Paul A; Burford, Neil

    2014-06-10

    Pnictine derivatives can behave as both 2e(-) donors (Lewis bases) and 2e(-) acceptors (Lewis acids). As prototypical ligands in the coordination chemistry of transition metals, amines and phosphines also form complexes with p-block Lewis acids, including a variety of pnictogen-centered acceptors. The inherent Lewis acidity of pnictogen centers can be enhanced by the introduction of a cationic charge, and this feature has been exploited in recent years in the development of compounds resulting from coordinate Pn-Pn and Pn-Pn' interactions. These compounds offer the unusual opportunity for homoatomic coordinate bonding and the development of complexes that possess a lone pair of electrons at the acceptor center. This Review presents new directions in the systematic extension of coordination chemistry from the transition series into the p-block.

  10. Reaction between sulfur dioxide and iron oxide cationic clusters

    Institute of Scientific and Technical Information of China (English)

    YIN Shi; HE ShengGui; HE ShengGui; GE MaoFa; GE MaoFa

    2009-01-01

    The reactivity of sulfur dioxide (SO_2) molecules toward iron oxide cationic clusters (Fe_mO_n~+) is studied by a homemade time-of-flight mass spectrometer coupled with a laser ablation/supersonic expansion cluster source and a fast flow reactor.The association products Fe_mO_nSO_2~+ can be observed for most of the clusters.The interesting result is that the cooperation effect of SO_2 and water is in favor of the adsorption of gas phase water on specific scale iron oxide clusters (Fe_2O_2~+ and Fe_3O_3~+).The reactivity information obtained may be useful to investigate atmospheric heterogeneous chemistry of related systems.

  11. Synthesis and Properties of Gemini Cationic Surfactants with Amide Spacers

    Institute of Scientific and Technical Information of China (English)

    DENG Qi-gang; YU Hong-wei; LIN Hong; JIA Li-hua; GUO Xiang-feng; ZHOU De-rui

    2005-01-01

    Four gemini cationic surfactants {N,N'-di[2-(lauryldimethylamino)acetyl]polymethylenediamine dichloride, LAA-s-LAA, s=2,3,4,6} were synthesized by using four bis(α-chloroacetamide)s and N,N-dimethyllaurylamine, respectively. The molecular structures were characterized by means of IR, 1H NMR, 13C NMR and MS, and the behavior of their aqueous solutions was studied. The critical micell concentrations(CMC) of LAA-s-LAA were one order of magnitude lower than that of dodecyltrimethyl ammonium chloride(DTAC). With the change of the length of spacer chain(s), their CMC values change, and CMC reaches the top value at s=4.

  12. EXCHANGE ADSORPTION EQUILIBRIA OF AMMONIUM ON CATION-VERMICULITE MINERALS

    Institute of Scientific and Technical Information of China (English)

    GUO Yaping; XIE Lianwu; WU Xiaofu

    2006-01-01

    Experiment was designed under different pH and temperature conditions to analysis the NH4+ exchange capacity of Na+-vermiculite, Ca2+-vermiculite and Mg2+-vermiculite clay minerals pre-treated using NaCl, CaCl2 and MgCl2 solutions respectively. The results indicated that the exchange reactions occurred most rapidly at the proceeding 80 minutes and approached to equilibrium by about 120 minutes. The exchange quantity of ammonium on the vermiculite (at initial ammonium concentration of 673mg/L ) varied with pH with a peak value of 28.36mg/g on Na+-vermiculite, 23.01mg/g on Ca2+-vermiculite, 20.14mg/g on Mg2+-vermiculite, 18.04mg/g on natural vermiculite at pH 7. The exchange and adsorption isotherm of NH4+ on cation-vermiculite can be described by Langmuir equation.

  13. Porphyrin Analogues of a Trityl Cation and Anion.

    Science.gov (United States)

    Kato, Kenichi; Kim, Woojae; Kim, Dongho; Yorimitsu, Hideki; Osuka, Atsuhiro

    2016-05-17

    Porphyrin-stabilized meso- or β-carbocations were generated upon treatment of the corresponding bis(4-tert-butylphenyl)porphyrinylcarbinols with trifluoroacetic acid (TFA). Bis(4-tert-butylphenyl)porphyrinylcarbinols were treated with TFA to generate the corresponding carbocations stabilized by a meso- or β-porphyrinyl group. The meso-porphyrinylmethyl carbocation displayed more effective charge delocalization with decreasing aromaticity compared with the β-porphyrinylmethyl carbocation. A propeller-like porphyrin trimer, tris(β-porphyrinyl)carbinol, was also synthesized and converted to the corresponding cation that displayed a more intensified absorption reaching over the NIR region. meso-Porphyrinylmethyl carbanion was generated as a stable species upon deprotonation of bis(4-tert-butylphenyl)(meso-porphyrinyl)methane with potassium bis(trimethylsilyl)amide (KHMDS) and [18]crown-6, whereas β-porphyrinylmethyl anions were highly unstable. PMID:26991021

  14. Study on synthesis and flocculation property of cation-polyacrylamide

    Institute of Scientific and Technical Information of China (English)

    NIE Rong-chun; GUO Li-ying; XU Chu-yang

    2008-01-01

    On the basis of flocculating settling experimentation on flotation waste coal in Wangfenggang coal preparation plant, influence of medical dosage and cationization (CD) of CPAM samples on coal slurry's flocculating effect was studied, difference of flocculating effect on coal slurry among different categories of polyacrylamide was discussed. Experi-mental results show that when the dosage of flocculant reaches 2~4 g/m3 flotation waste,and the CD of CPAM is 5%, flocculating effect is the best, light transmittance of super-natant liquor reaches 93%. Taking 3types of sample CPAM, PAM and PHP, which formula weight vary a little, to deal with the same concn of coal slurry, when medicine dosage is 3 g/m3, flocculating effect of CPAM is the best, light transmittance of supernatant liquor reaches 92%.

  15. Organic non-aqueous cation-based redox flow batteries

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, Andrew N.; Vaughey, John T.; Chen, Zonghai; Zhang, Lu; Brushett, Fikile R.

    2016-03-29

    The present invention provides a non-aqueous redox flow battery comprising a negative electrode immersed in a non-aqueous liquid negative electrolyte, a positive electrode immersed in a non-aqueous liquid positive electrolyte, and a cation-permeable separator (e.g., a porous membrane, film, sheet, or panel) between the negative electrolyte from the positive electrolyte. During charging and discharging, the electrolytes are circulated over their respective electrodes. The electrolytes each comprise an electrolyte salt (e.g., a lithium or sodium salt), a transition-metal free redox reactant, and optionally an electrochemically stable organic solvent. Each redox reactant is selected from an organic compound comprising a conjugated unsaturated moiety, a boron cluster compound, and a combination thereof. The organic redox reactant of the positive electrolyte is selected to have a higher redox potential than the redox reactant of the negative electrolyte.

  16. Supramolecular Explorations: Exhibiting the Extent of Extended Cationic Cyclophanes.

    Science.gov (United States)

    Dale, Edward J; Vermeulen, Nicolaas A; Juríček, Michal; Barnes, Jonathan C; Young, Ryan M; Wasielewski, Michael R; Stoddart, J Fraser

    2016-02-16

    Acting as hosts, cationic cyclophanes, consisting of π-electron-poor bipyridinium units, are capable of entering into strong donor-acceptor interactions to form host-guest complexes with various guests when the size and electronic constitution are appropriately matched. A synthetic protocol has been developed that utilizes catalytic quantities of tetrabutylammonium iodide to make a wide variety of cationic pyridinium-based cyclophanes in a quick and easy manner. Members of this class of cationic cyclophanes with boxlike geometries, dubbed Ex(n)Boxm(4+) for short, have been prepared by altering a number of variables: (i) n, the number of "horizontal" p-phenylene spacers between adjoining pyridinium units, to modulate the "length" of the cavity; (ii) m, the number of "vertical" p-phenylene spacers, to modulate the "width" of the cavity; and (iii) the aromatic linkers, namely, 1,4-di- and 1,3,5-trisubstituted units for the construction of macrocycles (ExBoxes) and macrobicycles (ExCages), respectively. This Account serves as an exploration of the properties that emerge from these structural modifications of the pyridinium-based hosts, coupled with a call for further investigation into the wealth of properties inherent in this class of compounds. By variation of only the aforementioned components, the role of these cationic receptors covers ground that spans (i) synthetic methodology, (ii) extraction and sequestration, (iii) catalysis, (iv) molecular electronics, (v) physical organic chemistry, and (vi) supramolecular chemistry. Ex(1)Box(4+) (or simply ExBox(4+)) has been shown to be a multipurpose receptor capable of binding a wide range of polycyclic aromatic hydrocarbons (PAHs), while also being a suitable component in switchable mechanically interlocked molecules. Additionally, the electronic properties of some host-guest complexes allow the development of artificial photosystems. Ex(2)Box(4+) boasts the ability to bind both π-electron-rich and -poor aromatic

  17. Aqueous behaviour of cationic surfactants containing a cleavable group.

    Science.gov (United States)

    Samakande, Austin; Chaghi, Radhouane; Derrien, Gaelle; Charnay, Clarence; Hartmann, Patrice C

    2008-04-01

    The aggregation behaviour of two novel cationic RAFT agents (transfer surfactants); N,N-dimethyl-N-(4-(((phenylcarbonothioyl)thio)methyl)benzyl)ethanammonium bromide (PCDBAB) and N-(4-((((dodecylthio)-carbonothioyl)thio)methyl)benzyl)-N,N-dimethylethanammonium bromide (DCTBAB) in diluted solutions have been investigated by surface tension, conductimetry and microcalorimetry measurements. The thermodynamic parameters i.e. the critical micelle concentration (cmc), the degree of micelle ionization (alpha), the head group surface area (a 0), Delta H mic, Delta G mic and T Delta S mic are reported at 303 K. The thermodynamic parameters have been compared to those of the conventional surfactant cetyltrimethylammonium bromide (CTAB) in order to specify structural relationships. The obtained results have been discussed considering the hydrophobic behaviour of the S-C=S- linkage and the specific interactions that arise from the introduction of the benzene ring into the hydrophobic part.

  18. Dilution thermodynamics of the biologically relevant cation mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Kaczyński, Marek, E-mail: marek.kaczynski@pwr.wroc.pl; Borowik, Tomasz, E-mail: office@novel-id.pl; Przybyło, Magda, E-mail: magdalena.przybylo@pwr.wroc.pl; Langner, Marek, E-mail: marek.langner@pwr.wroc.pl

    2014-01-10

    Graphical abstract: - Highlights: • Dilution energetics of Ca{sup 2+} can be altered by the aqueous phase ionic composition. • Dissipated heat upon Ca{sup 2+} dilution is drastically reduced in the K{sup +} presence. • Reduction of the enthalpy change upon Ca{sup 2+} dilution is K{sup +} concentration dependent. • The cooperativity of Ca{sup 2+} hydration might be of great biological relevance providing a thermodynamic argument for the specific ionic composition of the intracellular environment. - Abstract: The ionic composition of intracellular space is rigorously controlled by a variety of processes consuming large quantities of energy. Since the energetic efficiency is an important evolutional criterion, therefore the ion fluxes within the cell should be optimized with respect to the accompanying energy consumption. In the paper we present the experimental evidence that the dilution enthalpies of the biologically relevant ions; i.e. calcium and magnesium depend on the presence of monovalent cations; i.e. sodium and potassium. The heat flow generated during the dilution of ionic mixtures was measured with the isothermal titration calorimetry. When calcium was diluted together with potassium the dilution enthalpy was drastically reduced as the function of the potassium concentration present in the solution. No such effect was observed when the potassium ions were substituted with sodium ones. When the dilution of magnesium was investigated the dependence of the dilution enthalpy on the accompanying monovalent cation was much weaker. In order to interpret experimental evidences the ionic cluster formation is postulated. The specific organization of such cluster should depend on ions charges, sizes and organization of the hydration layers.

