Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

DEFF Research Database (Denmark)

Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

2013-01-01

Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

Science.gov (United States)

There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

Is the American Zebu really Bos indicus?

Directory of Open Access Journals (Sweden)

Meirelles Flávio V.

1999-01-01

Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

OpenAIRE

Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

2016-01-01

En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

Efecto de la proporción de genes Bos indicus x Bos taurus sobre peso al destete y edad a primer parto en una población multirracial

Directory of Open Access Journals (Sweden)

Hugo O. Toledo Alvarado

2015-01-01

Full Text Available Se analizaron 1,289 registros de hembras de primer parto con diversas proporciones de genes Bos indicus y Bos taurus (Charolais, Suizo, Simmental, Holstein Friesian y Salers. Tanto animales puros y cruzados de un hato comercial, ubicado en el municipio de Hueytamalco, Puebla, nacidas entre 1966 a 2006, con el objetivo de estimar la combinación óptima de genes Cebú y la retención de heterosis (RVH sobre las características de peso al destete ajustado a 270 días (PD y edad a primer parto (EPP. A partir de modelos de regresión múltiple se identificó la proporción de Cebú con el mejor comportamiento para las dos características de acuerdo al coeficiente de determinación (R 2 y al estadístico de Mallow (CP. La mejor respuesta para PD se encontró en el rango de 42 a 70 % de genes Bos indicus ; mientras que las menores EPP se establecieron entre 27 al 40 % de proporción Cebú. La retención de heterosis que mostró mayor potencial para PD fue de 76 a 78 % y para EPP de 79 a 92 %. Estos resultados manifiestan la importancia de los efectos no aditivos en ambas características, así como la necesidad de realizar cruzamientos dirigidos.

Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

Science.gov (United States)

Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

2016-09-22

Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

International Nuclear Information System (INIS)

Ojeda, A.; Parra, O.

1999-01-01

Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W 0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3- 15 N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W 0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

Directory of Open Access Journals (Sweden)

Daniela Bebbere

Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

Características da carcaça e da carne de novilhos mantidos em pastagem de capim-marandu submetidos a diferentes estratégias de suplementação Carcass and meat traits from crossbred steers submitted to different supplementation strategies

Directory of Open Access Journals (Sweden)

Roberta Carrilho Canesin

2006-12-01

Full Text Available Este trabalho foi realizado com o objetivo de avaliar as características quantitativas e qualitativas da carcaça e da carne de 24 novilhos submetidos a três estratégias de suplementação em pastagem: SD - suplementação diária; DA - suplementação em dias alternados; e FS - suplementação oferecida de segunda à sexta-feira e suspensa aos sábados e domingos. Foram utilizados 24 bovinos mestiços (Bos indicus x Bos taurus com peso inicial de 230 kg mantidos em pastagem de Brachiaria brizantha cv. Marandu no período das águas de 2003 e nos períodos de seca e das águas de 2004, quando atingiram o peso de abate. O delineamento experimental utilizado foi o inteiramente casualizado, com três tratamentos e oito repetições. As características quantitativas e qualitativas da carcaça e da carne não foram influenciadas pelas diferentes estratégias de suplementação, mesmo quando o suplemento foi fornecido apenas em dias alternados ou quando não foi fornecido nos finais de semana. Na média, os animais apresentaram peso de abate de 468,21 kg de PV, rendimento de carcaça quente de 50,26%, área de olho-de-lombo de 59,67 cm² e espessura de gordura de 3,3 mm. A carne foi classificada como macia, com suculência e palatabilidade levemente acima da média.The objective of this trial was to evaluate quantitative and qualitative traits of carcass and meat from grazing steers submitted to one of the following three supplementation strategies: daily supplementation (DS, alternate days supplementation (AS or Monday to Friday supplementation (MFS. Twenty-four crossbred steers (Bos indicus x Bos taurus averaging 230 kg of initial body were used in a completely randomized block design (three treatments and eight replicates/treatment. Animals were maintained in pasture of Brachiaria brizantha cv. Marandu from the rainy season of 2003 to the dry and rainy seasons of 2004, when they reached the expected slaughter weight. The quantitative and

THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

Directory of Open Access Journals (Sweden)

I. M. Chernukha

2016-01-01

Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

ethnoveterinary uses of B. taurus by-products by traditional practitioners in Nigeria and South Africa. Conclusion: There ... Moreover, there are over 60 species of bacteria, about 100 species ..... bioremediation of pharmaceutical, pesticides and.

Do cattle (Bos taurus) retain an association of a visual cue with a food reward for a year?

Science.gov (United States)

Hirata, Masahiko; Takeno, Nozomi

2014-06-01

Use of visual cues to locate specific food resources from a distance is a critical ability of animals foraging in a spatially heterogeneous environment. However, relatively little is known about how long animals can retain the learned cue-reward association without reinforcement. We compared feeding behavior of experienced and naive Japanese Black cows (Bos taurus) in discovering food locations in a pasture. Experienced animals had been trained to respond to a visual cue (plastic washtub) for a preferred food (grain-based concentrate) 1 year prior to the experiment, while naive animals had no exposure to the cue. Cows were tested individually in a test arena including tubs filled with the concentrate on three successive days (Days 1-3). Experienced cows located the first tub more quickly and visited more tubs than naive cows on Day 1 (usually P visual cue with a food reward within a day and retain the association for 1 year despite a slight decay. © 2014 Japanese Society of Animal Science.

When and how did Bos indicus introgress into Mongolian cattle?

Science.gov (United States)

Yue, Xiangpeng; Li, Ran; Liu, Li; Zhang, Yunsheng; Huang, Jieping; Chang, Zhenhua; Dang, Ruihua; Lan, Xianyong; Chen, Hong; Lei, Chuzhao

2014-03-10

The Mongolian cattle are one of the most widespread breeds with strictly Bos taurus morphological features in northern China. In our current study, we presented a diversity of mitochondrial DNA (mtDNA) D-loop region and Y chromosome SNP markers in 25 male and 8 female samples of Mongolian cattle from the Xinjiang Uygur autonomous region in Western China, and detected 21 B. taurus and four Bos indicus (zebu) mtDNA haplotypes. Among four B. indicus mtDNA haplotypes, two haplotypes belonged to I1 haplogroup and the remaining two haplotypes belonged to I2 haplogroup. In contrast, all 25 male Mongolian cattle samples revealed B. taurus Y chromosome haplotype and no B. indicus haplotypes were found. Historical and archeological records indicate that B. taurus was introduced to Xinjiang during the second millennium BC and B. indicus appeared in this region by the second century AD. The two types of cattle coexisted for many centuries in Xinjiang, as depicted in clay and wooden figurines unearthed in the Astana cemetery in Turfan (3rd-8th century AD). Multiple lines of evidence suggest that the earliest B. indicus introgression in the Mongolian cattle may have occurred during the 2nd-7th centuries AD through the Silk Road around the Xinjiang region. This conclusion differs from the previous hypothesis that zebu introgression to Mongolian cattle happened during the Mongol Empire era in the 13th century. Copyright © 2014 Elsevier B.V. All rights reserved.

Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

Directory of Open Access Journals (Sweden)

Rodrigo Pinheiro Araldi

2015-01-01

Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

Science.gov (United States)

Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

2012-10-01

Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0.01) concentrations of cortisol and haptoglobin on d 40 and reduced (P = 0.02) exit velocity on d 200 compared with control heifers. Puberty was hastened in acclimated heifers compared with control (P = 0.01). Results from this study indicate that B. taurus beef cows with aggressive temperament have impaired reproductive performance compared with cohorts with adequate temperament, whereas acclimation to human handling after weaning hastens reproductive development of

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

taurus L urine, bile and dung in Nigeria and South Africa. Mariam O ... traditional health care systems are still in use by majority of the people ..... improving memory, enhancing the function of the liver, slowing ... standard guidelines and database be made available to ... WHO, Traditional and Modern Medicine: Harmonishing.

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

Nuclear and mitochondrial DNA markers in traceability of retail beef samples Marcadores de DNA nuclear e mitocondrial para rastreabilidade da carne bovina comercializada

Directory of Open Access Journals (Sweden)

Aline S.M. Cesar

2010-09-01

ém de dados da cadeia produtiva. Em geral, a empresa certificadora dispõe das informações do animal que está sendo abatido, porém não tem condições de garantir se houve erro entre abate, desossa, processamento e a distribuição dos produtos. Existe diferenciação no custo e na qualidade dos produtos cárneos, especialmente no mercado internacional, em virtude do sexo e composição racial dos animais. Os marcadores genéticos permitem identificar as características que são controladas num programa de rastreabilidade bovina tais como sexo e composição racial, permitindo identificar e avaliar corretamente para o consumidor, o produto final. A hipótese deste estudo foi que a maioria das amostras de carne bovina vendida no mercado local seria proveniente de fêmeas e com grande participação de raças Zebu. O objetivo deste trabalho foi caracterizar amostras de carne bovina com marcadores de DNA para identificar o sexo e a composição racial. Em dez pontos comerciais da cidade de Pirasssununga, SP, Brasil, foram coletadas 61 amostras e todas foram genotipadas como possuindo DNA mitocondrial Bos taurus e 18 foram positivos para amplificação do cromossomo Y (macho. Para o marcador sat1711b-Msp I a frequência alélica do A foi 0.278 e para o marcador Lhr-Hha I a frequência alélica do T foi 0.417. Os resultados das frequências alélicas do sat1711b-Msp I e Lhr-Hha I apresentaram menor proporção do genoma Bos indicus em relação ao Bos taurus quando comparado ao rebanho Nelore. Com a metodologia descrita neste trabalho foi possível avaliar o sexo e as características de subespécie das amostras de carne bovina, tendo uma importante aplicação para a certificação de produtos cárneos especialmente, em programas de rastreabilidade animal.

Obtenção de oócitos e produção in vitro de embriões em doadoras lactantes da raça Gir (Bos taurus indicus)

OpenAIRE

Ferreira, Marcos Brandão Dias [UNESP

2011-01-01

Raças zebuínas (Bos taurus indicus) e seus cruzamentos têm papel fundamental na pecuária brasileira, e a raça Gir, em especial, acrescenta rusticidade e produtividade nas suas descendentes leiteiras. A produção in vitro de embriões bovinos é uma biotécnica de alto valor econômico, que, aliada à utilização de sêmen sexado para cromossoma X, possibilita a multiplicação com fêmeas de valor genético superior. Foram realizados dois experimentos com o objetivo de avaliar a produção in vitro (PIV) d...

DIVERSIDAD GENÉTICA ENTRE SUBPOBLACIONES RACIALES BOVINAS DE COSTA RICA

Directory of Open Access Journals (Sweden)

Marco Martínez

2015-01-01

Full Text Available El objetivo del estudio fue cuantificar la diversidad genética entre 16 subpoblaciones raciales bovinas de Costa Rica, con base en 1412 muestras de ADN bovino de todo el país, evaluadas mediante 18 marcadores microsatélites. El número promedio de alelos (Na por locus dentro de raza fue de 10,3, que varían entre 8 (Holstein×Jersey y 13 (Criolla para doble propósito. El número promedio de alelos efectivo (Ne fue de 5,04, con cambios entre 4,18 (Jersey y 5,64 (Bos taurus×Bos indicus. La heterocigosidad observada promedio fue de 0,77, variando entre 0,73 (Jersey y 0,81 (Bos taurus×Bos indicus. La heterocigosidad esperada (He promedio fue de 0,78, que oscilan entre 0,74 (Jersey y Holstein×Jersey y 0,81 (Bos taurus×Bos indicus, Criolla para doble propósito y Cruces para doble propósito. El contenido de información polimórfica (PIC fue de 0,76, con variaciones entre 0,71 (Jersey y Holstein×Jersey y 0,79 (Criollas para doble propósito y Cruces para doble propósito. El FIS promedio fue de 0,02, con oscilaciones entre -0,03 (Holstein×Jersey a 0,04 (Brahman, Criolla para carne y Cruces para leche. La desviación del equilibrio Hardy Weinberg no fue significativa (p>0,05 en la mayoría de los loci para las subpoblaciones raciales. El subgrupo con mayor número de loci en desequilibrio fue Jersey (8 loci, mientras que los subgrupos Bos taurus×Bos indicus, Criolla para leche y Holstein×Jersey presentaron solo 1 locus en desequilibrio. Los índices de fijación FIS (0,02, FIT (0,05 y FST (0,03 indicaron cierta tendencia hacia la homocigosidad. Los dendrogramas mostraron 3 agrupaciones raciales claramente diferenciadas que coinciden con las razas de origen Bos taurus, Bos indicus y sus respectivos cruces. Los resultados del análisis indicaron que el número de microsatélites empleados sí permitió establecer una discriminación clara a nivel de las frecuencias alélicas y en la distribución del tamaño de los alelos entre las

Genetic polymorphisms related to meat traits in purebred and crossbred Nelore cattle Polimorfismos genéticos relacionados às características da carne em bovinos Nelore puros e cruzados

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2009-12-01

Full Text Available The objective of this work was to estimate the allelic and genotypic frequencies of CAST/XmnI, a calpastatin gene polymorphism, and CAPN530, a calpain 1 large subunit gene polymorphism, in different beef genetic groups (Nelore and Nelore x Bos taurus, and to investigate associations between these polymorphisms and carcass and meat traits. Three hundred animals - comprising 114 Nelore, 67 Angus x Nelore, 44 Rubia Gallega x Nelore, 41 Canchim, 19 Brangus three-way cross and 15 Braunvieh three-way cross- were genotyped by PCR-RFLP and phenotyped for rib-eye area (REA, back-fat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The occurrence of the two alleles of the CAST/XmnI and CAPN530 single nucleotide polymorphisms (SNPs in a B. indicus breed, which permitted association studies in purebred and crossbred Nelore cattle, was first shown in the present work. No relationship was found between the CAST or CAPN1 SNPs and growth-related traits (REA or fat deposition (BT and IF, since calpastatin and µ-calpain are not physiologically involved with these traits. Moreover, the association results between genotypes and aged meat tenderness (assessed by SF and MFI showed that these markers are useless in assisted selection for purebred Nelore and their crosses with B. taurus.O presente trabalho objetivou estimar, em bovinos de corte de diferentes grupos genéticos (Nelore e Nelore x Bos taurus, as frequências alélicas e genotípicas dos polimorfismos CAST/XmnI, do gene da calpastatina, e CAPN530, do gene da calpaína, bem como avaliar a ocorrência de associações entre esses polimorfismos e características da carcaça e da carne produzida. Trezentos animais - 114 Nelore, 67 Angus x Nelore, 44 Rubia Galega x Nelore, 41 Canchim, 19 tricross Brangus e 15 tricross Braunvieh - foram genotipados por PCR-RFLP e fenotipados para área de olho de lombo (AOL, cobertura de gordura subcutânea (CGS, gordura

Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2012-02-01

Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

Directory of Open Access Journals (Sweden)

Radmanović Darko P

2016-01-01

Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

Science.gov (United States)

Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

2011-03-22

The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

Science.gov (United States)

Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

2018-04-03

Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

Directory of Open Access Journals (Sweden)

Jessica E. Monk

2018-04-01

Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Fixed-time artificial insemination with estradiol and progesterone for Bos indicus cows II: strategies and factors affecting fertility.

Science.gov (United States)

Sá Filho, O G; Meneghetti, M; Peres, R F G; Lamb, G C; Vasconcelos, J L M

2009-07-15

In Experiments 1, 2, and 3, we evaluated the effects of temporary weaning (TW), equine chorionic gonadotropin (eCG), and follicle-stimulating hormone (FSH) treatments on results of a fixed-time artificial insemination (TAI) protocol in postpartum Bos indicus cows. In Experiment 1, treatment with 400 IU eCG or with TW for 48 h consistently improved pregnancy rates (PRs) at TAI, but, in Experiment 2, FSH treatment was less effective than eCG or TW. In Experiment 3, the inclusion of eCG treatment in cows subjected to TW did not improve PRs. We concluded that TW or 400 IU eCG should be included in the TAI protocol in postpartum Bos indicus cows to enhance fertility. In Experiment 4, we used records from heifers and cows treated with the proposed protocol during the 2006-2007 (n=27,195) and 2007-2008 (n=36,838) breeding seasons from multiple locations in Brazil to evaluate factors potentially affecting PRs. Overall PR at TAI was 49.6% (31,786 of 64,033). Pregnancy rate differed (Pcow group within farm, by breed (Bos indicus, 48.3% [26,123 of 54,145]; Bos taurus, 61.7% [3652 of 5922]; and crossbred Bos indicus x Bos taurus, 50.7% [2011 of 3966]), category (nulliparous, 39.6% [2095 of 5290]; suckled primiparous, 45.2% [3924 of 8677]; suckled multiparous, 51.8% [24,245 of 46,767]; and nonsuckled multiparous, 46.1% [1522 of 3299]), body condition score at TAI ( or =3.5, 52.7% [9419 of 17,881]). Days postpartum at beginning of protocol did not affect PR (30 to 60 d, 47.6% [4228 of 8881]; 61 to 90 d, 51.7% [16,325 to 31,572]; and 91 to 150 d, 50.8% [7616 to 14,991]; P>0.1). Pregnancy rate was also consistently affected (P<0.01) by sire (results ranging from 7.2% to 77.3%) and artificial insemination technician (results ranging from 15.1% to 81.8%).

Evidence of solitary chemosensory cells in a large mammal: the diffuse chemosensory system in Bos taurus airways

Science.gov (United States)

Tizzano, Marco; Merigo, Flavia; Sbarbati, Andrea

2006-01-01

The diffuse chemosensory system (DCS) of the respiratory apparatus is composed of solitary chemosensory cells (SCCs) that resemble taste cells but are not organized in end organs. The discovery of the DCS may open up new approaches to respiratory diseases. However, available data on mammalian SCCs have so far been collected from rodents, the airways of which display some differences from those of large mammals. Here we investigated the presence of the DCS and of SCCs in cows and bulls (Bos taurus), in which the airway cytology is similar to that in humans, focusing our attention on detection in the airways of molecules involved in the transduction cascade of taste [i.e. α-gustducin and phospholipase C of the β2 subtype (PLCβ2)]. The aim of the research was to extend our understanding of airway chemoreceptors and to compare the organization of the DCS in a large mammal with that in rodents. Using immunocytochemistry for α-gustducin, the taste buds of the tongue and arytenoid were visualized. In the trachea and bronchi, α-gustducin-immunoreactive SCCs were frequently found. Using immunocytochemistry for PLCβ2, the staining pattern was generally similar to those seen for α-gustducin. Immunoblotting confirmed the expression of α-gustducin in the tongue and in all the airway regions tested. The study demonstrated the presence of SCCs in cows and bulls, suggesting that DCSs are present in many mammalian species. The description of areas with a high density of SCCs in bovine bronchi seems to indicate that the view of the DCS as made up of isolated cells totally devoid of ancillary elements is probably an oversimplification. PMID:16928202

Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

Science.gov (United States)

Li, Fengmei; Liu, Wuyi

2017-06-01

The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

Directory of Open Access Journals (Sweden)

Aparecida Carla de Moura

1999-01-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

Uso de extratos vegetais, vitaminas e sua associação sobre o desempenho, temperamento e qualidade de carne de bovinos nelore confinados com dieta de alto grão

OpenAIRE

Silva, Maurícia Brandão da [UNESP

2015-01-01

Fifty-six Nellore (Bos taurus indicus) young bulls of 360 (±19,8) kg initial weight and 20 month of age were used to evaluate the effect of plant extract, vitamins A, D3 supplementation and their associations on the temperament, feedlot performance (finishing phase) and meat quality of Bos indicus cattle. Animals were located in individual pens during 105 days (21 and 84 days, for adaptation and trial period, respectively). Animals were individually weighed, and blocked by initial body weight...

Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

Science.gov (United States)

Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

Cattle phenotypes can disguise their maternal ancestry.

Science.gov (United States)

Srirattana, Kanokwan; McCosker, Kieren; Schatz, Tim; St John, Justin C

2017-06-26

Cattle are bred for, amongst other factors, specific traits, including parasite resistance and adaptation to climate. However, the influence and inheritance of mitochondrial DNA (mtDNA) are not usually considered in breeding programmes. In this study, we analysed the mtDNA profiles of cattle from Victoria (VIC), southern Australia, which is a temperate climate, and the Northern Territory (NT), the northern part of Australia, which has a tropical climate, to determine if the mtDNA profiles of these cattle are indicative of breed and phenotype, and whether these profiles are appropriate for their environments. A phylogenetic tree of the full mtDNA sequences of different breeds of cattle, which were obtained from the NCBI database, showed that the mtDNA profiles of cattle do not always reflect their phenotype as some cattle with Bos taurus phenotypes had Bos indicus mtDNA, whilst some cattle with Bos indicus phenotypes had Bos taurus mtDNA. Using D-loop sequencing, we were able to contrast the phenotypes and mtDNA profiles from different species of cattle from the 2 distinct cattle breeding regions of Australia. We found that 67 of the 121 cattle with Bos indicus phenotypes from NT (55.4%) had Bos taurus mtDNA. In VIC, 92 of the 225 cattle with Bos taurus phenotypes (40.9%) possessed Bos indicus mtDNA. When focusing on oocytes from cattle with the Bos taurus phenotype in VIC, their respective oocytes with Bos indicus mtDNA had significantly lower levels of mtDNA copy number compared with oocytes possessing Bos taurus mtDNA (P cattle with a Bos taurus phenotype. The phenotype of cattle is not always related to their mtDNA profiles. MtDNA profiles should be considered for breeding programmes as they also influence phenotypic traits and reproductive capacity in terms of oocyte quality.

Mitochondrial DNA single nucleotide polymorphism associated with weight estimated breeding values in Nelore cattle (Bos indicus

Directory of Open Access Journals (Sweden)

Fernando Henrique Biase

2007-01-01

Full Text Available We sampled 119 Nelore cattle (Bos indicus, 69 harboring B. indicus mtDNA plus 50 carrying Bos taurus mtDNA, to estimate the frequencies of putative mtDNA single nucleotide polymorphisms (SNPs and investigate their association with Nelore weight and scrotal circumference estimated breeding values (EBVs. The PCR restriction fragment length polymorphism (PCR-RFLP method was used to detect polymorphisms in the mitochondrial asparagine, cysteine, glycine, leucine and proline transporter RNA (tRNA genes (tRNAasn, tRNAcys, tRNAgly, tRNAleu and tRNApro. The 50 cattle carrying B. taurus mtDNA were monomorphic for all the tRNA gene SNPs analyzed, suggesting that they are specific to mtDNA from B. indicus cattle. No tRNAcys or tRNAgly polymorphisms were detected in any of the cattle but we did detect polymorphic SNPs in the tRNAasn, tRNAleu and tRNApro genes in the cattle harboring B. indicus mtDNA, with the same allele observed in the B. taurus sequence being present in the following percentage of cattle harboring B. indicus mtDNA: 72.46% for tRNAasn, 95.23% for tRNAleu and 90.62% for tRNApro. Analyses of variance using the tRNAasn SNP as the independent variable and EBVs as the dependent variable showed that the G -> T SNP was significantly associated (p < 0.05 with maternal EBVs for weight at 120 and 210 days (p < 0.05 and animal's EBVs for weight at 210, 365 and 455 days. There was no association of the tRNAasn SNP with the scrotal circumference EBVs. These results confirm that mtDNA can affect weight and that mtDNA polymorphisms can be a source of genetic variation for quantitative traits.

in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

Science.gov (United States)

Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

2013-01-01

Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

Directory of Open Access Journals (Sweden)

Norberto Villa-Duque

2016-01-01

Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

Directory of Open Access Journals (Sweden)

Jane M. RUBENSAM

1998-10-01

Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

Marcadores moleculares asociados a la Capacidad de Retención de Agua (CRA) en carne de Bos indicus y sus cruces

OpenAIRE

Leal Gutiérrez, Joel David

2013-01-01

La Capacidad de Retención de Agua (CRA) es una de las características de la carne con mayor efecto sobre la rentabilidad del sector, al estar asociada a las mermas y a la jugosidad. Los objetivos principales son: resaltar la importancia de la CRA de la carne de bovino, evaluar el desempeño de estos parámetros según los factores tiempo de maduración y cruce de los animales y establecer polimorfismos en genes candidatos asociados al parámetro evaluado. Varios genes y sus polimorfismos han sido ...

Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

Science.gov (United States)

Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

2016-08-01

The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. Copyright © 2016 Elsevier Inc. All rights reserved.

MACIEZ DA CARNE BOVINA

Directory of Open Access Journals (Sweden)

Antonio Bento Mancio

2006-10-01

Full Text Available Dentre as características de qualidade da carne bovina, a maciez assume posição de destaque, sendo considerada a característica organoléptica de maior influência na aceitação da carne por parte dos consumidores. A dureza da carne pode ser dividida em dureza residual, causada pelo tecido conjuntivo e outras proteínas do estroma, e dureza de actomiosina, causada pelas proteínas miofibrilares. Dentre os fatores que influenciam a maciez da carne, podem ser destacados a genética, a raça, a idade ao abate, o sexo, a alimentação, o uso de agentes hormonais (?-adrenérgicos e os tratamentos post-mortem. A qualidade final da carne é resultante de tudo o que aconteceu com o animal durante toda a cadeia produtiva. Devem-se assegurar procedimentos adequados de transporte, armazenamento, manipulação, exposição e preparo da carne, a fim de se obter um produto de melhor qualidade. PALAVRAS-CHAVE: Calpaínas, calpastatina, qualidade da carne, rigor mortis, tecido muscular.

Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

Science.gov (United States)

Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

2013-10-01

The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

Science.gov (United States)

Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

2017-01-01

The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

A microsatellite-based analysis for the detection of selection on BTA1 and BTA20 in northern Eurasian cattle (Bos taurus populations

Directory of Open Access Journals (Sweden)

Li Meng-Hua

2010-08-01

Full Text Available Abstract Background Microsatellites surrounding functionally important candidate genes or quantitative trait loci have received attention as proxy measures of polymorphism level at the candidate loci themselves. In cattle, selection for economically important traits is a long-term strategy and it has been reported that microsatellites are linked to these important loci. Methods We have investigated the variation of seven microsatellites on BTA1 (Bos taurus autosome 1 and 16 on BTA20, using bovine populations of typical production types and horn status in northern Eurasia. Genetic variability of these loci and linkage disequilibrium among these loci were compared with those of 28 microsatellites on other bovine chromosomes. Four different tests were applied to detect molecular signatures of selection. Results No marked difference in locus variability was found between microsatellites on BTA1, BTA20 and the other chromosomes in terms of different diversity indices. Average D' values of pairwise syntenic markers (0.32 and 0.28 across BTA 1 and BTA20 respectively were significantly (P FST-test indicated elevated or decreased genetic differentiation, at SOD1 and AGLA17 markers respectively, deviating significantly (P SOD1 and AGLA17. Our data also indicate significant intergenic linkage disequilibrium around the candidate loci and suggest that hitchhiking selection has played a role in shaping the pattern of observed linkage disequilibrium. Conclusion Hitchhiking due to tight linkage with alleles at candidate genes, e.g. the POLL gene, is a possible explanation for this pattern. The potential impact of selective breeding by man on cattle populations is discussed in the context of selection effects. Our results also suggest that a practical approach to detect loci under selection is to simultaneously apply multiple neutrality tests based on different assumptions and estimations.

Efecto de la suplementación con grasa protegida sobre la producción y calidad de carne de toretes mexicanos doble propósito

Directory of Open Access Journals (Sweden)

German Mendoza M

2011-04-01

Full Text Available Objetivo. Evaluar la respuesta productiva y calidad de la carne de toretes doble propósito a la adición de grasa protegida (GP en su dieta. Materiales y métodos. Se utilizaron 45 toretes comerciales (B. taurus x B. indicus, divididos en tres bloques de 15 animales, de acuerdo con su peso vivo en pequeños, medianos y grandes. Cada bloque fue dividido en tres subgrupos de 5 animales, asignados aleatoriamente a los tratamientos 0, 1.5 y 3% de GP, en un diseño de bloques completamente al azar. Resultados. No hubo diferencias (p>0.05 en comportamiento productivo. La grasa dorsal fue mayor (p0.05 en área del ojo de la costilla (AC ni pH de la carne. El contenido de proteína cruda de la carne incrementó (p0.05 entre tratamientos. Conclusiones. Adicionar GP a dietas para bovinos doble propósito en finalización no modificó la respuesta productiva, pero mejoró algunas características de la canal y de la carne. Se sugiere realizar más investigación, utilizando el mismo tipo de animales, con niveles mayores de GP a los usados en este estudio, ya que la respuesta pudiera mejorar.

NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-175 86% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-161 89% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-169 83% ...

NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0005 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-120 65% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0428 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-149 76% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1596 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1596 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 89% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0287 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1487 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-179 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 92% ...

Perfil de ácidos grasos en carne de toretes Europeo x Cebú finalizados en pastoreo y en corral

Directory of Open Access Journals (Sweden)

Maribel Montero-Lagunes

2011-01-01

Full Text Available El objetivo fue determinar el perfil de ácidos grasos en grasa intramuscular de toretes encastados de Europeo (Bos taurus con Cebú (Bos indicus, finalizados en pastoreo y en corral. Cincuenta y dos toretes se analizaron con un ANDEVA en un arreglo factorial 2 x 2. La mitad de los animales fueron finalizados en pastoreo , siendo el pasto estrella de África [Cynodon plectostachyus (K. Schum Pilg.] la base de la alimentación, y la otra mitad en corral alimentados con 65 % de maíz, 10 % de pasta de soya, 20 % de heno, 4 % de sebo, 1 % de urea y minerales. La mitad de cada grupo consistió de toretes con más de ¾ B. taurus, y la otra mitad mayormente ¾ B. indicus . Los toretes se sacrificaron con 500 kg de peso. Se tomaron muestras del músculo Longissimus dorsi de la región de la 12a costilla. Los lípidos se analizaron por cromatografía de gases. El ácido graso más abundante (mg/g de grasa fue el C18,1 (381±16.4 seguido por el C16,0 (250±5.3 y el C18,0 (201±8.6, El contenido de C18:2, 9-cis, 11-trans fue de 6.1±0.67. C14,0 y C16,0 fueron mayores en corral, y C18,0 fue más alto en pastoreo (P<0.01. C14,0, C16,0, C18,2, C18,3 y CLA total fueron mayores (P<0.05 en B. indicus y C18,0 fue más alto (P<0.05 en B. taurus. Se concluye que el perfil de ácidos grasos en toretes cruzados de Europeo por Cebú es diferente si es finalizado en pastoreo o en corral y por el nivel de encaste.

Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

Directory of Open Access Journals (Sweden)

Daniel Perotto

2009-09-01

em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

Detection and quantification of Duffy antigen on bovine red blood cell membranes using a polyclonal antibody

Directory of Open Access Journals (Sweden)

Ana Teresa B.F. Antonangelo

2012-09-01

Full Text Available Babesiosis is one of the most important diseases affecting livestock agriculture worldwide. Animals from the subspecies Bos taurus indicus are more resistant to babesiosis than those from Bos taurus taurus. The genera Babesia and Plasmodium are Apicomplexa hemoparasites and share features such as invasion of red blood cells (RBC. The glycoprotein Duffy is the only human erythrocyte receptor for Pasmodium vivax and a mutation which abolishes expression of this glycoprotein on erythrocyte surfaces is responsible for making the majority of people originating from the indigenous populations of West Africa resistant to P. vivax. The current work detected and quantified the Duffy antigen on Bos taurus indicus and Bos taurus taurus erythrocyte surfaces using a polyclonal antibody in order to investigate if differences in susceptibility to Babesia are due to different levels of Duffy antigen expression on the RBCs of these animals, as is known to be the case in human beings for interactions of Plasmodium vivax-Duffy antigen. ELISA tests showed that the antibody that was raised against Duffy antigens detected the presence of Duffy antigen in both subspecies and that the amount of this antigen on those erythrocyte membranes was similar. These results indicate that the greater resistance of B. taurus indicus to babesiosis cannot be explained by the absence or lower expression of Duffy antigen on RBC surfaces.

Biochemical polymorphism in Egyptian Baladi cattle and their relationship with other breeds.

Science.gov (United States)

Graml, R; Ohmayer, G; Pirchner, F; Erhard, L; Buchberger, J; Mostageer, A

1986-01-01

Gene frequencies were estimated in a sample of Baladi cattle for milk proteins, blood proteins and blood groups. Gene frequency estimates of Bos taurus, Bos indicus and Sanga breeds were assembled from the literature. The gene frequencies were utilized for estimating the genetic distance between the breeds and breed groups. The Egyptian Baladi cattle appeared to be closer to Bos taurus breeds than to the Sanga. They are far removed from Zebus.

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

Directory of Open Access Journals (Sweden)

Ali Abdirahman A

2012-07-01

Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

Science.gov (United States)

Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

2012-07-27

Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

Directory of Open Access Journals (Sweden)

Reinsch Norbert

2009-09-01

Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

THE TAURUS SPITZER SURVEY: NEW CANDIDATE TAURUS MEMBERS SELECTED USING SENSITIVE MID-INFRARED PHOTOMETRY

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; McCabe, C.-E.; Noriega-Crespo, A.; Carey, S. J.; Brooke, T.; Hillenbrand, L. A.; Stapelfeldt, K. R.; Angione, J. R.; Huard, T.; Terebey, S.; Audard, M.; Baldovin-Saavedra, C.; Monin, J.-L.; Menard, F.; Bouvier, J.; Fukagawa, M.; Guedel, M.; Knapp, G. R.; Allen, L. E.

2010-01-01

We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in seven mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously identified members of the Taurus star-forming region in our ∼44 deg 2 map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ∼20% of the bona fide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 new candidate members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, three probable new members, and 10 possible new members, an increase of 15%-20% in Taurus members. Of the objects for which we have spectroscopy, seven are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candidate objects await additional analysis and/or data to be confirmed or rejected as Taurus members. Most of the new members are Class II M stars and are located along the same cloud filaments as the previously identified Taurus members. Among non-members with Spitzer colors similar to young, dusty stars are evolved Be stars, planetary nebulae, carbon stars, galaxies, and active galactic nuclei.

Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

Science.gov (United States)

Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

2010-03-01

Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

Demographic consequences of increased winter births in a large aseasonally breeding mammal (Bos taurus) in response to climate change.