  19. Understanding electrochromic processes initiated by dithienylcyclopentene cation-radicals.

    Science.gov (United States)

    Guirado, Gonzalo; Coudret, Christophe; Hliwa, Mohamed; Launay, Jean-Pierre

    2005-09-22

    Simple photochromic dithienylethylenes with either a perfluoro or a perhydro cyclopentene ring, and a variety of substituents (chlorine, iodine, trimethylsilyl, phenylthio, aldehyde, carboxylic acid, and ethynylanisyl), have been prepared and their electrochemical behavior was explored by cyclic voltammetry. All dithienylethylenes present two-electron irreversible oxidation waves in their open form, but the cation-radical of the open isomers can follow two different reaction pathways: dimerization or ring closure, whereas the halogen derivatives follow a dimerization mechanism, the presence of donor groups, such as the phenylthio-substituted compound, promote an efficient oxidative ring closure following an ECE/DISP mechanism. Electrochromic properties are also found in the corresponding ring-closed isomers. Depending on the substituents on the thiophene ring, and the perfluro or perhydro cyclopentene ring, open isomers can be obtained from oxidation (chemical or electrochemical) of the corresponding ring-closed isomers via an EC mechanism. This reaction pathway is favored by the presence of electron-withdrawing groups in the molecule. For all these compounds, closed or open, the oxidation lies between 0.8 and 1.5 V vs SCE, and provokes a permanent modification of the color, even after an oxidation-reduction cycle. This could be qualified as "electrochromism with memory". On the other hand, the ring-closed electron-rich isomers (E degrees electrochromism", for which no structural changes are observed. The experimental study was completed by theoretical calculations at the DFT level, using B3LYP density functional, which gave information on the total energy, the geometry, and the electronic structures of several representative compounds, either in the neutral form or in the cation-radical state. These results are important for the potential design of photochromic systems, such as three-state conjugated systems and photoelectrical molecular switching devices. PMID

  20. Non-Surface Activity of Cationic Amphiphilic Diblock Copolymers

    Energy Technology Data Exchange (ETDEWEB)

    Nayak, Rati Ranjan; Yamada, Tasuku; Matsuoka, Hideki, E-mail: ratiranjan@immt.res.in, E-mail: matsuoka@star.polym.kyoto-u.ac.jp [Department of Polymer Chemistry, Graduate School of Engineering, Kyoto University, Nishikyo-ku, Kyoto 615-8510 (Japan)

    2011-09-19

    Cationic amphiphilic diblock copolymers containing quaternized poly (2-vinylpyridine) chain as a hydrophilic segment (PIp-b-PNMe2VP) were synthesized by living anionic polymerization. By IR measurement, we confirmed the quaternization of the polymer (PIp-b-PNMe2VP), and determined the degree of quaternization by conductometric titration. The surface tension experiment showed that the polymers are non-surface active in nature. The foam formation of the polymer solutions was also investigated with or without added salt. Almost no foam formation behavior was observed without added salt, while a little foam was observed in the presence of 1M NaCl. The critical micelle concentration (cmc) of the diblock copolymers with 3 different chain lengths was measured by the static light scattering method. The cmc values obtained in this study were much lower than the values obtained for anionic non-surface active diblock polymers studied previously. The hydrodynamic radii of the polymer micelle increased slightly in the presence of 1 M NaCl. The transmission electron microscopic images revealed spherical micelles in pure water. In the presence of salt, the cmc values increased as was the case for anionic polymers, which is unlike conventional surfactant systems but consistent with non-surface active anionic block copolymers. The microviscosity of the micelle core was evaluated using Coumarin-153 as a fluorescent anisotropy probe using steady-sate fluorescence depolarization. Non-surface activity has been proved to be universal for ionic amphiphilic block copolymers both for anionic and cationic. Hence, the origin of non-surface activity is not the charged state of water surface itself, but should be an image charge repulsion at the air/water interface.

  1. Regulation of TRP-like muscarinic cation current in gastrointestinal smooth muscle with special reference to PLC/InsP3/Ca2+ system

    Institute of Scientific and Technical Information of China (English)

    Alexander V ZHOLOS

    2006-01-01

    Acetylcholine,the main enteric excitatory neuromuscular transmitter,evokes membrane depolarization and contraction of gastrointestinal smooth muscle cells by activating G protein-coupled muscarinic receptors.Although the cholinergic excitation is generally underlined by the multiplicity of ion channel effects,the primary event appears to be the opening of cation-selective channels;among them the 60 pS channel has been recently identified as the main target for the acetylcholine action in gastrointestinal myocytes.The evoked cation current,termed mICAT,causes either an oscillatory or a more sustained membrane depolarization response,which in turn leads to increases of the open probability of voltage-gated Ca2+ channels.thus providing Ca2+ entry in parallel with Ca2+ release for intracellular Ca2+ concentration rise and contraction.In recent years there have been several significant developments in our understanding of the signaling processes underlying mIcAT generation.They have revealed important synergistic interactions between M2 and M3 receptor subtypes,single channel mechanisms,and the involvement of TRPC-encoded proteins as essential components of native muscarinic cation channels.This review summarizes these recent findings and in particular discusses the roles of the phospholipase C/InsP3/intracellular Ca2+ release system in the mICAT physiological regulation.

  2. The effect of cation source and dietary cation-anion difference on rumen ion concentrations in lactating dairy cows.

    Science.gov (United States)

    Catterton, T L; Erdman, R A

    2016-08-01

    Many studies have focused on the influence of dietary cation-anion difference (DCAD) on animal performance but few have examined the effect of DCAD on the rumen ionic environment. The objective of this study was to examine the effects of DCAD, cation source (Na vs. K), and anion source (Cl vs. bicarbonate or carbonate) on rumen environment and fermentation. The study used 5 rumen-fistulated dairy cows and 5 dietary treatments that were applied using a 5×5 Latin square design with 2-wk experimental periods. Treatments consisted of (1) the basal total mixed ration (TMR); (2) the basal TMR plus 340mEq/kg of Na (dry matter basis) using NaCl; (3) the basal TMR plus 340mEq/kg of K using KCl; (4) the basal TMR plus 340mEq/kg of Na using NaHCO3; and (5) the basal TMR plus 340mEq/kg of K using K2CO3. On the last day of each experimental period, rumen samples were collected and pooled from 5 different locations at 0, 1.5, 3, 4.5, 6, 9, and 12h postfeeding for measurement of rumen pH and concentrations of strong ions and volatile fatty acids (VFA). Dietary supplementation of individual strong ions increased the corresponding rumen ion concentration. Rumen Na was decreased by 24mEq/L when K was substituted for Na in the diet, but added dietary Na had no effect on rumen K. Rumen Cl was increased by 10mEq/L in diets supplemented with Cl. Cation source had no effect on rumen pH or total VFA concentration. Increased DCAD increased rumen pH by 0.10 pH units and increased rumen acetate by 4mEq/L but did not increase total VFA. This study demonstrated that rumen ion concentrations can be manipulated by dietary ion concentrations. If production and feed efficiency responses to DCAD and ionophores in the diet are affected by rumen Na and K concentrations, then manipulating dietary Na and K could be used either to enhance or diminish those responses. PMID:27289159

  3. Recurrent stupor due to lysinuric protein intolerance

    Directory of Open Access Journals (Sweden)

    Ahsan Moosa N

    2005-01-01

    Full Text Available Recurrent stupor in children is an uncommon clinical problem with a wide differential diagnosis; inherited metabolic disorders account for a vast majority. We report a 9-year-old girl with recurrent episodes of stupor. Initial episode was treated as viral encephalitis and the second episode was managed as non-convulsive status epilepticus. Hyperammonemia was detected in the last episode. Metabolic work-up after dietary protein challenge revealed classical biochemical features of lysinuric protein intolerance. She was managed with protein-restricted diet, which resulted in marked neurological improvement. LPI is a rare inherited metabolic disorder due to membrane transport defect of cationic amino acids.

  4. Reduction of bioactive substances in stored donor blood: prestorage versus bedside leucofiltration

    DEFF Research Database (Denmark)

    Hammer, J H; Mynster, T; Reimert, C M;

    1999-01-01

    units, 9 were stored under standard conditions for 35 d, 9 were leucofiltered after donation and then stored for 35 d, and 3x9 units were stored for 7, 21 and 35 d, respectively, before leucofiltration. Samples were collected from blood units immediately after donation, and before and after......Leucocyte filtration has been suggested to improve transfusion products. We studied the effect of prestorage versus bedside leucofiltration on reduction of bioactive substances and leucocyte content in donor blood. Forty-five units of whole blood from healthy blood donors were studied. Of these...... leucofiltration, and analysed by ELISA and RIA methods for extracellular content of myeloperoxidase (MPO), eosinophil cationic protein (ECP), histamine (HIS) and plasminogen activator inhibitor-1 (PAI-1). Leucocyte content was counted in all samples. In non-filtered blood extracellular MPO, ECP, HIS and PAI-1...

  5. Binding properties of oxacalix[4]arenes derivatives toward metal cations; Interactions entre cations metalliques et derives des oxacalix[4]arenes

    Energy Technology Data Exchange (ETDEWEB)

    Mellah, B

    2006-11-15

    The objective of this work was to establish the binding properties of oxacalix[4]arene derivatives with different numbers of the oxa bridges, functional groups (ketones, pyridine, ester, amide and methoxy) and conformations. Their interactions with alkali and alkaline-earth, heavy and transition metal cations have been evaluated according to different approaches: (i) extraction of corresponding picrates from an aqueous phase into dichloromethane; (ii) determination of the thermodynamic parameters of complexation in methanol and/or acetonitrile by UV-spectrophotometry and micro-calorimetry; (iii) determination of the stoichiometry of the complexes by ESI-MS; (iv) {sup 1}H-NMR titrations allowing to localize the metal ions in the ligand cavity. In a first part dealing on homo-oxacalix[4]arenes, selectivities for Na{sup +}, K{sup +}, Ca{sup 2+}, Pb{sup 2+} and Mn{sup 2+} of ketones derivatives was shown. The presence of oxa bridge in these derivatives increases their efficiency while decreasing their selectivity with respect to related calixarenes. The pyridine derivative prefers transition and heavy metal cations, in agreement with the presence of the soft nitrogen atoms. In the second part, di-oxacalix[4]arene ester and secondary amide derivatives were shown to be less effective than tertiary amide counterparts but to present high selectivities for Li{sup +}, Ba{sup 2+}, Zn{sup 2+} and Hg{sup 2+}. A third part devoted to the octa-homo-tetra-oxacalix[4]arene tetra-methoxy shows that the 1:1 metal complexes formed are generally more stable than those of calixarenes, suggesting the participation of the oxygen atoms of the bridge in the complexation. Selectivity for Cs{sup +}, Ba{sup 2+}, Cu{sup 2+} and Hg{sup 2+} were noted. (author)

  6. Photochemical generation of a primary vinyl cation from (E)-bromostyrene: Mechanisms of formation and reaction

    NARCIS (Netherlands)

    Gronheid, R.; Zuilhof, H.; Hellings, M.G.

    2003-01-01

    The photochemistry of (E)-bromostyrene was investigated to determine the nature of the product-forming intermediates and to clarify the mechanism of formation of vinylic cations and vinylic radicals. Both a cation- and a radical-derived product are formed, and the ionic origin of the former product

  7. Coordination Chemistry of Alkali and Alkaline-Earth Cations with Macrocyclic Ligands.

    Science.gov (United States)

    Dietrich, Bernard

    1985-01-01

    Discusses: (l) alkali and alkaline-earth cations in biology (considering naturally occurring lonophores, their X-ray structures, and physiochemical studies); (2) synthetic complexing agents for groups IA and IIA; and (3) ion transport across membranes (examining neutral macrobicyclic ligands as metal cation carriers, transport by anionic carriers,…

  8. Comparison of Cationic and Unmodified Starches in Reactive Extrusion of Starch-Polyacrylamide Graft Copolymers

    Science.gov (United States)

    Graft copolymers of starch and polyacrylamide (PAAm) were prepared using reactive extrusion in a corotating twin screw extruder. The effect of cationic starch modification was examined using unmodified and cationic dent starch (approximately 23% amylose) and waxy maize starch (approximately 2% amyl...

  9. Chemical mechanical polishing of transparent conductive layers using spherical cationic polymer microbeads

    Energy Technology Data Exchange (ETDEWEB)

    Nagaoka, Shoji, E-mail: nagaoka@kmt-iri.go.jp [Kumamoto Industrial Research Institute, 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Chuouku, Kumamoto 860-8555 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Ryu, Naoya [Kumamoto Industrial Research Institute, 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Yamanouchi, Akio [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Chuouku, Kumamoto 860-8555 (Japan); Shirosaki, Tomohiro [Kumamoto Industrial Research Institute, 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Horikawa, Maki [Kumamoto Industrial Research Institute, 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Chuouku, Kumamoto 860-8555 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan); Sakurai, Hideo; Takafuji, Makoto; Ihara, Hirotaka [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Chuouku, Kumamoto 860-8555 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), 3-11-38 Higashimachi, Higashiku, Kumamoto 862-0901 (Japan)

    2015-02-02

    Spherical cationic polymer microbeads were used to chemically mechanically polish transparent conductive oxide (TCO) layers without the need for inorganic abrasives. Poly(methyl acrylate) (PMA) was used as the polymer matrix. Surface cationization of the spherical PMA microbeads was achieved by aminolysis using 1,2-diaminoethane. The amino group content of the microbeads was controlled using the aminolysis reaction time. The surface roughness of the TCO polished using the cationic polymer microbeads was similar to that of TCO polished with an inorganic abrasive. The microbead-polished TCO layer was slightly thinner than the unpolished TCO layer. The sheet resistance of the TCO layer polished using the microbeads was lower than that polished using the inorganic abrasive. The TCO polishing ability of the microbeads was dependent on their cationic properties and softness. - Highlights: • Indium tin oxide (ITO) layer was planarized using cationic polymer microbeads. • Cationic polymer microbeads planarized, while retaining ITO layer thickness • Cationic polymer microbeads did not degrade the sheet resistance of ITO. • Cationic polymer microbeads could planarize the ITO surface without damaging.

  10. Biodistribution of rhodamine B fluorescence-labeled cationic nanoparticles in rats

    DEFF Research Database (Denmark)

    Knudsen, K. B.; Northeved, H.; Gjetting, Torben;

    2014-01-01

    were used. The animals were randomly allocated to five groups receiving either cationic micelles or cationic liposomes by single intravenous (IV) administration at a dose of 100 mg/kg bodyweight by single intracerebroventricular (ICV) injection at a dose of 50 μg or no treatment. ICV administration...

  11. Chemical Surface, Thermal and Electrical Characterization of Nafion Membranes Doped with IL-Cations

    Directory of Open Access Journals (Sweden)

    María del Valle Martínez de Yuso

    2014-04-01

    Full Text Available Surface and bulk changes in a Nafion membrane as a result of IL-cation doping (1-butyl-3-methylimidazolium tetrafluoroborate or BMIM+BF4 and phenyltrimethylammonium chloride or TMPA+Cl− were studied by X-ray photoelectron spectroscopy (XPS, contact angle, differential scanning calorimetry (DSC and impedance spectroscopy (IS measurements performed with dry samples after 24 h in contact with the IL-cations BMIM+ and TMPA+. IL-cations were selected due to their similar molecular weight and molar volume but different shape, which could facilitate/obstruct the cation incorporation in the Nafion membrane structure by proton/cation exchange mechanism. The surface coverage of the Nafion membrane by the IL-cations was confirmed by XPS analysis and contact angle, while the results obtained by the other two techniques (DSC and IS seem to indicate differences in thermal and electrical behaviour depending on the doping-cation, being less resistive the Nafion/BMIM+ membrane. For that reason, determination of the ion transport number was obtained for this membrane by measuring the membrane or concentration potential with the samples in contact with HCl solutions at different concentrations. The comparison of these results with those obtained for the original Nafion membrane provides information on the effect of IL-cation BMIM+ on the transport of H+ across wet Nafion/BMIM+ doped membranes.

  12. Novel Cholesterol-Based Cationic Lipids as Transfecting Agents of DNA for Efficient Gene Delivery

    Directory of Open Access Journals (Sweden)

    Jia Ju

    2015-03-01

    Full Text Available The design, synthesis and biological evaluation of the cationic lipid gene delivery vectors based on cholesterol and natural amino acids lysine or histidine are described. Cationic liposomes composed of the newly synthesized cationic lipids 1a or 1b and neutral lipid DOPE (1,2-dioleoyl-l-α-glycero-3-phosphatidyl-ethanolamine exhibited good transfection efficiency. pEGFP-N1 plasmid DNA was transferred into 293T cells by cationic liposomes formed from cationic lipids 1a and 1b, and the transfection activity of the cationic lipids was superior (1a or parallel (1b to that of the commercially available 3β-[N-(N',N'-dimethylaminoethyl-carbamoyl] cholesterol (DC-Chol derived from the same cholesterol backbone with different head groups. Combined with the results of agarose gel electrophoresis, transfection experiments with various molar ratios of the cationic lipids and DOPE and N/P (+/− molar charge ratios, a more effective formulation was formed, which could lead to relatively high transfection efficiency. Cationic lipid 1a represents a potential agent for the liposome used in gene delivery due to low cytotoxicity and impressive gene transfection activity.

  13. Cationic cell-penetrating peptides induce ceramide formation via acid sphingomyelinase: implications for uptake.

    NARCIS (Netherlands)

    Verdurmen, W.P.R.; Thanos, M.; Ruttekolk, I.R.R.; Gulbins, E.; Brock, R.E.

    2010-01-01

    Cationic cell-penetrating peptides (CPP) are receiving increasing attention as molecular transporters of membrane-impermeable molecules. Import of cationic CPP occurs both via endocytosis and - at higher peptide concentrations - in an endocytosis-independent manner via localized regions of the plasm

  14. SEQUESTRATION OF ORGANIC CATIONS BY ACIDIFIED HEPATIC ENDOCYTIC VESICLES AND IMPLICATIONS FOR BILIARY-EXCRETION

    NARCIS (Netherlands)

    VANDYKE, RW; FABER, ED; MEIJER, DKF

    1992-01-01

    A number of cationic amine drugs that are taken up by liver and excreted into bile may accumulate in acidified intracellular organelles such as lysosomes and endosomes. These studies were undertaken to assess directly the uptake and accumulation of three types of model organic cationic amines by end

  15. Base cation deposition in Europe - Part II. Acid neutralization capacity and contribution to forest nutrition

    NARCIS (Netherlands)

    Draaijers, G.P.J.; Leeuwen, E.P. van; Jong, P.G.H. de; Erisman, J.W.

    1997-01-01

    An assessment was made of the capacity of base cations to neutralize acid deposition and of the contribution of base cation deposition to forest nutrition in Europe. In large parts of southern Europe more than 50% of the potential acid deposition was found counteracted by deposition of non-sea salt

  16. Chemical mechanical polishing of transparent conductive layers using spherical cationic polymer microbeads

    International Nuclear Information System (INIS)

    Spherical cationic polymer microbeads were used to chemically mechanically polish transparent conductive oxide (TCO) layers without the need for inorganic abrasives. Poly(methyl acrylate) (PMA) was used as the polymer matrix. Surface cationization of the spherical PMA microbeads was achieved by aminolysis using 1,2-diaminoethane. The amino group content of the microbeads was controlled using the aminolysis reaction time. The surface roughness of the TCO polished using the cationic polymer microbeads was similar to that of TCO polished with an inorganic abrasive. The microbead-polished TCO layer was slightly thinner than the unpolished TCO layer. The sheet resistance of the TCO layer polished using the microbeads was lower than that polished using the inorganic abrasive. The TCO polishing ability of the microbeads was dependent on their cationic properties and softness. - Highlights: • Indium tin oxide (ITO) layer was planarized using cationic polymer microbeads. • Cationic polymer microbeads planarized, while retaining ITO layer thickness • Cationic polymer microbeads did not degrade the sheet resistance of ITO. • Cationic polymer microbeads could planarize the ITO surface without damaging

  17. Purification and characterization of novel cationic peroxidases from Asparagus acutifolius L. with biotechnological applications.

    Science.gov (United States)

    Guida, Vincenzo; Cantarella, Maria; Chambery, Angela; Mezzacapo, Maria C; Parente, Augusto; Landi, Nicola; Severino, Valeria; Di Maro, Antimo

    2014-08-01

    Four novel basic peroxidases, named AaP-1, AaP-2, AaP-3, and AaP-4, were purified from Asparagus acutifolius L. seeds by cation-exchange and gel filtration chromatographies. The four proteins showed a similar electrophoretic mobility of 46 kDa while, by MALDI-TOF MS, different Mr values of 42758.3, 41586.9, 42796.3, and 41595.5 were determined for AaP-1, AaP-2, AaP-3, and AaP-4, respectively. N-terminal sequences of AaPs 1-4 up to residue 20 showed a high percentage of identity with the peroxidase from Glycine max. In addition, AaP-1, AaP-2, AaP-3, and AaP-4 were found to be glycoproteins, containing 21.75, 22.27, 25.62, and 18.31 % of carbohydrates, respectively. Peptide mapping and MALDI-TOF MS analysis of AaPs 1-4 showed that the structural differences between AaP-1 and AaP-2 and AaP-3 and AaPs-4 were mainly due to their glycan content. We also demonstrate that AaPs were able to remove phenolic compounds from olive oil mill wastewaters with a higher catalytic efficiency with respect to horseradish peroxidase, thus representing candidate enzymes for potential biotechnological applications in the environmental field.

  18. Production of phytotoxic cationic α-helical antimicrobial peptides in plant cells using inducible promoters.

    Directory of Open Access Journals (Sweden)

    Nuri Company

    Full Text Available Synthetic linear antimicrobial peptides with cationic α-helical structures, such as BP100, have potent and specific activities against economically important plant pathogenic bacteria. They are also recognized as valuable therapeutics and preservatives. However, highly active BP100 derivatives are often phytotoxic when expressed at high levels as recombinant peptides in plants. Here we demonstrate that production of recombinant phytotoxic peptides in transgenic plants is possible by strictly limiting transgene expression to certain tissues and conditions, and specifically that minimization of this expression during transformation and regeneration of transgenic plants is essential to obtain viable plant biofactories. On the basis of whole-genome transcriptomic data available online, we identified the Os.hsp82 promoter that fulfilled this requirement and was highly induced in response to heat shock. Using this strategy, we generated transgenic rice lines producing moderate yields of severely phytotoxic BP100 derivatives on exposure to high temperature. In addition, a threshold for gene expression in selected tissues and stages was experimentally established, below which the corresponding promoters should be suitable for driving the expression of recombinant phytotoxic proteins in genetically modified plants. In view of the growing transcriptomics data available, this approach is of interest to assist promoter selection for specific purposes.