Science.gov (United States)

Burthe, Sarah; Butler, Adam; Searle, Kate R; Hall, Stephen J G; Thackeray, Stephen J; Wanless, Sarah

2011-11-01

1. Studies examining changes in the scheduling of breeding in response to climate change have focused on species with well-defined breeding seasons. Species exhibiting year-round breeding have received little attention and the magnitudes of any responses are unknown. 2. We investigated phenological data for an enclosed feral population of cattle (Bos taurus L.) in northern England exhibiting year-round breeding. This population is relatively free of human interference. 3. We assessed whether the timing of births had changed over the last 60 years, in response to increasing winter and spring temperatures, changes in herd density, and a regime of lime fertilisation. 4. Median birth date became earlier by 1·0 days per year. Analyses of the seasonal distribution of calving dates showed that significantly fewer calves were born in summer (decline from 44% of total births to 20%) and significantly more in winter (increase from 12% to 30%) over the study period. The most pronounced changes occurred in winter, with significant increases in both the proportion and number of births. Winter births arise from conceptions in the previous spring, and we considered models that investigated climate and weather variables associated with the winter preceding and the spring of conceptions. 5. The proportion of winter births was higher when the onset of the plant growing season was earlier during the spring of conceptions. This relationship was much weaker during years when the site had been fertilised with lime, suggesting that increased forage biomass was over-riding the impacts of changing plant phenology. When the onset of the growing season was late, winter births increased with female density. 6. Recruitment estimates from a stage-structured state-space population model were significantly negatively correlated with the proportion of births in the preceding winter, suggesting that calves born in winter are less likely to survive than those born in other seasons. 7.�

Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

Directory of Open Access Journals (Sweden)

Rodrigo Costa Mattos

2002-05-01

Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

Independent mitochondrial origin and historical genetic differentiation in North Eastern Asian cattle.

Science.gov (United States)

Mannen, H; Kohno, M; Nagata, Y; Tsuji, S; Bradley, D G; Yeo, J S; Nyamsamba, D; Zagdsuren, Y; Yokohama, M; Nomura, K; Amano, T

2004-08-01

In order to clarify the origin and genetic diversity of cattle in North Eastern Asia, this study examined mitochondrial displacement loop sequence variation and frequencies of Bos taurus and Bos indicus Y chromosome haplotypes in Japanese, Mongolian, and Korean native cattle. In mitochondrial analyses, 20% of Mongolian cattle carried B. indicus mitochondrial haplotypes, but Japanese and Korean cattle carried only B. taurus haplotypes. In contrast, all samples revealed B. taurus Y chromosome haplotypes. This may be due to the import of zebu and other cattle during the Mongol Empire era with subsequent crossing with native taurine cattle. B. taurus mtDNA sequences fall into several geographically distributed haplogroups and one of these, termed here T4, is described in each of the test samples, but has not been observed in Near Eastern, European or African cattle. This may have been locally domesticated from an East Eurasian strain of Bos primigenius.

NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 1e-135 48% ...

Antibiogram profile of pathogens isolated from processed cow meat

African Journals Online (AJOL)

2016-06-30

Jun 30, 2016 ... Cow meat or beef is the culinary name for meat from bovines especially cattle. The generic name of cow meat is Bos taurus and the habitable weather of Bos taurus includes temperature of 101.50F (38.60C) and ability to live in a harsh terrains (Li et al., 2006). The processing of cow meat begins from ...

Genome sequencing of the extinct Eurasian wild aurochs, Bos primigenius, illuminates the phylogeography and evolution of cattle.

Science.gov (United States)

Park, Stephen D E; Magee, David A; McGettigan, Paul A; Teasdale, Matthew D; Edwards, Ceiridwen J; Lohan, Amanda J; Murphy, Alison; Braud, Martin; Donoghue, Mark T; Liu, Yuan; Chamberlain, Andrew T; Rue-Albrecht, Kévin; Schroeder, Steven; Spillane, Charles; Tai, Shuaishuai; Bradley, Daniel G; Sonstegard, Tad S; Loftus, Brendan J; MacHugh, David E

2015-10-26

Domestication of the now-extinct wild aurochs, Bos primigenius, gave rise to the two major domestic extant cattle taxa, B. taurus and B. indicus. While previous genetic studies have shed some light on the evolutionary relationships between European aurochs and modern cattle, important questions remain unanswered, including the phylogenetic status of aurochs, whether gene flow from aurochs into early domestic populations occurred, and which genomic regions were subject to selection processes during and after domestication. Here, we address these questions using whole-genome sequencing data generated from an approximately 6,750-year-old British aurochs bone and genome sequence data from 81 additional cattle plus genome-wide single nucleotide polymorphism data from a diverse panel of 1,225 modern animals. Phylogenomic analyses place the aurochs as a distinct outgroup to the domestic B. taurus lineage, supporting the predominant Near Eastern origin of European cattle. Conversely, traditional British and Irish breeds share more genetic variants with this aurochs specimen than other European populations, supporting localized gene flow from aurochs into the ancestors of modern British and Irish cattle, perhaps through purposeful restocking by early herders in Britain. Finally, the functions of genes showing evidence for positive selection in B. taurus are enriched for neurobiology, growth, metabolism and immunobiology, suggesting that these biological processes have been important in the domestication of cattle. This work provides important new information regarding the origins and functional evolution of modern cattle, revealing that the interface between early European domestic populations and wild aurochs was significantly more complex than previously thought.

Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

OpenAIRE

Santana, Clarissa Helena [UNESP

2016-01-01

A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

NARCIS (Netherlands)

Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

2014-01-01

Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford

OpenAIRE

Mendonça,Gilson de; Pimentel,Marcelo Alves; Cardellino,Ricardo Alberto; Osório,José Carlos da Silveira

2003-01-01

O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca), peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus), com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus) e 32 com Nelore (Bos indicus). Os fatores estudados fora...

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprint...ed in Prader-Willi/Angelman syndrome region protein 2 homolog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 1e-140 88% ...

Processamento da carne-de-sol com carne maturada: qualidade sensorial e textura

OpenAIRE

Salvino, Alanne Tamize de Medeiros

2011-01-01

A carne-de-sol é um alimento de ampla aceitação no Nordeste brasileiro, com processamento, na grande maioria, realizado artesanalmente por pequenos produtores que devido à ausência de legislação específica, apresentam variações no seu processo de obtenção, influenciando na sua qualidade final. Objetivou-se neste trabalho caracterizar o processamento da carne-de-sol comercializada no município de João Pessoa/PB, por meio de entrevista estruturada junto aos comerciantes e produtores, e avaliar ...

Description of Mycobacterium chelonae subsp. bovis subsp. nov., isolated from cattle (Bos taurus coreanae), emended description of Mycobacterium chelonae and creation of Mycobacterium chelonae subsp. chelonae subsp. nov.

Science.gov (United States)

Kim, Byoung-Jun; Kim, Ga-Na; Kim, Bo-Ram; Jeon, Che Ok; Jeong, Joseph; Lee, Seon Ho; Lim, Ji-Hun; Lee, Seung-Heon; Kim, Chang Ki; Kook, Yoon-Hoh; Kim, Bum-Joon

2017-10-01

Three rapidly growing mycobacterial strains, QIA-37 T , QIA-40 and QIA-41, were isolated from the lymph nodes of three separate Korean native cattle, Hanwoo (Bos taurus coreanae). These strains were previously shown to be phylogenetically distinct but closely related to Mycobacterium chelonae ATCC 35752 T by taxonomic approaches targeting three genes (16S rRNA, hsp6 and rpoB) and were further characterized using a polyphasic approach in this study. The 16S rRNA gene sequences of all three strains showed 99.7 % sequence similarity with that of the M. chelonae type strain. A multilocus sequence typing analysis targeting 10 housekeeping genes, including hsp65 and rpoB, revealed a phylogenetic cluster of these strains with M. chelonae. DNA-DNA hybridization values of 78.2 % between QIA-37 T and M. chelonae indicated that it belongs to M. chelonae but is a novel subspecies distinct from M. chelonae. Phylogenetic analysis based on whole-genome sequences revealed a 95.44±0.06 % average nucleotide identity (ANI) value with M. chelonae, slightly higher than the 95.0 % ANI criterion for determining a novel species. In addition, distinct phenotypic characteristics such as positive growth at 37 °C, at which temperature M. chelonae does not grow, further support the taxonomic status of these strains as representatives of a novel subspecies of M. chelonae. Therefore, we propose an emended description of Mycobacterium chelonae, and descriptions of M. chelonae subsp. chelonae subsp. nov. and M. chelonae subsp. bovis subsp. nov. are presented; strains ATCC 35752 T (=CCUG 47445 T =CIP 104535 T =DSM 43804 T =JCM 6388 T =NCTC 946 T ) and QIA-37 T (=KCTC 39630 T =JCM 30986 T ) are the type strains of the two novel subspecies.

Agroindustrialización de la carne de cuy

OpenAIRE

Quevedo Pantoja, Mauricio; Universidad de San Buenaventura

2014-01-01

Agro-industrialización de la carne de cuy recopila información alrededor del proceso de producción de carne de cuy en diferentes regiones de Colombia. De acuerdo con los autores la carne de cuy presenta deficiencias en los procesos de transformación y comercialización, y proponen algunas alternativas que pueden constituirse en un vector de eficacia para el sector.

Patrones de consumo de carne en el noroeste de México

Directory of Open Access Journals (Sweden)

Cristina Taddei

2012-01-01

Full Text Available En gran medida, el conocimiento de la forma en la que se comporta el consumidor determina el desempeño en el mercado de un producto determinado. Se utiliza un algoritmo de agrupamiento de datos, en el marco del reconocimiento de patrones, para identificar tipos de consumidores de carne en el noroeste de México, con el objetivo de conocer las preferencias de consumo y con ello orientar decisiones de mercado por parte de los productores o bien de funcionarios responsables de políticas de fomento en sectores involucrados. El análisis de datos permitió encontrar tres tipos de consumidores de carne: 1 aquellos que tienen preferencia alta por el consumo de carne de res y carnes blancas como pollo y pescado, 2 los que muestran preferencia alta por carne de res, seguida por carne de pollo y de puerco y 3 quienes prefieren el consumo de carnes blancas como pollo y pescado y tienen muy escasa preferencia por el consumo de carne de res. Es a partir de estos grupos que se describen algunas características del mercado de carnes en la región de estudio.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study

Directory of Open Access Journals (Sweden)

JOSEFA M. NASCIMENTO-ROCHA

2017-08-01

Full Text Available ABSTRACT Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli], and farm level i.e., milking room hygiene (-Milking room, dunghill location, and replacement female. Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31; +Mycoplasma spp (OR, 5.67; yearly milk production (4500 kg or more (OR, 1.99; +Bos taurus (OR, 1.68; +E. coli (OR, 4.96; -milking room (OR, 2.31; and replacement females (OR, 1.89. Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study.

Science.gov (United States)

Nascimento-Rocha, Josefa M; Oliveira, Benedito D DE; Arnhold, Emannuel; Pôrto, Regiani N G; Lima, Svetlana F; Gambarini, Maria Lucia

2017-01-01

Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli]), and farm level i.e., milking room hygiene (-Milking room), dunghill location, and replacement female). Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31); +Mycoplasma spp (OR, 5.67); yearly milk production (4500 kg or more) (OR, 1.99); +Bos taurus (OR, 1.68); +E. coli (OR, 4.96); -milking room (OR, 2.31); and replacement females (OR, 1.89). Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Presencia de sulfitos en carne picada y preparados de carne elaborados en industrias de la Comunidad Valenciana

Directory of Open Access Journals (Sweden)

Zubeldia Lauzurica Lourdes

1997-01-01

Full Text Available FUNDAMENTO: Desde este estudio y frente al desarrollo de disposiciones para la armonización de la legislación alimentaria sobre aditivos, se pretende conocer la utilización de sulfitos en carnes picadas y preparados de carne elaborados en establecimientos ubicados en la Comunidad Valenciana. MÉTODOS: Previa planificación de los tipos de productos y del número de muestras a investigar, se evalúan cualitativa y cuantitativamente los resultados obtenidos respecto a la presencia de sulfitos, expresados en mg/kg de SO2. RESULTADOS: Destaca la presencia de sulfitos en el 65,38% de muestras de hamburguesas de ternera/cerdo y en el 64,18% de hamburguesas de pollo. En carnes picadas, chorizo fresco y salchicha cruda se pone de manifiesto una mejor adaptación a la normativa. CONCLUSIONES: Se observa el amplio uso de sulfitos en los preparados de carne. La inminente aplicación de la normativa comunitaria va a suponer una modificación en las prácticas de elaboración de estos productos.

O ultrassom no amaciamento de carnes

Directory of Open Access Journals (Sweden)

Larissa de Lima Alves

2013-08-01

Full Text Available O ultrassom é uma das novas tecnologias limpas aplicadas a alimentos. Na ciência e tecnologia de carnes, é estudado principalmente quanto à sua capacidade de melhorar a maciez da carne, por mecanismos de cavitação. Alguns parâmetros acústicos como frequência, intensidade e tempo de exposição ao tratamento influenciam na tenderização da carne. Os primeiros estudos determinaram que o uso de altas frequências não apresentaram efeitos na textura, em função de não provocarem cavitação. A intensidade de ultrassom que atinge a matriz cárnea também é importante, sendo que, quando aplicada abaixo de 10W cm-2 ou muito acima desse valor, não se percebe o efeito. O tempo de exposição é dependente da frequência e intensidade utilizadas e influencia diretamente na maciez. Características de qualidade da carne, como perda de peso após cozimento, queda de pH, cor e microbiologia também foram analisados por diversos autores, com dados contraditórios quanto ao efeito do ultrassom sobre esses parâmetros. As particularidades de cada músculo dificultam as comparações de resultados, abrindo espaço para novas pesquisas. O uso de ultrassom na tecnologia de carnes, visando a melhorar a maciez, mostra-se como uma tecnologia promissora, um potencial a ser explorado.

9 CFR 319.301 - Chili con carne with beans.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Chili con carne with beans. 319.301 Section 319.301 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Dehydrated Meat Food Products § 319.301 Chili con carne with beans. Chili con carne with beans shall contain...

Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

Directory of Open Access Journals (Sweden)

Gustavo Gasparin

2005-12-01

Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Results of BLAST with GenBank show that three genes or expressed sequence tag (ESTs) were unknown, and there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and other sequences were B. taurus ebd-P2 pseudogene, B. taurus similar to F-box only protein 21 isoform 2, ...

crossbreeding wit}i africander dam as basis . 3. post-weaning ...

African Journals Online (AJOL)

'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

Características sensoriais da carne ovina

OpenAIRE

Osório, José Carlos da Silveira; Osório, Maria Teresa Moreira; Sañudo, Carlos

2009-01-01

Considerando que a tendência mundial é produzir o que se consome e que a ciência da carne busca o mais alto grau de satisfação do consumidor, o estudo aborda as características que propiciam essa satisfação na carne ovina. A utilização dos órgãos dos sentidos humanos na percepção das características que propiciam a mais alta satisfação do consumidor, passou a ser definição de "qualidade"; que aponta como características sensoriais importantes da carne ovina a suculência (capacidade de retençã...

Marginal costs of abating greenhouse gases in the global ruminant livestock sector

NARCIS (Netherlands)

Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

2017-01-01

Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

Morphological dimorphism in the Y chromosome of "pé-duro" cattle in the Brazilian State of Piauí

Directory of Open Access Journals (Sweden)

Carmen M.C. Britto

1999-09-01

Full Text Available "Pé-duro" (hard foot is a rare breed of beef cattle of European (Bos taurus taurus origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 "pé-duro" bulls from the Empresa Brasileira de Pesquisa Agropecuária (Embrapa herd in the Brazilian State of Piauí. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus in a cattle that has been considered closest to its European origin (B. t. taurus. The presence of both submetacentric and acrocentric Y chromosomes, typical of B. t. taurus and B. t. indicus, respectively, and the larger preputial sheath in bulls with an acrocentric Y chromosome indicated racial contamination of the "pé-duro" herd with Zebu cattle. Phenotypic parameters involving horn, dewlap, ear, chamfer, and coat color characteristics, indicative of apparent racial contamination, were not associated with acrocentric Y chromosome.Um plantel de touros "pé-duro", consistindo de 75 animais do núcleo da Embrapa envolvido com a preservação desse gado no Estado do Piauí, foi examinado quanto à morfologia do seu cromossomo Y, bem como em relação a elementos da genitália externa e outras características fenotípicas dos machos. O objetivo era investigar a contaminação racial por animais zebuínos (Bos taurus indicus num gado bovino que tem sido considerado mais próximo de sua origem européia (Bos taurus taurus. Tanto a forma submetacêntrica quanto a forma acrocêntrica do cromossomo Y, típicas das sub-espécies B. t. taurus e B. t. indicus, respectivamente, bem como maior bainha prepucial nos espécimes portadores do cromossomo Y acrocêntrico, indicativa de contaminação racial por gado zebuíno, foram detectadas no rebanho "pé-duro" mantido no núcleo da Embrapa. Outras características fenotípicas analisadas que podem informar sobre a contaminação racial aparente n

OPTIMIZACIÓN DE COMBINACIÓN CARNE DE CHAME (Dormitator latifrons Y CARNE DE RES EN PROCESAMIENTO DE SALCHICHA

Directory of Open Access Journals (Sweden)

Manuel Vicente Ganchoso Espinoza

2012-12-01

Full Text Available La investigación se realizó con el objetivo de obtener una salchicha mixta, utilizando como principales ingredientes carne de chame y carne de res, que cumpla con los requisitos establecidos por el Instituto Ecuatoriano de Normalización (INEN 1338:96. Se formularon tres combinaciones (p/p:kg/kg de carnes chame:res, obteniendo los tratamientos A1 (10:60, A2 (20:50, A3(30:40 y un tratamiento testigo (A4 compuesto de carne de res (0:70, la unidad experimental fue de un kilogramo. Se evaluaron parámetros bromatológicos (proteína, grasa, humedad, cenizas y pH, microbiológicos (Salmonella, Staphylococcus aureus, Enterobacteriaceae, Escherichia coli y Recuento estándar en Placas (REP para aerobios mesófilos y propiedades térmicas de la salchicha (calor específico, difusividad térmica y conductividad térmica aplicando el modelo matemático de Choi y Okos. En las características bromatológicas se encontró diferencias significativas (p<0.01 en todas las formulaciones; en los microbiológicos alcanzaron lo establecido por la norma INEN 133. El calor específico se incrementa en función de la temperatura. Se concluye que la salchicha con menor porcentaje de carne de chame (A1 presenta parámetros bromatológicos apropiados. Las propiedades térmicas variaron a diferentes temperaturas, demostrando que a mayor temperatura aumenta su calor específico, difusividad y conductividad térmica.

Photometric peculiarities of the RY Taurus

International Nuclear Information System (INIS)

Zajtseva, G.V.

1982-01-01

The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region

Effect of Concentrate Supplementation on Reproductive ...

African Journals Online (AJOL)

A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

The power and pain of market-based carbon policies

NARCIS (Netherlands)

Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

2018-01-01

The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

Processamento da carne do jacaré do pantanal (Caiman crocodilus yacare

Directory of Open Access Journals (Sweden)

Romanelli Pedro Fernando

2002-01-01

Full Text Available Trata-se de um estudo de algumas formas de processamento da carne de jacaré do pantanal como uma alternativa de consumo, de uma forma não convencional, da carne dessa espécie. Testa-se, ao mesmo tempo, a utilização de carne de cortes normalmente descartados tais como o tronco e os membros. Dessa forma relatam-se os seguintes processamentos: produtos de salsicharia não embutidos (tipo hambúrguer, carne em conserva (enlatado, carne curada e não cozida (defumada e produto curado e cozido (tipo apresuntado. Avalia-se a qualidade dos produtos através da análise sensorial e mede-se estatisticamente o grau de sua aceitação.

Effects of temperament and acclimation to handling on feedlot performance of Bos taurus feeder cattle originated from a rangeland-based cow-calf system.

Science.gov (United States)

Francisco, C L; Cooke, R F; Marques, R S; Mills, R R; Bohnert, D W

2012-12-01

= 0.03) and tended to have decreased DMI (P = 0.07) compared with controls. Acclimated steers had greater plasma haptoglobin on d 4 (P = 0.04) and greater ceruloplasmin from d 0 to 10 (P ≤ 0.04) and tended to have greater cortisol on d 1 (P = 0.08) than controls. In conclusion, temperament affects productivity of beef operations based on Bos taurus feeder cattle reared in extensive rangeland systems until weaning whereas acclimation to handling ameliorated cattle temperament but did not benefit feedlot receiving performance.

Genome variability in European and American bison detected using the BovineSNP50 BeadChip

DEFF Research Database (Denmark)

Pertoldi, C.; Wójcik, Jan M; Tokarska, Małgorzata

2010-01-01

 The remaining wild populations of bison have all been through severe bottlenecks. The genomic consequences of these bottlenecks present an interesting area to study. Using a very large panel of SNPs developed in Bos taurus we have carried out a genome-wide screening on the European bison (Bison...... bonasus; EB) and on two subspecies of American bison: the plains bison (B. bison bison; PB) and the wood bison (B. bison athabascae; WB). One hundred bison samples were genotyped for 52,978 SNPs along with seven breeds of domestic bovine Bos taurus. Only 2,209 of the SNPs were polymorphic in the bison...

9 CFR 94.0 - Definitions.

Science.gov (United States)

2010-01-01

... than poultry or game birds). Bovine. Bos taurus, Bos indicus, and Bison bison. Bovine spongiform... loaded with meat product, or the areas at various points along the belt in an oven chamber, slowest to.... Game birds. Migratory birds, including certain ducks, geese, pigeons, and doves (“migratory” refers to...

THE DISK POPULATION OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

2010-01-01

We have analyzed nearly all images of the Taurus star-forming region at 3.6, 4.5, 5.8, 8.0, and 24 μm that were obtained during the cryogenic mission of the Spitzer Space Telescope (46 deg 2 ) and have measured photometry for all known members of the region that are within these data, corresponding to 348 sources, or 99% of the known stellar population. By combining these measurements with previous observations with the Spitzer Infrared Spectrograph and other facilities, we have classified the members of Taurus according to whether they show evidence of circumstellar disks and envelopes (classes I, II, and III). Through these classifications, we find that the disk fraction in Taurus, N(II)/N(II+III), is ∼75% for solar-mass stars and declines to ∼45% for low-mass stars and brown dwarfs (0.01-0.3 M sun ). This dependence on stellar mass is similar to that measured for Chamaeleon I, although the disk fraction in Taurus is slightly higher overall, probably because of its younger age (1 Myr versus 2-3 Myr). In comparison, the disk fraction for solar-mass stars is much lower (∼20%) in IC 348 and σ Ori, which are denser than Taurus and Chamaeleon I and are roughly coeval with the latter. These data indicate that disk lifetimes for solar-mass stars are longer in star-forming regions that have lower stellar densities. Through an analysis of multiple epochs of Spitzer photometry that are available for ∼200 Taurus members, we find that stars with disks exhibit significantly greater mid-infrared (mid-IR) variability than diskless stars, which agrees with the results of similar variability measurements for a smaller sample of stars in Chamaeleon I. The variability fraction for stars with disks is higher in Taurus than in Chamaeleon I, indicating that the IR variability of disks decreases with age. Finally, we have used our data in Taurus to refine the observational criteria for primordial, evolved, and transitional disks. The ratio of the number of evolved and

TAURUS - a wide field imaging Fabry-Perot spectrometer

International Nuclear Information System (INIS)

Atherton, P.D.; Taylor, K.

1983-01-01

TAURUS, an imaging Fabry-Perot system developed by the Royal Greenwich Observatory and Imperial College London, is described. The imaging process is explained and the technique is compared with grating spectrographs. It is argued that TAURUS is superior for obtaining field information from extended emission line sources. (Auth.)

Urinary catecholamine concentrations in three beef breeds at ...

African Journals Online (AJOL)

Handling and transport of live animals is a stressful experience for animals. The temperaments of cattle affect their behaviour and differ between breeds, i.e. studies have shown that Bos indicus types are more temperamental than Sanga and Bos taurus types. Catecholamines (CAT's) are considered as indicators of stress, ...

Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

Directory of Open Access Journals (Sweden)

Chase A. Runyan

2017-12-01

Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

Directory of Open Access Journals (Sweden)

Ceiridwen J Edwards

Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

LENUS (Irish Health Repository)

Edwards, Ceiridwen J

2010-01-01

BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

Background-Oriented Schlieren (BOS) for Scramjet Inlet-isolator Investigation

Science.gov (United States)

Che Idris, Azam; Rashdan Saad, Mohd; Hing Lo, Kin; Kontis, Konstantinos

2018-05-01

Background-oriented Schlieren (BOS) technique is a recently invented non-intrusive flow diagnostic method which has yet to be fully explored in its capabilities. In this paper, BOS technique has been applied for investigating the general flow field characteristics inside a generic scramjet inlet-isolator with Mach 5 flow. The difficulty in finding the delicate balance between measurement sensitivity and measurement area image focusing has been demonstrated. The differences between direct cross-correlation (DCC) and Fast Fourier Transform (FFT) raw data processing algorithm have also been demonstrated. As an exploratory study of BOS capability, this paper found that BOS is simple yet robust enough to be used to visualize complex flow in a scramjet inlet in hypersonic flow. However, in this case its quantitative data can be strongly affected by 3-dimensionality thus obscuring the density value with significant errors.

Gene : CBRC-TTRU-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

SPECTROSCOPY OF PUTATIVE BROWN DWARFS IN TAURUS

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.

2010-01-01

Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2 ± 0.5), and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

Dicty_cDB: Contig-U05787-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 534 ) Bos taurus clone CH240-467E17, WORKING DRAFT SEQU... 32 2.9 2 ( BD142887 ) Method of simple and quick determ.... 34 3.1 3 ( AR634817 ) Sequence 19 from patent US 6852489. 34 3.1 3 ( BD142885 ) Method of simple and quick determ...clone SSL573. 172 9e-64 2 ( EK498372 ) 1095505197154 Global-Ocean-Sampling_GS-32-...0.049 12 ( AC161851 ) Bos taurus clone CH240-99E24, WORKING DRAFT SEQUE... 44 0.049 2 ( EK274769 ) 1095462272251 Global-Ocean-Sampli...95458103663 Global-Ocean-Sampling_GS-26-01-01-1... 44 0.23 2 ( AC208960 ) Nomascu

TAURUS, Post-processor of 3-D Finite Elements Plots

International Nuclear Information System (INIS)

Brown, B.E.; Hallquist, J.O.; Kennedy, T.

2002-01-01

Description of program or function: TAURUS reads the binary plot files generated by the LLNL three-dimensional finite element analysis codes, NIKE3D (NESC 9725), DYNA3D (NESC 9909), TACO3D (NESC 9838), TOPAZ3D (NESC9599) and GEMINI and plots contours, time histories, and deformed shapes. Contours of a large number of quantities may be plotted on meshes consisting of plate, shell, and solid type elements. TAURUS can compute a variety of strain measures, reaction forces along constrained boundaries, and momentum. TAURUS has three phases: initialization, geometry display with contouring, and time history processing

Le Flaubert de Charles Du Bos

Directory of Open Access Journals (Sweden)

Jacques Neefs

2009-01-01

Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

The effect of dietary rations on the gut morphology of Zebu Cattle ...

African Journals Online (AJOL)

Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

Factors influencing recalving rate in lactating beef cows in the sweet ...

African Journals Online (AJOL)

goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

Solid CO in the Taurus dark clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1985-01-01

The infrared vibrational feature of solid state CO at 4.67 μm wavelength is detected towards five sources in or behind the dark cloud complex in Taurus. A comparison with millimetre-wave data suggests that a significant fraction (up to 40 per cent) of the CO may be depleted on to grains. The adjacent CN feature at 4.62 μm observed in W33A by previous authors is absent from the present spectra, suggesting that the grain mantles in Taurus are unannealed. (author)

Gene : CBRC-CPOR-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2e-35 41% ref|XP_870944.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 6e-71 60% M...SIPKATNQSKKITLHILFLSTLFIISNTLRQPRCPSMETCECAFYSSVVVPKLLENLLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTRFRAVCHPLLYMVAY

ANÁLISE MICROBIOLÓGICA DA CARNE DE JACARÉ DO PANTANAL (Caiman crocodilus yacare)

OpenAIRE

HOFFMANN,Fernando Leite; ROMANELLI,Pedro Fernando

1998-01-01

O objetivo deste estudo foi realizar o levantamento das características microbiológicas da carne do jacaré, através da detecção e/ou enumeração dos microrganismos mais comumente encontrados na carne. Pela inexistência de padrões na legislação brasileira para a carne de jacaré, os resultados foram comparados com os padrões microbiológicos existentes para carne bovina e pescado. Encontrou-se a presença de S. aureus e de Salmonella sp, resultados estes considerados insatisfatórios, o que nos per...

Elaboração de carne caprina maturada para churrasco

OpenAIRE

Bosco de Macedo Coelho, João

2004-01-01

Com o propósito de melhorar as características organolépticas da carne caprina quando preparada sob a forma de churrasco e torna-la competitiva, a carne foi maturada em pré-rigor à quente com e sem tripolifosfato de sódio, e comparadas, através de análise sensorial Teste de Ordenação, com as carnes caprina e ovina preparadas pelo método tradicional da região. Os efeitos dos tratamentos foram avaliados por meio da determinação dos teores de umidade, capacidade de retenção de água (CRA) e p...

Gene : CBRC-DNOV-01-1811 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 1e-69 68% ref|XP_588566.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 2e-7...9 78% MQHCLSSWCPSWTLNSTLLCIFFLSHFSFLDLCFLSSIIPQLLVNLKCSDKSITYVDCMIQLYVSLVMGYTECIHLAVMTYDHYVAVCHPLHYIFFMHLWLRHVLASME

Características da carne de bovinos cruzados (WAGYU × Red Angus) e maturação da carne de Nelore

OpenAIRE

Carvalho, Rúbio Madureira de Souza

2015-01-01

Características da carne de bovinos cruzados (Wagyu × Red Angus) e maturação da carne de Nelore. Orientador: Orientador: Orientador: Orientador: Orientador: Cleube Andrade BoariCleube Andrade Boari Cleube Andrade BoariCleube Andrade Boari Cleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade Boari . Dissertação (Mestrado em Zootecnia). Esta dissertação foi elaborada com o resultado de duas ...

Correlation analysis of the Taurus molecular cloud complex

International Nuclear Information System (INIS)

Kleiner, S.C.

1985-01-01

Autocorrelation and power spectrum methods were applied to the analysis of the density and velocity structure of the Taurus Complex and Heiles Cloud 2 as traced out by 13 CO J = 1 → 0 molecular line observations obtained with the 14m antenna of the Five College Radio Astronomy Observatory. Statistically significant correlations in the spacing of density fluctuations within the Taurus Complex and Heiles 2 were uncovered. The length scales of the observed correlations correspond in magnitude to the Jeans wavelengths characterizing gravitational instabilities with (i) interstellar atomic hydrogen gas for the case of the Taurus complex, and (ii) molecular hydrogen for Heiles 2. The observed correlations may be the signatures of past and current gravitational instabilities frozen into the structure of the molecular gas. The appendices provide a comprehensive description of the analytical and numerical methods developed for the correlation analysis of molecular clouds

Breeding programs for the main economically important traits of zebu dairy cattle

OpenAIRE

Ariosto Ardila Silva

2010-01-01

In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

Nutrición y calidad de la carne de los rumiantes

OpenAIRE

Martínez Marín, Andrés L.

2008-01-01

Aparte de los factores intrínsecos de los animales (raza, sexo) y de aquellos relacionados con el faenado y el procesado de la carne (sacrificio, maduración, conservación), la calidad de la canal y las cualidades organolépticas y saludables de la carne están muy influenciadas por la nutrición de los animales. El tipo y cantidad de grasa incluida en las raciones, los nutrientes aportados y la incorporación de ciertas vitaminas y sustancias análogas pueden aumentar el tenor de la carne en nutri...

Aspectos genético-quantitativos da qualidade da carne em frangos

Directory of Open Access Journals (Sweden)

Gaya Leila de Genova

2006-01-01

Full Text Available O estudo dos parâmetros genéticos das características de qualidade de carne de aves permite à industria avícola se adequar às exigências da indústria processadora, aumentando sua eficiência, e melhorando a aceitação da carne de frango pelo mercado consumidor. Além disso, por meio do estudo destes parâmetros, valiosas informações sobre a caracterização do fenômeno denominado PSE, que representa a carne pálida, flácida e exsudativa, podem ser obtidas, uma vez que são escassos os estudos a esse respeito em frangos. O conhecimento do comportamento genético e da relação entre os atributos da carne e outras características de interesse em frangos de corte pode favorecer o estabelecimento mais preciso e adequado das estratégias utilizadas nos programas de seleção.

Polarimetric study of the interstellar medium in Taurus Dark Clouds

International Nuclear Information System (INIS)

Hsu, J.

1985-01-01

An optical linear polarimetric survey was completed for more than 300 stars in an area of 6.5 0 x 10 0 toward the Taurus Dark Clouds Complex. It was found that the orientation of the magnetic field is roughly perpendicular to the elongation direction of the dust lanes, indicating cloud contraction along the magnetic field lines. The distance to the front edge of the dark clouds in Taurus is determined to be 126 pc. There is only insignificant amount of obscuring material between the cloud complex and the Sun. Besides the polarization data, the reddenings of about 250 stars were also obtained from the UBV photometry. The mean polarization to reddening ratio in the Taurus region is 4.6, which is similar to that of the general interstellar matter. The wavelengths of maximum polarization were determined for 30 stars in Taurus. They show an average value of lambda/sub max/ = 0.57 μm, which is only slightly higher than the mean value of the general interstellar medium, lambda/sub max/ = 0.55 μm. A few stars that show higher values of lambda/sub max/ are found near the small isolated regions of very high extinction. One such highly obscured small region where very complex long chain molecules have been discovered in the ratio spectra, is the Taurus Molecular Cloud 1

Study on the flare stars in the Taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results of the search of flare stars and their photometric, Hsub(α)-spectroscopic and statistical study in the Taurus are presented. By means of photographic observations carried out during 1980-1984, 92 new flare stars were discovered, 13 of which are known Orion Population variables, and 16 repeated flare-ups among 13 known flare stars. Spatial distribution of these stars was considered and the problem of their membership was discussed. Comparative analysis of the data of flare stars in the Taurus with that of other systems has been carried out. The Herzsprung-Russel and two-colour (U-B, B-V) diagrams for the Taurus flare stars are similar to the diagrams of stellar clusters and associations (Pleiades, Orion etc.). The estimated total number of flare stars in this region is larger than 500

A WISE survey of circumstellar disks in Taurus

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

2014-01-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M ☉ ).

A WISE survey of circumstellar disks in Taurus

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E., E-mail: taran.esplin@psu.edu [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States)

2014-04-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M {sub ☉}).