  19. Cationic Thiolated Poly(aspartamide) Polymer as a Potential Excipient for Artificial Tear Formulations

    Science.gov (United States)

    Budai-Szűcs, Mária; Horvát, Gabriella; Szilágyi, Barnabás Áron; Gyarmati, Benjámin; Szilágyi, András; Berkó, Szilvia; Szabó-Révész, Piroska; Sandri, Giuseppina; Bonferoni, Maria Cristina; Caramella, Carla; Soós, Judit; Facskó, Andrea; Csányi, Erzsébet

    2016-01-01

    Dry eye disease is a relatively common ocular problem, which causes eye discomfort and visual disorders leading to a decrease in the quality of life. The aim of this study was to find a possible excipient for eye drop formulations, which is able to stabilize the tear film. A cationic thiolated polyaspartamide polymer, poly[(N-mercaptoethylaspartamide)-co-(N-(N′,N′-dimethylaminoethyl)aspartamide)] (ThioPASP-DME), was used as a potential vehicle. Besides satisfying the basic requirements, the chemical structure of ThioPASP-DME is similar to those of ocular mucins as it is a protein-like polymer bearing a considerable number of thiol groups. The solution of the polymer is therefore able to mimic the physiological properties of the mucins and it can interact with the mucus layer via disulphide bond formation. The resultant mucoadhesion provides a prolonged residence time and ensures protective effect for the corneal/conjunctival epithelium. ThioPASP-DME also has an antioxidant effect due to the presence of the thiol groups. The applicability of ThioPASP-DME as a potential excipient in eye drops was determined by means of ocular compatibility tests and through examinations of the interactions with the mucosal surface. The results indicate that ThioPASP-DME can serve as a potential eye drop excipient for the therapy of dry eye disease. PMID:27313866

  20. Isolation and Purifi cation of Chitinase Bacillus sp. D2 Isolated from Potato Rhizosfer

    Directory of Open Access Journals (Sweden)

    Sebastian Margino

    2015-11-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 Potato Cyst Nematodes (Globodera rostochiensis is one of the important potato’s pests and caused economic looses up to 70% in the several centrals of potato plantations in Indonesia. Potato Cyst Nematodes (PCN shell component of egg shell containing chitin (inner layer and vitelline/protein (outer layer, so the purpose of research was to fi nd out of chitin degrading bacteria for controlling of egg’s PCN by cutting of their life cycle. The results showed that Bacillus sp. D2 isolated from potato rhizosphere could produce extra cellular chitinase in the medium containing of 0.20% colloidal chitin and fermented for 72 hours. Result of chitinase purifi cation using ammonium sulphate precipitation and DEAE-Cellulose ion-exchange chromatography showed a specifi c activity 2691,052 U/mg and analyzing using SDS-PAGE 12.5% resulted in molecular weight 30 kDa. The apparent Km and Vmax of chitinase towards colloidal chitin were 2 mg/ml and 2.2 μg/h, respectively.  

  1. Transient Receptor Potential Melastatin 7 Cation Channel Kinase: New Player in Angiotensin II-Induced Hypertension.

    Science.gov (United States)

    Antunes, Tayze T; Callera, Glaucia E; He, Ying; Yogi, Alvaro; Ryazanov, Alexey G; Ryazanova, Lillia V; Zhai, Alexander; Stewart, Duncan J; Shrier, Alvin; Touyz, Rhian M

    2016-04-01

    Transient receptor potential melastatin 7 (TRPM7) is a bifunctional protein comprising a magnesium (Mg(2+))/cation channel and a kinase domain. We previously demonstrated that vasoactive agents regulate vascular TRPM7. Whether TRPM7 plays a role in the pathophysiology of hypertension and associated cardiovascular dysfunction is unknown. We studied TRPM7 kinase-deficient mice (TRPM7Δkinase; heterozygous for TRPM7 kinase) and wild-type (WT) mice infused with angiotensin II (Ang II; 400 ng/kg per minute, 4 weeks). TRPM7 kinase expression was lower in heart and aorta from TRPM7Δkinase versus WT mice, effects that were further reduced by Ang II infusion. Plasma Mg(2+) was lower in TRPM7Δkinase versus WT mice in basal and stimulated conditions. Ang II increased blood pressure in both strains with exaggerated responses in TRPM7Δkinase versus WT groups (Phypertension is exaggerated, cardiac remodeling and left ventricular dysfunction are amplified, and endothelial function is impaired. These processes are associated with hypomagnesemia, blunted TRPM7 kinase expression/signaling, endothelial nitric oxide synthase downregulation, and proinflammatory vascular responses. Our findings identify TRPM7 kinase as a novel player in Ang II-induced hypertension and associated vascular and target organ damage.

  2. Cationic surface modification of PLG nanoparticles offers sustained gene delivery to pulmonary epithelial cells.

    Science.gov (United States)

    Baoum, Abdulgader; Dhillon, Navneet; Buch, Shilpa; Berkland, Cory

    2010-05-01

    Biodegradable polymeric nanoparticles are currently being explored as a nonviral gene delivery system; however, many obstacles impede the translation of these nanomaterials. For example, nanoparticles delivered systemically are inherently prone to adsorbing serum proteins and agglomerating as a result of their large surface/volume ratio. What is desired is a simple procedure to prepare nanoparticles that may be delivered locally and exhibit minimal toxicity while improving entry into cells for effectively delivering DNA. The objective of this study was to optimize the formulation of poly(D,L-lactide-co-glycolide) (PLG) nanoparticles for gene delivery performance to a model of the pulmonary epithelium. Using a simple solvent diffusion technique, the chemistry of the particle surface was varied by using different coating materials that adsorb to the particle surface during formation. A variety of cationic coating materials were studied and compared to more conventional surfactants used for PLG nanoparticle fabrication. Nanoparticles (approximately 200 nm) efficiently encapsulated plasmids encoding for luciferase (80-90%) and slowly released the same for 2 weeks. In A549 alveolar lung epithelial cells, high levels of gene expression appeared at day 5 for certain positively charged PLG particles and gene expression was maintained for at least 2 weeks. In contrast, PEI gene expression ended at day 5. PLG particles were also significantly less cytotoxic than PEI suggesting the use of these vehicles for localized, sustained gene delivery to the pulmonary epithelium.

  3. Expression Profile of Cationic Amino Acid Transporters in Rats with Endotoxin-Induced Uveitis

    Directory of Open Access Journals (Sweden)

    Yung-Ray Hsu

    2016-01-01

    Full Text Available Purpose. The transcellular arginine transportation via cationic amino acid transporter (CAT is the rate-limiting step in nitric oxide (NO synthesis, which is crucial in intraocular inflammation. In this study, CAT isoforms and inducible nitric oxide synthase (iNOS expression was investigated in endotoxin-induced uveitis (EIU. Methods. EIU was induced in Lewis rats by lipopolysaccharide (LPS injection. In the treatment group, the rats were injected intraperitoneally with the proteasome inhibitor bortezomib before EIU induction. After 24 hours, leukocyte quantification, NO measurement of the aqueous humor, and histopathological examination were evaluated. The expression of CAT isoforms and iNOS was determined by reverse transcription-polymerase chain reaction, western blotting, and immunofluorescence staining. Nuclear factor-kappa B (NF-κB binding activity was evaluated by electrophoretic mobility shift assay. The mouse macrophage cell line RAW 264.7 was used to validate the in vivo findings. Results. LPS significantly stimulated iNOS, CAT-2A, and CAT-2B mRNA and protein expression but did not affect CAT-1 in EIU rats and RAW 264.7 cells. Bortezomib attenuated inflammation and inhibited iNOS, CAT-2A, and CAT-2B expression through NF-κB inhibition. Conclusions. CAT-2 and iNOS, but not CAT-1, are specifically involved in EIU. NF-κB is essential in the induction of CAT-2 and iNOS in EIU.

  4. Cations modulate the substrate specificity of bifunctional class I O-methyltransferase from Ammi majus.

    Science.gov (United States)

    Lukacin, Richard; Matern, Ulrich; Specker, Silvia; Vogt, Thomas

    2004-11-19

    Caffeoyl-coenzyme A O-methyltransferase cDNA was cloned from dark-grown Ammi majus L. (Apiaceae) cells treated with a crude fungal elicitor and the open reading frame was expressed in Escherichia coli. The translated polypeptide of 27.1-kDa shared significant identity to other members of this highly conserved class of proteins and was 98.8% identical to the corresponding O-methyltransferase from parsley. For biochemical characterization, the recombinant enzyme could be purified to apparent homogeneity by metal-affinity chromatography, although the recombinant enzyme did not contain any affinity tag. Based on sequence analysis and substrate specificity, the enzyme classifies as a cation-dependent O-methyltransferase with pronounced preference for caffeoyl coenzyme A, when assayed in the presence of Mg2+-ions. Surprisingly, however, the substrate specificity changed dramatically, when Mg2+ was replaced by Mn2+ or Co2+ in the assays. This effect could point to yet unknown functions and substrate specificities in situ and suggests promiscuous roles for the lignin specific cluster of plant O-methyltransferases.

  5. Ceruloplasmin revisited: structural and functional roles of various metal cation-binding sites

    International Nuclear Information System (INIS)

    The three-dimensional molecular structure of human serum ceruloplasmin has been reinvestigated using X-ray synchrotron data collected at 100 K from a crystal frozen to liquid-nitrogen temperature. The three-dimensional molecular structure of human serum ceruloplasmin has been reinvestigated using X-ray synchrotron data collected at 100 K from a crystal frozen to liquid-nitrogen temperature. The resulting model, with an increase in resolution from 3.1 to 2.8 Å, gives an overall improvement of the molecular structure, in particular the side chains. In addition, it enables the clear definition of previously unidentified Ca2+-binding and Na+-binding sites. The Ca2+ cation is located in domain 1 in a configuration very similar to that found in the activated bovine factor Va. The Na+ sites appear to play a structural role in providing rigidity to the three protuberances on the top surface of the molecule. These features probably help to steer substrates towards the mononuclear copper sites prior to their oxidation and to restrict the size of the approaching substrate. The trinuclear copper centre appears to differ from the room-temperature structure in that a dioxygen moiety is bound in a similar way to that found in the endospore coat protein CotA from Bacillus subtilis

  6. Maitotoxin-induced cell death cascade in bovine aortic endothelial cells: divalent cation specificity and selectivity.

    Science.gov (United States)

    Wisnoskey, Brian J; Estacion, Mark; Schilling, William P

    2004-08-01

    The maitotoxin (MTX)-induced cell death cascade in bovine aortic endothelial cells (BAECs), a model for Ca(2+) overload-induced toxicity, reflects three sequential changes in plasmalemmal permeability. MTX initially activates Ca(2+)-permeable, nonselective cation channels (CaNSC) and causes a massive increase in cytosolic free Ca(2+) concentration ([Ca(2+)](i)). This is followed by the opening of large endogenous cytolytic/oncotic pores (COP) that allow molecules ionomycin and were significantly delayed in BAPTA-loaded cells. Experiments at the single-cell level revealed that Ba(2+) not only delayed the time to cell lysis but also caused desynchronization of the lytic phase. Last, membrane blebs, which were numerous and spherical in Ca(2+)-containing solutions, were poorly defined and greatly reduced in number in the presence of Ba(2+). Taken together, these results suggest that intracellular high-affinity Ca(2+)-binding proteins are involved in the MTX-induced changes in plasmalemmal permeability that are responsible for cell demise. PMID:15044153

  7. Protein-protein interactions

    DEFF Research Database (Denmark)

    Byron, Olwyn; Vestergaard, Bente

    2015-01-01

    . The biophysical and structural investigations of PPIs consequently demand hybrid approaches, implementing orthogonal methods and strategies for global data analysis. Currently, impressive developments in hardware and software within several methodologies define a new era for the biostructural community. Data can......Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers...