Consumo de carnes por adultos do sul do Brasil: um estudo de base populacional

Directory of Open Access Journals (Sweden)

Bruna Celestino Schneider

2014-08-01

Full Text Available Estudo transversal de base populacional que avaliou indivíduos com 20 anos ou mais, residentes na zona urbana de Pelotas, Rio Grande do Sul, que objetivou descrever a frequência do consumo de carnes e o hábito de consumi-las com excesso de gordura. Foi avaliado, no último ano, o consumo de carnes vermelhas (com osso, bife e carne moída, brancas (frango e peixes, vísceras e embutidos. Dos 2,730 entrevistados, 99,1% (IC95%, 98,7 - 99,5 consumiu algum tipo de carne no último ano, sendo que, em torno de 32% referiu consumo diário. A prevalência do consumo de carnes vermelhas (99,3%, IC95%, 98,9 - 99,6 e brancas (99,4% IC95%, 99,1 - 99,7 foi semelhante. A carne de frango foi a mais consumida (98,0%, IC95%, 97,4 - 98,5, enquanto que as vísceras, as menos (59,1% IC95% 56,4 - 61,7. Os embutidos, consumidos por 85,5% (IC95%, 83,7 - 87,2 das pessoas, apresentaram a maior prevalência de consumo diário (16,6%. As carnes com excesso de gordura foram consumidas por 52,3% (IC95%, 49,8 - 54,8 dos adultos, principalmente homens, e pessoas de menor escolaridade e nível econômico.

Interstellar ice grains in the Taurus molecular clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; Bode, M.F.; Baines, D.W.T.; Evans, A.

1983-01-01

Observations made in November 1981 using the United Kingdom Infrared Telescope (UKIRT) at Mauna Kea of the 3 μm ice absorption feature in the spectra of several obscured stars in the Taurus interstellar clouds are reported. The feature correlated in strength with extinction at visual wavelengths (Asub(v)), and is present in stars with Asub(v) as low as 4-6 mag. Ice may be widespread in the Taurus clouds, vindicating ideas on grain composition and growth first reported nearly 50 yr ago. (author)

T Tauri stars in Taurus - the IRAS view

International Nuclear Information System (INIS)

Harris, Stella; Clegg, Peter; Hughes, Joanne

1988-01-01

Statistical studies of star-formation have traditionally been beset with selection effects. We have developed a technique, using the completeness of the IRAS catalogue, which circumvents these effects. We have taken the properties of known T Tau stars within Taurus as a template to establish a purely IRAS-based definition of such sources. We then use this definition to extract, from the IRAS catalogue, all sources within a specific region of Taurus having those same IRAS properties. This wider class of source is examined and discussed. (author)

ÓPTIMO TÉCNICO Y ECONÓMICO EN BOVINOS PRODUCTORES DE CARNE ENGORDADOS EN CORRAL

Directory of Open Access Journals (Sweden)

S. Rebollar-Rebollar

2011-01-01

Full Text Available The feedlot cattle producers in the south zone of the State of Mexico, generally does not an correct planning of sale to the market of yours finished hooky. Likewise, they lack a technical and administrative managing in his productive units, focused with the efficient use of inputs, which has prevented that they maximize her monetary earnings. The present research was realized to estimate the levels technical (TOL and economic optimal (EOL in feedlot cattle, using two cubic functions of production with diminishing marginal returns. There was in use 100 hooky Bos taurus x Bos indicus. Alive weight-LW to beginning of the fattens of 290 ± 15 kg, age 21 to 24 months fattened in feedlot during 93 days consuming a diet totally mixed (Protein: 133.33, FDN: 237.44, FDA 114.33 g/kg MS and 2.62 MS's Mcal/kg of metabolisable energy. To estimate the both functions (TOL and EOL, the profit of weight was considered to be a dependent variable. For the first production function the food consumption was taken as an independent variable and in the second the time defined in days. For the first production function the TOL was of 475.04 and the EOL was of 473.94 kg of LW; with a food consumption of 12.58 and 12.36 kg/day. For the second production function the TOL it was 475.01 and the EOL of 460.21 kg of LW, with a period of 93.29 and 77.21 days. The ideal point of sale and the maximum profit is obtained by the second production function, when the animals they come an LW of 460.21 kg during a food period of 77.21 days

Population Structure Analysis of Bull Genomes of European and Western Ancestry

DEFF Research Database (Denmark)

Chung, Neo Christopher; Szyda, Joanna; Frąszczak, Magdalena

2017-01-01

Since domestication, population bottlenecks, breed formation, and selective breeding have radically shaped the genealogy and genetics of Bos taurus. In turn, characterization of population structure among diverse bull (males of Bos taurus) genomes enables detailed assessment of genetic resources...... and origins. By analyzing 432 unrelated bull genomes from 13 breeds and 16 countries, we demonstrate genetic diversity and structural complexity among the European/Western cattle population. Importantly, we relaxed a strong assumption of discrete or admixed population, by adapting latent variable models...... harboring largest genetic differentiation suggest positive selection underlying population structure. We carried out gene set analysis using SNP annotations to identify enriched functional categories such as energy-related processes and multiple development stages. Our population structure analysis of bull...

Infestation by Haematopinus quadripertusus on cattle in São Domingos do Capim, state of Pará, Brazil Infestação por Haematopinus quadripertusus em bovinos de São Domingos do Capim, Estado do Pará, Brasil

Directory of Open Access Journals (Sweden)

Alessandra Scofield

2012-09-01

Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23

Impact of Balance Of System (BOS) costs on photovoltaic power systems

Science.gov (United States)

Hein, G. F.; Cusick, J. P.; Poley, W. A.

1978-01-01

The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

EGRET observations of diffuse gamma-ray emission in taurus and perseus

International Nuclear Information System (INIS)

Digel, Seth W.; Grenier, Isabelle A.

2001-01-01

We present an analysis of the interstellar gamma-ray emission observed toward the extensive molecular cloud complexes in Taurus and Perseus by the Energetic Gamma-Ray Experiment Telescope (EGRET). The region's large size (more than 300 square degrees) and location below the plane in the anticenter are advantageous for straightforward interpretation of the interstellar emission. The complex of clouds in Taurus has a distance of ∼140 pc and is near the center of the Gould Belt. The complex in Perseus, adjacent to Taurus on the sky, is near the rim of the Belt at a distance of ∼300 pc. The findings for the cosmic-ray density and the molecular mass-calibrating ratio N(H 2 )/W CO in Taurus and Perseus are compared with results for other nearby cloud complexes resolved by EGRET. The local clouds that now have been studied in gamma rays can be used to trace the distribution of high-energy cosmic rays within 1 kpc of the sun

B- AND A-TYPE STARS IN THE TAURUS-AURIGA STAR-FORMING REGION

International Nuclear Information System (INIS)

Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

2013-01-01

We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), τ Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

Zvířecí kosterní pozůstatky z popraviště ve Vodňanech

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2006-01-01

Roč. 58, č. 4 (2006), s. 813-814 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : scaffold * Bos taurus * burned bones * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

Características sensoriais da carne ovina Sensorial characteristics of sheep meat

OpenAIRE

José Carlos da Silveira Osório; Maria Teresa Moreira Osório; Carlos Sañudo

2009-01-01

Considerando que a tendência mundial é produzir o que se consome e que a ciência da carne busca o mais alto grau de satisfação do consumidor, o estudo aborda as características que propiciam essa satisfação na carne ovina. A utilização dos órgãos dos sentidos humanos na percepção das características que propiciam a mais alta satisfação do consumidor, passou a ser definição de "qualidade"; que aponta como características sensoriais importantes da carne ovina a suculência (capacidade de retençã...

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_776444.1| chondroadherin [Bos taurus] sp|Q27972|CHAD_BOVIN Chondroad...herin precursor (Cartilage leucine-rich protein) (38 kDa bone protein) [Contains: Chondroadherin m

A study of flare stars in the taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results are given of a search for flare stars in the region of the dark clouds in Taurus together with the results of photometric, H /sub alpha/ -spectroscopic, and statistical investigations of them. Photographic observations during 1980-1984 revealed 92 new flare stars, 13 of which were found to be known Orion variables with 16 repeated flares of 13 previously known flare stars. Their apparent distribution is considered. The question of whether the flare stars belong to a dark cloud is discussed. A comparative analysis of the flare stars in the Taurus region and other aggregates is made. The Hertzsprung-Russell (V, B - V) and two-color (U - B, B - V) diagrams for the flare stars are similar to the corresponding diagrams constructed for star clusters and associations (Pleiades, Orion, etc.). The total number of flare stars in the region of the dark clouds in Taurus is estimated at ≥ 500

Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

Directory of Open Access Journals (Sweden)

Leslie Scarpelli

2009-01-01

Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

OpenAIRE

Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

2017-01-01

Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

QUALIDADE E PERFIL SENSORIAL DESCRITIVO DA CARNE MATURADA PROVENIENTE DE ANIMAIS CRUZADOS

OpenAIRE

Nassu, Renata Tieko; Verruma-Bernardi, Marta Regina; Tullio, Rymer Ramiz; Cruz, Geraldo Maria da; Alencar, Maurício Mello de

2014-01-01

A maturação é uma alternativa para obtenção de carne de melhor qualidade, além de diminuir a variabilidade da maciez da carne proveniente de animais do mesmo grupo genético. Neste estudo, carnes provenientes de animais cruzados ½ Angus + ½ Nelore (AN) e ½ Senepol + ½ Nelore (SN) foram maturadas até 28 dias e analisadas em relação a parâmetros físico-químicos e sensoriais. Para todos os parâmetros a interação tempo de maturação x grupo genético não foi significativa, com exceção do atributo te...

Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2011-01-01

Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

Nature conservation and grazing management. Free-ranging cattle as a driving force for cyclic vegetation seccession

NARCIS (Netherlands)

Bokdam, J.

2003-01-01

Key-words : biodiversity, herbivory, wilderness, non-linear dynamics, mosaic cycling, grassland, wood encroachment, forest, Bos taurus , Calluna vulgaris , Deschampsia flexuosa.This thesis examines the suitability of controlled and wilderness grazing as conservation management tool for open,

BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

Science.gov (United States)

Zhang, Xiaoyu; Wessler, Susan R

2005-05-01

Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

Determinantes da demanda internacional de carne bovina brasileira: evidências de quebras estruturais

Directory of Open Access Journals (Sweden)

Laércio Juarez Melz

2014-12-01

Full Text Available O objetivo deste artigo é verificar as variáveis de impacto na demanda internacional por carne bovina entre janeiro de 1995 e junho de 2013. O método utilizado foi de Mínimos Quadrados Ordinários com Quebras, obtendo-se quatro quebras, cinco regimes. As variáveis independentes na regressão foram os preços de exportação e internos das carnes de bovinos, frangos e suínos, além da renda e da taxa de câmbio. No primeiro regime, a demanda por carne bovina foi elástica em relação aos preços, tanto interno quanto externo, da carne de frango e preço interno da carne bovina. Porém, a elasticidade-renda foi mais significativa. No segundo regime, a relação de preços externos foi inelástica. A elasticidade-renda foi significativa neste regime e houve impacto da taxa de câmbio. No terceiro regime, a demanda foi inelástica em relação aos preços externos das carnes de frango e bovina e elástica aos preços internos das mesmas carnes. A taxa de câmbio também teve impacto significativo. No quarto regime, a demanda foi elástica em relação ao preço interno e inelástica em relação aos preços externos e internos do frango. A renda passa a ser novamente significativa. No quinto regime, a demanda é elástica em relação ao preço externo dos suínos, interno do bovino e à renda. Houve tendência significativa de crescimento no segundo regime e de recessão no primeiro e terceiro regimes.

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Yomi

2012-01-05

Jan 5, 2012 ... 1Laboratory of Molecular Biology and Bovine Breeding, Institute ... there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and ..... orchestrate microtubule dynamics and determine the.

Percepción del consumidor sobre los tipos de carne picada que se comercializan en Montevideo

Directory of Open Access Journals (Sweden)

Laura María Raggio

2014-12-01

Full Text Available La técnica de asociación de palabras fue utilizada para realizar un estudio preliminar de la percepción sobre los tipos de carnes picadas comercializadas en Montevideo. 60 consumidores recibieron cinco tarjetas con las palabras: Carne Picada Común, Magra, Premium, de Ternera y Especial y se les solicitó que escribieran las cuatro primeras imágenes, asociaciones, pensamientos o sentimientos que vinieran a su mente al leer cada tarjeta. Posteriormente, evaluaron cuán saludable consideraban que era cada tipo de carne picada. Las respuestas fueron agrupadas en 16 categorías. La Carne Picada Común fue percibida como un alimento con alto contenido de grasa y evaluada como poco saludable. Las carnes picadas Magra y Premium fueron percibidas como productos con bajo contenido graso, nutritivas, saludables y de precio elevado. La tipo Premium fue considerada, además, como un producto de calidad. La carne picada de Ternera fue percibida principalmente como un producto con una textura tierna, suave y blanda, mientras que en la carne picada Especial se encontraron contradicciones en las palabras utilizadas por los consumidores para su descripción (cara-económica, con poca grasa- con mucha grasa. Por medio de esta técnica se identificaron los atributos más relevantes en el proceso de selección y toma de decisiones de compra de este tipo de producto.

INFORMAÇÃO E QUALIDADE NA COMPRA DE CARNE BOVINA

Directory of Open Access Journals (Sweden)

Marcia Dutra de Barcellos

2004-12-01

Full Text Available As transformações ocorridas na economia mundial nos últimos anos têm se refletido no comportamento do consumidor de alimentos, particularmente em relação ao seu processo decisório de compra. A crescente preocupação com o consumo de produtos de origem animal, em especial de carne bovina, posicionou a qualidade como um diferencial competitivo. Nesse sentido, informar ao consumidor sobre a qualidade do produto torna-se um desafio. Em carne bovina, a qualidade pode ser inferida pelas características intrínsecas do produto (cor, sabor, aroma, mas também pelas informações disponibilizadas. Este artigo objetiva, então, identificar o grau de importância de informações diretamente relacionadas à qualidade de carne bovina, a partir de uma amostra de 400 consumidores. Além disso, utilizando-se a estatística multivariada através da análise fatorial, foram identificados fatores relacionados à informação como indicadores de qualidade. Os resultados sugerem que os consumidores em Porto Alegre apresentam interesse por informações ainda não disponibilizadas pelos fornecedores de carne bovina, sinalizando que a oferta não está em acordo com a demanda. Assim, o produto oferecido no mercado não fornece elementos suficientes para que o consumidor possa inferir sobre sua qualidade, com base nas informações disponíveis.

A near-infrared survey for pre-main sequence stars in Taurus

Science.gov (United States)

Gomez, Mercedes; Kenyon, Scott J.; Hartmann, Lee

1994-01-01

We present a near-infrared survey of approximately 2 sq deg covering parts of L1537, L1538, and Heiles cloud 2 in the Taurus-Auriga molecular cloud. Although this study is more sensitive than previous attempts to identify pre-main sequence stars in Taurus-Auriga, our survey regions contain only one new optically visible, young star. We did find several candidate embedded protostars; additional 10 micrometer photometry is necessary to verify the pre-main sequence nature of these sources. Our results--combined with those of previous surveys--show that the L1537/L1538 clouds contain no pre-main sequence stars. These two clouds are less dense than the active star formation sites in Taurus-Auriga, which suggests a cloud must achieve a threshold density to form stars.

the occurrence of post partum anoestrus in bonsmara cows

African Journals Online (AJOL)

duration of post partum anoestrus than gain in body mass. Post pactum ... and Bos Taurus cattle to improve fertility and milk pro- duction in high .... The occurrence of post partum anoestrus in beef cows under ranching conditions. Proc.

UniProt search blastx result: AK289096 [KOME

Lifescience Database Archive (English)

Full Text Available AK289096 J090096D02 Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 precursor... (EC 3.4.23.-) (PAG 1) (Pregnancy-specific protein B) (PSP-B) - Bos taurus (Bovine) 9.00E-45 ...

El mercado de la carne de bovino en México, 1970-2011

Directory of Open Access Journals (Sweden)

Joaquín Cruz Jiménez

2014-01-01

Full Text Available La proteína animal es básica en la dieta de los mexicanos y las fuentes principales son carne de ave, bovina y porcina. En 2011 se consumieron 60 kg/persona de carne; 16.5 kg/persona fue bovino. Para estable- cer y cuantifi car el efecto sobre el mercado mexicano de carne de bovino de sus prin- cipales variables determinantes, se diseñó un modelo econométrico de ecuaciones simultáneas, estimado a través de mínimos cuadrados en dos etapas con información secundaria para el periodo 1970-2011. Se consideró un contexto de economía abierta para el mercado bovino, de costos de pro- ducción crecientes y de pérdida de partici- pación en el mercado nacional. Resultó una oferta inelástica a los cambios del precio al productor y una demanda elástica al precio al consumidor, y el precio de importación de carne y granos inciden sobre la oferta, demanda y el saldo de comercio exterior.

Características de carcaça e qualidade de carne de novilhos superprecoces de três grupos genéticos Carcass characteristics and beef quality of young bulls from three genetic groups

Directory of Open Access Journals (Sweden)

Patrícia Maria Ribeiro Campos Pereira

2009-11-01

Full Text Available O objetivo deste trabalho foi avaliar parâmetros de carcaça, características físico-químicas e de qualidade de carne de novilhos machos superprecoces. Foram avaliados três grupos raciais com 8 animais Nelore (N, 18 ¼ Abeerden Angus ½ Nelore (AN e 18 ½ Limousin ¼ Abeerden Angus ¼ Nelore (LAN, com idade entre 7,5 e 11,5 meses no início do experimento, abatidos após 143 dias de confinamento. Os animais AN apresentaram maior peso ao abate, ganho médio diário de peso, peso de carcaça e comprimento de carcaça; os animais LAN apresentaram maior rendimento de carcaça e área de olho de lombo. Os animais LAN apresentaram 72% de carcaças convexas, enquanto 83% das carcaças dos animais AN e 100% das carcaças dos animais N foram classificadas como subconvexas. Os grupos LAN e AN não apresentaram diferença significativa nos valores de força de cisalhamento, o que indica a possibilidade de utilização da proporção de 50% do genótipo Bos indicus sem prejuízo para a maciez da carne. As características de carcaça e carne dos animais dos grupos genéticos NA, LAN e N estão em conformidade com as especificações de consumo e adequadas para abate aos 15 meses de idade, o que viabiliza o sistema de produção de novilhos superprecoces.The objective of this work was to evaluate carcass parameters, physicochemical characteristics and quality of meat of young bulls. Three genetic groups with 8 Nelore (N, 18 ½ Abeerden Angus ½ Nelore (AN, and 18 ½ Limousin ¼ Abeerden Angus ¼ Nelore (LAN animals, with ages varying between 7.5 and 11.5 months at the beginning of the experiment, slaughtered after 143 days of confinement, were evaluated. AN animals were heavier at slaughter and showed higher average daily weight gain, higher hot carcass weight and carcass length; LAN animals had higher carcass yield and rib-eye area. LAN animals showed 72% convex carcasses, while 83% of AN and 100% of N carcasses were classified as subconvex. LAN and AN

Contribución a la patología de los carnívoros silvestres.

OpenAIRE

Sobrino Menchero, Raquel

2008-01-01

España cuenta con una rica comunidad de carnívoros silvestres terrestres. Esta tesis parte de las siguientes hipótesis: (1) los carnívoros terrestres, por su ubicación en la cúspide de la pirámide trófica, pueden ser buenos indicadores de la presencia y frecuencia de enfermedades que afectan a distintos taxones animales. (2) la diversidad paisajística de la Península Ibérica, que se asocia con diferentes comunidades de carnívoros terrestres, podría determinar diferencias en la distribución y ...

Prevalence of infection and molecular confirmation by using ITS-2 region of Fasciola gigantica found in domestic cattle from Chiang Mai province, Thailand.

Science.gov (United States)

Phalee, Anawat; Wongsawad, Chalobol

2014-03-01

To investigate the infection of Fasciola gigantica (F. gigantica) in domestic cattle from Chiang Mai province and molecular confirmation using ITS-2 region. The liver and gall bladder of Bubalus bubalis (B. bubalis) and Bos taurus (B. taurus) from slaughterhouses were examined adult worms and prevalence investigation. The species confirmation with phylogenetic analysis using ITS-2 sequences was performed by maximum likelihood and UPGMA methods. The total prevalences of infection in B. bubalis and Bubalus taurus (B. taurus) were 67.27% and 52.94% respectively. The respective prevalence in both B. bubalis and B. taurus were acquired from Doi-Saket, Muang, and Sanpatong districts, with 81.25%, 62.50% and 60.00% for B. bubalis and 62.50%, 50.00% and 47.06% for Bos taurus respectively. The species confirmation of F. gigantica and some related species by basing on maximum likelihood and UPGMA methods used, 4 groups of trematodes were generated, first F. gigantica group including specimen of Chiang Mai, second 2 samples of F. hepatica, third group of 3 rumen flukes; Orthocoelium streptocoelium, F. elongatus and Paramphistomum epliclitum and fourth group of 3 minute intestinal flukes; Haplorchis taichui, Stellantchasmu falcatus, Haplorchoides sp. and liver fluke; Opisthorchis viverrini respectively. These results can be confirmed the Giant liver fluke which mainly caused fascioliasis in Chiang Mai was identified as F. gigantica and specimens were the same as those of F. gigantica recorded in other different countries. Nucleotide sequence of ITS-2 region has been proven as effective diagnostic tool for the identification of F. gigantica. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

Sistemas de equações de demanda por carnes no Brasil: especificação e estimação

Directory of Open Access Journals (Sweden)

Moisés de Andrade Resende Filho

2012-03-01

Full Text Available Especificações alternativas do sistema de demanda quase ideal (AIDS foram utilizadas para estimar as demandas agregadas das carnes bovina, suína e de frango e outros bens de consumo e as suas elasticidades no Brasil. Detectada a necessidade de se utilizar a variável tendência nas equações dos modelos, observou-se uma tendência de crescimento da demanda por carnes e de decrescimento da demanda por outros bens de consumo. A variável dummy para o Plano Real indicou que o mesmo não afetou as demandas. Com base nas elasticidades próprios-preços Marshallianas, as demandas por carnes são inelásticas e a demanda por outros bens de consumo é elástica. As elasticidades preços-cruzados Marshallianas e Hicksianas confirmaram que as carnes bovina, suína e de frango são bens substitutos. As elasticidades-gasto indicaram que todos os bens são normais, exceto a carne suína que é um bem inferior. Como é provável que o gasto com o consumo das famílias aumente ao longo do tempo, ceteris paribus, as elasticidades gasto indicam que a demanda por carnes perderá importância para os outros bens de consumo, que o consumo de carne bovina perderá importância para a carne de frango e que o consumo de carne de porco perderá importância para as outras carnes.

The size of domestic cattle, sheep, goats and pigs in the Czech Neolithic and Eneolithic Periods: Temporal variations and their causes

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2016-01-01

Roč. 25, Junio (2016), s. 33-78 ISSN 1132-6891 Institutional support: RVO:67985912 Keywords : osteometry * body mass * domestication * cross-breeding * Chalcolithic * Bos taurus * Ovis aries * Capra hircus * Sus domesticus * aurochs * wild boar * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

Dicty_cDB: VHM242 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda

Dicty_cDB: VHM737 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein upda

Risk factors related to resistance to Rhipicephalus (Boophilus microplus and weight gain of heifers

Directory of Open Access Journals (Sweden)

Jenevaldo Barbosa da Silva

2015-08-01

Full Text Available The aim of the present study was to evaluate the influence of age and genetics in dairy heifers on resistance to the cattle tick Rhipicephalus (Boophilus microplus and correlate these parameters with weight gain. Twenty-two heifers were evaluated from birth up to two years of age. Resistance to the cattle tick was evaluated by counting the number of engorged female ticks and subjective qualification of the larvae and nymph infestation. The animals were weighted in the first 24 hours after birth and at six, 12, 18 and 24 months of age. The average tick count and weight gain were compared by Tukey’s test at 5% significance. Subsequently, linear regression was performed to verify the strength of the association between the risk factors age and genetics and infestation by R. (B. microplus. Age and genetics were both significant risk factors for R. (B. microplus infestation in heifers. Between the third and sixth months of age, the animals showed a window of susceptibility to R. (B. microplus. Regardless of age, Bos taurus heifers had higher infestations than Bos indicus, crossbred F1 (½ B. taurus x ½ B. indicus and crossbred Gir-Holstein (Girolando (? B. taurus x ? B. indicus heifers. B. taurus heifers were heavier than B. indicus heifers at birth and had significantly greater weight gain (p < 0.01.

Hormonal protocols for in vitro production of Zebu and taurine embryos

Directory of Open Access Journals (Sweden)

Carlos Antônio de Carvalho Fernandes

2014-10-01

Full Text Available The objective of this work was to evaluate the effects of hormonal synchronization protocols, associated or not with follicular development stimulation, on the recovery of oocytes and on in vitro production of Bos indicus and B. taurus embryos, in different seasons. Ultrasound-guided follicular aspirations (n=237 were performed without pre-treatment (G1, control group and after follicular wave synchronization (G2, or after follicular wave synchronization and follicle growth induction (G3. Bos indicus produced more oocytes and embryos than B. taurus (18.7±0.9 vs. 11.9±0.6 oocytes and 4.8±0.3 vs. 2.1±0.2 embryos. On average, oocyte and embryo yields were higher in G3 than in G2, and both were greater than in G1, which lead to a higher conversion of oocytes to embryos in these treatments. The hot or the cold season did not affect the B. indicus outcomes, whereas, in B. taurus, both oocyte recovery and embryo production were higher in the cold season. Follicular wave synchronization improves ovum pick-up and in vitro production of embryos in both cattle subspecies evaluated.

CO survey of the dark nebulae in Perseus, Taurus, and Auriga

International Nuclear Information System (INIS)

Ungerechts, H.; Thaddeus, P.

1987-01-01

A new SIS receiver with extremely low noise temperature, used on the Columbia 1.2-m telescope has permitted mapping CO rapidly with full sampling. Results are presented of a survey for which the angular resolution of the telescope was reduced to 0.5 deg, allowing the observations for the complete region of 750 square degrees to be finished within four months, while retaining sufficient resolution to see significant substructure. Most positions with emission are in the Taurus-Auriga dark nebulae, a cloud associated with IC 348 and NGC 1333, and a cloud associated with the California nebula (NGC 1499) and NGC 1579, which overlaps the northern Taurus-Auriga nebulae but is separated from them in velocity. Also seen were several small clouds at Galactic latitude -25 deg to -35 deg southwest of the Taurus clouds, and the L1558 and L1551 clouds in the south. 89 references

Recombinant lactoferrin (Lf) of Vechur cow, the critical breed of Bos indicus and the Lf gene variants.

Science.gov (United States)

Anisha, Shashidharan; Bhasker, Salini; Mohankumar, Chinnamma

2012-03-01

Vechur cow, categorized as a critically maintained breed by the FAO, is a unique breed of Bos indicus due to its extremely small size, less fodder intake, adaptability, easy domestication and traditional medicinal property of the milk. Lactoferrin (Lf) is an iron-binding glycoprotein that is found predominantly in the milk of mammals. The full coding region of Lf gene of Vechur cow was cloned, sequenced and expressed in a prokaryotic system. Antibacterial activity of the recombinant Lf showed suppression of bacterial growth. To the best of our knowledge this is the first time that the full coding region of Lf gene of B. indicus Vechur breed is sequenced, successfully expressed in a prokaryotic system and characterized. Comparative analysis of Lf gene sequence of five Vechur cows with B. taurus revealed 15 SNPs in the exon region associated with 11 amino acid substitutions. The amino acid arginine was noticed as a pronounced substitution and the tertiary structure analysis of the BLfV protein confirmed the positions of arginine in the β sheet region, random coil and helix region 1. Based on the recent reports on the nutritional therapies of arginine supplementation for wound healing and for cardiovascular diseases, the higher level of arginine in the lactoferrin protein of Vechur cow milk provides enormous scope for further therapeutic studies. Copyright © 2011 Elsevier B.V. All rights reserved.

NEW YOUNG STAR CANDIDATES IN THE TAURUS-AURIGA REGION AS SELECTED FROM THE WIDE-FIELD INFRARED SURVEY EXPLORER

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; Noriega-Crespo, A.

2011-01-01

The Taurus Molecular Cloud subtends a large solid angle on the sky, in excess of 250 deg 2 . The search for legitimate Taurus members to date has been limited by sky coverage as well as the challenge of distinguishing members from field interlopers. The Wide-field Infrared Survey Explorer has recently observed the entire sky, and we take advantage of the opportunity to search for young stellar object (YSO) candidate Taurus members from a ∼260 deg 2 region designed to encompass previously identified Taurus members. We use near- and mid-infrared colors to select objects with apparent infrared excesses and incorporate other catalogs of ancillary data to present a list of rediscovered Taurus YSOs with infrared excesses (taken to be due to circumstellar disks), a list of rejected YSO candidates (largely galaxies), and a list of 94 surviving candidate new YSO-like Taurus members. There is likely to be contamination lingering in this candidate list, and follow-up spectra are warranted.

Fibroblasts express OvHV-2 capsid protein in vasculitis lesions of American bison (Bison bison) with experimental sheep-associated malignant catarrhal fever

Science.gov (United States)

Sheep-associated malignant catarrhal fever (SA-MCF) caused by ovine herpesvirus-2 (OvHV-2), a '-herpesvirus, is an often fatal disease characterized by lymphoproliferation, vasculitis, and mucosal ulceration in American bison (Bison bison), cattle (Bos taurus), and other clinically susceptible speci...

NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0198 ref|XP_596853.2| PREDICTED: similar to T-cell acute lymphocytic leukemia...-1 protein (TAL-1 protein) (Stem cell protein) (T-cell leukemia/lymphoma-5 protein) [Bos taurus] XP_596853.2 1e-168 89% ...

Dicty_cDB: VHO851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

Dicty_cDB: VHM169 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available one) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic...06_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein

Dicty_cDB: VHI393 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHO630 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHA439 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 CR457155_1( CR457155 |...pid:none) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHC785 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 75 1e-1...one) Homo sapiens full open reading fra... 75 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic

Dicty_cDB: VHD838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid.....06 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein update 2009. 6.29 PSORT psg: 0.67 gvh:

Dicty_cDB: VHF111 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHL517 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

Carne y nada más: la configuración del discurso cárnico en La Carne de René de Virgilio Piñera

Directory of Open Access Journals (Sweden)

Sergio Antonio Mora Moreno

2017-01-01

Full Text Available Este artículo hace un análisis de la novela La carne de René , del escritor cubano Virgilio Piñera, desde la construcción del discurso hegemónico –al que llamo cárnico– el cual construye y define los cuerpos de los personajes y, por tanto, sus subjetividades. Así, este trabajo se pregunta por los mecanismos discursivos (como la pa- rodia y las luchas entre poder-conocimiento sobre el cuerpo que configuran el discurso cárnico y cómo este opera en los individuos de este universo literario (especialmente en René, su protagonista para que puedan entenderse como sujetos constituidos de solo carne dispuesta al dolor, sin posibilidad de hacerse una vida espiritual. René, a pesar de ejercer resistencia al discurso cárnico, sucumbe ante este, ya que no logra hacerse una individualidad que esté por fuera del discurso, por lo que no le queda más remedio que aceptar que es un ser hecho de carne y nada más.

Nutrición y calidad de la carne de los rumiantes

OpenAIRE

Martínez Marín, Andrés L.

2008-01-01

Aparte de los factores intrínsecos de los animales (raza, sexo) y de aquellos relacionados con el faenado y el procesado de la carne (sacrificio, maduración, conservación), la calidad de la canal y las cualidades organolépticas y saludables de la carne están muy influenciadas por la nutrición de los animales. El tipo y cantidad de grasa incluida en las raciones, los nutrientes aportados y la incorporación de ciertas vitaminas y sustancias análogas pueden aumentar el tenor de...

INFORMAÃÃO E QUALIDADE NA COMPRA DE CARNE BOVINA

Directory of Open Access Journals (Sweden)

Marcia Dutra de Barcellos

2004-12-01

Full Text Available As transformações ocorridas na economia mundial nos últimos anos têm se refletido no comportamento do consumidor de alimentos, particularmente em relação ao seu processo decisório de compra. A crescente preocupação com o consumo de produtos de origem animal, em especial de carne bovina, posicionou a qualidade como um diferencial competitivo. Nesse sentido, informar ao consumidor sobre a qualidade do produto torna-se um desafio. Em carne bovina, a qualidade pode ser inferida pelas características intrínsecas do produto (cor, sabor, aroma, mas também pelas informações disponibilizadas. Este artigo objetiva, então, identificar o grau de importância de informações diretamente relacionadas à qualidade de carne bovina, a partir de uma amostra de 400 consumidores. Além disso, utilizando-se a estatística multivariada através da análise fatorial, foram identificados fatores relacionados à informação como indicadores de qualidade. Os resultados sugerem que os consumidores em Porto Alegre apresentam interesse por informações ainda não disponibilizadas pelos fornecedores de carne bovina, sinalizando que a oferta não está em acordo com a demanda. Assim, o produto oferecido no mercado não fornece elementos suficientes para que o consumidor possa inferir sobre sua qualidade, com base nas informações disponíveis.

Caracterización físico-química de la carne de toro de lidia

OpenAIRE

Heras Rojo, Joana de las

2012-01-01

La carne de toro de lidia es un tipo de carne cuyo consumo es muy estacional ligado a las tradiciones culinarias de los festejos populares. Sin embargo, es un producto del que los consumidores no tienen una percepción clara, ya que tanto el sistema de producción como su calidad y su composición química son bastante desconocidos debido a los pocos estudios publicados sobre la calidad de los toros de lidia. Por ello, en este trabajo se ha caracterizado la carne del toro de lidia ...

A novel polymorphism of resistin gene and its association with meat ...

African Journals Online (AJOL)

Searching for candidate gene polymorphisms and their relationship with meat quality traits is an important issue for Bos taurus industry. In this study, we evaluated polymorphism of resistin (RETN) gene involved in energy metabolism. Using the polymerase chain reaction-single strand conformation polymorphism ...

Breeds of cattle

NARCIS (Netherlands)

Buchanan, David S.; Lenstra, Johannes A.

2015-01-01

This chapter gives an overview on the different breeds of cattle (Bos taurus and B. indicus). Cattle breeds are presented and categorized according to utility and mode of origin. Classification and phylogeny of breeds are also discussed. Furthermore, a description of cattle breeds is provided.

Congenital bovine spinal dysmyelination is caused by a missense mutation in the SPAST gene

DEFF Research Database (Denmark)

Thomsen, Bo; Nissen, Peter H.; Agerholm, Jørgen S

2010-01-01

 Bovine spinal dysmyelination (BSD) is a recessive congenital neurodegenerative disease in cattle (Bos taurus) characterized by pathological changes of the myelin sheaths in the spinal cord. The occurrence of BSD is a longstanding problem in the American Brown Swiss (ABS) breed and in several...

Antibiogram profile of pathogens isolated from processed cow meat ...

African Journals Online (AJOL)

... the antibiotic resistance tests revealed varied, but interesting susceptibility patterns. Our findings does highlight the fact that there exist obvious vehicles for pathogenic bacteria proliferation within our abattoirs, and hence, the need for caution. Key words: Abattoirs, Bos taurus, Pathogenic bacteria, Antibiotics, Resistance ...