  8. Eutrophication of mangroves linked to depletion of foliar and soil base cations.

    Science.gov (United States)

    Fauzi, Anas; Skidmore, Andrew K; Heitkönig, Ignas M A; van Gils, Hein; Schlerf, Martin

    2014-12-01

    There is growing concern that increasing eutrophication causes degradation of coastal ecosystems. Studies in terrestrial ecosystems have shown that increasing the concentration of nitrogen in soils contributes to the acidification process, which leads to leaching of base cations. To test the effects of eutrophication on the availability of base cations in mangroves, we compared paired leaf and soil nutrient levels sampled in Nypa fruticans and Rhizophora spp. on a severely disturbed, i.e. nutrient loaded, site (Mahakam delta) with samples from an undisturbed, near-pristine site (Berau delta) in East Kalimantan, Indonesia. The findings indicate that under pristine conditions, the availability of base cations in mangrove soils is determined largely by salinity. Anthropogenic disturbances on the Mahakam site have resulted in eutrophication, which is related to lower levels of foliar and soil base cations. Path analysis suggests that increasing soil nitrogen reduces soil pH, which in turn reduces the levels of foliar and soil base cations in mangroves.

  9. Modification of potato peel waste with base hydrolysis and subsequent cationization.

    Science.gov (United States)

    Lappalainen, Katja; Kärkkäinen, Johanna; Joensuu, Päivi; Lajunen, Marja

    2015-11-01

    Potato peel waste (PW) is a starch containing biomaterial produced in large amounts by food processing industry. In this work, the treatment of PW by alkaline hydrolysis and cationization in the water phase is reported. In order to improve the cationization of starch, PW was hydrolyzed by heating with alkaline (NaOH) ethanol solution (80%) in a water bath. The impact of variable molar ratios of anhydroglucose unit (AGU):NaOH, heating temperatures and times was studied on the degradation of starch and the molecular size distribution of the product. The hydrolyzed PW was cationized subsequently in water by using glycidyltrimethylammonium chloride and catalyzed by NaOH under microwave irradiation or in an oil bath. The impact of the various reaction conditions on the cationization and degree of substitution of starch was studied. The degree of substitution of the cationized starch varied in the range of 0-0.35.

  10. Large zinc cation occupancy of octahedral sites in mechanically activated zinc ferrite powders

    International Nuclear Information System (INIS)

    The cation site occupancy of a mechanically activated nanocrystalline zinc ferrite powder was determined as (Zn0.552+Fe0.183+)tet[Zr0.452+Fe1.823+]octO4 through analysis of extended x-ray absorption fine structure measurements, showing a large redistribution of cations between sites compared to normal zinc ferrite samples. The overpopulation of cations in the octahedral sites was attributed to the ascendance in importance of the ionic radii over the crystal energy and bonding coordination in determining which interstitial sites are occupied in this structurally disordered powder. Slight changes are observed in the local atomic environment about the zinc cations, but not the iron cations, with respect to the spinel structure. The presence of Fe3+ on both sites is consistent with the measured room temperature magnetic properties. (c) 2000 American Institute of Physics

  11. Theoretical Investigation on the Adsorption of Ag+ and Hydrated Ag+ Cations on Clean Si(111)Surface

    Institute of Scientific and Technical Information of China (English)

    SHENG Yong-Li; LI Meng-Hua; WANG Zhi-Guo; LIU Yong-Jun

    2008-01-01

    In this paper,the adsorption of Ag+ and hydrated Ag+ cations on clean Si(111)surface were investigated by using cluster(Gaussian 03)and periodic(DMol3)ab initio calculations.Si(111)surface was described with cluster models(Si14H17 and Si22H21)and a four-silicon layer slab with periodic boundary conditions.The effect of basis set superposition error(BSSE)was taken into account by applying the counterpoise correction.The calculated results indicated that the binding energies between hydrated Ag+ cations and clean Si(111)surface are large,suggesting a strong interaction between hydrated Ag+ cations and the semiconductor surface.With the increase of number,water molecules form hydrogen bond network with one another and only one water molecule binds directly to the Ag+ cation.The Ag+ cation in aqueous solution will safely attach to the clean Si(111)surface.

  12. Cationic liposomes containing soluble Leishmania antigens (SLA) plus CpG ODNs induce protection against murine model of leishmaniasis.

    Science.gov (United States)

    Heravi Shargh, Vahid; Jaafari, Mahmoud Reza; Khamesipour, Ali; Jalali, Seyed Amir; Firouzmand, Hengameh; Abbasi, Azam; Badiee, Ali

    2012-07-01

    Development of an effective vaccine against leishmaniasis is possible due to the fact that individuals cured from cutaneous leishmaniasis (CL) are protected from further infection. First generation Leishmania vaccines consisting of whole killed parasites reached to phase 3 clinical trials but failed to show enough efficacies mainly due to the lack of an appropriate adjuvant. In this study, an efficient liposomal protein-based vaccine against Leishmania major infection was developed using soluble Leishmania antigens (SLA) as a first generation vaccine and cytidine phosphate guanosine oligodeoxynucleotides (CpG ODNs) as an immunostimulatory adjuvant. 1, 2-Dioleoyl-3-trimethylammonium-propane was used as a cationic lipid to prepare the liposomes due to its intrinsic adjuvanticity. BALB/c mice were immunized subcutaneously (SC), three times in 2-week intervals, with Lip-SLA-CpG, Lip-SLA, SLA + CpG, SLA, or HEPES buffer. As criteria for protection, footpad swelling at the site of challenge and spleen parasite loads were assessed, and the immune responses were evaluated by determination of IFN-γ and IL-4 levels of cultured splenocytes, and IgG subtypes. The group of mice that received Lip-SLA-CpG showed a significantly smaller footpad swelling, lower spleen parasite burden, higher IgG2a antibody, and lower IL-4 level compared to the control groups. It is concluded that cationic liposomes containing SLA and CpG ODNs are appropriate to induce Th1 type of immune response and protection against leishmaniasis. PMID:22223037

  13. Cationic liposomes containing soluble Leishmania antigens (SLA) plus CpG ODNs induce protection against murine model of leishmaniasis.

    Science.gov (United States)

    Heravi Shargh, Vahid; Jaafari, Mahmoud Reza; Khamesipour, Ali; Jalali, Seyed Amir; Firouzmand, Hengameh; Abbasi, Azam; Badiee, Ali

    2012-07-01

    Development of an effective vaccine against leishmaniasis is possible due to the fact that individuals cured from cutaneous leishmaniasis (CL) are protected from further infection. First generation Leishmania vaccines consisting of whole killed parasites reached to phase 3 clinical trials but failed to show enough efficacies mainly due to the lack of an appropriate adjuvant. In this study, an efficient liposomal protein-based vaccine against Leishmania major infection was developed using soluble Leishmania antigens (SLA) as a first generation vaccine and cytidine phosphate guanosine oligodeoxynucleotides (CpG ODNs) as an immunostimulatory adjuvant. 1, 2-Dioleoyl-3-trimethylammonium-propane was used as a cationic lipid to prepare the liposomes due to its intrinsic adjuvanticity. BALB/c mice were immunized subcutaneously (SC), three times in 2-week intervals, with Lip-SLA-CpG, Lip-SLA, SLA + CpG, SLA, or HEPES buffer. As criteria for protection, footpad swelling at the site of challenge and spleen parasite loads were assessed, and the immune responses were evaluated by determination of IFN-γ and IL-4 levels of cultured splenocytes, and IgG subtypes. The group of mice that received Lip-SLA-CpG showed a significantly smaller footpad swelling, lower spleen parasite burden, higher IgG2a antibody, and lower IL-4 level compared to the control groups. It is concluded that cationic liposomes containing SLA and CpG ODNs are appropriate to induce Th1 type of immune response and protection against leishmaniasis.

  14. Direct detection of hyaluronidase in urine using cationic gold nanoparticles: a potential diagnostic test for bladder cancer.

    Science.gov (United States)

    Nossier, Ahmed Ibrahim; Eissa, Sanaa; Ismail, Manal Fouad; Hamdy, Mohamed Ahmed; Azzazy, Hassan Mohamed El-Said

    2014-04-15

    Hyaluronidase (HAase) was reported as a urinary marker of bladder cancer. In this study, a simple colorimetric gold nanoparticle (AuNP) assay was developed for rapid and sensitive detection of urinary HAase activity. Charge interaction between polyanionic hyaluronic acid (HA) and cationic AuNPs stabilized with cetyl trimethyl ammonium bromide (CTAB) led to formation of gold aggregates and a red to blue color shift. HAase digests HA into small fragments preventing the aggregation of cationic AuNPs. The nonspecific aggregation of AuNPs in urine samples was overcome by pre-treatment of samples with the polycationic chitosan that was able to agglomerate all negatively charged interfering moieties before performing the assay. The developed AuNP assay was compared with zymography for qualitative detection of urinary HAase activity in 40 bladder carcinoma patients, 11 benign bladder lesions patients and 15 normal individuals, the assay sensitivity was 82.5% vs. 65% for zymography, while the specificity for both assays was 96.1%. The absorption ratio, A530/A620 of the reacted AuNP solution was used to quantify the HAase activity. The best cut off value was 93.5 μU/ng protein, at which the sensitivity was 90% and the specificity was 80.8%.The developed colorimetric AuNP HAase assay is simple, inexpensive, and can aid noninvasive diagnosis of bladder cancer. PMID:24240162

  15. Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.

    Science.gov (United States)

    Lai, Ren; Lomas, Lee O; Jonczy, Jan; Turner, Philip C; Rees, Huw H

    2004-01-01

    Two non-cationic defensin-like antimicrobial peptides, named Amblyomma defensin peptide 1 and Amblyomma defensin peptide 2, were identified from the hard tick, Amblyomma hebraeum, by a combination of suppression subtractive hybridization for differentially expressed genes and proteomics. cDNA clones encoding each of these two defensin-like antimicrobial peptides were isolated from the differentially expressed cDNA library of the tick synganglia (central nervous system). The preproproteins deduced from the cDNA sequences each have 92 amino acid residues. Amblyomma defensin peptide 2 was purified from the haemolymph of fed female ticks. The purified peptide displayed antibacterial activity against Gram-negative and Gram-positive bacteria. Amblyomma defensin peptide 1 was further identified by protein chip capture combined with SELDI-TOF (surface-enhanced laser desorption/ionization-time-of-flight) MS. By screening for differentially expressed proteins, it was found that the expression of Amblyomma defensin peptide 1 was upregulated during 4 days post-feeding. Our findings firstly provide two defensin-like antimicrobial peptides that are particularly novel in being anionic, together with corresponding cDNA sequences, in hard ticks, and prove that the combination of suppression subtractive hybridization and protein profiling is a powerful method to study differentially expressed proteins, especially for organisms without available genome sequence information. PMID:14705963

  16. Osteoporosis in lysinuric protein intolerance.

    Science.gov (United States)

    Parto, K; Penttinen, R; Paronen, I; Pelliniemi, L; Simell, O

    1993-01-01

    Lysinuric protein intolerance (LPI) is an autosomal recessive disease characterized by defective transport of cationic amino acids. Patients have an increased incidence of fractures and their skeletal radiographs show osteoporosis. The aim of the study was to characterize the osteopenia in LPI. Twenty-nine Finnish LPI patients (age range 3.7-44.4 years) were screened for parameters of bone metabolism. Morphometric analysis of bone was carried out in specimens of 9 patients. Collagen synthesis was studied with cultured skin fibroblasts (4 patients) and collagen fibril sizes (3 patients) were measured using electron microscopy. Most histological bone specimens (8/9) showed osteoporosis. Osteomalacia was excluded. Routine clinical laboratory tests were unrevealing. The concentrations of free hydroxyproline and type III procollagen N-propeptide in serum and the urinary excretion of hydroxyproline were increased in almost all patients during their growth and in about half of adult patients. Collagen synthesis in LPI fibroblast cultures was significantly decreased compared with that in age-matched controls at 5 (p < 0.01), 14 (p < 0.01) and still at 30 years (p < 0.01), whereas no difference was observed at the age of 44 years (p = N.S.). Osteoporosis in LPI might reflect defective matrix protein synthesis caused by protein deprivation and deficiency of cationic amino acids. Increased collagen turnover can also contribute to the osteoporosis. PMID:8412005