50 CFR 14.4 - What terms do I have to understand?

Science.gov (United States)

2010-10-01

... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...

UniProt search blastx result: AK287891 [KOME

Lifescience Database Archive (English)

Full Text Available AK287891 J065209I11 P47865|AQP1_BOVIN Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water c...hannel protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) - Bos taurus (Bovine) 1.00E-19 ...

Facilitative and competitive interactions between sympatric cattle, red deer and wild boar in Dutch woodland pastures

NARCIS (Netherlands)

Kuiters, A.T.; Groot Bruinderink, G.W.T.A.; Lammertsma, D.R.

2005-01-01

Use of cattle-grazed and ungrazed woodland pastures by red deer Cervus elaphus Linnaeus, 1758 and wild boar Sus scrofa Linnaeus, 1758 was investigated monthly by measuring dung-deposition rates. Cattle Bos taurus grazed pastures year-round, with peak intensities during the growing season

NUTGRANJA 2.0

NARCIS (Netherlands)

Prado, del A.; Corré, W.J.; Gallejones, P.; Pardo, G.; Pinto, M.; Hierro, del O.; Oenema, O.

2016-01-01

Farm nutrient management has been identified as one of the most important factors determining the economic and environmental performance of dairy cattle (Bos taurus) farming systems. Given the environmental problems associated with dairy farms, such as emissions of greenhouse gases (GHG), and the

Dicty_cDB: VHK777 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 75 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas.....ll open reading fra... 75 4e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 75 4e-

Dicty_cDB: SFL375 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 15 |pid:none) Rhodococcus opacus B4 DNA, comp... 88 4e-16 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecoli... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 87 1e-15 BC116493_1( B

Dicty_cDB: VHP706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...3 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13

Dicty_cDB: VHF631 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

Dicty_cDB: VHJ864 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 pro

Dicty_cDB: VHC661 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX882278_1( ...AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Comer carne y pagar impuestos. El impacto de las imposiciones municipales en el comercio barcelonés de carne durante el siglo XV

Directory of Open Access Journals (Sweden)

Banegas López, Ramón Agustí

2009-06-01

Full Text Available The municipal taxes are going to be consolidated in Barcelona in the 14th century; one of the most important taxes in the city was the meat consumption tax. This tax was contributing to the municipal exchequer with a lot of money. The evolution of the tax will have a lot of importance on the meat market of Barcelona, because his impact on the prices was very strong. The joint study of the tax and the meat market in Barcelona can help us to see the evolution of a short distance market; this is specially interesting because it is a market very linked with the territory.

Los impuestos indirectos municipales se consolidan en Barcelona a lo largo del siglo XIV, entre estos uno de las más importantes era la que gravaba el consumo de carne. La evolución de la imposición influirá de una manera determinante en el mercado de carne de Barcelona, ya que desde el primer momento tendrá un importante impacto sobre los precios. El estudio conjunto de la evolución del impuesto indirecto y de la venta de carne en Barcelona puede ayudar a dilucidar la evolución de un mercado de corta distancia profundamente vinculado con el territorio.

CO survey of the dark nebulae in Taurus and Perseus

International Nuclear Information System (INIS)

Baran, G.P.

1986-01-01

The thesis reports a large-scale survey of carbon monoxide ( 12 CO) emission (at λ = 2.6 mm) from dark nebulae in Taurus and Perseus. CO spectra at 4395 points were obtained within an area of about 800 square degrees generally west of the galactic anti-center. The spatial resolution of the instrument was eight arcminutes and velocity resolution was 2.6 km s -1 /. CO emission is strongest wherever extinction by dust is greatest, spilling over the apparent outer boundaries of the dust clouds observed optically. Combining CO velocity for the nebulae with optically determined distances shows that the clouds in the survey area form several layers. The molecular cloud mass closest to the sun is the Taurus and Auriga complex about 150 +/- 50 pc). Nearer to the Per )B2 OB association (at 350 +/- 100 pc) than the Taurus clouds are the Per OB2 molecular cloud (350 +/- 100 pc) and the California Nebula = NGC15979 molecular clouds (at 400 +/- 150 pc). Cloud masses were determined from integrated CO emission intensity alone by assuming that γ-ray emission intensities can be used to relate H 2 column densities to CO emission intensities

Qualidade da carne de frangos caipiras abatidos em diferentes idades

Directory of Open Access Journals (Sweden)

X.R. Souza

2012-04-01

Full Text Available Neste trabalho, foram avaliadas as características físico-químicas e de composição centesimal da carne de frangos machos de três linhagens utilizadas para criação semi-intensiva: Redbro Cou Nu - Vermelho de Pescoço Pelado (Pescoço Pelado; Redbro Plumé - Vermelho de Pescoço Emplumado (Pesadão e Gris Barre Plumé (Carijó. Foram analisadas diferenças em relação à linhagem e à idade de abate (70, 85 e 110 dias. Na carne do peito, não foi verificado efeito de linhagem sobre os parâmetros de cor (L*, a* e b* e pH final. Houve comportamento diferenciado para as aves em relação a qualidade da carne do peito, com menores valores de maciez para linhagem Pesadão e de Perda de Peso por Cozimento para linhagem Carijó. A linhagem Carijó apresentou, para a carne de peito aos 110 dias, os menores valores de umidade e as maiores médias de proteína. Os valores de proteina reduziram para linhagem Pescoço Pelado a partir de 85 dias. Na coxa, a partir de 110 dias, foi verificada redução dos valores de L* (luminosidade e aumento das médias de a* (vermelho. Os valores de força de cisalhamento e extrato etéreo aumentaram para peito e coxa a partir dos 110 dias. As linhagens Pesadão e Pescoço Pelado apresentaram de forma geral, melhores aspectos físico-quimicos, que são os atributos de maior preferência pelo consumidor em função deste tipo de produto.

La suavidad de la carne: implicaciones físicas y bioquímicas asociadas al manejo y proceso agroindustrial

Directory of Open Access Journals (Sweden)

Alejandro Chac\\u00F3n

2004-01-01

Full Text Available La suavidad de la carne: implicaciones físicas y bioquímicas asociadas al manejo y proceso agroindustrial. Actualmente, el problema de la suavidad de la carne representa una gran preocupación entre los productores, dado que esta variable ha demostrado ser el principal criterio con base al cual los consumidores juzgan la calidad de la carne. El problema es especialmente importante si se considera que una de cada cuatro degustaciones de la carne resultan insatisfactorias para el consumidor. Este trabajo abordó los principales aspectos asociados con la suavidad de la carne tales como la estructura y composición de la carne, el fenómeno de la contracción muscular, los cambios bioquímicos post mortem como el rigor mortis y la maduración, y el efecto general debido a las operaciones del procesamiento industrial como la cocción y el congelamiento. Métodos generales para el mejoramiento de la suavidad son discutidos, así como la actividad bioquímica e importancia de las enzimas CALPAINAS (calcium ion dependent papain like cisteine proteases.

Factores determinantes de la oferta regional de carne bovina en México, 1994-2013

Directory of Open Access Journals (Sweden)

Sergio Puebla Albiter

2018-04-01

Full Text Available El objetivo de este artículo es analizar las variables que determinan la oferta regional de carne bovina en México, en el periodo 1994-2013, en las regiones centro-occidente, oriente, norte, noroeste y sur. Para hacerlo se utilizaron cinco modelos lineales multivariables, y los resultados indican que en cada región la oferta fue inelástica al precio de la carne; inversa e inelástica al precio del maíz y al del sorgo; directa e inelástica a la tasa de extracción; positiva e inelástica en cuanto a la precipitación pluvial y los subsidios. Tales resultados predicen que los aumentos en los precios de la carne reflejan un incremento en la producción; pero que ésta se restringe si aumenta el costo de los insumos. La conclusión es que los subsidios gubernamentales y la precipitación pluvial incidieron en que la inelasticidad fuera menor, y que su papel es importante para contrarrestar el efecto del precio de los insumos sobre la producción de esta carne.

Crises de Segurança do Alimento e a Demanda por Carnes no Brasil

Directory of Open Access Journals (Sweden)

Moisés de Andrade Resende Filho

Full Text Available Resumo: Investiga-se se crises de segurança do alimento deslocam para baixo as demandas por carne bovina, suína e de frango no Brasil. Constroem-se três séries de índices de crises de segurança do alimento, um para cada tipo de carne, somando-se o total de notícias na Folha de São Paulo que atenderam a critérios predefinidos de busca. Utilizam-se estas três séries, os preços das carnes e de um bem composto e o gasto per capita com consumo como variáveis explicativas em seis especificações alternativas de um sistema de quatro equações de demanda. Seleciona-se a melhor especificação do modelo por meio de testes ajustados de razão de verossimilhança. Testes com o modelo selecionado não rejeitam a hipótese de que as demandas não são afetadas por crises de segurança do alimento. Conclui-se que se deslocamentos da demanda para baixo em reação a crises de segurança do alimento criam incentivos para que as empresas adotem medidas para produzir um alimento mais seguro, tais incentivos não existem nos setores de carnes no Brasil. Assim, reforça-se a importância e necessidade de um sistema público ativo para regulamentar e estabelecer padrões de segurança da carne no Brasil.

In situ rumen degradability characteristics of rice straw, soybean ...

African Journals Online (AJOL)

In situ rumen degradability characteristics of rice straw, soybean curd residue and peppermint (Mentha piperita) in Hanwoo steer (Bos Taurus coreanae). Byong Tae Jeon, KyoungHoon Kim, Sung Jin Kim, Na Yeon Kim, Jae Hyun Park, Dong Hyun Kim, Mi Rae Oh, Sang Ho Moon ...

Characterization and sequence analysis of cysteine and glycine-rich ...

African Journals Online (AJOL)

Primers specific for CSRP3 were designed using known cDNA sequences of Bos taurus published in database with different accession numbers. Polymerase chain reaction (PCR) was performed and products were purified and sequenced. Sequence analysis and alignment were carried out using CLUSTAL W (1.83).

Reproductive Performance And Superovulatory Response Of ...

African Journals Online (AJOL)

This study was undertaken to determine the reproductive performance of the endangered Bos-taurus Namshi breed of Cameroon. Ovarian response to superovulatory treatment was also evaluated. The following observations were recorded. The average calf mortality rate was 25.71% while the average birth weight was ...

Breed x sex effects on birth weight in Brahman-Simmental embryo transfer calves

Science.gov (United States)

Brahman cross calves exhibit unusual inheritance of birth weight: Brahman-sired crossbreds out of Bos taurus females are heavier with greater difference between sexes than calves of the reciprocal cross. The objective of this work was to compare birth weight in various crosses of Brahman, Simmenta...

Dicty_cDB: VHI816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHO717 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-12 AX882278_1( AX882278 |pid:none) Sequenc...e 17183 from Patent EP10746... 76 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

New insights on multiplicity and clustering in Taurus.

Science.gov (United States)

Joncour, Isabelle; Duchene, Gaspard; Moraux, Estelle; Mundy, Lee

2018-01-01

Multiplicity and clustering of young stars are critical clues to constraint star formation process. The Taurus molecular complex is the archetype of a quiescent star forming region that may retain primeval signature of star formation.Using statistical and clustering tools such as nearest neighbor statistics, correlation functions and the density-Based Spatial Clustering of Applications with Noise (DBSCAN) algorithm, this work reveals new spatial substructures in Taurus.We have identified unexpected ultra wide pairs (UWPs) candidates of high order multiplicity in Taurus in the 5-60 kAU separation range (Joncour et al 2017), beyond the separation assessed for wide pairs (Kraus & Hillenbrand 2009).Our work reveals 20 local stellar substructures, the Nested Elementary Structures (NESTs). These NESTs contain nearly half the stars of Taurus and 75% of the Class 0/I objects probing that they are the preferred sites of star formation (Joncour et al, sub.). The NESTs size ranges from few kAU up to 80 kAU making a length scale bridge between wide pairs and loose group (few hundreds kAU, Kirk & Myers, 2011). The NESTs mass ranges from 0.5-10 solar mass. The balance between Class I, II and III in NESTs suggests that they may be ordered as an evolutionary temporal scheme, some of them got infertile, while other shelter stars in infancy.The UWPs and the NESTs may be pristine imprints of their spatial configuration at birth. The UWPs population may result from a cascade fragmentation scenario of the natal molecular core. They could be the older counterparts, to the 0.5 Myr prestellar cores/Class 0 multiple objects observed at radio/millimeter wavelengths (Tobin et al 2010, 2016) and the precursors of the large number of UWPs (10–100 kAU) recently identified in older moving groups (Floriano-Alonso et al, 2015 ; Elliot et al 2016). The NESTs may result from the gravitational collapse of a gas clump that fragments to give a tight collection of stars within few millions years

Characterization of PRLR and PPARGC1A genes in buffalo (Bubalus bubalis

Directory of Open Access Journals (Sweden)

Ruheena Javed

2011-01-01

Full Text Available More than 40 million households in India depend at least partially on livestock production. Buffaloes are one of the major milk producers in India. The prolactin receptor (PRLR gene and peroxisome proliferators activated receptor-γ coactivator 1-alpha (PPARGC1A gene are reportedly associated with milk protein and milk fat yields in Bos taurus. In this study, we sequenced the PRLR and PPARGC1A genes in the water buffalo Bubalus bubalis. The PRLR and PPARGC1A genes coded for 581 and 819 amino acids, respectively. The B. bubalis PRLR gene differed from the corresponding Bos taurus at 21 positions and four differences with an additional arginine at position 620 in the PPARGC1A gene were found in the amino acid sequence. All of the changes were confirmed by cDNA sequencing. Twelve buffalo-specific single nucleotide polymorphisms (SNPs were identified in both genes, with five of them being non-synonymous.

Carne de consumo e risco de transmissão de Toxoplasma gondii

OpenAIRE

Rosado, Joana de Carvalho Serra

2009-01-01

O consumo de carne de suíno (Sus domesticus) é considerado o maior factor de risco para a transmissão da toxoplasmose aos humanos. No entanto, apesar dos suínos serem muito usados na gastronomia portuguesa, tanto pelo consumo de carne, como pelo de enchidos, pouco se sabe sobre a prevalência e caracterização genética de Toxoplasma gondii nestes produtos alimentares, no país. Neste trabalho, pretendeu-se determinar a seroprevalência de anticorpos IgG anti-T. gondii em suínos de ...

Uros, genética, indígenas y colonos. A propósito de la Neolitización de Europa

OpenAIRE

Alday, Alfonso .; Carretero, José Miguel; Anderung, Cecilia .; Götherström, Anders .

2012-01-01

Las analíticas genéticas realizadas sobre los uros (Bos primigenius) del yacimiento de Mendandia (Treviño), han ofrecido un resultado sorprendente: uno de los individuos pertenece al haplotypo T3, generalmente asociado a animales domésticos (Bos taurus). La datación de la muestra (7265 ± 70 BP; Ua 34366) es acorde con las otras conocidas de su nivel, el III-superior, incidiendo en la antigüedad de su Neolítico. El dato es la excusa para reflexionar sobre el proceso neolitizador y adentrarnos ...

Circumstellar disks around binary stars in Taurus

International Nuclear Information System (INIS)

Akeson, R. L.; Jensen, E. L. N.

2014-01-01

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Evaluation of indirect TaSP enzyme-linked immunosorbent assay for diagnosis of tropical theileriosis in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in Egypt.

Science.gov (United States)

Mohamed, Amr M; Abdel-Rady, Ahmed; Ahmed, Laila S; El-Hosary, Amira

2012-05-25

The aim of the present study was to evaluate the validity of Theileria annulata surface protein (TaSP)-ELISA, in comparison with traditional microscopic test, for the diagnosis of T. annulata infection among Egyptian baladi cattle (Bos taurus) and water buffaloes (Bubalus bubalis). Molecular confirmation of infection using T. annulata merozoite surface (Tams-1) target amplification by PCR was used as a gold standard. A total of 76 clinically suspected animals including 64 baladi cattle and 12 water buffaloes were investigated in the current study by the three methods. Based on the PCR-confirmed results, the evaluation study revealed higher sensitivity of TaSP-ELISA (72.9% and 75%) as compared to microscopic examination (58.3% and 50%) among cattle and buffaloes, respectively. On the other hand, the specificity of TaSP-ELISA in diagnosis of T. annulata infection was higher (87.5%) in baladi cattle as compared to water buffaloes (37.5%). In conclusion, TaSP-ELISA was shown to be suitable for the diagnosis of T. annulata infection in cattle under field conditions. Copyright © 2011 Elsevier B.V. All rights reserved.

AcEST: BP912479 [AcEST

Lifescience Database Archive (English)

Full Text Available |P81282|CSPG2_BOVIN Versican core protein OS=Bos taurus GN=VCA... 35 0.22 sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS...PSVNQRCLGG 325 + + + E+ KVPSV + G Sbjct: 2452 STTFVSD---RSLEKHPKVPSVEAVTVNG 2477 >sp|Q9Y2K

Morphological assessment of Niger Kuri cattle using multivariate ...

African Journals Online (AJOL)

This work confirms that at type trait level Kuri cattle is a unique population within the West African taurine cattle group. The implementation of genetic analyses aiming at ascertaining the degree of uniqueness of the breed is advised. Keywords: Body measurements, Bos taurus, multivariate analyses, qualitative traits, West ...

Livestock and elk grazing effects on stream morphology, brown trout population dynamics, movement, and growth rate, Valles Caldera National Preserve, New Mexico

Science.gov (United States)

Michael C. Anderson

2009-01-01

Ungulate grazing in riparian areas has been shown to detrimentally impact stream morphology and fish populations. Goals of this research were to assess changes in stream morphology and responses of a brown trout (Salmo trutta) population to exclusion of cattle (Bos taurus) and elk (Cervus elaphus) from riparian...

Chopped or long roughage: what do calves prefer? Using cross point analysis of double demand functions

NARCIS (Netherlands)

Webb, L.E.; Bak Jensen, M.; Engel, B.; Reenen, van C.G.; Gerrits, W.J.J.; Boer, de I.J.M.; Bokkers, E.A.M.

2014-01-01

The present study aimed to quantify calves'(Bos taurus) preference for long versus chopped hay and straw, and hay versus straw, using cross point analysis of double demand functions, in a context where energy intake was not a limiting factor. Nine calves, fed milk replacer and concentrate, were

Dicty_cDB: VHJ505 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available arcosine oxidase; S... 73 5e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 73 5e-...none) Homo sapiens full open reading fra... 72 9e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: AHA771 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 9e-13 AX882278_1( AX882278 |pid...:none) Sequence 17183 from Patent EP10746... 76 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHN454 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 93_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 72 2e-11 AX882278_1( AX882278 |pid:none) Seq...uence 17183 from Patent EP10746... 72 2e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHD308 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eroxisomal sarcosine oxidase; S... 75 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxid...7155 |pid:none) Homo sapiens full open reading fra... 75 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHK674 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 77 2e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...0746... 77 2e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 77 3e-13 CP001291_518

Dicty_cDB: VHQ355 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ens full open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... ... 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 7

Dicty_cDB: VHA709 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 A...X882278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 6e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Influence of cow breed type, age and previous lactation status on cow height, calf growth, and patterns of body weight, condition, and blood metabolites for cows grazing bahiagrass pastures.

Science.gov (United States)

Coleman, S W; Chase, C C; Riley, D G; Williams, M J

2017-01-01

This study was initiated to evaluate performance and patterns of cow traits and blood metabolites of 3 breeds of cows grazing bahiagrass (Paspalum notatum Flügge) pastures in central Florida. Purebred cows (n = 411) of either Angus (Bos taurus), Brahman (Bos indicus), or Romosinuano (Bos taurus) breeding, rotationally grazed (moved twice weekly) bahiagrass pastures year-round, and received bahiagrass hay supplemented with molasses and soyhulls or legume hay supplemented with unfortified molasses from October to June each production year. At monthly intervals, all cows were weighed, measured at the hip (HH), scored for BCS, and blood samples collected by jugular puncture from 10 cows per cow breed/block group for plasma urea N (PUN), glucose and non-esterified fatty acids (NEFA). Data were analyzed on cows that calved with a statistical model that included fixed effects of year, cowage, cow breed, month, block, supplement group (n = 2, but not presented), and whether the cow weaned a calf the previous year. Cow was a repeated observation over mo. Three-way interactions involving monthly patterns for cowage x year, year x lactation status the previous year, cowage × cow breed, year × cow breed, and cow breed × lactation status the previous year were significant (P cow breed × month was important (P cows compared to 3-yr old cows; 2) greater BW and BCS before calving for cows that did not lactate the previous year; 3) PUN levels were above 11 mg/dl except for February, August and September, and was generally greater in tropically adapted breeds; 4) GLU was greatest in Brahman, lowest in Angus, and intermediate in Romosinuano cows; and 5) plasma levels of NEFA escalated at calving and then declined, but Brahman cows maintained greater (P Cows that lactated the previous year had less NEFA than those that did not lactate. Brahman cows were less fertile than Bos taurus breeds, and weaned heavier calves.

Detection of Theileria annulata carriers in Holstein–Friesian (Bos taurus taurus) and Sistani (Bos taurus indicus) cattle breeds by polymerase chain reaction in Sistan region, Iran

OpenAIRE

Majidiani, Hamidreza; Nabavi, Reza; Ganjali, Maryam; Saadati, Dariush

2015-01-01

Theileria annulata is common in tropical and subtropical regions especially in Iran and causes great economic losses in cattle industry. In Iran the epidemiological aspects of bovine theileriosis in different breeds of cattle is poorly understood. The aim of present study is comparison of the number of T. annulata carriers in the two major cattle breeds (Holstein–Friesian and Sistani) in Sistan of Iran by giemsa and polymerase chain reaction (PCR) methods. During winter 2013, 160 native cattl...

Aminas bioativas e qualidade da carne de frangos de corte

Directory of Open Access Journals (Sweden)

D.C.S. Assis

2015-12-01

Full Text Available Com o objetivo de avaliar a qualidade da carne de frangos de corte mediante pesquisa dos níveis de aminas bioativas, foram coletadas, pelos serviços de inspeção oficiais, 160 amostras de carcaças provenientes de cinco regiões distintas do estado de Minas Gerais, durante o período de um ano. As poliaminas (espermidina e espermina e as aminas biogênicas (putrescina, cadaverina, histamina, tiramina foram pesquisadas por cromatografia líquida de alta eficiência e detecção ultravioleta (CLAE/UV. Os resultados encontrados demonstraram a presença das poliaminas, espermidina e espermina, em todas as amostras, em concentrações médias de 3,56mg/100g e 5,72mg/100g, respectivamente. Em todas as amostras foram detectadas, em concentrações muito baixas, as aminas putrescina, cadaverina, histamina e tiramina. Foi concluído que a carne de frangos de corte produzida no estado de Minas Gerais é uma fonte de poliaminas, importantes para o crescimento e a proliferação celular, e que os baixos teores de aminas biogênicas encontrados não representam riscos à saúde do consumidor, indicando que esse tipo de carne apresenta boa qualidade, tomando por base o critério de aminas bioativas.

Qualidade da carne maturada de ovelhas em sistema de embalagem a vácuo durante diferentes períodos de acondicionamento

OpenAIRE

Constantino, Camila; Universidade Estadual de Londrina; Ribeiro, Edson Luis de Azambuja; Universidade Estadual de Londrina; Bridi, Ana Maria; Universidade de Londrina; Tarsitano, Marina Avena; Universidade Estadual de Londrina; Koritiaki, Natália Albieri; Universidade Estadual de Londrina; Peres, Louise Manha; Universidade Estadual de Londrina; Mizubuti, Ivone Yurika; Universidade Estadual de Londrina; Pereira, Elzânia Sales; Universidade Federal do Ceará; Pimentel, Patrícia Guimarães; Universidade Federal do Ceará

2013-01-01

Os consumidores acreditam que a maciez é a característica organoléptica mais importante da carne. No entanto, há grande variabilidade na maciez da carne disponível para os consumidores, um método de reduzir a variabilidade e melhorar a maciez seria promover a maturação da carne. O objetivo deste estudo foi avaliar a qualidade da carne maturada de ovelhas. O experimento foi conduzido na Universidade Estadual de Londrina. Foram utilizadas 18 ovelhas da raça Santa Inês. Após o abate, o músculo L...

AN INFRARED/X-RAY SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Mamajek, E. E.; Cruz, K. L.

2009-01-01

We present the results of a search for new members of the Taurus star-forming region using data from the Spitzer Space Telescope and the XMM-Newton Observatory. We have obtained optical and near-infrared spectra of 44 sources that exhibit red Spitzer colors that are indicative of stars with circumstellar disks and 51 candidate young stars that were identified by Scelsi and coworkers using XMM-Newton. We also performed spectroscopy on four possible companions to members of Taurus that were reported by Kraus and Hillenbrand. Through these spectra, we have demonstrated the youth and membership of 41 sources, 10 of which were independently confirmed as young stars by Scelsi and coworkers. Five of the new Taurus members are likely to be brown dwarfs based on their late spectral types (>M6). One of the brown dwarfs has a spectral type of L0, making it the first known L-type member of Taurus and the least massive known member of the region (M ∼ 4-7 M Jup ). Another brown dwarf exhibits a flat infrared spectral energy distribution, which indicates that it could be in the protostellar class I stage (star+disk+envelope). Upon inspection of archival images from various observatories, we find that one of the new young stars has a large edge-on disk (r = 2.''5 = 350 AU). The scattered light from this disk has undergone significant variability on a timescale of days in optical images from the Canada-France-Hawaii Telescope. Using the updated census of Taurus, we have measured the initial mass function for the fields observed by XMM-Newton. The resulting mass function is similar to previous ones that we have reported for Taurus, showing a surplus of stars at spectral types of K7-M1 (0.6-0.8 M sun ) relative to other nearby star-forming regions, such as IC 348, Chamaeleon I, and the Orion Nebula Cluster.

Mercado consumidor de carne suína e derivados em Belo Horizonte

OpenAIRE

Faria,I.G.; Ferreira,J.M.; Garcia,S.K.

2006-01-01

Avaliou-se o comportamento do mercado consumidor de carne suína e seus derivados em Belo Horizonte. Foram entrevistados 401 consumidores, homens e mulheres, maiores de 19 anos de idade, mantendo-se a proporcionalidade observada no censo populacional. Além de sexo e faixa etária, escolaridade, ocupação e renda familiar foram levantadas para compor os fatores condicionantes da pesquisa. A carne suína in natura é consumida até três vezes por semana pela maioria da população (61,6%), em função de...

Star Formation in Taurus: Preliminary Results from 2MASS

Science.gov (United States)

Beichman, C. A.; Jarrett, T.

1993-01-01

Data with the 2MASS prototype camera were obtained in a 2.3 sq. deg region in Taurus containing Heiles Cloud 2, a region known from IRAS observations to contain a number of very young solar type stars.

THE SPITZER INFRARED SPECTROGRAPH SURVEY OF T TAURI STARS IN TAURUS

International Nuclear Information System (INIS)

Furlan, E.; Luhman, K. L.; Espaillat, C.

2011-01-01

We present 161 Spitzer Infrared Spectrograph (IRS) spectra of T Tauri stars and young brown dwarfs in the Taurus star-forming region. All of the targets were selected based on their infrared excess and are therefore surrounded by protoplanetary disks; they form the complete sample of all available IRS spectra of T Tauri stars with infrared excesses in Taurus. We also present the IRS spectra of seven Class 0/I objects in Taurus to complete the sample of available IRS spectra of protostars in Taurus. We use spectral indices that are not significantly affected by extinction to distinguish between envelope- and disk-dominated objects. Together with data from the literature, we construct spectral energy distributions for all objects in our sample. With spectral indices derived from the IRS spectra we infer disk properties such as dust settling and the presence of inner disk holes and gaps. We find a transitional disk frequency, which is based on objects with unusually large 13-31 μm spectral indices indicative of a wall surrounding an inner disk hole, of about 3%, and a frequency of about 20% for objects with unusually large 10 μm features, which could indicate disk gaps. The shape and strength of the 10 μm silicate emission feature suggests weaker 10 μm emission and more processed dust for very low mass objects and brown dwarfs (spectral types M6-M9). These objects also display weaker infrared excess emission from their disks, but do not appear to have more settled disks than their higher-mass counterparts. We find no difference for the spectral indices and properties of the dust between single and multiple systems.

Perfil lipídico da carne e gordura de suínos alimentados com milheto

Directory of Open Access Journals (Sweden)

Rodrigo Caetano de Abreu

2014-01-01

Full Text Available O objetivo deste trabalho foi avaliar níveis de milheto na alimentação de suínos na composição lipídica e de colesterol da gordura subcutânea e da carne. Foram utilizados 48 animais, machos castrados, distribuídos em um delineamento experimental de blocos casualizados, com quatro níveis de milheto na dieta (0; 25; 50 e 75%, seis repetições, sendo cada unidade experimental constituída por dois animais. Foram analisados os perfis lipídicos da gordura e da carne através de cromatografia gasosa e a quantidade de colesterol nas amostras de carne foi determinada seguindo a metodologia de extração. O aumento do nível de milheto na dieta dos suínos reduziu (P<0,05 a concentração dos ácidos mirístico, palmítico, palmitoleico, heptadecanoico e aumentou a concentração do ácido linoleico na gordura subcutânea. O nível de inclusão de 50,82% de milheto na dieta possibilita máxima deposição do ácido linolênico na gordura. Os níveis de milheto não modificam o perfil de ácidos graxos e o teor de colesterol na carne suína. O nível de 42,09% de inclusão de milheto na dieta resulta no maior índice trombogênico da carne.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.; Shukla, S. J.; Loutrel, N. P.

2017-01-01

Previous studies have found that ∼1 deg 2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg 2 ) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

Energy Technology Data Exchange (ETDEWEB)

Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E. [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States); Shukla, S. J. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Loutrel, N. P., E-mail: kluhman@astro.psu.edu [eXtreme Gravity Institute, Department of Physics, Montana State University, Bozeman, MT 59715 (United States)

2017-01-01

Previous studies have found that ∼1 deg{sup 2} fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg{sup 2}) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

Análisis sobre consumo de carne porcina en la Argentina : relevamiento sobre una población seleccionada

OpenAIRE

Marchese, Nicolás Gaspar; Alippe, María Victoria; Vieites, Carlos María; López, María Virginia; De Caro, Adriana E. J.

2002-01-01

p.179-184 La carne porcina es la de mayor consumo en el mundo; en la Argentina tiene baja incidencia en el consumo total de carnes, especialmente en estado fresco. Se carece de antecedentes publicados para determinar las causas culturales y/o de información que provocan este comportamiento. Se realizó una encuesta de opinión sobre preferencias en el consumo de carnes, utilizando el Muestreo Aleatorio Estratificado con muestras de la población de la Facultad de Agronomía (UBA). No se observ...

De prijsvorming van hout uit het Nederlandse bos

NARCIS (Netherlands)

Slangen, L.H.G.

1984-01-01

De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

Heterosis para pesos a los 18 meses y sacrificio en un hato cebú-cruzado.

Directory of Open Access Journals (Sweden)

Llano Arango Juan David

2003-12-01

Full Text Available El objetivo de la presente investigación fue evaluar comparativamente los pesos o los 18 meses y al sacrificio de machos cruzados ¼ , bos taurus (aberdeen angus. holstein, simmental americano, simmental alemán por cebú y animales brahman puros cebú comercial y mestizos.

AcEST: BP911627 [AcEST

Lifescience Database Archive (English)

Full Text Available 1-like protein OS=Bos taurus GN=TRM1L P... 30 5.0 sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolas...HVRRHVNKGETKSRYIAASAAKPPKE 233 >sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapie

Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

Natural selection has molded the evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically ad...

Natural (auto)antibodies in calves are affected by age and diet

NARCIS (Netherlands)

Khobondo, J.O.; Nieuwland, M.G.B.; Webb, L.E.; Bokkers, E.A.M.; Parmentier, H.K.

2015-01-01

Background: Natural autoantibodies (N(a)ab) were found in every species tested so far, and are likely important in maintaining homeostasis. Objectives: (1) To determine N(a)ab in Bos taurus calves, (2) evaluate effects of diet and age on N(a)ab binding repertoires in calves, and (3) delineate bovine

75 FR 43853 - Endangered and Threatened Wildlife and Plants; Final Rule to List the Medium Tree-Finch...

Science.gov (United States)

2010-07-27

... confirmation of the success of the goat eradication program, was provided by one peer reviewer and has been... habitat is unprotected. A large amount of the highlands has been cleared or altered for farming. Much of... animals include goats (Capra hircus), donkeys (Equus asinus), cattle (Bos taurus), and pigs (Sus scrofa...

Dicty_cDB: VHL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ing fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 AX882278_... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 8e-13 protein update 2009. 7.15 PSORT psg: 0.6

Dicty_cDB: VHN233 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHA135 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ll open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-... BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 6.26 PS

Dicty_cDB: VHM587 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHD682 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...id:none) Homo sapiens L-pipecolic acid oxid... 75 5e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from

Isolation and genetic diversity of endangered grey nurse shark (Carcharias taurus) populations.

Science.gov (United States)

Stow, Adam; Zenger, Kyall; Briscoe, David; Gillings, Michael; Peddemors, Victor; Otway, Nicholas; Harcourt, Robert

2006-06-22

Anthropogenic impacts are believed to be the primary threats to the eastern Australian population of grey nurse sharks (Carcharias taurus), which is listed as critically endangered, and the most threatened population globally. Analyses of 235 polymorphic amplified fragment length polymorphisms (AFLP) loci and 700 base pairs of mitochondrial DNA control region provide the first account of genetic variation and geographical partitioning (east and west coasts of Australia, South Africa) in C. taurus. Assignment tests, analysis of relatedness and Fst values all indicate that the Australian populations are isolated from South Africa, with negligible migration between the east and west Australian coasts. There are significant differences in levels of genetic variation among regions. Australian C. taurus, particularly the eastern population, has significantly less AFLP variation than the other sampling localities. Further, the eastern Australian sharks possess only a single mitochondrial haplotype, also suggesting a small number of founding individuals. Therefore, historical, rather than anthropogenic processes most likely account for their depauperate genetic variation. These findings have implications for the viability of the eastern Australian population of grey nurse sharks.

Circumstellar disks around binary stars in Taurus

Energy Technology Data Exchange (ETDEWEB)

Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

2014-03-20

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

Science.gov (United States)

Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

2015-07-04

Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

Demanda actual y potencial de la carne de conejo en el Municipio de Texcoco, Estado de México.

OpenAIRE

Rosas Peralta, Natividad

2013-01-01

La carne de conejo es un alimento sano para el consumo humano por su alto contenido proteico, bajo porcentaje de grasa y colesterol, es de fácil digestión, reducida en calorías, rica en vitaminas B y en minerales. El objetivo del presente estudio fue estimar la demanda actual y potencial de la carne de conejo en el municipio de Texcoco, estado de México. Se realizó un estudio por muestreo probabilístico en 105 hogares. Se estimó un modelo binario probit, en el cual, el consumo de carne de con...

Partial characterization of three β-defensin gene transcripts in river ...

African Journals Online (AJOL)

In this study, the tracheal tissues from Egyptian river buffalo and cattle were screened for the presence of three bovine β-defensin gene transcripts. Three primer pairs were designed on the basis of published Bos taurus sequences for partial amplification of β-defensin 4, β-defensin 10 and β-defensin 11 complementary DNA ...

Llllan, w. WAIBOCPH, Keith, T. BALLINGALI, Niall, n. MACHUGA ...

African Journals Online (AJOL)

African cattle are a hi ghly divergent population possibly due tointrogression by Asian Bos indicus Oiumped) cattle and more recently European B. taurus ... highly divergent Asian, African and European allelic families. This describes signiñcant allelic ..... J. Tïssue Culture Methods Il: 101. 13. Bembridge, G.P. Parsons, K,R., ...

Dicty_cDB: VHC115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 62 6e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...2 |pid:none) Synthetic construct Homo sapiens c... 60 3e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli

Dicty_cDB: VHM609 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...m Patent EP10746... 76 7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13

Dicty_cDB: VHB165 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |p...id:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHG519 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available L1... 69 8e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 69 8e-11 CR457155_1( CR...4593 |pid:none) Homo sapiens L-pipecolic acid oxid... 69 8e-11 protein update 2009. 7.12 PSORT psg: 0.67 gvh

Dicty_cDB: VHE245 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

Dicty_cDB: VHI596 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

Dicty_cDB: Contig-U06144-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens infertility-related s... 54 9e-06 AK057482_1( AK057482 |pid:none) Homo sapiens cDNA F... 7e-06 BC149464_1( BC149464 |pid:none) Bos taurus FK506 binding protein l... 54 7e-06 AF311312_1( AF311312 |

Dual Origins of Dairy Cattle Farming – Evidence from a Comprehensive Survey of European Y-Chromosomal Variation

DEFF Research Database (Denmark)

Edwards, Ceiridwen J; Genja, Catarina; Kantanen, Juha

2011-01-01

, with limited breed panels, identified two Bos taurus (taurine) haplogroups (Y1 and Y2; both composed of several haplotypes) and one Bos indicus (indicine/zebu) haplogroup (Y3), as well as a strong phylogeographic structuring of paternal lineages. Methodology and Principal Findings: Haplogroup data were......, the Nordic region and Russia, with the highest Ychromosomal diversity seen in the Iberian Peninsula. Conclusions: We propose that the homogeneous Y1 and Y2 regions reflect founder effects associated with the development and expansion of two groups of dairy cattle, the pied or red breeds from the North Sea...

Análise comparativa da competividade do Brasil e EUA no mercado internacional da carne bovina

Directory of Open Access Journals (Sweden)

Matheus Dhein Dill

2013-12-01

Full Text Available O Brasil e os EUA estão entre os principais produtores mundiais de carne bovina. Entretanto, distorções no mercado alimentar decorrentes da presença de barreiras comerciais podem comprometer a competitividade desses países. O objetivo deste trabalho foi verificar a competitividade da carne bovina brasileira e norte-americana, no mercado internacional, entre 1990 e 2008. Para isso, foi utilizado o Índice de Competitividade Revelada (CR para inferir sobre os efeitos que subsídios, acordos comercias e barreiras sanitárias exercem sobre a competitividade da carne bovina dos respectivos países. Os resultados indicaram que o Brasil obteve vantagens competitivas no período de 1991 a 2008, enquanto que os EUA apresentaram vantagens entre 1993 e 2003. Os acordos comerciais elevaram a competitividade dos países envolvidos, contudo ocorreram diminuições dos índices quando problemas sanitários foram identificados. Em suma, os EUA, mesmo com os altos subsídios fornecidos aos produtores rurais, apresentou desempenho inferior em comparação ao Brasil no mercado mundial da carne bovina.

A CONTRIBUIÇÃO DO GENE HALOTANO SOBRE AS CARACTERÍSTICAS DE QUALIDADE DA CARNE SUÍNA

Directory of Open Access Journals (Sweden)

Culau Paulete de Oliveira Vargas

2002-01-01

Full Text Available O objetivo deste trabalho foi o de avaliar o efeito do gene halotano sobre as características de qualidade da carne suína. Foram utilizadas 151 carcaças de suínos híbridos comerciais, sendo 93 carcaças com genótipo halotano normal (HalNN, 51 heterozigotos (HalNn e 7 recessivas (Hal nn. As medidas efetuadas foram: espessura de toucinho e de músculo, percentagem de carne, peso da carcaça, pH aos 45 minutos e 24 horas após o abate, no músculo Longissimus dorsi, cor, perda de líquido por gotejamento e identificação do genótipo halotano em amostras de gordura através de PCR-RFLP. Suínos HalNn apresentaram maior espessura de músculo e percentagem de carne do que os suínos HalNN. Houve diferença significativa entre suínos HalNn e HalNN quanto ao pH inicial e à cor . Em relação à espessura de toucinho, pH final e perda de líquido, não houve diferença significativa entre os genótipos. A qualidade da carne de suínos HalNn foi inferior à de suínos HalNN, em termos de pH e cor. A qualidade da carcaça de suínos HalNn não se mostrou melhor do que a dos suínos Hal nn, em relação à espessura de toucinho e músculo e à percentagem de carne. A relação entre quantidade e qualidade da carne parece depender da presença do gene halotano.

Cultura y poder: el consumo de carne bovina en Colombia

Directory of Open Access Journals (Sweden)

Íngrid Johanna Bolívar

2005-04-01

Full Text Available El artículo presenta líneas de indagación para comprender cómo se construyó el consumo de carne de res como una práctica hegemónica en Colombia, especialmente en la primera mitad del siglo XX. El texto insiste en la necesidad de situar las preguntas por el consumo en un mapa amplio que permita ir más allá de las explicaciones económicas para entender las distintas racionalidades sociales, culturales y políticas implícitas en los diversos usos del ganado. Además, sugiere que la evolución del consumo de carne es inseparable del desarrollo de la economía cafetera y es funcional a las formas de diferenciación territorial y social que la acompañan.

CULTURA Y PODER: EL CONSUMO DE CARNE BOVINA EN COLOMBIA

Directory of Open Access Journals (Sweden)

Íngrid Johanna Bolívar

2005-01-01

Full Text Available El artículo presenta líneas de indagación para comprender cómo se construyó el consumo de carne de res como una práctica hegemónica en Colombia, especialmente en la primera mitad del siglo XX. El texto insiste en la necesidad de situar las preguntas por el consumo en un mapa amplio que permita ir más allá de las explicaciones económicas para entender las distintas racionalidades sociales, culturales y políticas implícitas en los diversos usos del ganado. Además, sugiere que la evolución del consumo de carne es inseparable del desarrollo de la economía cafetera y es funcional a las formas de diferenciación territorial y social que la acompañan.

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

International Nuclear Information System (INIS)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

2016-01-01

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

Energy Technology Data Exchange (ETDEWEB)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

2016-06-15

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

Estudio del consumo de la carne de cerdo en la zona metropolitana del Valle de México

Directory of Open Access Journals (Sweden)

Guillermo Felipe Cortés Tinoco

2012-01-01

distribución X2. Se levantó una encuesta semiestructurada aplicada a 440 individuos. Entre los principales resultados se encontró que el ingreso y consumo bajos están correlacionados positivamente con los tipos de cortes de carne, frescura del producto, lugar de venta y cantidad de cortes adquiridos. La variable sin relación significativa con el consumo e ingreso fue el número de servicios agregados a la carne. Se concluye que los consumidores con ingresos bajos y medios demandan cortes populares (chuleta, bistec, espinazo, maciza, pierna y otras piezas. Consumen principalmente carne fresca (caliente y la adquieren en mercados públicos y carnicerías de barrio.

Far-infrared investigation of the Taurus star-forming region using the IRAS database

International Nuclear Information System (INIS)

Hughes, J.D.

1986-01-01

The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

In silico study of protein to protein interaction analysis of AMP-activated protein kinase and mitochondrial activity in three different farm animal species

Science.gov (United States)

Prastowo, S.; Widyas, N.

2018-03-01

AMP-activated protein kinase (AMPK) is cellular energy censor which works based on ATP and AMP concentration. This protein interacts with mitochondria in determine its activity to generate energy for cell metabolism purposes. For that, this paper aims to compare the protein to protein interaction of AMPK and mitochondrial activity genes in the metabolism of known animal farm (domesticated) that are cattle (Bos taurus), pig (Sus scrofa) and chicken (Gallus gallus). In silico study was done using STRING V.10 as prominent protein interaction database, followed with biological function comparison in KEGG PATHWAY database. Set of genes (12 in total) were used as input analysis that are PRKAA1, PRKAA2, PRKAB1, PRKAB2, PRKAG1, PRKAG2, PRKAG3, PPARGC1, ACC, CPT1B, NRF2 and SOD. The first 7 genes belong to gene in AMPK family, while the last 5 belong to mitochondrial activity genes. The protein interaction result shows 11, 8 and 5 metabolism pathways in Bos taurus, Sus scrofa and Gallus gallus, respectively. The top pathway in Bos taurus is AMPK signaling pathway (10 genes), Sus scrofa is Adipocytokine signaling pathway (8 genes) and Gallus gallus is FoxO signaling pathway (5 genes). Moreover, the common pathways found in those 3 species are Adipocytokine signaling pathway, Insulin signaling pathway and FoxO signaling pathway. Genes clustered in Adipocytokine and Insulin signaling pathway are PRKAA2, PPARGC1A, PRKAB1 and PRKAG2. While, in FoxO signaling pathway are PRKAA2, PRKAB1, PRKAG2. According to that, we found PRKAA2, PRKAB1 and PRKAG2 are the common genes. Based on the bioinformatics analysis, we can demonstrate that protein to protein interaction shows distinct different of metabolism in different species. However, further validation is needed to give a clear explanation.

Cattle grazing in semiarid forestlands: Habitat selection during periods of drought

Science.gov (United States)

C. L. Roever; T. DelCurto; M. Rowland; M. Vavra; M. Wisdom

2015-01-01

Climate change models are predicting increased frequency and severity of droughts in arid and semiarid environments, and these areas are responsible for much of the world’s livestock production. Because cattle (Bos Taurus) grazing can impact the abundance, distribution, and ecological function of native plant and animal communities, it is important...

Sire breed and breed genotype of dam effects in crossbreeding beef ...

African Journals Online (AJOL)

Cows bred to Afrikaner bulls were less (P < 0.05) productive than cows bred to other Bos taurus sires. An increase in proportion Afrikaner breeding in dam resulted in longer calving intervals and a decline in cow productivity, but these differences were not always significant. A breeding strategy for the retainment of superior ...

Dicty_cDB: SHD834 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available reading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX88...2278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHN139 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX8822...78_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHP888 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ng fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1...( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

El PRT-La Verdad entre los trabajadores de la carne de Berisso: La agrupación El Activista de la Carne y la Lista Gris [1967-1972

Directory of Open Access Journals (Sweden)

Christian Carlos Hernán Castillo

2011-10-01

Full Text Available This article is part of a research about the working class and students struggles and the strategies of the left parties in La Plata city and Gran La Plata between 1966 and 1973. This work is focused on the study of the political activity of the PRT-La Verdad during this period. At the beginning of 1968 the Partido Revolucionario de los Trabajadores -PRT split in two fractions. The fraction led by Nahuel Moreno -named PRT-La Verdad [PRT- The Truth]- was the largest of the two in La Plata y Gran La Plata. In this area the PRT had many members among the students and in the workers movement. This article studies the political activity of the PRT, and the PRT-LV after the split- in the Sindicato de Obreros y Empleados de la Industria de la Carne y Afines de Berisso [Meat Processing Plants Workers Union], between 1967 and 1972 at the Swift and Armour meat processing plants. During the period analyzed in the article, the members and supporters of the PRT-LV were organized in a rank and file union group named El Activista de la Carne - Lista Gris [The Activist-Gray List]. The sources of this research are the bulletins and leaflets edited by El Activista de la Carne. We also consulted the files of DIPBA as well as the bibliography on the subject

Medições instrumentais e sensoriais de dureza e suculência na carne caprina

OpenAIRE

Borges,Ângela da Silva; Zapata,Jorge Fernando Fuentes; Garruti,Deborah dos Santos; Rodrigues,Maria do Carmo Passos; Freitas,Ednardo Rodrigues; Pereira,Ana Lucia Fernandes

2006-01-01

Foi avaliado o efeito do tipo de músculo e da maturação sobre algumas propriedades funcionais e sensoriais da carne caprina. Utilizaram-se os músculos longissimus dorsi, semimembranosus e biceps femoris de cabras com aproximadamente 20 meses de idade. A carne, sem maturar e maturada por sete dias, foi avaliada para perdas por cocção (PPC) e força de cisalhamento (FC), por métodos instrumentais, e para dureza sensorial (DS) e suculência sensorial (SS), por provadores treinados. As PPC não sofr...

Flares of Orion population variables in the association Taurus T3

International Nuclear Information System (INIS)

Khodzhaev, A.S.; AN Armyanskoj SSR, Byurakan. Astrofizicheskaya Observatoriya)

1987-01-01

Thirteen new flare stars, proved to be irregular variables of Orion Population, were discovered from a study of the Taurus Dark Cloud region by the homogeneous photographic multipose method on the wide angle Schmidt telescopes of the Byurakan Astorphysical Observatory. Seventeen flares on these stars were detected for about 750 hours of the effective observing time. The analysis of the complicated light curves of these flares shows a great variety and multiplicity of this phenomenon and various dynamics of flare energy release processes. The existence of flare stars with some properties typical for both of the T Tauri and UV Ceti stars simulteneously indicates nonstable stars. The population of flare stars in the Taurus Dark Cloud region is apparently as young as in Orion and Monoceros

El mecanismo de muerte celular programada y su importancia en el proceso de maduración de la carne bovina

Directory of Open Access Journals (Sweden)

Janeth Ortega Torres

2012-06-01

Full Text Available El objetivo de este artículo es presentar el mecanismo de muerte celular programada y las evidencias que apoyan su relación con el proceso de maduración de la carne bovina. La terneza de la carne bovina es quizá una de las características más importantes para los consumidores, pues hace de la carne un producto deseable en los mercados mundiales e influye en su precio y calidad. Estas características dependen de factores genéticos, nutricionales y ambientales. Aunque en Colombia aún no existe la cultura de la trazabilidad de los productos cárnicos en los supermercados, se prevé que en un futuro cercano aumente el número de consumidores en América Latina y que ellos tendrán también la posibilidad de exigir las mejores carnes. Descifrar los factores bioquímicos y moleculares que influyen en la maduración de la carne bovina es una tarea amplia que está en sus primeras etapas. Se han descifrado algunas vías implicadas, como la de la calpaína-calpastatina, la proteosómica y la de las catepsinas, proteínas que han sido reconocidas como de influencia positiva en el proceso de degradación de la fibra muscular durante su proceso de maduración. La conversión del músculo en carne es un proceso que comienza una vez el animal ha sido sacrificado y, por lo tanto, está asociado a los procesos de necrosis y muerte celular. En los últimos años muchos estudios se han orientado hacia la importancia y el aporte del mecanismo de muerte celular programada o apoptosis sobre la terneza de la carne.

Quality of wild boar meat and commercial pork Qualidade da carne de javali e de suíno comercial

Directory of Open Access Journals (Sweden)

Andréa Fernanda Marchiori

2003-02-01

Full Text Available Presently there is a growing interest in the production and marketing of wild boar meat, and to attend a differentiated consumer demand the quality attributes of this product should be well established. To characterize the quality of wild boar meat in comparison to commercial pork, post mortem changes in the longissimus dorsi and semimembranosus muscles were determined by pH and temperature decline, and color (CIE L*a*b* measurements. Water holding capacity (WHC was determined by the compression method and the exudate loss (EL by the drip loss test. Decline in longissimus dorsi muscle pH of wild boar was gradual and in the pork it was faster and more extensive. Temperature differences were observed in some post mortem times, and the lowest values were found in wild boar carcasses. Wild boar meat presented lower values of L* (brightness and b* (yellow color intensity, and higher values of a* (red color intensity than pork. The WHC of the wild boar meat was similar to pork, but the EL in female wild boar meat was lower than in pork.Atualmente existe no Brasil um interesse crescente na criação e exploração comercial da carne de javali e para atender a uma demanda diferenciada é importante que os atributos qualitativos do produto sejam bem estabelecidos. Com o objetivo de caracterizar a carne de javali nos parâmetros de qualidade e compará-la com a carne suína comercial, as mudanças nos músculos Longissimus dorsi e Semimembranosus, no post mortem, foram acompanhadas com medidas de pH, temperatura e cor (CIE L*a*b*. A capacidade de retenção de água (CRA foi determinada pelo método de compressão e a perda de exsudato (PE pelo teste de "drip loss". A queda de pH na carne de javali ocorreu de forma gradual, enquanto que no Longissimus dorsi de suíno a diminuição foi mais rápida e mais extensa. Diferenças de temperatura foram verificadas em alguns tempos post mortem, sendo que os menores valores foram encontrados nos javalis. A carne

The Taurus Boundary of Stellar/Substellar (TBOSS) Survey. II. Disk Masses from ALMA Continuum Observations

Science.gov (United States)

Ward-Duong, K.; Patience, J.; Bulger, J.; van der Plas, G.; Ménard, F.; Pinte, C.; Jackson, A. P.; Bryden, G.; Turner, N. J.; Harvey, P.; Hales, A.; De Rosa, R. J.

2018-02-01

We report 885 μm ALMA continuum flux densities for 24 Taurus members spanning the stellar/substellar boundary with spectral types from M4 to M7.75. Of the 24 systems, 22 are detected at levels ranging from 1.0 to 55.7 mJy. The two nondetections are transition disks, though other transition disks in the sample are detected. Converting ALMA continuum measurements to masses using standard scaling laws and radiative transfer modeling yields dust mass estimates ranging from ∼0.3 to 20 M ⊕. The dust mass shows a declining trend with central object mass when combined with results from submillimeter surveys of more massive Taurus members. The substellar disks appear as part of a continuous sequence and not a distinct population. Compared to older Upper Sco members with similar masses across the substellar limit, the Taurus disks are brighter and more massive. Both Taurus and Upper Sco populations are consistent with an approximately linear relationship in M dust to M star, although derived power-law slopes depend strongly upon choices of stellar evolutionary model and dust temperature relation. The median disk around early-M stars in Taurus contains a comparable amount of mass in small solids as the average amount of heavy elements in Kepler planetary systems on short-period orbits around M-dwarf stars, with an order of magnitude spread in disk dust mass about the median value. Assuming a gas-to-dust ratio of 100:1, only a small number of low-mass stars and brown dwarfs have a total disk mass amenable to giant planet formation, consistent with the low frequency of giant planets orbiting M dwarfs.

THE MAGNETIC FIELD IN TAURUS PROBED BY INFRARED POLARIZATION

International Nuclear Information System (INIS)

Chapman, Nicholas L.; Goldsmith, Paul F.; Pineda, Jorge L.; Li Di; Clemens, D. P.; Krco, Marko

2011-01-01

We present maps of the plane-of-sky magnetic field within two regions of the Taurus molecular cloud: one in the dense core L1495/B213 filament and the other in a diffuse region to the west. The field is measured from the polarization of background starlight seen through the cloud. In total, we measured 287 high-quality near-infrared polarization vectors in these regions. In L1495/B213, the percent polarization increases with column density up to A V ∼ 9 mag, the limits of our data. The radiative torques model for grain alignment can explain this behavior, but models that invoke turbulence are inconsistent with the data. We also combine our data with published optical and near-infrared polarization measurements in Taurus. Using this large sample, we estimate the strength of the plane-of-sky component of the magnetic field in nine subregions. This estimation is done with two different techniques that use the observed dispersion in polarization angles. Our values range from 5 to 82 μG and tend to be higher in denser regions. In all subregions, the critical index of the mass-to-magnetic flux ratio is sub-unity, implying that Taurus is magnetically supported on large scales (∼2 pc). Within the region observed, the B213 filament takes a sharp turn to the north and the direction of the magnetic field also takes a sharp turn, switching from being perpendicular to the filament to becoming parallel. This behavior can be understood if we are observing the rim of a bubble. We argue that it has resulted from a supernova remnant associated with a recently discovered nearby gamma-ray pulsar.

Arabidopsis CDS blastp result: AK104406 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 7e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK106125 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK067330 [KOME

Lifescience Database Archive (English)

Full Text Available eductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mort...ality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ...

Arabidopsis CDS blastp result: AK068639 [KOME

Lifescience Database Archive (English)

Full Text Available eductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mort...ality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 1e-17 ...

Arabidopsis CDS blastp result: AK104937 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK104294 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Dicty_cDB: VFI871 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available m... 477 e-133 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia, adrenoco...7671 |pid:none) Danio rerio achalasia, adrenocorti... 82 4e-14 BC120418_1( BC120418 |pid:none) Bos taurus achalasia...e-13 AK222509_1( AK222509 |pid:none) Homo sapiens mRNA for achalasia, a... 79 3e-

The influence of loss and gain of body mass on ovarian activity in ...

African Journals Online (AJOL)

Ovarian activity was studied in 36 dry, Bos taurus cows fed to achieve different rates of body mass loss and gain in a 2 x 2 factorial experiment. Cows were fed hay to supply either 70% (Treatments 1, 2) or 40% (Treatments. 3,4) of their ME requirements for maintenance until they became anoestrus. Following a 90-day ...

Dicty_cDB: VHH128 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pen reading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 A...X882278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHN847 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 72 1e-11 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 72 2e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecol..._1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 71 3e-11 AX882278_1( AX882278 |pid:none) Seque

Hair shedding score may affect body temperature more than hair coat color during heat stress in weaned beef heifers.

Science.gov (United States)

The objective of this study was to evaluate the effect of hair shedding score and hair coat color on the vaginal temperature (VT) of calves during heat stress. Weaned Bos taurus beef heifers (n = 32; BW = 282 ± 6.4 kg) were assigned to a hair coat color class (BLACK; RED; or LIGHT, where LIGHT = yel...

Contenido de ácidos grasos en carne de cuy

Directory of Open Access Journals (Sweden)

César Iván Flores-Mancheno

2015-07-01

Full Text Available El objetivo del estudio fue determinar la composición de ácidos grasos en carne de cuy. El trabajo se desarrolló en la ciudad de Riobamba (Ecuador, y las líneas de cuyes utilizadas fueron tres: Criolla, Andina y Peruana mejorada. Se realizó análisis de varianza para las diferencias, comparación de medias según Duncan (p < 0.05. El contenido total de ácidos grasos saturados en la carne de este roedor no registró diferencias estadísticas entre las líneas estudiadas, ya que presentaron valores de 37,11, 37,01 y 36,71%, para cuyes Criollo, Andino y Peruano mejorado, respectivamente; igualmente, el contenido de ácidos monoinsaturados tampoco registró diferencias estadísticas entre las tres líneas, pues se reportaron niveles de 30,49, 29,26 y 31,44%, ni los niveles de ácidos grasos poliinsaturados, que fueron de 13,30, 11,04 y 14,22%.

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Daemgen, Sebastian; Bonavita, Mariangela; Jayawardhana, Ray; Lafrenière, David; Janson, Markus

2015-01-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M ☉ and low-mass stars at ∼0.2 M ☉ . We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M Jup . The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3 −4.9 +6.6 %. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M ☉ appear to be multiple. Higher order multiples were found in 1.8 −1.5 +4.2 % of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

Energy Technology Data Exchange (ETDEWEB)

Daemgen, Sebastian [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5H 3H4 (Canada); Bonavita, Mariangela [The University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Jayawardhana, Ray [Physics and Astronomy, York University, Toronto, Ontario L3T 3R1 (Canada); Lafrenière, David [Department of Physics, University of Montréal, Montréal, QC (Canada); Janson, Markus, E-mail: daemgen@astro.utoronto.ca [Department of Astronomy, Stockholm University, Stockholm (Sweden)

2015-02-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M {sub ☉} and low-mass stars at ∼0.2 M {sub ☉}. We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M {sub Jup}. The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3{sub −4.9}{sup +6.6}%. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M {sub ☉} appear to be multiple. Higher order multiples were found in 1.8{sub −1.5}{sup +4.2}% of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively.

Recent TAURUS results on Hα velocities in M83

International Nuclear Information System (INIS)

Allen, R.J.; Atherton, P.D.; Oosterloo, T.A.

1983-01-01

Preliminary Hα observations with the TAURUS imaging spectrometer confirm a pattern of systematic radial motions in a section of spiral arm in M83. The velocity gradients are not consistent with those predicted for the neutral gas. Non-circular motions have also been discovered in the central regions of the galaxy. (Auth.)

Desempenho e qualidade da carne de bovinos cruzados alimentados com diferentes dietas em confinamento

OpenAIRE

Silva, Maria Lígia Pacheco da [UNESP

2016-01-01

Com a alta demanda mundial de carne de qualidade, a utilização de cruzamento entre raças e de dieta com teores elevados de energia são estratégias que podem ser utilizadas visando à melhorias na eficiência do sistema de produção de carne bovina e na qualidade do produto final. Assim, o objetivo neste trabalho foi avaliar o desempenho (pesos, ganhos em peso, consumo de matéria seca, eficiência alimentar e dias em confinamento), características de carcaça (peso e rendimento de carcaça fri...

Gastrointestinal Strongyle Egg Output and its Relationship with Tick Burden in Gambian N'dama and Gobra Zebu Cattle

Directory of Open Access Journals (Sweden)

Mattioli, RC.

1995-01-01

Full Text Available Fortnightly quantitative analysis of rectal faecal samples for the presence of strongyle eggs were carried out from May 1992 to April 1993 on 11 Gambian N'dama Bos taurus and 11 Gobra zebu Bos indicus cattle. Significantly (P <0.001 lower strongyle egg outputs were found in N'dama in comparison with zebu cattle. No correlation was found between individual cumulative tick burden and strongyle egg output in either breed, although individual variations in parasite burdens were lower in N'dama than in zebu cattle. This study strenghtens the evidence for the presence of a natural resistant trait to strongyle infection in N'dama cattle.

Ford Taurus Ethanol-Fueled Sedan

International Nuclear Information System (INIS)

Eudy, Leslie

1999-01-01

The U.S. Department of Energy (DOE) is encouraging the use of alternative fuels and alternative fuel vehicles (AFVs). To support this activity, DOE has directed the National Renewable Energy Laboratory (NREL) to conduct projects to evaluate the performance and acceptability of light-duty AFVs. In this study, we tested a pair of 1998 Ford Tauruses: one E85 (85% gasoline/15% ethanol) model (which was tested on both E85 and gasoline) and a gasoline model as closely matched as possible. Each vehicle was run through a series of tests to evaluate acceleration, fuel economy, braking, and cold-start capabilities, as well as more subjective performance indicators such as handling, climate control, and noise

Análise comparativa da competividade do Brasil e EUA no mercado internacional da carne bovina

OpenAIRE

Matheus Dhein Dill; Vitor Francisco Dalla Corte; Júlio Otávio Jardim Barcellos; Maria Eugênia Andrighetto Canozzi; Tamara Esteves de Oliveira

2013-01-01

O Brasil e os EUA estão entre os principais produtores mundiais de carne bovina. Entretanto, distorções no mercado alimentar decorrentes da presença de barreiras comerciais podem comprometer a competitividade desses países. O objetivo deste trabalho foi verificar a competitividade da carne bovina brasileira e norte-americana, no mercado internacional, entre 1990 e 2008. Para isso, foi utilizado o Índice de Competitividade Revelada (CR) para inferir sobre os efeitos que subsídios, acordos come...

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with Ca II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-01-01

Radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren 'HVR', (1986) are reported. Most of the velocities are determined to better than 2 km/s precision. The kinematic properties of the Ca II emission stars with strong Li are found to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. It is suggested following Jones and Herbig (1979), that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with CA II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-04-01

The authors report radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren (HVR). Most of the velocities are determined to better than 2 km s-1 precision. The authors find the kinematic properties of the Ca II emission stars with strong Li to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. The authors suggest, following Jones and Herbig, that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Infrared spectroscopy of dust in the Taurus dark clouds: solid carbon monoxide

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1989-01-01

Spectra centred on the spectral feature of solid CO at 4.67 μm wavelength are presented for eight stars in or behind the quiescent dark cloud complex in Taurus. The solid CO profile is dominated by a sharp component centred at 4.673 μm (2140 cm -1 ). As in previous observations of the feature, asymmetry in the profile is consistent with the presence of a weaker, somewhat broader, overlapping component centred at ∼ 4.682 μm (2136 cm -1 ). New and previously published data for Taurus stars are combined to study the correlation of the peak optical depth in the CO feature with visual extinction and with the depth of the water-ice feature at 3.0 μm. (author)

Potencial ganadero de Colombia para exportar cortes finos de carne de bovino a la Unión Europea

Directory of Open Access Journals (Sweden)

Michael López-Cepeda

2012-07-01

Full Text Available Factores globales como el crecimiento sostenidon poblacional, el aumento de la demanda mundial de alimentos –particularmente de carne de res– y las restricciones productivas, por la estacionalidad climática, en algunos países del cono sur, como Argentina, Uruguay y Paraguay, hacen prever el aumento de la oferta cárnica bovina de Colombia; sin embargo, esto no es suficiente para que Colombia sea aceptado por la Unión Europea (UE como proveedor internacional de carnes especializadas y de alto valor agregado. En la actualidad, es necesario adoptar medidas que busquen mejorar la competitividad, incrementar los estándares de consumo del mercado interno, promover sistemas productivos alternativos (silvopastoriles, mejorar y mantener el estatus sanitario, garantizar la calidad y consistencia de la oferta de ganados, aplicar prácticas que garanticen el bienestar animal, implementar adecuadamente la trazabilidad, y garantizar la inocuidad, para que finalmente el país obtenga la distinción internacional de productor de carnes limpias, biológicas, orgánicas y de alto valor agregado, mejorando así la rentabilidad del negocio cárnico nacional en cada uno de sus eslabones. Para lograr lo anterior, se busca entender, apropiar y aplicar alternativas comerciales para exportar carne de res a la UE, como la Cuota Hilton, un cupo de aproximadamente 60.250 toneladas de cortes finos de carne de res, con sus respectivas especificaciones, destinado a aquellos países con condiciones productivas y de transformación cárnica como Colombia. La investigación que aquí se presenta buscó diagnosticar la implementación de un modelo comercial para la exportación de cortes finos de carne bovina a la Unión Europea.

Carnes PSE (pale, soft, exudative) e análogo ao DFD (dark, firm, dry) de frango em embutido cárneos

OpenAIRE

Daryne Lu Maldonado Gomes da Costa

2008-01-01

O crescente consumo mundial de carne de frango e produtos processados, fez aumentar a preocupação com a qualidade da carne fresca, consequentemente anormalidades relacionadas a cor, como o PSE (Pale, Soft, Exudative) e análogo ao DFD (Dark, Firm, Dry) ganharam a sua devida importância. O objetivo deste trabalho foi investigar a influência da utilização de carnes PSE e análogo ao DFD (a-DFD) como matéria-prima para elaboração de embutidos cárneos. Os filés foram coletados e analisados 24h post...

QTL-Kartierung und funktionelle Kandidatengenanalyse für das Merkmal Totgeburt in einer fortgeschrittenen Fleckvieh- x Red-Holstein-Rückkreuzungspopulation

OpenAIRE

Gomeringer, Verena

2007-01-01

Das Ziel dieser Arbeit war die Kartierung eines QTL mit Effekt auf paternalen Kalbeverlauf und paternale Totgeburt auf Bos Taurus Autosom 9 (BTA09) in einer fortgeschrittenen Fleckvieh x Red-Holstein Rückkreuzungspopulation mit positioneller und funktioneller Kandidatengenanalyse. Dazu wurden Untersuchungen mit verschiedenen Kartierungsdesigns in Granddaughter und Daughter Designs durchgeführt. Intervallkartierung und Linkage / Linkage-Disequilibrium-Kartierung wurden verwendet um den QTL ...

SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: II - ACIDOSE METABÓLICAE METABOLIZAÇÃO DO LACTATO-L SUSCEPTIBILITY OF JERSEY AND GIR STEERS TO RUMEN LACTIC ACIDOSIS: II - METABOLIC ACIDOSIS AND L-LACTATE METABOLISM

Directory of Open Access Journals (Sweden)

Celso Akio Maruta

2002-02-01

Full Text Available Quatro garrotes Jersey (J (Bos taurus e quatro Gir (G (Bos indicus foram utilizados para comparar a susceptibilidade de zebuínos e taurinos à acidose láctica ruminal (ALR. Neste trabalho, acompanhou-se o grau da acidose metabólica (AM e a metabolização do lactato-L. A ALR foi induzida com a administração de sacarose intraruminal. Amostras de sangue foram colhidas nos seguintes momentos: zero, 14, 16, 18, 20, 22 e 24 horas. Foram determinadas as concentrações de lactato total, de seus isômeros L e D e o perfil hemogasométrico. Nos momentos mais críticos observados (14ªh a 18ªh, a AM foi severa em ambas as raças, porém, ao término do experimento, esta passou a grau moderado nos garrotes G, mantendo-se severa nos J. Os animais J absorveram, do rúmen, maiores quantidades de lactato-D, o qual apresentou correlação negativa com o pH sangüíneo (r = - 0,78. Por outro lado, o lactato-L foi mais absorvido e utilizado nos bovinos G, contribuindo para a restauração parcial do equilíbrio ácido-básico e gerando alterações nas pCO2 e pO2. Os garrotes zebuínos da raça Gir apresentaram menor susceptibilidade à AM que os taurinos da raça Jersey.In order to compare the susceptibility to acute rumen lactic acidosis (RLA, four Jersey (J (Bos taurus and four Gir (G (Bos indicus steers were used to evaluate the degree of metabolic acidosis (MA and the metabolism of L-lactate during the RLA. The RLA was induced by the administration of sucrose into the rumen. Blood samples were collected at following times: zero, 14th,16th, 18th, 20th, 22nd and 24th h. Total lactic acid and its isomers, and blood gas determination were measured. At the most critical moments (14th to 18th h the MA was severe in both breeds, but the MA became moderate in the G steers and remained severe in the J steers at the end of the trial. Higher amounts of D-lactate was absorbed from the rumen to the blood of the J steers; the higher the D-lactate plasma level, the

Using binary statistics in Taurus-Auriga to distinguish between brown dwarf formation processes

Science.gov (United States)

Marks, M.; Martín, E. L.; Béjar, V. J. S.; Lodieu, N.; Kroupa, P.; Manjavacas, E.; Thies, I.; Rebolo López, R.; Velasco, S.