  17. Preservation of Bacillus pumilus PU4-2 xylanases by immobilization technique into pollard and cation addition

    Directory of Open Access Journals (Sweden)

    T Haryati

    2010-03-01

    Full Text Available Utilization of by-product from agriculture as alternative source of feedstuff has been widely practiced. However their usage is limited due to high fiber content and low nutrient digestibility. The use of specific hydrolizing enzymes, xylanases are gaining importance because of their wide application in various industrial sectors especially in bioconversion of hemicellulosic material. This experiment was done to evaluate the effect of cation addition and immobilization of enzyme into pollard on stability of B. pumilus xylanase. The enzyme extract was purified by precipitation with 75% ammonium sulphate. Four kinds of cation (Ca2+, Fe3+, Mg2+, Zn2+ were added to the purified enzyme, at concentration of 1m M and stored at 4 and 27˚C. For immobilization process, the optimum enzyme concentration that will be added to pollard has been evaluated by analysis of xylanase activity and their recovery. The specific activity of enzyme after precipitation increased 1.8 times, from 420.3 to 765.2 U/mg protein. All cations act as activator which relative activity become 130.6; 139.0; 103.8 and 163.5% respectively. Concentration of 0.5mM Ca2+ and Fe3+ were most able to keep xylanases activity stable at 4˚C. The optimum composition of enzymes and pollard was 1.5 ml for 5 gram of pollard with recovery of xylanases activity of 82.2%. In immobilized enzyme, the activity of enzyme without cation addition is higher than that with addition of Ca2+ and Fe3+. Activity of enzyme stored at 4˚C is more stable than that at 27˚C. Immobilized enzyme is more stable for storage, which lasted for 7 weeks at 27˚C and 12 weeks at 4˚C compared to liquid enzyme which lasted for only 7 days at 27˚C and 13 days at 4˚C.

  18. Novel localization of OCTN1, an organic cation/carnitine transporter, to mammalian mitochondria

    International Nuclear Information System (INIS)

    Carnitine is a zwitterion essential for the β-oxidation of fatty acids. We report novel localization of the organic cation/carnitine transporter, OCTN1, to mitochondria. We made GFP- and RFP-human OCTN1 cDNA constructs and showed expression of hOCTN1 in several transfected mammalian cell lines. Immunostaining of GFP-hOCTN1 transfected cells with different intracellular markers and confocal fluorescent microscopy demonstrated mitochondrial expression of OCTN1. There was striking co-localization of an RFP-hOCTN1 fusion protein and a mitochondrial-GFP marker construct in transfected MEF-3T3 and no co-localization of GFP-hOCTN1 in transfected human skin fibroblasts with other intracellular markers. L-[3H]Carnitine uptake in freshly isolated mitochondria of GFP-hOCTN1 transfected HepG2 demonstrated a K m of 422 μM and Western blot with an anti-GFP antibody identified the expected GFP-hOCTN1 fusion protein (90 kDa). We showed endogenous expression of native OCTN1 in HepG2 mitochondria with anti-GST-hOCTN1 antibody. Further, we definitively confirmed intact L-[3H]carnitine uptake (K m 1324 μM), solely attributable to OCTN1, in isolated mitochondria of mutant human skin fibroblasts having <1% of carnitine acylcarnitine translocase activity (alternate mitochondrial carnitine transporter). This mitochondrial localization was confirmed by TEM of murine heart incubated with highly specific rabbit anti-GST-hOCTN1 antibody and immunogold labeled goat anti-rabbit antibody. This suggests an important yet different role for OCTN1 from other OCTN family members in intracellular carnitine homeostasis

  19. Cation immobilization in pyrolyzed simulated spent ion exchange resins

    Energy Technology Data Exchange (ETDEWEB)

    Luca, Vittorio, E-mail: vluca@cnea.gov.ar [Programa Nacional de Gestion de Residuos Radiactivos, Centro Atomico Constituyentes, Comision Nacional de Energia Atomica, Av. General, Paz 1499, 1650 San Martin, Provincia de Buenos Aires (Argentina); Bianchi, Hugo L. [Gerencia de Quimica, Centro Atomico Constituyentes, Comision Nacional de Energia Atomica, Av. General, Paz 1499, 1650 San Martin, Provincia de Buenos Aires (Argentina); ECyT, Universidad Nacional de General San Martin, Campus Miguelete, Ed. Tornavias, Martin de Irigoyen 3100, 1650 San Martin (Argentina); Conicet, Av. Rivadavia 1917, 1033 Buenos Aires (Argentina); Manzini, Alberto C. [Programa Nacional de Gestion de Residuos Radiactivos, Comision Nacional de Energia Atomica, Av. Del Libertador 8250, CP 1429, Ciudad Autonoma de Buenos Aires (Argentina)

    2012-05-15

    Significant quantities of spent ion exchange resins that are contaminated by an assortment of radioactive elements are produced by the nuclear industry each year. The baseline technology for the conditioning of these spent resins is encapsulation in ordinary Portland cement which has various shortcomings none the least of which is the relatively low loading of resin in the cement and the poor immobilization of highly mobile elements such as cesium. The present study was conducted with cationic resin samples (Lewatit S100) loaded with Cs{sup +}, Sr{sup 2+}, Co{sup 2+}, Ni{sup 2+} in roughly equimolar proportions at levels at or below 30% of the total cation exchange capacity. Low temperature thermal treatment of the resins was conducted in inert (Ar), or reducing (CH{sub 4}) gas atmospheres, or supercritical ethanol to convert the hydrated polymeric resin beads into carbonaceous materials that contained no water. This pyrolytic treatment resulted in at least a 50% volume reduction to give mechanically robust spherical materials. Scanning electron microscope investigations of cross-sections of the beads combined with energy dispersive analysis showed that initially all elements were uniformly distributed through the resin matrix but that at higher temperatures the distribution of Cs became inhomogeneous. Although Cs was found in the entire cross-section, a significant proportion of the Cs occurred within internal rings while a proportion migrated toward the outer surfaces to form a crustal deposit. Leaching experiments conducted in water at 25 Degree-Sign C showed that the divalent contaminant elements were very difficult to leach from the beads heated in inert atmospheres in the range 200-600 Degree-Sign C. Cumulative fractional loses of the order of 0.001 were observed for these divalent elements for temperatures below 500 Degree-Sign C. Regardless of the processing temperature, the cumulative fractional loss of Cs in water at 25 Degree-Sign C reached a plateau or

  20. The fifth adaptor protein complex.

    OpenAIRE

    Jennifer Hirst; Barlow, Lael D.; Gabriel Casey Francisco; Sahlender, Daniela A.; Seaman, Matthew N.J.; Dacks, Joel B.; Robinson, Margaret S.

    2011-01-01

    Adaptor protein (AP) complexes sort cargo into vesicles for transport from one membrane compartment of the cell to another. Four distinct AP complexes have been identified, which are present in most eukaryotes. We report the existence of a fifth AP complex, AP-5. Tagged AP-5 localises to a late endosomal compartment in HeLa cells. AP-5 does not associate with clathrin and is insensitive to brefeldin A. Knocking down AP-5 subunits interferes with the trafficking of the cation-independent manno...

  1. The Fifth Adaptor Protein Complex

    OpenAIRE

    Hirst, Jennifer; D. Barlow, Lael; Francisco, Gabriel Casey; Sahlender, Daniela A.; Seaman, Matthew N.J.; Dacks, Joel B.; Robinson, Margaret S.

    2011-01-01

    Adaptor protein (AP) complexes sort cargo into vesicles for transport from one membrane compartment of the cell to another. Four distinct AP complexes have been identified, which are present in most eukaryotes. We report the existence of a fifth AP complex, AP-5. Tagged AP-5 localises to a late endosomal compartment in HeLa cells. AP-5 does not associate with clathrin and is insensitive to brefeldin A. Knocking down AP-5 subunits interferes with the trafficking of the cation-independent manno...

  2. Radical Cations of the Monomer and van der Waals Dimer of a Methionine Residue as Prototypes of (2 Center-3 Electron) SN and SS Bonds. Molecular Simulations of Their Absorption Spectra in Water.

    Science.gov (United States)

    Archirel, Pierre; Bergès, Jacqueline; Houée-Lévin, Chantal

    2016-09-22

    Oxidation of peptides or proteins by the OH(•) radicals produced by pulse radiolysis yields species identified by their absorption spectra in the UV-visible domain. However, the case of methionine (Met) in peptides is complex because its oxidation can lead to various free radicals with 2 center-3 electron (2c-3e) bonds. We have performed Monte Carlo/density functional theory molecular simulations of the radical cation of the methylated methionine aminoacid, Met(•+), taken as a model of the methonine residue of peptides, and of the radical cation of its van der Waals dimer, Met2(•+). The cation of the methionine residue displays a 2c-3e SN bond. The cation of dimer Met2(•+) displays three quasidegenerate conformers, one stabilized by a 2c-3e SS bond and the other two stabilized by ion-molecule interactions and made up of a neutral and a cationic unit. These conformers are characterized by their charge and spin density localization and their UV-visible absorption spectra. These spectra enable a discussion of the absorption spectra of the literature; in particular, we emphasize the role of dimers before and after the oxidation process. PMID:27564585

  3. Effect of RNA interference therapy on the mice eosinophils CCR3 gene and granule protein in the murine model of allergic rhinitis

    Institute of Scientific and Technical Information of China (English)

    Xin-Hua Zhu; Bing Liao; Ke Liu; Yue-Hui Liu

    2014-01-01

    Objective:To observe the clinical manifestations of allergic rhinitis mice and the expression changes of the eosinophilsCCR3 and the granule protein mRNA in the bone marrow, peripheral blood and nasal lavage fluid.Methods:Twenty-fourBALB/c mice were randomly divided into the control group,PBS therapy group, siRNA therapy group and theCCR3 siRNA therapy group (n=6).Allergic rhinitis model were sensitized and stimulated by ovalbunfin, andCCR3 siRNA therapy group were administered withCCR3 transnasally before stimulated.The levels of the eosinophilsCCR3,MBP,ECP andEPO in bone marrow, peripheral blood and nasal lavage fluid were detected byRT-PCR.Results:Compared to the control group andCCR3 siRNA therapy group, the nasal mucosa of thePBS therapy group and siRNA therapy group developed epithalaxy, goblet cells hyperplasia, squamous epithelium metaplasia, epithelium necrosis, lamina propria and submucosa gland hyperplasia, vasodilatation, tissue edema, and the characterized eosinophil infiltration.RT-PCR indicated that theCCR3 mRNA,MBP ,ECP andEPO expression in bone marrow, peripheral blood and nasal lavage fluid of theCCR3 siRNA therapy group was lower than thePBS therapy group andsiRNA therapy group(P<0.05).Conclusions:TheRNA interference therapy toCCR3 by local administration pernasal can suppress the process of the development, migration and invasion of the allergic rhinitis eosinophil, thus can reduce the effect of eosinophils and then reduce the inflammation effect of the allergic rhinitis.It may be a new treatment for respiratory tract allergic inflammation.

  4. Conserved and Diversified Gene Families of Monovalent Cation/H+ Antiporters from Algae to Flowering Plants

    Directory of Open Access Journals (Sweden)

    Salil eChanroj

    2012-02-01

    Full Text Available All organisms have evolved strategies to regulate ion and pH homeostasis in response to developmental and environmental cues. One strategy is mediated by cation-proton antiporters (CPA. CPA1 genes found in bacteria, fungi, metazoa and plants have been functionally-characterized; though roles of plant CPA2 genes in KEA (K+-efflux antiporter and CHX (cation/H+ exchanger families are largely unknown. Phylogenetic analysis showed that three clades of the Na+-H+ exchanger (NHX family have been conserved from single-celled alga to Arabidopsis. These are i plasma membrane-bound SOS1/AtNHX7 that share ancestry with prokaryote NhaP, ii endosomal AtNHX5/6 that is part of the eukaryote Intracellular-NHE clade, and iii a vacuolar NHX clade (AtNHX1-4 specific to plants. Early diversification of KEA genes possibly from ancestral genes of a cyanobacterium is suggested for three K+-efflux antiporter clades (KEA/Kef seen in all plants. Intriguingly, the CHX gene family blossomed from a few members in early land plants to >40 genes in legumes. Homologs from spirogyra or moss share high similarity with guard cell-specific AtCHX20, suggesting that AtCHX20 and its relatives (AtCHX16-19 are founders of the family. Evolutionary analysis suggests pollen-expressed CHX genes appeared later in monocots and early eudicots. AtCHX proteins have been localized to intracellular and plasma membrane of plants, and shown to mediate K+ transport and pH homeostasis. Thus KEA genes are conserved from green algae to angiosperms, and their presence in red algae and secondary endosymbionts suggest a role in plastids. In contrast, AtNHX1-4 subtype evolved in ancestral plants to handle ion homeostasis of vacuoles in all cell types. The strong presence of CHX genes in land plants, but not in metazoa or fungi, would infer a role of ion and pH homeostasis at dynamic endomembranes to support vegetative and reproductive success of flowering plants.

  5. OmpW of Caulobacter crescentus Functions as an Outer Membrane Channel for Cations.

    Directory of Open Access Journals (Sweden)

    Roland Benz

    Full Text Available Caulobacter crescentus is an oligotrophic bacterium that lives in dilute organic environments such as soil and freshwater. This bacterium represents an interesting model for cellular differentiation and regulation because daughter cells after division have different forms: one is motile while the other is non-motile and can adhere to surfaces. Interestingly, the known genome of C. crescentus does not contain genes predicted to code for outer membrane porins of the OmpF/C general diffusion type present in enteric bacteria or those coding for specific porins selective for classes of substrates. Instead, genes coding for 67 TonB-dependent outer membrane receptors have been identified, suggesting that active transport of specific nutrients may be the norm. Here, we report that high channel-forming activity was observed with crude outer membrane extracts of C. crescentus in lipid bilayer experiments, indicating that the outer membrane of C. crescentus contained an ion-permeable channel with a single-channel conductance of about 120 pS in 1M KCl. The channel-forming protein with an apparent molecular mass of about 20 kDa was purified to homogeneity. Partial protein sequencing of the protein indicated it was a member of the OmpW family of outer membrane proteins from Gram-negative bacteria. This channel was not observed in reconstitution experiments with crude outer membrane extracts of an OmpW deficient C. crescentus mutant. Biophysical analysis of the C. crescentus OmpW suggested that it has features that are special for general diffusion porins of Gram-negative outer membranes because it was not a wide aqueous channel. Furthermore, OmpW of C. crescentus seems to be different to known OmpW porins and has a preference for ions, in particular cations. A putative model for OmpW of C. crescentus was built on the basis of the known 3D-structures of OmpW of Escherichia coli and OprG of Pseudomonas aeruginosa using homology modeling. A comparison of the two

  6. OmpW of Caulobacter crescentus Functions as an Outer Membrane Channel for Cations.

    Science.gov (United States)

    Benz, Roland; Jones, Michael D; Younas, Farhan; Maier, Elke; Modi, Niraj; Mentele, Reinhard; Lottspeich, Friedrich; Kleinekathöfer, Ulrich; Smit, John

    2015-01-01

    Caulobacter crescentus is an oligotrophic bacterium that lives in dilute organic environments such as soil and freshwater. This bacterium represents an interesting model for cellular differentiation and regulation because daughter cells after division have different forms: one is motile while the other is non-motile and can adhere to surfaces. Interestingly, the known genome of C. crescentus does not contain genes predicted to code for outer membrane porins of the OmpF/C general diffusion type present in enteric bacteria or those coding for specific porins selective for classes of substrates. Instead, genes coding for 67 TonB-dependent outer membrane receptors have been identified, suggesting that active transport of specific nutrients may be the norm. Here, we report that high channel-forming activity was observed with crude outer membrane extracts of C. crescentus in lipid bilayer experiments, indicating that the outer membrane of C. crescentus contained an ion-permeable channel with a single-channel conductance of about 120 pS in 1M KCl. The channel-forming protein with an apparent molecular mass of about 20 kDa was purified to homogeneity. Partial protein sequencing of the protein indicated it was a member of the OmpW family of outer membrane proteins from Gram-negative bacteria. This channel was not observed in reconstitution experiments with crude outer membrane extracts of an OmpW deficient C. crescentus mutant. Biophysical analysis of the C. crescentus OmpW suggested that it has features that are special for general diffusion porins of Gram-negative outer membranes because it was not a wide aqueous channel. Furthermore, OmpW of C. crescentus seems to be different to known OmpW porins and has a preference for ions, in particular cations. A putative model for OmpW of C. crescentus was built on the basis of the known 3D-structures of OmpW of Escherichia coli and OprG of Pseudomonas aeruginosa using homology modeling. A comparison of the two known structures

  7. [Expression, purification of recombinant cationic peptide AIK in Escherichia coli and its antitumor activity].

    Science.gov (United States)

    Fan, Fangfang; Sun, Huiying; Xu, Hui; Liu, Jiawei; Zhang, Haiyuan; Li, Yilan; Ning, Xuelian; Sun, Yue; Bai, Jing; Fu, Songbin; Zhou, Chunshui

    2015-12-01

    AIK is a novel cationic peptide with potential antitumor activity. In order to construct the AIK expression vector by Gateway technology, and establish an optimal expression and purification method for recombinant AIK, a set of primers containing AttB sites were designed and used to create the AttB-TEV-FLAG-AIR fusion gene by overlapping PCR. The resulting fusion gene was cloned into the donor vector pDONR223 by attB and attP mediated recombination (BP reaction), then, transferred into the destination vector pDESTl 5 by attL and attR mediated recombination (LR reaction). All the cloning was verified by both colony PCR and DNA sequencing. The BL21 F. coli transformed by the GST-AIR expression plasmid was used to express the GST-AIK fusion protein with IPTG induction and the induction conditions were optimized. GST-AIR fusion protein was purified by glutathione magnetic beads, followed by rTEV cleavage to remove GST tag and MTS assay to test the growth inhibition activity of the recombinant AIR on human leukemia HL-60 cells. We found that a high level of soluble expression of GST-AIK protein (more than 30% out of the total bacterial proteins) was achieved upon 0.1 mmol/L ITPG induction for 4 h at 37 °C in the transformed BL21 F. coli with starting OD₆₀₀ at 1.0. Through GST affinity purification and rTEV cleavage, the purity of the resulting recombinant AIK was greater than 95%. And the MTS assays on HL-60 cells confirmed that the recombinant AIK retains an antitumor activity at a level similar to the chemically synthesized AIK. Taken together, we have established a method for expression and purification of recombinant AIK with a potent activity against tumor cells, which will be beneficial for the large-scale production and application of recombinant AIK in the future. PMID:27093838

  8. Dipicolinate complexes of main group metals with hydrazinium cation

    Indian Academy of Sciences (India)

    K Saravanan; S Govindarajan

    2002-02-01

    Some new coordination complexes of hydrazinium main group metal dipicolinate hydrates of formulae (N2H5)2M(dip)2.H2O (where, M =Ca, Sr, Ba or Pb and = 0, 2, 4 and 3 respectively and dip = dipicolinate), N2H5Bi(dip)2.3H2O and (N2H5)3Bi(dip)3.4H2O have been prepared and characterized by physico-chemical techniques. The infrared spectra of the complexes reveal the presence of tridentate dipicolinate dianions and non-coordinating hydrazinium cations. Conductance measurements show that the mono, di and trihydrazinium complexes behave as 1:1, 2:1 and 3:1 electrolytes respectively, in aqueous solution. Thermal decomposition studies show that these compounds lose water followed by endothermic decomposition of hydrazine to give respective metal hydrogendipicolinate intermediates, which further decompose exothermically to the final product of either metal carbonates (Ca, Sr, Ba and Pb) or metal oxycarbonates (Bi). The coordination numbers around the metal ions differ from compound to compound. The various coordination numbers exhibited by these metals are six (Ca), seven (Ba), eight (Sr) and nine (Pb and Bi). In all the complexes the above coordination number is attained by tridentate dipicolinate dianions and water molecules. The X-ray diffraction patterns of these compounds differ from one another suggesting that they are not isomorphous.

  9. Structure-conductivity studies in polymer electrolytes containing multivalent cations

    CERN Document Server

    Aziz, M

    1996-01-01

    force microscopy (AFM). DSC evidences helped to explain the texture of the iron samples during the drying process, and showed transitions between low melting, PEO and high melting spherulites, and VTPM is able to visualise the spherulites present in the samples. AFM has successfully imaged the as cast PEO sub 8 :FeBr sub 2 sample and the surface effect causing extra resistance in the impedance spectra could be seen. Conductivity studies were carried out using a.c. impedance spectra. Fe(ll) samples exhibit the typical semicircle-spike plot but the Fe(lll) samples displayed an extra semicircle before the spike reflecting a surface effect. This is also manifested in the Arrhenius plots of the same samples where a dip was shown at 100 deg C. From the conductivity studies on the iron systems it was found that for the dry samples the optimum conductivity was observed in PEO sub 8 :FeBr sub x irrespective of the valence state of the cation. For the air-cast samples the optimum conductivity composition depends on the...

  10. Structures of tin cluster cations Sn3+ to Sn15+

    Science.gov (United States)

    Drebov, Nedko; Oger, Esther; Rapps, Thomas; Kelting, Rebecca; Schooss, Detlef; Weis, Patrick; Kappes, Manfred M.; Ahlrichs, Reinhart

    2010-12-01

    We employ a combination of ion mobility measurements and an unbiased systematic structure search with density functional theory methods to study structure and energetics of gas phase tin cluster cations, {Snn}^+, in the range of n = 3-15. For {Sn_{13}}^+ we also carry out trapped ion electron diffraction measurements to ascertain the results obtained by the other procedures. The structures for the smaller systems are most easily described by idealized point group symmetries, although they are all Jahn-Teller distorted: D_{3h} (trigonal bipyramid), D_{4h} (octahedron), D_{5h} (pentagonal bipyramid) for n = 5, 6, and 7. For the larger systems we find capped D_{5h} for {Sn8}^+ and {Sn9}^+, D_{3h} (tricapped trigonal prism) and D_{4d} (bicapped squared antiprism) plus adatoms for n = 10, 11, 14, and 15. A centered icosahedron with a peripheral atom removed is the dominant motif in {Sn_{12}}^+. For {Sn_{13}}^+ the calculations predict a family of virtually isoenergetic isomers, an icosahedron and slightly distorted icosahedra, which are about 0.25 eV below two C_1 structures. The experiments indicate the presence of two structures, one from the I_h family and a prolate C_1 isomer based on fused deltahedral moieties.

  11. Nonbonded interactions in membrane active cyclic biopolymers. IV - Cation dependence

    Science.gov (United States)

    Radhakrishnan, R.; Srinivasan, S.; Prasad, C. V.; Brinda, S. R.; Macelroy, R. D.; Sundaram, K.