2017-08-01

Context. One of the key questions of the star formation problem is whether brown dwarfs (BDs) form in the manner of stars directly from the gravitational collapse of a molecular cloud core (star-like) or whether BDs and some very low-mass stars (VLMSs) constitute a separate population that forms alongside stars comparable to the population of planets, for example through circumstellar disk (peripheral) fragmentation. Aims: For young stars in Taurus-Auriga the binary fraction has been shown to be large with little dependence on primary mass above ≈ 0.2 M⊙, while for BDs the binary fraction is computations. A small amount of dynamical processing of the stellar component was accounted for as appropriate for the low-density Taurus-Auriga embedded clusters. Results: The binary fraction declines strongly in the transition region between star-like and peripheral formation, exhibiting characteristic features. The location of these features and the steepness of this trend depend on the mass limits for star-like and peripheral formation. Such a trend might be unique to low density regions, such as Taurus, which host binary populations that are largely unprocessed dynamically in which the binary fraction is large for stars down to M-dwarfs and small for BDs. Conclusions: The existence of a strong decline in the binary fraction - primary mass diagram will become verifiable in future surveys on BD and VLMS binarity in the Taurus-Auriga star-forming region. The binary fraction - primary mass diagram is a diagnostic of the (non-)continuity of star formation along the mass scale, the separateness of the stellar and BD populations, and the dominant formation channel for BDs and BD binaries in regions of low stellar density hosting dynamically unprocessed populations.

EFECTO REOLÓGICO DE HIDROCOLOIDES SOBRE LA SALMUERA DE MARINADO DE CARNE BOVINA EFEITO REOLÓGICO DE HIDROCOLOIDES NA SALMOURA DE MARINADO DE CARNE BOVINA EFFECT OF HYDROCOLLOIDS ON RHEOLOGICAL BRINE MARINATED MEAT

Directory of Open Access Journals (Sweden)

YOMAIRA TAPASCO Z

2011-12-01

Full Text Available En algunos países la práctica del marinado en carnes ha sido convertida en práctica rutinaria, sin embargo las pérdidas por cocción son considerables. El objetivo de esta investigación fue valorar el comportamiento tixotrópico de hidrocoloides como agentes espesantes en la salmuera utilizada para el marinado de carnes. Los hidrocoloides utilizados fueron: xantan, guar y carragenina I; Inicialmente fue propuesto un diseño de mezclas para elegir la mejor mezcla de hidrocoloides. Posteriormente fue evaluado el efecto que sobre la tixotropía presentó la mezcla óptima de hidrocoloides incluidas en una salmuera estándar para marinado de carnes rojas. La mezcla óptima de hidrocoloides encontrada fue de 87% de xantan y 13% de carragenina, utilizada en la salmuera en tres concentraciones 0,5%, 1,0% y 7,5%. Esta salmuera fue utilizada para marinar muestras de carne bovina de músculo semitendinoso. Las muestras de los tratamientos fueron refrigeradas en cava durante 3 días. Fueron determinadas pérdidas de peso antes y después de cocción a80°C de temperatura interna y realizados los análisis de perfil de textura. Los resultados indican que la mejor concentración de hidrocoloides fue para el tratamiento con 1,5%. Solamente fue encontrada diferencia significativa (pEm alguns países, a pràtica de carnes marinadas transformou-se em pràtica rotineira, entretanto as perdas de cozimento são consideráveis. 0 objetivo desta pesquisa foi avallar o comportamento tixotrópico de très hidrocolóides como espessantes na salmoura usado para marinara carne. Os hidrocolóides utilizados foram: goma xantana, goma guar e goma carragena I, foi inicialmente proposto um projeto de mistura de escolhera melhor combinaçáo de hidrocolóides. Foi entáo avallado o efeito da tixotropia que apresentou a mistura ideal de hidrocolóides incluídos em urna salmoura carnes marinadas. A combinaçáo óptima de hidrocolóides encontrada foi de 87% e 13% xantana e

VALIDACIÓN DE PCR PARA DETECCIÓN DE Listeria monocytogenes EN CARNES CRUDAS DE RES Y POLLO

Directory of Open Access Journals (Sweden)

Kirvis Torres

2004-12-01

Full Text Available Listeria monocytogenes es un microorganismo zoonótico emergente en la industria de alimentos, resultando degran interés para la salud pública. El objetivo de este trabajo fue validar la técnica de PCR para la detecciónde este microorganismo en carnes crudas de res y pollo. El procedimiento de extracción de ADN fue realizadocon lisozima, proteinasa K y fenol-cloroformo a partir de muestras contaminadas artificialmente. La especificidadde los cebadores LI1 y U1 fue comprobada por la amplificación de una banda de 938pb correspondiente a unfragmento del ADNr 16S; de igual manera los cebadores LF y LR amplificaron una banda del gen hlyA de750pb; lo que permitió la identificación de género (banda 938pb y especie (banda de 750pb respectivamente.Las cepas de los otros géneros bacterianos ensayados no amplificaron ninguna de las bandas específicas. Ellímite de detección para la PCR fue de 102 y 104 UFC/gr para carnes de res y pollo respectivamente; el «GoldStandard» reportó 102 UFC/ml para ambos alimentos. La comparación de la PCR vs., el método «Gold Standard»reportó en carne de pollo una concordancia observada de 98.43%, una sensibilidad del 96.9%, una especificidadde 100%, un valor predictivo positivo del 100% y un valor predictivo negativo del 97%; para la carne de restodos los parámetros anteriores fueron del 100%. Estos resultados demostraron la factibilidad de la PCR parael control de calidad de carnes crudas de res y pollo.

Ratio of total-to-selective extinction in the Taurus dark cloud complex

International Nuclear Information System (INIS)

Vrba, F.J.; Rydgren, A.E.; Space Telescope Science Institute, Baltimore, MD)

1985-01-01

UBVRI and JHK photometry, as well as spectral classifications are presented for seven reddened early-type field stars that are observed through the Taurus dark cloud complex. The ratio of total-to-selective extinction is derived for each star by the color-difference method. For six stars with absolute magnitudes in violet of more than 1.7 and less than 3.2 mag, a normal ratio R of total-to-selective extinction of about 3.1 is found. The mildly anomalous R value of about 3.5 for the well-studied star HD 29647 was also confirmed. The results provide further evidence that the interstellar extinction law in the Taurus dark cloud complex is basically normal for lines of sight with absolute magnitudes in violet of less than 3 mag. 24 references

Breeding programs for the main economically important traits of zebu dairy cattle

Directory of Open Access Journals (Sweden)

Ariosto Ardila Silva

2010-06-01

Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

Effect of heat stress on rumen temperature of three breeds of cattle

Science.gov (United States)

Lees, A. M.; Lees, J. C.; Lisle, A. T.; Sullivan, M. L.; Gaughan, J. B.

2018-02-01

Thirty-six steers (12 of each Angus, Charolais, and Brahman) with an initial BW of 318.5 ± 6.7 kg were used in a 130-day study. Two treatments were imposed: un-shaded and shaded (3 m2/animal; 90% solar block shade cloth). On day 1, steers were administered with rumen temperature boluses. Rumen temperatures ( T RUM) were obtained at 10 min intervals over the duration of the study to determine differences in T RUM between Bos indicus and Bos taurus cattle. Six feedlot pens (162 m2) were used with six steers (2/breed) per pen with three pens/treatment. Ambient dry bulb temperature ( T A; °C), relative humidity (RH; %), wind speed (WS; m/s) and direction, and solar radiation (SR; W/m2) were recorded at 10 min intervals. Rainfall (mm) was collected daily at 0900 h. From these data, black globe temperature (BGT; °C), temperature humidity index (THI), heat load index (HLI), and accumulated heat load (AHL) were calculated. Individual T RUM were converted to an hourly average and then mean hourly T RUM were converted to a mean within hour T RUM across the 130 days. Rumen temperatures were analyzed using an autoregressive repeated measures model. The model analyzed the effect of breed ( P < 0.0002), treatment ( P = 0.3543), time of day (hour, h; P < 0.0001), breed × treatment ( P < 0.3683), breed × h ( P < 0.0001), treatment × h ( P < 0.0001), breed × treatment × h ( P = 0.0029), pen within treatment ( P = 0.0195), and animal × breed × treatment within pen ( P = 0.1041). Furthermore, there were breed × treatment × hour differences in T RUM ( P = 0.0036), indicating that Bos indicus and Bos taurus regulate T RUM differently.

Implementasi Kebijakan Pembiayaan Pendidikan pada Era Otonomi Daerah (Studi Kasus Implementasi Dana BOS dan BKM Pada Sekolah yang Terpilih di Kabupaten Kebumen

Directory of Open Access Journals (Sweden)

Panuntun Nur Karomah

2017-08-01

Full Text Available Tujuan Penelitian ini untuk mengetahui implementasi kebijakan pembiayaan pendidikan pada era otonomi daerah studi di Kabupaten Kebumen dilihat dari aspek pelaksanaan, sumber-sumber dan alokasi anggaran pendidikan. Teknik pengumpulan data yaitu observasi, wawancara, dan dokumentasi. Uji keabsahan data adalah triangulasi. Hasil penelitian ini adalah pelaksanaan BOS diimplementasikan berdasarkan RAKS dan RAPBS, dan BKM berdasarkan penjaringan dari pihak sekolah. Dana BOS bersumber dari APBN (pemerintah pusat, BKM bersumber dari APBD Kabupaten (pemerintah daerah dan sumbangan sukarela bersumber dari masyarakat. Alokasi dana BOS setiap sekolah berbeda-beda, yang mempengaruhi hal itu adalah perbedaan jenjang sekolah, banyaknya jumlah siswa yang ada di sekolah, perbedaan letak sekolah. Hal ini, karena setiap sekolah mempunyai perbedaan kebutuhan operasional sekolah dan kegiatan-kegiatan yang dilakukan sekolah. Sumbangan sukarela untuk memenuhi kekurangan biaya yang diperlukan sekolah. Alokasi dana BKM tepat sasaran, namun waktu alokasi pencairannya kurang efektif .  This research aims to determine the education funding policy implementation at the regional autonomy in Kebumen, seen from the aspect implementation, resources and the education budget allocation for education. Data collection techniques are observation, interviews, and documentation. Test the validity of the data is triangulation. The results of this study are the implementation of BOS based RAKS and RAPBS, and BKM based networking from the school. BOS funds from the state budget (central government, BKM sourced from district budget (local government and voluntary contributions provided by the community. BOS funding is in each school different, the casue of difference in levels of schooling, the amount of students in the school, the school location. This is because each school has different operational needs and the activities. Voluntary donations for meet defiency from BOS. Allocation of

Seroprevalence of antibodies to Neospora caninum in Bos javanicus ('Bali cattle') from Indonesia.

Science.gov (United States)

Damriyasa, I Made; Schares, Gereon; Bauer, Christian

2010-01-01

A cross-sectional survey was performed to obtain first information on the presence of Neospora caninum infection in Bos javanicus ('Bali cattle'), the predominant beef cattle in the Eastern Islands of Indonesia. Serum samples were collected from 438 Bali cattle of two age classes (2 years) and both genders at three slaughterhouses in the Bali island, and examined for N. caninum-specific antibodies using native NcSRS2 (p38 antigen) as an ELISA antigen. The estimated overall seroprevalence of antibodies was 5.5% (95% CI: 3.5-8.0%). The seroprevalence was not significantly associated with age class or gender of the animals. The results give first serological evidence for the presence of natural N. caninum infection in Bos javanicus and indicate its occurrence in Indonesia.

Processos proteolíticos e características sensoriais em carne de bovino da raça Maronesa. Influência do pH final e tempo de maturação

OpenAIRE

Silva, José António de Oliveira e

2007-01-01

Durante o processo de transformação do músculo em carne, vários factores condicionam os processos bioquímicos e físicos, que influenciam de forma marcante a qualidade final da carne. Entre estes factores, o pH final (pHf) da carne é referido como um importante condicionador das características sensoriais e tecnológicas da carne. A tenrura é, na carne de bovino, particularmente importante contudo, o tipo de relação existente entre o pHf e a tenrura, bem como as suas causas não são unanimemente...

Composição química e rendimento da carne ovina in natura e assada Chemical composition and yield of in natura and roast sheep meat

Directory of Open Access Journals (Sweden)

Rafael Silvio Bonilha Pinheiro

2008-12-01

Full Text Available Utilizou-se o músculo Triceps brachii de cordeiros não castrados ½ Ile de France ½ Santa Inês terminados em confinamento para a realização das análises físico-químicas. Foram determinados: a umidade, a proteína, a gordura, as cinzas e os carboidratos da carne, in natura e assada, destes animais, assim como o rendimento desta carne, após o processo de cocção. A carne assada apresentou valores maiores de gordura e proteína (7,49 e 33,67% em comparação com a carne in natura (5,36 e 18,85%, respectivamente. Os percentuais de cinzas e carboidratos não foram influenciados pelos tratamentos estudados, porém para os valores de umidade, a carne in natura obteve valores superiores ao da carne assada, 74,05 e 57,02%, respectivamente. A carne assada teve perdas durante o seu preparo por evaporação, por gotejamento e por cocção de 33,20, 1,36 e 35,20%, respectivamente. Concluiu-se que a carne assada apresenta valor nutricional mais elevado que a carne in natura, para os teores de gordura e proteína, pelo fato da carne in natura apresentar maior valor de umidade em relação à assada, ocasionando assim a concentração de gordura e de proteína na carne assada. O preparo da carne ocasionou perdas por cocção de 35,20%, por gotejamento e evaporação.Tríceps brachii muscle from non-castrated ½ Ile de France ½ Santa Inês lambs terminated in confinement was used for physical and chemical analyses. In natura and roast meat moisture, protein, fat, ashes, carbohydrates, and meat yield were determined after the cooking process. Roast meat presented higher fat and protein values (7,49 and 33,67%, compared to in natura meat (5,36 and 18,85%, respectively. Ashes and carbohydrates percentages were not influenced by the treatments studied; however, in natura meat presented higher moisture values than roast meat (74,05 and 57,02%, respectively. Roast meat presented losses of 33, 20, 1,36, and 35,20% from evaporation, dripping, and cooking

The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation

Science.gov (United States)

Plesniak, A.; Garboushian, V.

2012-10-01

In 2011, the Amonix Advanced Technology Group was awarded DOE SunShot funding in the amount of 4.5M to design a new Balance of System (BOS) architecture utilizing Amonix MegaModules™ focused on reaching the SunShot goal of 0.06-$0.08/kWhr LCOE. The project proposal presented a comprehensive re-evaluation of the cost components of a utility scale CPV plant and identified critical areas of focus where innovation is needed to achieve cost reduction. As the world's premier manufacturer and most experienced installer of CPV power plants, Amonix is uniquely qualified to lead a rethinking of BOS architecture for CPV. The presentation will focus on the structure of the BOS-X approach, which looks for the next wave of cost reduction in CPV through evaluation of non-module subsystems and the interaction between subsystems during the lifecycle of a solar power plant. Innovation around nonmodule components is minimal to date because CPV companies are just now getting enough practice through completion of large projects to create ideas and tests on how to improve baseline designs and processes. As CPV companies increase their installed capacity, they can utilize an approach similar to the methodology of BOS-X to increase the competitiveness of their product. Through partnership with DOE, this holistic approach is expected to define a path for CPV well aligned with the goals of the SunShot Initiative.

Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

Indian Academy of Sciences (India)

Yak (Bos grunniens) is distributed in the area of Central. Asian highlands, it thrives in conditions of extreme harsh- ness with severely cold winters, short growing seasons for herbage and no absolutely frost-free periods (Wiener et al. 2003). The total population of yak is estimated to be 14 mil- lion, about 90% of the domestic ...

Bienestar animal durante el transporte y su relación con la calidad de la carne bovina

OpenAIRE

Marlyn Romero P.; Jorge Sánchez V.

2012-01-01

RESUMENEl bienestar animal (BA) es un elemento diferenciador en la comercialización de la carne bovina a nivel internacional, aunque no forma parte de los acuerdos comerciales, se pueden citar ejemplos de las experiencias de Chile, Argentina, Brasil y Uruguay con la Unión Europea, que los ha privilegiado para la exportación de carne fresca bovina con este valor agregado. Durante el transporte, cargue y descargue los bovinos son sometidos a factores estresantes que afectan su bienestar y la ca...

AVALIAÇÃO FÍSICO-QUÍMICA DE HAMBÚRGUER DE CARNE BOVINA E DE FRANGO SUBMETIDOS A DIFERENTES PROCESSAMENTOS TÉRMICOS

Directory of Open Access Journals (Sweden)

Cristiane Maria de BORBA

2013-01-01

Full Text Available Neste experimento, objetivou-se avaliar a qualidade físico-química de hambúrgueres de carne bovina e de frango submetidos a diferentes tratamentos térmicos: cozimento em micro-ondas, forno convencional e fritura. Composição centesimal e rendimento, percentual de perda de peso e grau de encolhimento (retração, foram avaliados. As análises foram realizadas em triplicata. O método micro-ondas foi o que apresentou as maiores perdas de umidade, peso e maior grau de retração para os dois tipos de carne estudados. Tanto para hambúrguer de carne bovina como de frango o maior percentual de proteínas e cinzas foi encontrado no método micro-ondas, no entanto o percentual de lipídios foi maior no método micro-ondas para hambúrguer de frango e no frito para hambúrguer de carne bovina.

The temporal behaviour of Taurus X-1 (the Crab Nebula)

International Nuclear Information System (INIS)

Davison, P.J.N.

1975-01-01

Copernicus data on Taurus X-1 and the Crab pulsar extending over a 2 1/2-yr period indicate that under normal conditions the source has a flux that is constant to within 2.5 per cent at the 90 per cent confidence level. The pulsed/total flux ratio also shows no significant changes during the same time. (author)

Association of udder traits with single nucleotide polymorphisms in crossbred Bos indicus-Bos taurus cows.

Science.gov (United States)

Tolleson, M W; Gill, C A; Herring, A D; Riggs, P K; Sawyer, J E; Sanders, J O; Riley, D G

2017-06-01

The size, support, and health of udders limit the productive life of beef cows, especially those with background, because, in general, such cows have a reputation for problems with udders. Genomic association studies of bovine udder traits have been conducted in dairy cattle and recently in Continental European beef breeds but not in cows with background. The objective of this study was to determine associations of SNP and udder support scores, teat length, and teat diameter in half (Nellore), half (Angus) cows. Udders of cows ( = 295) born from 2003 to 2007 were evaluated for udder support and teat length and diameter ( = 1,746 records) from 2005 through 2014. These included a subjective score representing udder support (values of 1 indicated poorly supported, pendulous udders and values of 9 indicated very well-supported udders) and lengths and diameters of individual teats in the 4 udder quarters as well as the average. Cows were in full-sibling or half-sibling families. Residuals for each trait were produced from repeated records models with cow age category nested within birth year of cows. Those residuals were averaged to become the dependent variables for genomewide association analyses. Regression analyses of those dependent variables included genotypic values as explanatory variables for 34,980 SNP from a commercially available array and included the genomic relationship matrix. Fifteen SNP loci on BTA 5 were associated (false discovery rate controlled at 0.05) with udder support score. One of those was also detected as associated with average teat diameter. Three of those 15 SNP were located within genes, including one each in (), (), and (). These are notable for their functional role in some aspect of mammary gland formation or health. Other candidate genes for these traits in the vicinity of the SNP loci include () and (). Because these were detected in Nellore-Angus crossbred cows, which typically have very well-formed udders with excellent support across their productive lives, similar efforts in other breeds should be completed, because that may facilitate further refinement of genomic regions responsible for variation in udder traits important in multiple breeds.

Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

Science.gov (United States)

Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

2013-09-25

Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

Characterization of the bovine type I IFN locus: rearrangements, expansions, and novel subfamilies

Directory of Open Access Journals (Sweden)

Walker Angela M

2009-04-01

Full Text Available Abstract Background The Type I interferons (IFN have major roles in the innate immune response to viruses, a function that is believed to have led to expansion in the number and complexity of their genes, although these genes have remained confined to single chromosomal region in all mammals so far examined. IFNB and IFNE define the limits of the locus, with all other Type I IFN genes except IFNK distributed between these boundaries, strongly suggesting that the locus has broadened as IFN genes duplicated and then evolved into a series of distinct families. Results The Type I IFN locus in Bos taurus has undergone significant rearrangement and expansion compared to mouse and human, however, with the constituent genes separated into two sub-loci separated by >700 kb. The IFNW family is greatly expanded, comprising 24 potentially functional genes and at least 8 pseudogenes. The IFNB (n = 6, represented in human and mouse by one copy, are also present as multiple copies in Bos taurus. The IFNT, which encode a non-virally inducible, ruminant-specific IFN secreted by the pre-implantation conceptus, are represented by three genes and two pseudogenes. The latter have sequences intermediate between IFNT and IFNW. A new Type I IFN family (IFNX of four members, one of which is a pseudogene, appears to have diverged from the IFNA lineage at least 83 million years ago, but is absent in all other sequenced genomes with the possible exception of the horse, a non-ruminant herbivore. Conclusion In summary, we have provided the first comprehensive annotation of the Type I IFN locus in Bos taurus, thereby providing an insight into the functional evolution of the Type I IFN in ruminants. The diversity and global spread of the ruminant species may have required an expansion of the Type I IFN locus and its constituent genes to provide broad anti-viral protection required for foraging and foregut fermentation.

Detection of warm water vapour in Taurus protoplanetary discs by Herschel

NARCIS (Netherlands)

Riviere-Marichalar, P.; Menard, F.; Thi, W. F.; Kamp, I.; Montesinos, B.; Meeus, G.; Woitke, P.; Howard, C.; Sandell, G.; Podio, L.; Dent, W. R. F.; Mendigutia, I.; Pinte, C.; White, G. J.; Barrado, D.

Line spectra of 68 Taurus T Tauri stars were obtained with the Herschel-PACS (Photodetector Array Camera and Spectrometer) instrument as part of the GASPS (GAS evolution in Protoplanetary Systems) survey of protoplanetary discs. A careful examination of the linescans centred on the [OI] 63.18 mu m

Qualidade da carne de fêmeas suínas alimentadas com diferentes concentrações de ractopamina na dieta

Directory of Open Access Journals (Sweden)

P.H. Watanabe

2012-10-01

Full Text Available Analisaram-se as qualidades física, química e sensorial, bem como o perfil de ácidos graxos da carne de fêmeas suínas alimentadas com dietas com concentrações crescentes de ractopamina. Foram utilizadas 468 fêmeas, com peso inicial de 84,77±7,20kg, alojadas em 36 baias e alimentadas com dietas contendo 0, 5, 10 ou 15mg de ractopamina/kg. Após o período de 28 dias, dois animais de cada baia, depois de passarem por 15 horas de jejum sólido, foram abatidos. Uma amostra do músculo Longissimus da meia carcaça direita foi colhida para se avaliar as características de qualidade da carne. Não houve efeito (P>0,05 da adição de ractopamina às dietas sobre o pH, capacidade de retenção de água, força de cisalhamento, cor e oxidação lipídica da carne. Observou-se efeito quadrático (P0,05 na análise sensorial da carne. Também não foi observado efeito (P>0,05 sobre a composição em ácidos graxos e sobre a relação entre ácidos graxos saturados:insaturados. A adição de até 15mg de ractopamina/kg de dieta não altera as características físicas, sensoriais e o perfil de ácidos graxos da carne de fêmeas suínas abatidas com 110kg de peso.

Caracterização e percepção de consumidores sobre a qualidade da carne de frango comercializada em Brasília - DF

OpenAIRE

Zamudio, Luz Haydee Bravo

2011-01-01

O presente estudo teve como objetivo caracterizar demograficamente os consumidores de carne de frango do Distrito Federal e avaliar a percepção dos mesmos sobre atributos de qualidade da carne comercializada em supermercados da região. Para realização da pesquisa 410 questionários foram aplicados em consumidores de carne de frango no momento da compra em supermercados e hipermercados da cidade de Brasília. O questionário era composto por perguntas relacionadas à caracterização e identificação...

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

Energy Technology Data Exchange (ETDEWEB)

Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México Apartado Postal 3-72, 58090 Morelia, Michoacán (Mexico); Mioduszewski, Amy J. [National Radio Astronomy Observatory, Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Kounkel, Marina A.; Hartmann, Lee [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48105 (United States); Torres, Rosa M. [Instituto de Astronomía y Meteorología, Universidad de Guadalajara, Avenida Vallarta No. 2602, Col. Arcos Vallarta, CP 44130 Guadalajara, Jalisco, México (Mexico); Boden, Andrew F. [Division of Physics, Math, and Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, 1 University Station, C1400, Austin, TX 78712 (United States); Briceño, Cesar [Cerro Tololo Interamerican Observatory, Casilla 603, La Serena (Chile); Tobin, John, E-mail: sdzib@mpifr-bonn.mpg.de [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)

2015-03-10

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature.

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

International Nuclear Information System (INIS)

Dzib, Sergio A.; Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L.; Mioduszewski, Amy J.; Kounkel, Marina A.; Hartmann, Lee; Torres, Rosa M.; Boden, Andrew F.; Evans II, Neal J.; Briceño, Cesar; Tobin, John

2015-01-01

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature

Absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at seven wavelengths in the 1.8-4.2 cm band

International Nuclear Information System (INIS)

Dmitrenko, L.V.; Snegireva, V.V.; Turchin, V.I.; Tsejtlin, N.M.; Voronkov, L.A.; Dmitrenko, D.A.; Kuznetsova, N.A.; Kholodilov, N.N.

1981-01-01

Results of absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at 1.8-4.17 cm wavelengths are presented. Spectra are built in the wave range of 1.8-100 cm with the use of results obtained earlier. Variability has been detected in radiation of Taurus A as well as ''steps'' in the spectrum of Taurus A with the spectral index α=0 in the region of 2 cm and 3-4 cm [ru

Reflexões sobre a “Operação Carne Fraca”

Directory of Open Access Journals (Sweden)

Maria Helena Simões Villas Bôas

2017-11-01

Recentemente em nosso país, foi deflagrada a “Operação Carne Fraca”, que, supostamente, revelou um esquema de compra de licenças sanitárias por frigoríficos. Todas as notícias advindas dessa operação tiveram ampla divulgação na mídia nacional e internacional.

Análise físico-química e sensorial de linguiça frescal mista de carne suína e caprina

Directory of Open Access Journals (Sweden)

Diego Pereira da Silva

2014-07-01

Full Text Available  O presente trabalho teve como objetivo a elaboração de uma linguiça mista de carne suína e caprina, a sua avaliação físico-química e de sua aceitação através do teste sensorial escala hedônica. As carnes utilizadas no trabalho foram escolhidas devido às suas características favoráveis a produção de uma linguiça com médio teor de gordura aliadas com maciez proporcionada pela carne magra de caprino e a carne de suíno com quantidades de lipídios consideráveis. O produto desenvolvido foi submetido à análise de proteínas, extrato etéreo, umidade, cinzas e cloretos. Os parâmetros físico-químicos apresentaram-se dentro dos limites estabelecidos nos Padrões de Identidade e Qualidade para este tipo de produto. Os resultados da análise sensorial realizada apresentaram uma grande aceitação, indicando que o produto da junção de carne caprina e suína, pode ser utilizado para elaboração de linguiça.Palavras-chave: parâmetros, aceitabilidade, processamento.

Rendimento de carcaça e composição química da carne da perdiz nativa (Rhynchotus rufescens

Directory of Open Access Journals (Sweden)

Moro Maria Estela Gaglianone

2006-01-01

Full Text Available A composição química da carne e o rendimento de carcaça de perdizes (Rhynchotus rufescens adultas, com 12 meses, criadas em cativeiro com rações balanceadas, foram determinadas neste trabalho. Para rendimento de carcaça, após o abate e evisceração, foram feitos dois cortes: peito e coxa+sobrecoxa+dorso. Para análise química, foram retiradas três amostras de cada corte para determinação da composição centesimal da umidade, proteínas totais, lipídeos totais, cinzas e colesterol. Os valores observados mostraram um rendimento médio de carcaça de 74,4% com 36,6% de carne de peito. Os componentes químicos apresentaram para os cortes de coxa-sobrecoxa e peito, respectivamente, umidade 62,4 e 55,9%; proteínas 25,2 e 29,1%; lipídeos 1,6 e 5,6%; cinzas 1,4 e 1,2% e colesterol 234 e 70mg/100g. O excelente rendimento de carcaça, somado à composição química de sua carne, mostra o potencial desta espécie para a produção de carnes especiais.

Confiança e agregação de valor em carnes com indicação geográfica

Directory of Open Access Journals (Sweden)

F.S. Brandão

2012-04-01

Full Text Available O aumento da procura por produtos agroalimentares com certificação relacionada à origem geográfica tem ocorrido, buscando atender nichos específicos de mercado. Nesse sentido, este trabalho identificou a percepção dos consumidores brasileiros com relação às indicações geográficas e sua disposição em pagar por esse atributo. Como método, realizou-se uma survey utilizando-se o software Sphinx, via internet, com 272 consumidores de carne bovina. Constatou-se que a percepção do consumidor sobre as indicações geográficas em carnes é, de maneira geral, positiva, sendo este atributo reconhecido como um indicador de qualidade. Os consumidores entrevistados acreditam que essas carnes oferecem maior segurança alimentar e são mais confiáveis que o produto sem a indicação de origem geográfica, sendo possível agregar valor em função de tais diferenciais. Além disso, o consumidor valorizou esse atributo e está disposto a pagar mais pelas carnes com selo de indicação geográfica.

Development of Uncertainty Quantification Method for MIR-PIV Measurement using BOS Technique

International Nuclear Information System (INIS)

Seong, Jee Hyun; Song, Min Seop; Kim, Eung Soo

2014-01-01

Matching Index of Refraction (MIR) is frequently used for obtaining high quality PIV measurement data. ven small distortion by unmatched refraction index of test section can result in uncertainty problems. In this context, it is desirable to construct new concept for checking errors of MIR and following uncertainty of PIV measurement. This paper proposes a couple of experimental concept and relative results. This study developed an MIR uncertainty quantification method for PIV measurement using SBOS technique. From the reference data of the BOS, the reliable SBOS experiment procedure was constructed. Then with the combination of SBOS technique with MIR-PIV technique, velocity vector and refraction displacement vector field was measured simultaneously. MIR errors are calculated through mathematical equation, in which PIV and SBOS data are put. These errors are also verified by another BOS experiment. Finally, with the applying of calculated MIR-PIV uncertainty, correct velocity vector field can be obtained regardless of MIR errors

Mitochondrial haplotypes influence metabolic traits across bovine inter- and intra-species cybrids

OpenAIRE

Wang, Jikun; Xiang, Hai; Liu, Langqing; Kong, Minghua; Yin, Tao; Zhao, Xingbo

2017-01-01

In bovine species, mitochondrial DNA polymorphisms and their correlation to productive or reproductive performances have been widely reported across breeds and individuals. However, experimental evidence of this correlation has never been provided. In order to identify differences among bovine mtDNA haplotypes, transmitochondrial cybrids were generated, with the nucleus from MAC-T cell line, derived from a Holstein dairy cow (Bos taurus) and mitochondria from either primary cell line derived ...

Dicty_cDB: VHI692 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) Pongo abelii mRNA; cDNA DKFZp469L1... 53 4e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... oxidas... 53 4e-06 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid o... AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 53 4e-06 AX882278_1( AX882278 |pid:none) Sequence

Dicty_cDB: VHN758 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available t EP10746... 76 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... CR457155_1( CR457155 |pid:none) Homo sapiens full open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipeco...lic acid oxid... 76 1e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from Paten

A CENSUS OF ROTATION AND VARIABILITY IN L1495: A UNIFORM ANALYSIS OF TRANS-ATLANTIC EXOPLANET SURVEY LIGHT CURVES FOR PRE-MAIN-SEQUENCE STARS IN TAURUS

International Nuclear Information System (INIS)

Xiao Hongyu; Covey, Kevin R.; Lloyd, James P.; Rebull, Luisa; Charbonneau, David; Mandushev, Georgi; O'Donovan, Francis; Slesnick, Catherine

2012-01-01

We analyze light curves obtained by the Trans-atlantic Exoplanet Survey (TrES) for a field centered on the L1495 dark cloud in Taurus. The Spitzer Taurus Legacy Survey catalog identifies 179 bona fide Taurus members within the TrES field; 48 of the known Taurus members are detected by TrES, as well as 26 candidate members identified by the Spitzer Legacy team. We quantify the variability of each star in our sample using the ratio of the standard deviation of the original light curve (σ orig. ) to the standard deviation of a light curve that has been smoothed by 9 or 1001 epochs (σ 9 and σ 1001 , respectively). Known Taurus members typically demonstrate (σ orig. /σ 9 ) orig. /σ 1001 ) orig. /σ 9 ) ∼ 3.0 and (σ orig. /σ 1001 ) ∼ 10, as expected for light curves dominated by unstructured white noise. Of the 74 Taurus members/candidates with TrES light curves, we detect significant variability in 49 sources. Adapting a quantitative metric originally developed to assess the reliability of transit detections, we measure the amount of red and white noise in each light curve and identify 18 known or candidate Taurus members with highly significant period measurements. These appear to be the first periods measured for four of these sources (HD 282276, CX Tau, FP Tau, TrES J042423+265008), and in two other cases, the first non-aliased periods (LkCa 21 and DK Tau AB). For the remainder, the TrES measurements typically agree very well (δP < 1%) with previously reported values. Including periods measured at lower confidence for 15 additional sources, we report periods for 11 objects where no previous periods were found, including 8 confirmed Taurus members. We also identify 10 of the 26 candidate Taurus members that demonstrate variability levels consistent with being bona fide T Tauri stars. A Kolomgorov-Smirnov (K-S) test confirms that these new periods confirm the distinction between the rotation period distributions of stars with and without circumstellar

Interstellar extinction in the Taurus dark clouds

International Nuclear Information System (INIS)

Meistas, E.; Straizys, V.

1981-01-01

The results of photoelectric photometry of 89 stars in the Vilnius seven-color system in the area of the Taurus dark clouds with corrdinates (1950) 4sup(h)16sup(m)-4sup(h)33sup(m), +16 0 -+20 0 are presented. Photometric spectral types, absolute magnitude, color excesses, interstellar extinctions and distances of the stars are determined. The distance of the dark nebula is found to be 140 pc and is in a good agreement with the distance determined for the dark nebula Khavtassi 286, 278. The average extinction Asub(v) in the investigated area is of the order of 1.4. (author)

Anomalous strength of the 2200 Angstroem feature in Cassiopeia-Taurus association

International Nuclear Information System (INIS)

Morales, C.; Ruiz del Arbol, J.A.; Llorente de Andres, F.

1980-01-01

From a large sample of reddened stars we computed the individual extinction curves which agree with that calculated by Nandy et al. (1976), except for four stars which show that the extinction at the 2200 Angstroem feature is greater than that deduced for the rest of stars. These four stars belong to the Cassiopeia-Taurus association. (orig.)

Aspectos clínicos da indução experimental de acidose láctica ruminal em zebuínos e taurinos

Directory of Open Access Journals (Sweden)

Enrico Lippi Ortolani

2010-08-01

Full Text Available To compare the clinical signs and the susceptibility to acute rumen lactic acidosis (ARLA, experimentally induced, five Jersey (J (Bos taurus and five Gir (G (Bos indicus steers were used. The ARLA caused in all animals tachycardia, decreased rumen movement, diarrhoea, and dehydration; Although G steers presented higher tachycardia and tendency to a more severe dehydration, the J steers exhibited a pronounced depression in the general state, requiring an intense treatment to recover. J steers needed more time to recover the normal appetite. Thus, regarding clinical picture, was observed that J steers are more susceptible to ARLA than G. Positive correlation was found between plasma volume deficit and tachycardia (r = 0.67; blood pH did not influence heart rate (r= - 0.25.

THE RELATION BETWEEN GAS AND DUST IN THE TAURUS MOLECULAR CLOUD

International Nuclear Information System (INIS)

Pineda, Jorge L.; Goldsmith, Paul F.; Chapman, Nicholas; Li Di; Snell, Ronald L.; Cambresy, Laurent; Brunt, Chris

2010-01-01

We report a study of the relation between dust and gas over a 100 deg 2 area in the Taurus molecular cloud. We compare the H 2 column density derived from dust extinction with the CO column density derived from the 12 CO and 13 CO J = 1 → 0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200'' corresponding to 0.14 pc at a distance of 140 pc. We find that the relation between visual extinction A V and N(CO) is linear between A V ≅ 3 and 10 mag in the region associated with the B213-L1495 filament. In other regions, the linear relation is flattened for A V ∼> 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ∼30%-70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO 2 ices and A V , we find a linear relationship between the column of carbon monoxide and dust for observed visual extinctions up to the maximum value in our data ≅23 mag. We have used these data to study a sample of dense cores in Taurus. Fitting an analytical column density profile to these cores we derive an average volume density of about 1.4 x 10 4 cm -3 and a CO depletion age of about 4.2 x 10 5 yr. At visual extinctions smaller than ∼3 mag, we find that the CO fractional abundance is reduced by up to two orders of magnitude. The data show a large scatter suggesting a range of physical conditions of the gas. We estimate the H 2 mass of Taurus to be about 1.5 x 10 4 M sun , independently derived from the A V and N(CO) maps. We derive a CO integrated intensity to H 2 conversion factor of about 2.1 x 10 20 cm -2 (K km s -1 ) -1 , which applies even in the region where the [CO]/[H 2 ] ratio is reduced by up to two orders of magnitude. The distribution of column densities in our Taurus maps resembles a log

Análise das barreiras não-tarifárias usadas pelos principais compradores de carne de frango brasileira

Directory of Open Access Journals (Sweden)

Eliane Aparecida Gracioli Rodrigues

2011-12-01

Full Text Available La aplicación de barreras no-tarifarias restringe las exportaciones de un producto y su acceso al mercado internacional. En el mercado mundial, Brasil se destaca como un importante productor de carne de pollo, el sector de avicultura tiene gran participación en las exportaciones del país. En ese artículo se analizan las posibles barreras no-tarifarias utilizadas por los principales compradores de carne de pollo brasilera, usando como fuente de investigación los datos de las principales instituciones relacionadas al sector, considerando el período de 2000 a 2008. Fueron definidos como principales compradores de carne de pollo brasilera Oriente Medio, Unión Europea, Asia, Japón y Rusia. Se ha observado que hay una creciente utilización de barreras no-tarifarias aplicadas a la avicultura, sobre todo las técnicas y sanitarias.

ANÁLISE MICROBIOLÓGICA DA CARNE DE JACARÉ DO PANTANAL (Caiman crocodilus yacare MICROBIAL ANALYSIS CHARACTERISTICS OF THE ALLIGATOR'S MEAT (Caiman crocodilus yacare

Directory of Open Access Journals (Sweden)

Fernando Leite HOFFMANN

1998-08-01

Full Text Available O objetivo deste estudo foi realizar o levantamento das características microbiológicas da carne do jacaré, através da detecção e/ou enumeração dos microrganismos mais comumente encontrados na carne. Pela inexistência de padrões na legislação brasileira para a carne de jacaré, os resultados foram comparados com os padrões microbiológicos existentes para carne bovina e pescado. Encontrou-se a presença de S. aureus e de Salmonella sp, resultados estes considerados insatisfatórios, o que nos permitiu, classificar o produto como impróprio para o consumo. O trabalho sugere também, procedimentos para evitar e/ou minimizar a presença desses microrganismos indesejáveis na carne.This work subjects to collect data of the microbial characteristics of the alligator meat, and also to identify the microrganisms that can be found in it. The current Brazilian legislation does not have any specific regulations for the alligator meat, then the results were compaired to the microbial standards for the fresh beef and fish. The results has showed the presence of the S. aureus and Salmonella sp. These results let us to classify the product submited to the test, as unsatisfactory and, therefore, inadequate to the human consumption. The present study also suggests some procedures to avoid or minimize the presence of these microrganisms.

The Pan-STARRS1 Proper-motion Survey for Young Brown Dwarfs in Nearby Star-forming Regions. I. Taurus Discoveries and a Reddening-free Classification Method for Ultracool Dwarfs

Science.gov (United States)

Zhang, Zhoujian; Liu, Michael C.; Best, William M. J.; Magnier, Eugene A.; Aller, Kimberly M.; Chambers, K. C.; Draper, P. W.; Flewelling, H.; Hodapp, K. W.; Kaiser, N.; Kudritzki, R.-P.; Metcalfe, N.; Wainscoat, R. J.; Waters, C.

2018-05-01

We are conducting a proper-motion survey for young brown dwarfs in the Taurus-Auriga molecular cloud based on the Pan-STARRS1 3π Survey. Our search uses multi-band photometry and astrometry to select candidates, and is wider (370 deg2) and deeper (down to ≈3 M Jup) than previous searches. We present here our search methods and spectroscopic follow-up of our high-priority candidates. Since extinction complicates spectral classification, we have developed a new approach using low-resolution (R ≈ 100) near-infrared spectra to quantify reddening-free spectral types, extinctions, and gravity classifications for mid-M to late-L ultracool dwarfs (≲100–3 M Jup in Taurus). We have discovered 25 low-gravity (VL-G) and the first 11 intermediate-gravity (INT-G) substellar (M6–L1) members of Taurus, constituting the largest single increase of Taurus brown dwarfs to date. We have also discovered 1 new Pleiades member and 13 new members of the Perseus OB2 association, including a candidate very wide separation (58 kau) binary. We homogeneously reclassify the spectral types and extinctions of all previously known Taurus brown dwarfs. Altogether our discoveries have thus far increased the substellar census in Taurus by ≈40% and added three more L-type members (≲5–10 M Jup). Most notably, our discoveries reveal an older (>10 Myr) low-mass population in Taurus, in accord with recent studies of the higher-mass stellar members. The mass function appears to differ between the younger and older Taurus populations, possibly due to incompleteness of the older stellar members or different star formation processes.

Nutrición y calidad de carne de vacuno: efecto de la alimentación durante la lactancia y acabado de terneros

OpenAIRE

Cerdeño, Ana Isabel; Mantecón, Ángel R.

2003-01-01

La alimentación de los animales juega un papel primordial en la calidad de la carne obtenida. Ello se debe a que los alimentos ingeridos son la fuente a partir de la cual los animales reciben los nutrientes necesarios para el metabolismo, determinando, con ello, la composición tisular de la canal y la composición química de la carne.

Estrategias productivas y alimentarias para mejorar la calidad de la canal y de la carne de chato murciano

OpenAIRE

Auqui Silvera, Sonia Mariella

2014-01-01

En la presente Tesis Doctoral se estudió el efecto del peso al sacrificio en la calidad de la canal y de la carne de cerdos Chato Murciano así como también el efecto de la incorporación de 1000 ppm de extracto de romero en la alimentación animal sobre la calidad tanto en la carne fresca como en productos cárnicos crudo-curados (salchichón y longaniza imperial) evaluados durante el almacenamiento. Para ello se diseñaron tres estudios diferentes. En el primero (1) se utilizaron un total de ...

Análisis del potencial exportador colombiano de carne bovina y porcina a la Federación Rusa

OpenAIRE

Bautista Díaz, Camilo Andrés; Rojas Mesa, Camilo Andrés

2017-01-01

El estudio del potencial exportador colombiano de carne bovina y porcina a la Federación Rusa en función de su oferta y demanda es un proyecto que pertenece a la línea de realidad dentro del área de investigación de la Universidad del Rosario. Es una investigación tipo exploratoria con un enfoque cualitativo que buscará dar respuesta a si Colombia cuenta con el potencial exportador de carne bovina y porcina al mercado de la Federación Rusa. El marco teórico que justifica el proyecto de inv...

Comparison of nitrogen utilization and urea kinetics between yaks (Bos grunniens) and indigenous cattle (Bos taurus).

Science.gov (United States)

Zhou, J W; Zhong, C L; Liu, H; Degen, A A; Titgemeyer, E C; Ding, L M; Shang, Z H; Guo, X S; Qiu, Q; Li, Z P; Yang, G; Long, R J

2017-10-01

Under traditional management on the Qinghai-Tibetan Plateau, yaks () graze only on natural pasture without supplements and are forced to cope with sparse forage of low N content, especially in winter. In contrast, indigenous Tibetan yellow cattle () require supplements during the cold season. We hypothesized that, in response to harsh conditions, yaks cope with low N intakes better than cattle. To test this hypothesis, a study of whole-body N retention and urea kinetics was conducted in 2 concurrent 4 × 4 Latin squares, with 1 square using yaks and 1 square using cattle. Four isocaloric forage-concentrate diets differing in N concentrations (10.3, 19.5, 28.5, and 37.6 g N/kg DM) were formulated, and by design, DMI were similar between species and across diets. Urea kinetics were determined with continuous intravenous infusion of NN urea for 104 h, and total urine and feces were concomitantly collected. Urea production, urea recycling to the gut, and ruminal microbial protein synthesis all linearly increased ( Urea production was greater in yaks than in cattle at the 3 lowest N diets but greater in cattle than in yaks at the highest N diet (species × diet, Urea N recycled to the gut ( urea N captured by ruminal bacteria ( urea recycling was through saliva, with no difference between species ( = 0.61). Glomerular filtration rate was lower ( = 0.05) in yaks than in cattle. The higher urea recycling and greater capture of recycled urea by ruminal microbes in yaks than in cattle suggest that yaks use mechanisms to utilize dietary N more efficiently than cattle, which may partially explain the better survival of yaks than cattle when fed low-N diets.

Análisis proximal, evaluación microbiológica y sensorial de carnes para hamburguesas elaboradas con cachama blanca (Piaractus brachypomus y soya (Glycine max texturizada

Directory of Open Access Journals (Sweden)

Oscar García

2013-12-01

Full Text Available La cachama blanca (Piaractus brachypomus es una especie económicamente importante en la acuicultura continental de América Latina y una alternativa nacional de producción de pescado para la piscicultura, la industria y el consumo. El objetivo del presente trabajo de investigación fue caracterizar mediante análisis proximal, evaluación microbiológica y sensorial, carnes para hamburguesas elaboradas con pulpa de cachama y diferentes inclusiones porcentuales de harina de soya texturizada (HST (0, 3, 6 y 9 %. Se realizó análisis proximal a las carnes crudas y cocidas, se evaluó microbiológicamente a las crudas y sensorialmente las cocidas con 100 consumidores. En las carnes para hamburguesas a mayor adición de HST favoreció la retención de agua durante la cocción y se elevó el contenido de proteína, grasa y cenizas en las carnes crudas y cocidas (p < 0,05. El análisis microbiológico reveló inocuidad alimentaria en las carnes para hamburguesas crudas, encontrándose todos los valores por debajo de lo establecido en la norma venezolana COVENIN 2127-1998 para hamburguesa y otras normas de referencia. La blandura aumentó de manera proporcional al incremento porcentual en la inclusión de HST y las formulaciones con 0, 3 y 6 % de HST se diferenciaron significativamente (p < 0,05 de la formulación con 9 %. La apariencia de las carnes de hamburguesa agradó más en las formulaciones 6 y 9 %, la blandura en 9 %, y el sabor en el control (0 %, seguido de 3 %. Algunos consumidores hicieron asociaciones de sabor a carne de pollo, mariscos y hervidos de pollo.

BIOACTIVE PEPTIDES OF THE COW MILK WHEY PROTEINS (Bos taurus

Directory of Open Access Journals (Sweden)

A. V. Iukalo

2013-10-01

Full Text Available Data on the biological functions of milk whey proteins, which are implemented at the level of their proteolytic degradation products — bioactive peptides have been reviewed. The main functions of these proteins is to provide the amino acid nutrition of mammals in the early stages of development, as well as the transport of fatty acids, retinol, involved in the synthesis of lactose, ions of calcium and iron, immune protection, antimicrobial action, etc. However, in recent years, it has been found that milk proteins like casein are precursors of biologically active peptides. Аngiotensin — converting enzyme, opioid peptides which are opiate receptor agonists, anti–microbial peptides, peptides with immunomodulatory and hypocholesterolemic action, and peptides affecting motility have been found among the products of proteolytic degradation of ?-lactoglobulin, ?-laktoalbumin, lactoferrin and milk whey albumin. Also data on the possible participation of peptides from milk whey proteins in the implementation of the biological functions of both the assimilation of calcium, antioxidant effect, the regulation of appetite, anticarcinogenic are provided. The authors assume that the phenomenon of bioactive peptides formation could be considered as an additional function of natural food proteins, which gives advantages to the mammals and has a positive effect on their development in the postnatal period. Ways of bioactive peptides formation, their resistance to action of proteolytic enzymes, the ability to cross into the bloodstream and have biological effects have been also discussed. Up to date, only a few products with bioactive peptides from milk whey proteins are obtained. Further studies of their structure, mechanism of action, ways of formation and methods of isolation are required for their wider use. Formation of functional products based on bioactive peptides from milk whey proteins will allow efficient use of milk whey, which is often a byproduct of the dairy industry.

'Candidatus Mycoplasma haemobos': Transplacental transmission in dairy cows (Bos taurus).

Science.gov (United States)

Girotto-Soares, Aline; Soares, João Fabio; Bogado, Alexey Leon Gomel; de Macedo, César Augusto Barbosa; Sandeski, Lígia Mara; Garcia, João Luis; Vidotto, Odilon

2016-11-15

'Candidatus Mycoplasma haemobos' is a haemotropic mycoplasma that can produce various clinical signs in cattle, but abortive potential of the parasite is unknown, as well as the frequency of transplacental transmission in cattle. Thus, the objective of this work was to evaluate the frequency of detection of 'C. M. haemobos' in aborted fetuses and the blood of dairy cows. Blood samples of 22 dairy cows that aborted and pool tissues (brain, lung, heart and liver) of their respective aborted fetuses were tested by conventional PCR. The occurrence of 'C. M. haemobos' DNA in adult animals was 40.9% (9/22) and in the fetuses was 18.2% (4/22). Two fetuses that contained 'C. M. haemobos' DNA were derived from cows which were PCR negative. When stratifying by breed, it was observed that Jersey cows had a higher proportion of positive animals (8/11; 72.7%) as compared to Holstein (1/9; 11.1% P<0.01). The results of this study suggest that this parasite can be transferred via the placenta, but it is not certain if the abortions were due to 'C. M. haemobos'. Copyright © 2016 Elsevier B.V. All rights reserved.

Potenciais benefícios do sistema de rastreabilidade animal dos EUA para o setor de carnes americano

Directory of Open Access Journals (Sweden)

Moisés de Andrade Resende Filho

2008-12-01

Full Text Available Este artigo investigou os potenciais ganhos do setor de carnes americano advindos da implantação do Sistema Nacional de Identificação Animal (NAIS, dos EUA. Foram analisados os potenciais efeitos do NAIS sobre a percepção de risco dos consumidores americanos em relação aos perigos decorrentes do consumo das carnes bovina, suína e de aves e seus derivados. Sistemas de equações de demanda foram estimados, incorporando-se como "proxies" da percepção de risco do consumidor, séries de índices de segurança do alimento, separadamente construídas para cada tipo de carne. Tais séries foram concebidas, somando-se o número de referências nos principais jornais americanos a problemas de segurança da carne. Foi utilizado o melhor modelo estimado, escolhido com base em uma série de testes de especificação, para se construir três cenários, simulando-se os casos em que o NAIS não está implementado; que está implementado apenas para o gado bovino; e que está implementado para suínos e bovinos. Foram utilizadas as diferenças entre as receitas estimadas para cada cenário e para cada tipo de carne, como uma medida do potencial ganho advindo da implementação do NAIS. Foi concluído que os setores da carne bovina e suína poderiam arcar com os custos do NAIS. Esse resultado, contudo, depende de o quanto desses potenciais ganhos chegarão efetivamente aos produtores agrícolas.This article investigates the potential gains to the U.S. meat sector with the implantation of the U.S. National Animal Identification System (NAIS. The focus is on the effect that the NAIS could have on consumers' risk perception about eating meat. System of demand equations are estimated using time series of food safety indexes variables used as proxies for consumers' reactions to news on meat safety issues. The series of food safety indexes are built on the basis of the number of food safety news reported in top U.S. newspapers. Using the preferred model

Dicty_cDB: SSK827 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Xenopus laevis achalasia, adrenoco... 80 8e-14 BC067671_1( BC067671 |pid:none) Danio rerio achalasia...222509_1( AK222509 |pid:none) Homo sapiens mRNA for achalasia, a... 65 2e-09 (Q9NRG9) RecName: Full=Aladin; ... cl... 65 3e-09 BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 63 7e-09 AK087134_1( A

Dicty_cDB: VHQ356 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Streptomyces tendae strain Tue901, nik... 72 3e-11 BC158505_1( BC158505 |pid:none) Xenopus tropicalis pipecoli...5 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 56 2e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid oxidas... 55 3e-06 protein update 2009. 7.22 PSO

Dicty_cDB: VHJ851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 67 3e-10 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 67 3e-10 CT978603_2294( CT97...|pid:none) Synthetic construct Homo sapiens c... 63 3e-09 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli...AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 63 3e-09 AX882278_1( AX882278 |pid:non

Dicty_cDB: VHL817 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eading fra... 75 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 75 2e-12 AX8822...k... 108 1e-22 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 75 1e-12 BC114006_1( BC114006 |pid...:none) Bos taurus L-pipecolic acid oxidas... 75 1e-12 AY892312_1( AY892312 |pid:n

Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

NARCIS (Netherlands)

Kotterman, M.

1998-01-01

Outline of this thesis
In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L., E-mail: taran.esplin@psu.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

2017-10-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K{sub s}, which should have masses as low as ∼4–5 M {sub Jup} according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M{sub Jup}).

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.

2017-01-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K s , which should have masses as low as ∼4–5 M Jup according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M Jup ).

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

International Nuclear Information System (INIS)

Todorov, K. O.; Luhman, K. L.; Konopacky, Q. M.; McLeod, K. K.; Apai, D.; Pascucci, I.; Ghez, A. M.; Robberto, M.

2014-01-01

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M ☉ ). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15 −0.03 +0.05 for M4-M6 (M ∼ 0.1-0.3 M ☉ ) and 4/108 = 0.04 −0.01 +0.03 for >M6 (M ≲ 0.1 M ☉ ) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

Energy Technology Data Exchange (ETDEWEB)

Todorov, K. O.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Konopacky, Q. M. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); McLeod, K. K. [Whitin Observatory, Wellesley College, Wellesley, MA 02481 (United States); Apai, D.; Pascucci, I. [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Ghez, A. M. [Division of Astronomy and Astrophysics, University of California, Los Angeles, CA 90095 (United States); Robberto, M., E-mail: todorovk@phys.ethz.ch [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

2014-06-10

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M {sub ☉}). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15{sub −0.03}{sup +0.05} for M4-M6 (M ∼ 0.1-0.3 M {sub ☉}) and 4/108 = 0.04{sub −0.01}{sup +0.03} for >M6 (M ≲ 0.1 M {sub ☉}) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

Controle do carrapato Boophilus microplus (Acari: Ixodidae em sistemas de produção de leite da microrregião fisiográfica fluminense do grande Rio - Rio de Janeiro Control of the cattle tick Boophilus microplus (Acari: Ixodidae in dairy farm systems of the physiographic microrregion of grande Rio, Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Juracy de Castro Borba Santos Júnior

2000-04-01

Full Text Available O objetivo do trabalho foi analisar os métodos de controle do carrapato Boophilus microplus realizados em três fazendas representativas dos sistemas de produção de leite da Microrregião Fisiográfica Fluminense do Grande Rio, Rio de Janeiro, levando-se em consideração o manejo das fazendas, o grau de sangue Bos taurus e Bos indicus dos rebanhos, os fatores climáticos e a prevalência estacional do carrapato. Para efeito de avaliação, foi utilizada a contagem periódica de fêmeas ingurgitadas medindo entre 4,5 e 8mm, no antímero direito de 20% das vacas em lactação de cada fazenda, durante um ano. A diferença no manejo das pastagens, a composição genética dos rebanhos e as condições climáticas influenciaram a prevalência estacional de B. microplus. A maior lotação animal por hectare, o elevado "stand" vegetativo das pastagens e o maior grau de sangue B. taurus contribuíram para as maiores infestações de carrapatos nas fazendas. O controle de B. microplus realizado pelos proprietários teve importância secundária em relação as outras atitudes de manejo dos rebanhos. Ficou evidenciado o uso excessivo e ineficiente de produtos químicos para o controle de B. microplus nas fazendas. Para implantação de medidas de controle estratégico do B. Microplus, fazem-se necessários esforços para a transferência e adoção dos resultados de pesquisas disponíveis aos produtores rurais.The objective of the study was to analyse the control methods of the cattle tick, Boophilus microplus. The experiment was carried out on three farms of the dairy production systems of the Fluminense Physiographic Microregion of Grande Rio, Rio de Janeiro State, Brazil. Farm management, the Bos indicus and Bos taurus composition of herds, climatic factors and seasonal variation in tick infestation level of cattle was taken into account. Counts of engorged female ticks, measuring between 4.5 and 8.0mm, in 20% of the lactating cows of each farm

Characterization of a Dairy Gyr herd with respect to its mitochondrial DNA (mt DNA origin

Directory of Open Access Journals (Sweden)

Anibal Eugênio Vercesi Filho

2010-01-01

Full Text Available The Zebu breeds were introduced in Brazil mainly in the last century by imports from the Indian subcontinent. When the Zebu cattle arrived, the national herd suffered a significative change by backcrossing the national cows of taurine origin with Zebu sires. These processes created a polymorphism in the mitochondrial DNA (mtDNA in the Zebu animals with are in a major part derived from backcrossing and sharing mtDNA of taurine origin. To verify the maternal origin of cows belonging to the Dairy Gyr herd of APTA, Mococa 60 females were analyzed and 33 presented mtDNA from Bos taurus origin and 27 presented mtDNA from Bos indicus origin. None of these animals presented patterns of both mtDNA origins, indicating absence of heteroplasmy for these mitochondrial genotypes.

Transcriptomic response of goat mammary epithelial cells to Mycoplasma agalactiae challenge – a preliminary study

DEFF Research Database (Denmark)

Ogorevc, Jernej; Mihevc, Sonja Prpar; Hedegaard, Jakob

2015-01-01

Mycoplasma agalactiae (Ma) is one of the main aetiological agents of intramammary infections in small ruminants, causing contagious agalactia. To better understand the underlying disease patterns a primary goat mammary epithelial cell (pgMEC) culture was established from the mammary tissue and ch....... Additionally, the results represent comprehensive goat mammary transcriptome information and demonstrate the applicability of the comparative genomics approach for annotation of goat data, using transcriptome information of a closely related species (Bos taurus) as a reference....

Dicty_cDB: CFG838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available iscoideum chromosom... 390 e-107 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia..., adrenoco... 81 9e-14 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... 68 6e-1...e) Homo sapiens mRNA for achalasia, a... 62 3e-08 (Q9NRG9) RecName: Full=Aladin; AltName: Full=Adracalin; &A... BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 60 1e-07 AK087134_1( A

Dicty_cDB: VHO576 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mal sarcosine oxidase; S... 48 1e-04 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 4...8 1e-04 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecolic acid o... 48 2e-04 AY892312_1( AY892312 ...id:none) Pongo abelii mRNA; cDNA DKFZp469L1... 48 2e-04 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli

Parâmetros qualitativos da carne de cordeiros maturada

OpenAIRE

Lima, Flavia Biondi Fernandes de [UNESP

2013-01-01

Objetivando avaliar mudanças nas características físicas, químicas e estruturais da carne ovina maturada por sete dias foram utilizados 48 cordeiros sem padrão racial definido (SPRD), não castrados, com peso médio de 15 kg, os quais foram abatidos com 32 kg e cinco meses de período experimental. Foi utilizado delineamento experimental inteiramente casualizado (DIC) em arranjo fatorial 2x2x2, sendo que os animais receberam dois níveis de concentrado proteico energético (0 e 0,7% do peso vivo) ...

Fatores associados à percepção e atitude de consumidores de carne bovina com certificação de origem em Uberlândia, Minas Gerais

Directory of Open Access Journals (Sweden)

Marcos Aurélio Lopes

Full Text Available RESUMO O objetivo deste estudo foi verificar os fatores socioeconômicos relacionados com a decisão de compra de carne com certificação de origem, além de levantar os perfis de percepção e de atitude dos consumidores de carne bovina, em Uberlândia, MG. Foi realizada a descrição das variáveis e construído um modelo múltiplo Generalized Estimating Equations (GEE de regressão logística, para testar as possíveis associações entre as características socioeconômicas dos consumidores e os principais atributos da carne que influenciam a decisão sobre sua compra. As informações foram levantadas por meio de entrevistas com 213 consumidores, de abril a maio de 2012. A presença do carimbo do serviço de inspeção federal (SIF ou estadual é o atributo que mais influencia a decisão de compra dos consumidores. A maioria dos entrevistados já ouviu falar sobre rastreabilidade bovina. Dentre estes, a maior parte está disposta a pagar mais pela carne com certificação de origem. Apesar disso, muitos consideram que o aumento do preço da carne é uma desvantagem da rastreabilidade. Consumidores com maior grau de escolaridade e renda apresentaram melhor conhecimento sobre este tipo de certificação, sendo esses fatores os de grande influência sobre a aceitação dos consumidores em pagar mais caro pela carne bovina rastreada.

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M R; Chen, W; Lenstra, J A; Goderie, C R J; MacHugh, D E; Park, S D E; Magee, D A; Matassino, D; Ciani, F; Megens, H-J; van Arendonk, J A M; Groenen, M A M; Marsan, P A; Balteanu, V; Dunner, S; Garcia, J F; Ginja, C; Kantanen, J

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

COMBINED ANALYSIS OF IMAGES AND SPECTRAL ENERGY DISTRIBUTIONS OF TAURUS PROTOSTARS

International Nuclear Information System (INIS)

Gramajo, Luciana V.; Gomez, Mercedes; Whitney, Barbara A.; Robitaille, Thomas P.

2010-01-01

We present an analysis of spectral energy distributions (SEDs), near- and mid-infrared images, and Spitzer spectra of eight embedded Class I/II objects in the Taurus-Auriga molecular cloud. The initial model for each source was chosen using the grid of young stellar objects (YSOs) and SED fitting tool of Robitaille et al. Then the models were refined using the radiative transfer code of Whitney et al. to fit both the spectra and the infrared images of these objects. In general, our models agree with previous published analyses. However, our combined models should provide more reliable determinations of the physical and geometrical parameters since they are derived from SEDs, including the Spitzer spectra, covering the complete spectral range; and high-resolution near-infrared and Spitzer IRAC images. The combination of SED and image modeling better constrains the different components (central source, disk, envelope) of the YSOs. Our derived luminosities are higher, on average, than previous estimates because we account for the viewing angles (usually nearly edge-on) of most of the sources. Our analysis suggests that the standard rotating collapsing protostar model with disks and bipolar cavities works well for the analyzed sample of objects in the Taurus molecular cloud.

Preferencias de consum idores y disponibilidad a pagar por atributos de calidad en carne de conejo orgánico

Directory of Open Access Journals (Sweden)

José Luis Jaramillo Villanueva

2015-01-01

Full Text Available La demanda de productos cárnicos, especialmente los de especialidad, están altamente segmentados entre los diferentes tipos de consumidores. En este trabajo, las preferencias del consumidor por atributos relacionados con la calidad (inocuidad, frescura, textura, color, orgánico y precio por carne de conejo son analizadas para descubrir su nicho de mercado potencial. A partir de datos obtenidos por encuesta a una muestra aleatoria de 197 personas, se realizó análisis descriptivo, de correlación y un modelo econométrico para identificar las variables potencialmente explicativas de la disponibilidad a pagar (DAP de los consumidores por el atributo orgánico. Las preferencias se midieron utilizando una escala Likert de cinco categorías. Los atributos más preferidos, en orden de importancia, fueron lo orgánico, la inocuidad, la frescura, y el precio de la carne. El atributo “orgánico” es altamente preferido por el 64 % de la muestra, seguido de la inocuidad. Las razones para preferir carne orgánica son por salud y responsabilidad social. Las características, escolaridad, ingreso del hogar, conocimiento sobre alimentos orgánicos, y el atributo inocuidad fueron significativas (P<0.05 de la DAP. Esto revela la importancia del nivel de ingresos y la educación formal en la decisión del consumidor sobre el posible sobreprecio por estos alimentos. El sobreprecio que los consumidores pagarían por kilogramo de carne de conejo orgánico fue del 15 % de la media del precio ($13.50 más por kilogramo que los consumidores pagan.

Avaliação das características físico-químicas e microbiológicas de carne mecanicamente separada de frango de diferentes marcas comerciais.

OpenAIRE

Felipe Coser Chow

2011-01-01

Desde o final da década de 1950, a carne mecanicamente separada (CMS) de ave tem sido utilizada pelas indústrias de carne, como matéria-prima para fabricação de produtos derivados. Tal prática tornou-se corrente e comum nos dias de hoje e, por questões produtivas, comportamentais e, até mesmo, pela grande oferta do produto em nosso país, apresenta perspectiva de crescimento contínuo. Sabe-se, também, que se trata de uma carne com características extremamente particulares, tanto devido ao seu ...

Qualidade físico-química e sensorial da carne de peito de matrizes pesadas de descarte

OpenAIRE

Komiyama,Claudia Marie; Mendes,Ariel Antonio; Sanfelice,Cristiane; Cañizares,Marleide Costa; Roça,Roberto de Oliveira; Takahashi,Sabrina Endo; Rodrigues,Luciana; Cañizares,Gil Ignácio Lara; Paz,Ibiara Correia de Lima Almeida; Cardoso,Karen Franco de Godoi

2010-01-01

O objetivo do presente trabalho foi avaliar as características de qualidade: pH, cor, valor R, perda por exsudação, capacidade de retenção e absorção de água, capacidade de emulsificação, perdas por cocção, força de cisalhamento e análise sensorial da carne de matrizes pesadas de descarte de frangos de corte. A carne de peito de matrizes apresentou valores médios do parâmetro pH, valor R, perda por exsudação e valor de L* de 5,70, 1,43, 2,00 e 50,11, respectivamente. Para a capacidade de rete...

Avaliação de marcadores moleculares associados à qualidade da carne de bovinos Simental Sul Africano x Nelore

OpenAIRE

Roberta Doriguello Fonseca

2016-01-01

No Brasil, a perspectiva de aumento do volume de exportações e a exigência dos diferentes mercados faz com que a adaptação da cadeia produtiva da carne seja necessária, assim como a mudança de conceitos e critérios de seleção dos animais, de forma a melhorar as características consideradas pelo consumidor como de primeira importância: aparência e a palatabilidade. Porém existem diversos fatores que podem influenciar na qualidade da carne: sexo, raça (genética), idade, nutrição e estresse dura...

PESQUISA DE CAMPYLOBACTER SPP. EM CARNES DE FRANGO COMERCIALIZADAS NA CIDADE DE CAMPO MOURÃO-PR

Directory of Open Access Journals (Sweden)

Karina de Oliveira GONÇALVES

2012-04-01

Full Text Available A campilobacteriose causa um grande impacto na saúde pública em todo o mundo, sendo em muitos pa- íses a causa mais frequente de gastroenterite em humanos causada por alimentos. A principal fonte de Campylobacter são as aves, dessa forma, pode haver infecção pelo consumo de carne crua, mal cozida, contaminação cruzada no preparo dos alimentos ou por outros alimentos, como água e leite. O despreparo de muitos manipuladores de alimentos em relação a cuidados higiênicos é um dos fatores que favorece a contaminação dos alimentos, afetando principalmente ambientes como restaurantes, hospitais e indústrias de alimentos. Como o congelamento e a refrigeração têm o papel de conservar a carne em bom estado para o consumo, à detecção de bactérias viáveis nesta etapa é muito importante. Diante do exposto acima, o presente estudo teve como objetivo avaliar a ocorrência de Campylobacter spp. em frangos refrigerados comercializados na cidade de Campo Mourão-PR por meio do teste imunoenzimático pelo método ELFA (Enzime Linked Fluorescent Assay com o sistema automatizado VIDAS® campy. Dessa maneira, foi possível detectar uma contaminação de 79,16% em 24 frangos, confirmando a grande incidência de Campylobacter em carnes de aves destinadas ao consumo humano.

Carne de ovinos de descarte na elaboração de mortadelas com diferentes teores de gordura suína.

OpenAIRE

GUERRA, I. C. D.; MEIRELES, B. R. L. de A.; FÉLEX, S. S. dos S.; CONCEIÇÃO, M. L. da; SOUZA, E. L. de; BENEVIDES, S. D.; MADRUGA, M. S.

2012-01-01

Este estudo teve como objetivo avaliar o potencial de utilização da carne de ovinos de descarte na elaboração de mortadelas. Três formulações de mortadela foram desenvolvidas, com 90, 80 e 70% de carne ovina, adicionadas de 10, 20 e 30% de gordura suína. Os resultados demonstraram que as três formulações de mortadela atenderam aos parâmetros microbiológicos preconizados pela legislação brasileira, sendo, portanto, seguros para o consumo humano. Para os parâmetros cinzas, amido, cloretos, pH e...