    1980-01-01

    Interactions of valinomycin and form of its analogs in several conformations with the central ions Li(+), Na(+), K(+), Rb(+) and Cs(+) are investigated as part of a study of the specific preference of valinomycin for potassium and the mechanisms of carrier-mediated ion transport across membranes. Ion binding energies and conformational potential energies are calculated taking into account polarization energy formulas and repulsive energy between the central ion and the ligand atoms for conformations representing various stages in ion capture and release for each of the two ring chiralities of valinomycin and its analogs. Results allow the prediction of the chirality and conformation most likely to be observed for a given analog, and may be used to synthesize analogs with a desired rigidity or flexibility. The binding energies with the alkali metal cations are found to decrease with increasing ion size, and to be smaller than the corresponding ion hydration energies. It is pointed out that the observed potassium preference may be explainable in terms of differences between binding and hydration energies. Binding energies are also noted to depend on ligand conformation.

  12. Computer simulation of methanol exchange dynamics around cations and anions

    Energy Technology Data Exchange (ETDEWEB)

    Roy, Santanu; Dang, Liem X.

    2016-03-03

    In this paper, we present the first computer simulation of methanol exchange dynamics between the first and second solvation shells around different cations and anions. After water, methanol is the most frequently used solvent for ions. Methanol has different structural and dynamical properties than water, so its ion solvation process is different. To this end, we performed molecular dynamics simulations using polarizable potential models to describe methanol-methanol and ion-methanol interactions. In particular, we computed methanol exchange rates by employing the transition state theory, the Impey-Madden-McDonald method, the reactive flux approach, and the Grote-Hynes theory. We observed that methanol exchange occurs at a nanosecond time scale for Na+ and at a picosecond time scale for other ions. We also observed a trend in which, for like charges, the exchange rate is slower for smaller ions because they are more strongly bound to methanol. This work was supported by the US Department of Energy, Office of Science, Office of Basic Energy Sciences, Division of Chemical Sciences, Geosciences, and Biosciences. The calculations were carried out using computer resources provided by the Office of Basic Energy Sciences.

  13. Measurement of cation movement in primary cultures using fluorescent dyes.

    Science.gov (United States)

    Reynolds, I J

    2001-05-01

    Ca(2+), Na(+), K(+), and Mg(2+) have a central role in neuronal excitability. The concentration of these cations in the cytoplasm of neurons (generically termed [ion(+)]i) provides a marker of the excitation state of the neurons, and may also illuminate the activity of specific signaling mechanisms that involve Ca(2+)- or Mg(2+)-activated enzymes. The measurement of [ion(+)]i in cultured neurons is achieved with the use of an ion-sensitive fluorescent dye in combination with equipment designed to quantitatively measure fluorescence. Specificity is obtained by choosing dyes with the appropriate selectivity for the ion of interest. Measurements of steady state ion concentrations can be made, as well as measurements of the net difference between ion movement into the cytoplasm (in response to a stimulus) and the physiological buffering of that ion. The procedures in this unit for loading and recording from dyes are broadly similar for each ion when ratiometric dyes are used as described, and can readily be modified for use with single-wavelength dyes. Support protocols are provided for calibration of individual dyes, which can be more problematic. PMID:18428522

  14. Cationic micellar nanoparticles for DNA and doxorubicin co-delivery.

    Science.gov (United States)

    Lin, Jian-Tao; Zou, Ying; Wang, Chao; Zhong, Yue-Chun; Zhao, Yi; Zhu, Hui-Er; Wang, Guan-Hai; Zhang, Li-Ming; Zheng, Xue-Bao

    2014-11-01

    Cationic micellar nanoparticles for chemotherapeutic drugs and therapeutic gene co-delivery were prepared based on a poly-(N-ε-carbobenzyloxy-l-lysine) (PZLL) and dendritic polyamidoamine (PAMAM) block copolymer (PZLL-D3). PZLL-D3 was synthesized by a copper-catalyzed azide alkyne cyclization (click) reaction between α-alkyne-PZLL and azide focal point PAMAM dendrons. Its structure was characterized by (1)H NMR and FTIR, and its buffering capability was determined by acid-base titration. MTT, agarose gel electrophoresis and flow cytometry studies showed that PZLL-D3 revealed low in vitro cytotoxicity, strong pDNA condensation ability, protection of pDNA against deoxyribonuclease I degradation and high gene transfection efficiency in 293T and HeLa cells. In addition, the micellar nanoparticles delivered pDNA and anticancer drug doxorubicin (DOX) simultaneously and efficiently to tumor cells, and the DOX loaded nanoparticles showed sustained in vitro release at pH=7.4 and 5.8. PMID:25280725

  15. An Overview on Metal Cations Extraction by Azocalixarenes

    Directory of Open Access Journals (Sweden)

    Hasalettin Deligöz

    2011-12-01

    Full Text Available In this overview, our main aim is to present the design, preparation, characterization, and extraction/sorption properties of chromogenic azocalix[4]arenes (substituted with different groups toward metal cations. Azocalixarenes, which contain a conjugated chromophore, i.e. azo (-N=N- group are synthesized in “one-pot” procedures in satisfactory yields. A wide variety of applications is expected by the functionalization of the side arms. Some of them are used to complex with metal ions. These macrocycles due to their bowl-shaped geometry are indeed used as hosts allowing ionic or organic guests to coordinate onto their cavity. The azocalixarene based ionophores are generally applied in various fields such as catalyst recovery, power plant, agriculture, metals finishing, microelectonics, biotechnology processes, rare earths speciation, and potable water purification. Besides these, they find applications in the area of selective ion extractions, receptors, optical devices, chemical sensor devices, the stationary phase for capillary chromatography, ion transport membranes, and luminescence probes etc. This survey is focused to provide overview an of the versatile nature of azocalix[n]arenes as highly efficient extractants for metal ions treated as pollutants.

  16. Synthesis and Bioactivities of Kanamycin B-Derived Cationic Amphiphiles.

    Science.gov (United States)

    Fosso, Marina Y; Shrestha, Sanjib K; Green, Keith D; Garneau-Tsodikova, Sylvie

    2015-12-10

    Cationic amphiphiles derived from aminoglycosides (AGs) have been shown to exhibit enhanced antimicrobial activity. Through the attachment of hydrophobic residues such as linear alkyl chains on the AG backbone, interesting antibacterial and antifungal agents with a novel mechanism of action have been developed. Herein, we report the design and synthesis of seven kanamycin B (KANB) derivatives. Their antibacterial and antifungal activities, along with resistance/enzymatic, hemolytic, and cytotoxicity assays were also studied. Two of these compounds, with a C12 and C14 aliphatic chain attached at the 6″-position of KANB through a thioether linkage, exhibited good antibacterial and antifungal activity, were poorer substrates than KANB for several AG-modifying enzymes, and could delay the development of resistance in bacteria and fungi. Also, they were both relatively less hemolytic than the known membrane targeting antibiotic gramicidin and the known antifungal agent amphotericin B and were not toxic at their antifungal MIC values. Their oxidation to sulfones was also demonstrated to have no effect on their activities. Moreover, they both acted synergistically with posaconazole, an azole currently used in the treatment of human fungal infections. PMID:26592740

  17. Script identification in printed bilingual documents

    Indian Academy of Sciences (India)

    D Dhanya; A G Ramakrishnan; Peeta Basa Pati

    2002-02-01

    Identification of the script of the text in multi-script documents is one of the important steps in the design of an OCR system for the analysis and recognition of the page. Much work has already been reported in this area relating to Roman, Arabic, Chinese, Korean and Japanese scripts. In the Indian context, though some results have been reported, the task is still at its infancy. In the work presented in this paper, a successful attempt has been made to identify the script, at the word level, in a bilingual document containing Roman and Tamil scripts. Two different approaches have been proposed and thoroughly tested. In the first method, words are divided into three distinct spatial zones. The spatial spread of a word in upper and lower zones, together with the character density, is used to identify the script. The second technique analyses the directional energy distribution of a word using Gabor filters with suitable frequencies and orientations. Words with various font styles and sizes have been used for the testing of the proposed algorithms and the results are quite encouraging.

  18. Cation distribution and mixing thermodynamics in Fe/Ni thiospinels

    Science.gov (United States)

    Haider, Saima; Grau-Crespo, Ricardo; Devey, Antony J.; de Leeuw, Nora H.

    2012-07-01

    The structural analogy between Ni-doped greigite minerals (Fe3S4) and the (Fe, Ni)S clusters present in biological enzymes has led to suggestions that these minerals could have acted as catalysts for the origin of life. However, little is known about the distribution and stability of Ni dopants in the greigite structure. We present here a theoretical investigation of mixed thiospinels (Fe1-xNix)3S4, using a combination of density functional theory (DFT) calculations and Monte Carlo simulations. We find that the equilibrium distribution of the cations deviates significantly from a random distribution: at low Ni concentrations, Ni dopants are preferably located in octahedral sites, while at higher Ni concentrations the tetrahedral sites become much more favourable. The thermodynamic mixing behaviour between greigite and polydymite (Ni3S4) is dominated by the stability field of violarite (FeNi2S4), for which the mixing enthalpy exhibits a deep negative minimum. The analysis of the free energy of mixing shows that Ni doping of greigite is very unstable with respect to the formation of a separate violarite phase. The calculated variation of the cubic cell parameter with composition is found to be non-linear, exhibiting significant deviation from Vegard’s law, but in agreement with experiment.

  19. Effect of cation trapping on thermal stability of magnetite nanoparticles.

    Science.gov (United States)

    Pati, S S; Philip, John

    2014-06-01

    We investigate the effect of sodium trapping on thermal stability of magnetite (Fe3O4) nanoparticles. The pure magnetite nanoparticles incubated in sodium hydroxide solutions and subsequently washed with water to remove the excess sodium. The amount of sodium in magnetite is measured using atomic absorption spectroscopy. The size distribution obtained from Small angle X-ray scattering measurements show that particles are fairly monodisperse. The FTIR spectra of nanoparticles show transmission bands at 441 and 611 cm(-1) are due to the symmetric stretching vibrations (v) of Fe-O in octahedral and tetrahedral sites respectively. With 500 ppm of sodium ions (Na+) in magnetite, the cubic ferrite structure of maghemite (gamma-Fe2O3) to hexagonal hematite (alpha-Fe2O3) phase transition is enhanced by -150 degrees C in air. The Rietveld analysis of sodium doped magnetite nanoparticles show that above 99% of metastable gamma-Fe2O3 is converted to a thermodynamically stable alpha-Fe2O3 after air annealing at 700 degrees C. A decrease in enthalpy observed in doped magnetite unambiguously confirms that the activation energy for maghemite to hematite transition is increased due to the presence of trapped sodium ions. These results suggest that the trapped cations in ferrite nanoparticles can stabilize them by increasing the activation energy.

  20. New methodology for a person identification system

    Indian Academy of Sciences (India)

    R Bremananth; A Chitra

    2006-06-01

    Reliable person identification is a key factor for any safety measure. Unlike other biometrics such as the palm, retina, gait, face and fingerprints, the characteristic of the iris is stable in a person’s lifetime. Iris patterns are chaotically distributed and well suited for recognizing persons throughout their lifetime with a single conscription. This paper proposes a new approach to person recognition based on iris patterns, which works with indoor outdoor conditions, spectacles contact lens wearing persons and diseased eyes. A challenge-response method is used for eye aliveness checking that puts off artificial sources from entering the iris database. The proposed algorithm can work with 84 statistical iris features that are extracted from an individual. Space and time complexity of the proposed approach is lesser than the existing methods. This algorithm has been implemented and results have been analysed on 2500 different iris patterns acquired in India under different real-time conditions. Experimental results illustrate that the proposed method has been easily espoused in elections, bank transactions and other security applications.