Co-branding de marcas colectivas de carne de bovino: avaliação do valor atribuído pelos consumidores

OpenAIRE

Oliveira, Diana Judite Moura de

2014-01-01

Dissertação de Mestrado em Gestão Ocorrendo o Co-branding quando dois ou mais nomes de marcas já estabelecidas de diferentes instituições aparecem num mesmo produto, consideramos como pressuposto para a nossa investigação que uma forma de estimular a produção de carnes bovinas com Denominação de Origem Protegida (DOP) ou produzidas em modo de produção biológico seria pela associação em Co-branding destas duas marcas coletivas de carne bovina (DOP ou Biológica, individualmente ou em simultâ...

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M.R.; Chen, W.; Lenstra, J.A.; Goderie, C.R.J.; MacHugh, D.E.; Park, S.D.E.; Magee, D.A.; Matassino, D.; Ciani, F.; Megens, H.J.; Arendonk, van J.A.M.; Groenen, M.A.M.

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

The phylogenomic position of the grey nurse shark Carcharias taurus Rafinesque, 1810 (Lamniformes, Odontaspididae) inferred from the mitochondrial genome.

Science.gov (United States)

Bowden, Deborah L; Vargas-Caro, Carolina; Ovenden, Jennifer R; Bennett, Michael B; Bustamante, Carlos

2016-11-01

The complete mitochondrial genome of the grey nurse shark Carcharias taurus is described from 25 963 828 sequences obtained using Illumina NGS technology. Total length of the mitogenome is 16 715 bp, consisting of 2 rRNAs, 13 protein-coding regions, 22 tRNA and 2 non-coding regions thus updating the previously published mitogenome for this species. The phylogenomic reconstruction inferred from the mitogenome of 15 species of Lamniform and Carcharhiniform sharks supports the inclusion of C. taurus in a clade with the Lamnidae and Cetorhinidae. This complete mitogenome contributes to ongoing investigation into the monophyly of the Family Odontaspididae.

Análise físico-química e sensorial de hambúrguer elaborado com carne de avestruz Physicochemical and sensorial analyses of ostrich hamburger

Directory of Open Access Journals (Sweden)

Tiffany Prokopp Hautrive

2008-12-01

Full Text Available O objetivo deste estudo foi elaborar um hambúrguer com carne de avestruz, para possibilitar o aproveitamento total da carne de avestruz, utilizando cortes considerados menos nobres como recortes resultantes da desossa. Avaliar sua aceitação entre potenciais consumidores, como apreciadores de carnes e hambúrgueres, bem como sugerir a industrialização e comercialização pelas indústrias como um novo produto de conveniência. Foram elaboradas três formulações de hambúrgueres com diferentes percentuais de carne de avestruz e bovina. As amostras foram analisadas por 50 provadores não treinados, escolhidos em função de gostarem e serem consumidores de hambúrgueres. O hambúrguer de formulação 2, composto por carne bovina (50% e carne de avestruz (50% obteve maior aceitação em relação aos demais. Os teores de lipídios e proteínas das amostras de hambúrgueres encontram-se dentre os valores exigidos pela legislação. Sendo assim, os hambúrgueres formulados com carne de avestruz foram bem aceitos pelos julgadores. O hambúrguer misto, o qual obteve maior aceitação, seria uma alternativa de um produto para a industrialização e comercialização, pois agregado com a carne bovina o custo dos hambúrgueres de avestruz são mais acessíveis.The objective of this study was to prepare a hamburger with ostrich meat, making use of the ostrich meat cuts that are considered less noble such as those resulting form boning. This study also aimed at evaluating its acceptance among potential clients such meat and hamburger consumers as well as suggesting its industrialization as a new product. Three types of hamburgers were prepared with different percentage of ostrich and bovine meat. The samples were tested by 50 tasters without training, but who were hamburger consumers. The hamburger of formulation 2, composed by bovine meat (50% and ostrich meat (50%, obtained better acceptance than the others. The contents of lipids and proteins of

A rastreabilidade da carne suína : estudo de caso

OpenAIRE

Scattone, Guilherme de Siqueira

2014-01-01

O controle de qualidade da carne suína para o agronegócio brasileiro tem a oportunidade de melhoria nos processos, garantindo primordialmente a segurança sanitária do produto. Visando a ampliação do mercado nacional e internacional, a garantia de qualidade é uma consequência. Apesar do histórico crescente de exportação, observa-se que é inexistente um sistema brasileiro que organize o controle efetivo de informações rastreadas desde a origem. Este trabalho tem como objetivo referenciar os par...

Discordance between in silico & in vitro analyses of ACE inhibitory & antioxidative peptides from mixed milk tryptic whey protein hydrolysate.

Science.gov (United States)

Chatterjee, Alok; Kanawjia, S K; Khetra, Yogesh; Saini, Prerna

2015-09-01

ACE inhibitory and antioxidative peptides identified by LCMS/MS, from mixed milk (Bubalus bubalis and Bos taurus) tryptic whey protein hydrolysate, were compared with the in silico predictions. α la and ß lg sequences, both from Bubalus bubalis and Bos taurus, were used for in silico study. SWISS-PROT and BIOPEP protein libraries were accessed for prediction of peptide generation. Study observed gaps in the prediction versus actual results, which remain unaddressed in the literature. Many peptides obtained in vitro, were not reflected in in silico predictions. Differences in identified peptides in separate libraries were observed too. In in silico prediction, peptides with known biological activities were also not reflected. Predictions, towards generation of bioactive peptides, based upon in silico release of proteins and amino acid sequences from different sources and thereupon validation in relation to actual results has often been reported in research literature. Given that computer aided simulation for prediction purposes is an effective research direction, regular updating of protein libraries and an effectual integration, for more precise results, is critical. The gaps addressed between these two techniques of research, have not found any address in literature. Inclusion of more flexibility with the variables, within the tools being used for prediction, and a hierarchy based database with search options for various peptides, will further enhance the scope and strength of research.

Adaptive traits of indigenous cattle breeds: The Mediterranean Baladi as a case study.

Science.gov (United States)

Shabtay, Ariel

2015-11-01

Generally taken, breeds of Bos taurus ancestry are considered more productive, in comparison with Bos indicus derived breeds that present enhanced hardiness and disease resistance, low nutritional requirements and higher capability of feed utilization. While breeds of B. taurus have been mostly selected for intensive production systems, indigenous cattle, developed mostly from indicine and African taurines, flourish in extensive habitats. Worldwide demographic and economic processes face animal production with new challenges - the increasing demand for animal food products. Intensification of animal husbandry is thus a desired goal in stricken parts of the world. An introduction of productive traits to indigenous breeds might serve to generate improved biological and economic efficiencies. For this to succeed, the genetic merit of traits like efficiency of feed utilization and product quality should be revealed, encouraging the conservation initiatives of indigenous cattle populations, many of which are already extinct and endangered. Moreover, to overcome potential genetic homogeneity, controlled breeding practices should be undertaken. The Baladi cattle are a native local breed found throughout the Mediterranean basin. Purebred Baladi animals are rapidly vanishing, as more European breeds are being introduced or used for backcrosses leading to improved production. The superiority of Baladi over large-framed cattle, in feedlot and on Mediterranean pasture, with respect to adaptability and efficiency, is highlighted in the current review. Copyright © 2015 Elsevier Ltd. All rights reserved.

Molecular Characterization and Expression Analysis of Insulin-like Growth Factor-1 and Insulin-like Growth Factor Binding Protein-1 Genes in Qinghai-Tibet Plateau and Lowland

Directory of Open Access Journals (Sweden)

Ya-bing Chen

2015-01-01

Full Text Available Insulin-like growth factor-1 (IGF-1 and insulin-like growth factor binding protein-1 (IGFBP-1 play a pivotal role in regulating cellular hypoxic response. In this study, we cloned and characterized the genes encoding IGF-1 and IGFBP-1 to improve the current knowledge on their roles in highland Bos grunniens (Yak. We also compared their expression levels in the liver and kidney tissues between yaks and lowland cattle. We obtained full-length 465 bp IGF-1 and 792 bp IGFBP-1, encoding 154 amino acids (AA IGF-1, and 263 AA IGFBP-1 protein, respectively using reverse transcriptase-polyerase chain reaction (RT-PCR technology. Analysis of their corresponding amino acid sequences showed a high identity between B. grunniens and lowland mammals. Moreover, the two genes were proved to be widely distributed in the examined tissues through expression pattern analysis. Real-time PCR results revealed that IGF-1 expression was higher in the liver and kidney tissues in B. grunniens than in Bos taurus (p<0.05. The IGFBP-1 gene was expressed at a higher level in the liver (p<0.05 of B. taurus than B. grunniens, but it has a similar expression level in the kidneys of the two species. These results indicated that upregulated IGF-1 and downregulated IGFBP-1 are associated with hypoxia adaptive response in B. grunniens.

Factores de manejo pre y post sacrificio asociados a la presencia de carne DFD en ganado bovino durante la epoca cálida

Directory of Open Access Journals (Sweden)

Cristina Pérez-Linares

2013-01-01

Full Text Available En la evaluación de factores de manejo en su asociación a la presencia de carne DFD durante la época cálida y seca, una serie de cuestionarios fueron aplicados en tres unidades de engorda intensiva y en una planta de sacrificio TipoInspección Federal ubicadas en Mexicali, México. Se incluyó una muestra de 506 canales, en las cuales, en el músculo L. dorsi a las 24 h postsacrificio se registró pH y color (L*,a*,b,* para determinar la calidad de la carne. En la prueba de distribución independiente de carne DFD por variable de manejo se utilizó Chi-cuadrada y como medida de asociación, la razón del producto cruzado (OR junto con IC95%. La presencia de carne DFD por efecto de las prácticas de manejo fue de 13.64 %. De los factores de manejo evaluados, el tiempo y la forma de conducción del ganado hacia la carga, el tiempo de transporte a la planta de sacrificio, la humedad relativa en los corrales de espera, el tiempo de espera entre la manga de conducción y pasillo hacia el cajón de aturdimiento, el tiempo para ingresar al cajón de aturdimiento, el tiempo de permanencia de las canales en el cuarto frío y la temperatura en el centro térmico, resultaron con asociación a la presencia de carne DFD ( P <0.05. Se sugiere especial atención en la capacitación del personal para el buen desempeño de su labor, así como mantener las canales al menos 24h de almacenamiento en frío antes de su comercialización.

O comércio potencial brasileiro de carne bovina no contexto de integração regional

Directory of Open Access Journals (Sweden)

Luciane da Silva Rubin

2008-12-01

Full Text Available Este estudo analisa o potencial exportador do setor brasileiro de carne bovina frente à suposição de futuros acordos de integração regional. Os países ou blocos escolhidos são: União Européia (UE, Acordo de Livre Comércio da América do Norte (Nafta, Comunidade dos Estados Independentes (CEI, República Popular da China (RPC e Japão. Para analisar o potencial exportador do setor de carnes, foram desenvolvidos quatro generalizações metodológicas: o potencial importador dos países, o cálculo da evolução do Índice de Vantagem Revelada das Exportações do Brasil e de seus principais concorrentes, pesquisa bibliográfica das principais barreiras existentes e cálculo do Índice de Orientação Regional. Os resultados, quanto ao potencial importador, indicam que a União Européia (UE constitui-se altamente atrativo para a carne bovina. Os resultados do cálculo das vantagens comparativas revelaram que o Brasil tem alta e crescente competitividade no setor de carnes para o período 1990 a 2003. Quanto aos concorrentes no interior de cada bloco ou país, a União Européia é que apresentou o maior concorrente. Quanto às barreiras impostas, estas revelaram ser, de modo geral, extremamente elevadas e, em alguns casos, impeditivas. Portanto, o setor brasileiro de carnes teria muito a ganhar caso fossem eliminadas tais barreiras. Enfim, na última relação, constata-se alto grau de aceitação das exportações brasileiras de carne bovina àqueles blocos que não têm barreiras sanitárias impeditivas. Contudo, ao cruzar os resultados para o setor, observa-se que, a partir da efetivação de acordos de livre comércio inter-regionais, via Mercosul, ou por acordos bilaterais, com os blocos ou países em estudo, estes trarão ganhos efetivos para o setor brasileiro de carnes.This study analyses the Brazilian beef exportation potential considering the supposition of future agreements of regional integration. The countries or blocks that

VLBA DETERMINATION OF THE DISTANCE TO NEARBY STAR-FORMING REGIONS. III. HP TAU/G2 AND THE THREE-DIMENSIONAL STRUCTURE OF TAURUS

International Nuclear Information System (INIS)

Torres, Rosa M.; Loinard, Laurent; Rodriguez, Luis F.; Mioduszewski, Amy J.

2009-01-01

Using multiepoch Very Long Baseline Array (VLBA) observations, we have measured the trigonometric parallax of the weak-line T Tauri star HP Tau/G2 in Taurus. The best fit yields a distance of 161.2 ± 0.9 pc, suggesting that the eastern portion of Taurus (where HP Tau/G2 is located) corresponds to the far side of the complex. Previous VLBA observations have shown that T Tau, to the south of the complex, is at an intermediate distance of about 147 pc, whereas the region around L1495 corresponds to the near side at roughly 130 pc. Our observations of only four sources are still too coarse to enable a reliable determination of the three-dimensional structure of the entire Taurus star-forming complex. They do demonstrate, however, that VLBA observations of multiple sources in a given star-forming region have the potential not only to provide a very accurate estimate of its mean distance, but also to reveal its internal structure. The proper motion measurements obtained simultaneously with the parallax allowed us to study the kinematics of the young stars in Taurus. Combining the four observations available so far, we estimate the peculiar velocity of Taurus to be about 10.6 km s -1 almost completely in a direction parallel to the Galactic plane. Using our improved distance measurement, we have refined the determination of the position on the H-R diagram of HP Tau/G2, and of two other members of the HP Tau group (HP Tau itself and HP Tau/G3). Most pre-main-sequence evolutionary models predict significantly discrepant ages (by 5 Myr) for those three stars-expected to be coeval. Only in the models of Palla and Stahler do they fall on a single isochrone (at 3 Myr).

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Directory of Open Access Journals (Sweden)

Sunil W Kolte

Full Text Available Tick-borne pathogens (TBP are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD, most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey with native Bos indicus (numerous breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type. The model showed significant association between infection with TBP (particularly apicomplexan parasites and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Science.gov (United States)

Kolte, Sunil W; Larcombe, Stephen D; Jadhao, Suresh G; Magar, Swapnil P; Warthi, Ganesh; Kurkure, Nitin V; Glass, Elizabeth J; Shiels, Brian R

2017-01-01

Tick-borne pathogens (TBP) are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD), most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey) with native Bos indicus (numerous) breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type). The model showed significant association between infection with TBP (particularly apicomplexan parasites) and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic benefit.

Systemic and local anti-Mullerian hormone reflects differences in the reproduction potential of Zebu and European type cattle.

Science.gov (United States)

Stojsin-Carter, Anja; Mahboubi, Kiana; Costa, Nathalia N; Gillis, Daniel J; Carter, Timothy F; Neal, Michael S; Miranda, Moyses S; Ohashi, Otavio M; Favetta, Laura A; King, W Allan

2016-04-01

This study was conducted to evaluate plasma anti-Mullerian hormone (Pl AMH), follicular fluid AMH (FF AMH) and granulosa cell AMH transcript (GC AMH) levels and their relationships with reproductive parameters in two cattle subspecies, Bos taurus indicus (Zebu), and Bos taurus taurus (European type cattle). Two-dimensional ultrasound examination and serum collection were performed on Zebu, European type and crossbreed cows to determine antral follicle count (AFC), ovary diameter (OD) and Pl AMH concentration. Slaughterhouse ovaries for Zebu and European type cattle were collected to determine FF AMH concentrations, GC AMH RNA levels, AFC, oocyte number, cleavage and blastocyst rate. Additionally GC AMH receptor 2 (AMHR2) RNA level was measured for European type cattle. Relationship between AMH and reproductive parameters was found to be significantly greater in Zebu compared to European cattle. Average Pl AMH mean ± SE for Zebu and European cattle was 0.77 ± 0.09 and 0.33 ± 0.24 ng/ml respectively (p = 0.01), whereas average antral FF AMH mean ± SE for Zebu and European cattle was 4934.3 ± 568.5 and 2977.9 ± 214.1 ng/ml respectively (p cattle. Levels of GC AMHR2 RNA in European cattle were correlated to oocyte number (p = 0.01). Crossbred animals were found more similar to their maternal Zebu counterparts with respect to their Pl AMH to AFC and OD relationships. These results demonstrate that AMH reflects differences between reproduction potential of the two cattle subspecies therefore can potentially be used as a reproductive marker. Furthermore these results reinforce the importance of separately considering the genetic backgrounds of animals when collecting or interpreting bovine AMH data for reproductive performance. Copyright © 2016 Elsevier B.V. All rights reserved.

Salida de campo a Santo Domingo de Silos, en Burgos, el 14 de septiembre de 1953

OpenAIRE

Valverde Gómez, José Antonio, 1926-2003

2008-01-01

Salida de campo a Santo Domingo de Silos, en Burgos, el 14 de septiembre de 1953, de la que se anotaron observaciones sobre cangrejos, los siguientes peces: "Foxinellus sp." y Trucha (Salmo trutta o Oncorhynchus mykiss), los siguientes mamíferos: Bos taurus (Vaca), Capra aegagrus hircus (Cabra doméstica) y Galemys pyrenaicus (Desmán pirenaico), y las siguientes aves: Aquila sp. (Águila), Carduelis cannabina (Pardillo común, llamada Colorín y Acanthis cannabina por el autor), Carduelis carduel...

The Psychology of Cows

OpenAIRE

Lori Marino; Kristin Allen

2017-01-01

Domestic cows (Bos taurus) are consumed worldwide as beef and veal, kept as dairy product producers, employed as draft animals in labor, and are used for a long list of other products, including leather and manure. But despite global reliance on cows for thousands of years, most people’s perception of them is as plodding herd animals with little individual personality and very simple social relationships or preferences. Yet, a review of the scientific literature on cow behavior points to more...

AcEST: DK954898 [AcEST

Lifescience Database Archive (English)

Full Text Available d A4FV84 Definition sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus Align length 160 Scor...t alignments: (bits) Value sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taur... 153 6e-37 sp|...Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 152 8e-37 sp|Q9UKD2|MRT4_HUMAN mRNA turno...ver protein 4 homolog OS=Homo sap... 151 2e-36 sp|Q86HD3|MRT4_DICDI mRNA turnover p...rotein 4 homolog OS=Dictyost... 140 5e-33 sp|Q7S302|MRT4_NEUCR mRNA turnover protein 4 homolog OS=Neurospo..

PROCESSAMENTO E AVALIAÇÃO SENSORIAL DA CARNE DOS MOLUSCOS ESCARGOT (Achatina fulica E ARUÁ (Pomacea lineata

Directory of Open Access Journals (Sweden)

S. H. R. BARBOZA

2009-01-01

Full Text Available

O presente trabalho foi desenvolvido com o objetivo de avaliar sensorialmente os produtos do processamento da carne dos moluscos escargot (Achatina fulica e aruá (Pomacea lineata. Foram realizados dois processamentos em conserva (enlatado: triturada e defumada. Na avaliação sensorial da carne triturada observou-se diferença significativa entre os produtos, favorável ao escargot com valor médio de aceitação igual a 5,35 e 4,76 para o aruá. Para os produtos elaborados defumados observou-se uma aceitação igual para as duas espécies (escargot = 4,82 e aruá = 4,49. Esses resultados de aceitação nos permitem admitir que os produtos são tecnicamente e sensorialmente viáveis para consumo (aceitação acima de 60% para os dois casos, mas com tendências ligeiramente favoráveis de preferência para os produtos elaborados com carne de escargot.

Avaliação de Matrizes de Carne Bovina na Produção de Itens de Ensaio de Proficiência para Pesquisa de Salmonella spp.*

Directory of Open Access Journals (Sweden)

Marcelo Luiz Lima Brandão

2014-01-01

Full Text Available Objetivo: Avaliar três tipos de matrizes cárneas (autoclavada a 121ºC/15 min, cozida por 20 min e enlatada na produção de itens de ensaio (IE contendo Salmonella spp., a serem utilizados em um Ensaio de Proficiência (EP, Material e Métodos: O lote de IE foi preparado utilizando a técnica de liofilização e a trealose como crioprotetor e avaliados quando a sua homogeneidade e estabilidade, Resultados: Os lotes produzidos com carne cozida e com carne enlatada não se apresentaram suficientemente homogêneos, Os IE produzidos em matriz carne autoclavada foram considerados suficientemente homogêneos e estáveis à temperatura de ≤-70ºC durante o período de quatro meses, No estudo de estabilidade em curta duração, os IE apresentaram-se suficientemente estáveis nas temperaturas de -20, 4 e 25ºC durante três dias, Conclusão: A carne autoclavada a 121ºC/15 min foi considerada uma matriz satisfatória para produção de IE contendo Salmonella spp, aplicáveis a um EP.

Substituição da farinha de carne suína por fontes vegetais em dietas para carpa-húngara.

OpenAIRE

BERGAMIN, G. T.; RADUNZ NETO, J.; EMANUELLI, T.; LAZZARI, R.; MASCHIO, D.; KNAPP, V.

2011-01-01

O objetivo deste trabalho foi avaliar o crescimento e a qualidade de carcaça de carpa-húngara alimentada com dietas em que houve substituição da farinha de carne suína por farelos de soja e canola, bem como determinar parâmetros bioquímicos do metabolismo dos peixes e a qualidade sensorial do filé. Cada um dos farelos contribuiu com 50% da proteína na mistura. Cinco dietas foram avaliadas, com níveis de substituição (0, 25, 50, 75 e 100%) da proteína da farinha de carne suína pela mistura das...

k-Casein, b-lactoglobulin and growth hormone allele frequencies and genetic distances in Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis cattle

Directory of Open Access Journals (Sweden)

Paola Augusta Kemenes

1999-12-01

Full Text Available The genotypes for k-casein (k-CN, b-lactoglobulin (b-LG and growth hormone (GH were determined by polymerase chain reaction (PCR and restriction enzyme digestion in seven breeds of cattle (Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis. k-Casein had two alleles with the A allele occurring at a higher frequency in Bos indicus breeds (0.93, 0.92 and 0.91% for Gyr, Guzerá and Nelore, respectively. The b-lactoglobulin locus had two alleles in all of the breeds. European breeds had a higher frequency of the b-LG A allele than Zebu breeds. The GH locus had two alleles (L and V in Bos taurus and was monomorphic (L allele only in all of the Bos indicus breeds evaluated. The highest frequency for the V allele was observed in Charolais cattle. The markers used revealed a considerable similarity among breeds, with two main groups being discernible. One group consisted of Zebu and Santa Gertrudis breeds and the other consisted of European and Canchim breeds.Os genótipos de k-caseína (k-CN, b-lactoglobulina (b-LG e hormônio de crescimento foram determinados por reação em cadeia de polimerase (PCR e digestão com enzima de restrição em sete raças de bovinos (Nelore, Gir, Guzerá, Caracu, Charolesa, Canchim and Santa Gertrudis. A k-caseína apresentou dois alelos e as freqüências mais elevadas para o alelo A foram observadas em Bos indicus (0,93, 0,92 e 0,91% para as raças Gir, Guzerá e Nelore, respectivamente. A b-lactoglobulina apresentou dois alelos em todas as raças estudadas, sendo a freqüência do alelo A mais elevada nas raças européias. O loco de hormônio de crescimento apresentou dois alelos em Bos taurus e foi monomórfico (alelo L em todas as raças zebuínas. A maior freqüência para o alelo V foi observado na raça Charolesa. Os marcadores investigados revelaram alta similaridade entre as raças, com a formação de dois grupos principais: um composto de raças zebuínas e a raça Santa Gertrudis e outro

Possible maternal offloading of metals in the plasma, uterine and capsule fluid of pregnant ragged-tooth sharks (Carcharias taurus) on the east coast of South Africa.

Science.gov (United States)

Naidoo, Kristina; Chuturgoon, Anil; Cliff, Geremy; Singh, Sanil; Ellis, Megan; Otway, Nicholas; Vosloo, Andre; Gregory, Michael

2017-07-01

We studied the possible metal offloading onto the progeny of three pregnant female ragged-tooth sharks (Carcharias taurus) (C. taurus). The presences of five metals, i.e. aluminium (Al), arsenic (As), cadmium (Cd), lead (Pb) and selenium (Se) were validated by mass spectrometry in the maternal plasma as well as the intracapsular and uterine fluids (UF) in which embryos develop. Metals were ranked in a decreasing concentration as follows: Plasma: As > Al > Se > Pb > Cd; ICF: As > Se > Al > Cd > Pb and UF: As > Se > Al > Cd > Pb. As was present in the highest concentration in all three sharks. Al, Pb and Cd were found to be the highest within the plasma, while concentrations of Se were similar in all three fluids. These results indicate that C. taurus embryos are exposed to metals during early development, but the impact of this exposure remains unknown. To the best of our knowledge, this is the first investigation to confirm the presence of metals in the fluids that surround the developing C. taurus embryos, a species that is already listed as vulnerable.

PROCESSO DE ALTERAÇÃO ENZIMÁTICA DA MATRIZ PROTÉICA DE CARNE BOVINA, INFLUÊNCIA SOBRE A VISCOSIDADE

Directory of Open Access Journals (Sweden)

MARICê NOGUEIRA DE OLIVEIRA

2009-07-01

Full Text Available

RESUMO: A matriz protéica da carne bovina foi enzimaticamente alterada visando seu uso potencial em formulações de dietas especiais ou por sonda. Determinou-se a viscosidade de amostras de hidrolisado em diferentes tempos de processo e testou-se a aplicabilidade do modelo de Ostwald-de-Waele no tratamento dos resultados. Na faixa de velocidades angulares ensaiadas o hidrolisado protéico de carne bovina comportou-se como um fluído não-newtoniano, pseudoplástico. A viscosidade média do hidrolisado é de 1,7 a –52,7 poise. Os valores máximos para a viscosidade são alcançados aos 90 minutos de processo. PALAVRAS – CHAVE: Carne Bovina; hidrolisados protéicos; viscosidade.

Estimación de un Modelo de Demanda Casi Ideal para Determinar Cambios en la Estructura de Consumo de Carnes en los Estados Unidos de América

Directory of Open Access Journals (Sweden)

Antonio Kido Cruz

2010-12-01

Full Text Available El objetivo principal de este trabajo es el de explicar el comportamiento en la estructura de consumo en el mercado de carnes norteamericano para el periodo 1960 a 2005. Para la consecución de este objetivo se estudia la demanda de tres tipos de carne (res, puerco y pollo en los Estados Unidos de América (USA y se evalúan las elasticidades precio de la demanda, precio cruzada y del gasto entre los distintos bienes incluidos. Se utiliza el modelo casi ideal de demanda bajo el método de ecuaciones aparentemente no relacionadas empleando el programa Matrix Laboratory (Matlab, 2009a. Los resultados muestran que es importante tomar en cuenta las pruebas de estacionaridad sobre todo en los vectores de precios para poder implementar un modelo de corrección de errores y señalan que existe una recomposición de la demanda de carne hacia el consumo de la carne de pollo con una elasticidad precio cruzada de 0.352 y 0.305.

Patrones de consumo de carne en el noroeste de México

OpenAIRE

Cristina Taddei; Martín Preciado; Jesús Robles; Cristina Garza

2012-01-01

En gran medida, el conocimiento de la forma en la que se comporta el consumidor determina el desempeño en el mercado de un producto determinado. Se utiliza un algoritmo de agrupamiento de datos, en el marco del reconocimiento de patrones, para identificar tipos de consumidores de carne en el noroeste de México, con el objetivo de conocer las preferencias de consumo y con ello orientar decisiones de mercado por parte de los productores o bien de funcionarios responsables de políticas de foment...

Mercado consumidor de carne suína e derivados em Belo Horizonte Pork consumer market in Belo Horizonte, Brazil

Directory of Open Access Journals (Sweden)

I.G. Faria

2006-04-01

Full Text Available Avaliou-se o comportamento do mercado consumidor de carne suína e seus derivados em Belo Horizonte. Foram entrevistados 401 consumidores, homens e mulheres, maiores de 19 anos de idade, mantendo-se a proporcionalidade observada no censo populacional. Além de sexo e faixa etária, escolaridade, ocupação e renda familiar foram levantadas para compor os fatores condicionantes da pesquisa. A carne suína in natura é consumida até três vezes por semana pela maioria da população (61,6%, em função de seu sabor e versatilidade. A compra costuma ser feita num mesmo estabelecimento comercial, sendo preferidos os cortes feitos na hora. O consumo de derivados da carne suína é maior que o da carne in natura em razão da grande variedade de produtos. Os consumidores acreditam que a carne suína in natura e derivados sejam perigosos à saúde pelo excesso de gordura ou de colesterol (38,4% e por transmitir doenças (27,8%. Sexo, idade e renda familiar têm influência no consumo, mas não escolaridade e ocupação. As marcas dos produtos derivados aumentam a confiabilidade e indicam a origem, para a maioria dos consumidores. A população, embora mais atenta aos conceitos de alimentação saudável e segura, não conhece o significado e a função da rastreabilidade e certificação de origem dos produtos. Para aumentar o consumo e justificar a criação de programa de certificação da carne suína e derivados em Minas Gerais, é necessário campanha dirigida de marketing para eliminar os preconceitos em relação a estes produtos.This study aimed to assess the behavior of the consumer in relation to pork and pork products. Four hundred and one consumers, men and women over 19 years old, were randomly sampled from the residents of Belo Horizonte, Minas Gerais, to supply information about pork and pork products consumption, besides school background, occupation and family income. Consumption of fresh pork was directly affected by concepts related

Global mapping of miRNA-target interactions in cattle (Bos taurus)

DEFF Research Database (Denmark)

Scheel, Troels K H; Moore, Michael J; Luna, Joseph M

2017-01-01

With roles in development, cell proliferation and disease, micro-RNA (miRNA) biology is of great importance and a potential therapeutic target. Here we used cross-linking immunoprecipitation (CLIP) and ligation of miRNA-target chimeras on the Argonaute (AGO) protein to globally map miRNA interact...

DEVELOPMENT OF HAMBURGER USING ADULT SHEEP MEAT AND OAT FLOUR DESENVOLVIMENTO DE HAMBÚRGUER DE CARNE DE OVINOS DE DESCARTE ENRIQUECIDO COM FARINHA DE AVEIA

Directory of Open Access Journals (Sweden)

Luís Carlos Oliveira dos Santos Júnior

2009-12-01

Full Text Available

Carne de perra, de Fátima Sime: la persistencia de lo urgente

Directory of Open Access Journals (Sweden)

Cristian Montes Capó

2014-06-01

Through an analysis of the novel Carne de perra by Chilean author Fátima Sime, this article aims to demonstrate the legitimate, enduring social construction that persists in the symbolic realm within post-dictatorship Chile. It addresses a shared determination to revive the collective memory to allow the as yet uncompleted collective mourning process to take place before fading into oblivion. The novel reviewed here esthetically processes and elaborates upon the claims of that social discourse.

16S partial gene mitochondrial DNA and internal transcribed spacers ribosomal DNA as differential markers of Trichuris discolor populations.

Science.gov (United States)

Callejón, R; Halajian, A; de Rojas, M; Marrugal, A; Guevara, D; Cutillas, C

2012-05-25

Comparative morphological, biometrical and molecular studies of Trichuris discolor isolated from Bos taurus from Spain and Iran was carried out. Furthermore, Trichuris ovis isolated from B. taurus and Capra hircus from Spain has been, molecularly, analyzed. Morphological studies revealed clear differences between T. ovis and T. discolor isolated from B. taurus but differences were not observed between populations of T. discolor isolated from different geographical regions. Nevertheless, the molecular studies based on the amplification and sequencing of the internal transcribed spacers 1 and 2 ribosomal DNA and 16S partial gene mitochondrial DNA showed clear differences between both populations of T. discolor from Spain and Iran suggesting two cryptic species. Phylogenetic studies corroborated these data. Thus, phylogenetic trees based on ITS1, ITS2 and 16S partial gene sequences showed that individuals of T. discolor from B. taurus from Iran clustered together and separated, with high bootstrap values, of T. discolor isolated from B. taurus from Spain, while populations of T. ovis from B. taurus and C. hircus from Spain clustered together but separated with high bootstrap values of both populations of T. discolor. Furthermore, a comparative phylogenetic study has been carried out with the ITS1and ITS2 sequences of Trichuris species from different hosts. Three clades were observed: the first clustered all the species of Trichuris parasitizing herbivores (T. discolor, T. ovis, Trichuris leporis and Trichuris skrjabini), the second clustered all the species of Trichuris parasitizing omnivores (Trichuris trichiura and Trichuris suis) and finally, the third clustered species of Trichuris parasitizing carnivores (Trichuris muris, Trichuris arvicolae and Trichuris vulpis). Copyright © 2011 Elsevier B.V. All rights reserved.

Medições instrumentais e sensoriais de dureza e suculência na carne caprina Instrumental and sensorial assessment of tenderness and juiciness in goat meat

Directory of Open Access Journals (Sweden)

Ângela da Silva Borges

2006-12-01

Full Text Available Foi avaliado o efeito do tipo de músculo e da maturação sobre algumas propriedades funcionais e sensoriais da carne caprina. Utilizaram-se os músculos longissimus dorsi, semimembranosus e biceps femoris de cabras com aproximadamente 20 meses de idade. A carne, sem maturar e maturada por sete dias, foi avaliada para perdas por cocção (PPC e força de cisalhamento (FC, por métodos instrumentais, e para dureza sensorial (DS e suculência sensorial (SS, por provadores treinados. As PPC não sofreram efeito significativo (p > 0,05 do tipo de músculo e da maturação da carne. A carne sem maturar do músculo semimembranosus apresentou maior FC que aquelas dos músculos longissimus dorsi e biceps femoris. Em relação ao tipo de músculo, após a maturação, as carnes dos músculos semimembranosus e biceps femoris se apresentaram mais macias que a do longissimus dorsi. Quanto ao efeito da maturação, a FC da carne do músculo semimembranosus diminuiu significativamente. A FC apresentou correlação positiva com DS e correlação negativa com SS. Dureza e suculência avaliadas de forma sensorial apresentaram correlação negativa. A maturação por 7 dias diminuiu a dureza, mas não afetou as PPC da carne dos músculos semimembranosus e bíceps femoris.The effect of muscle type and aging for seven days on certain functional and sensory properties of goat meat was evaluated. The experiment used meat from longissimus dorsi, semimembranosus and biceps femoris muscles from female goats that were approximately 20 months. After 24 h of being slaughtered and seven days, the aging meat was instrumentally analyzed for cooking losses (CL and shear force (SF, as well as for sensory firmness (F and juiciness (J by a trained panel. CL was not affected (p > 0.05 by the type of muscle and aging of the meat. Before aging, meat from semimembranosus muscles showed higher SF than those from longissimus dorsi or bicep femoris muscles. After aging, meat from

Individual taper models for natural cedar and Taurus fir mixed stands of Bucak Region, Turkey

Directory of Open Access Journals (Sweden)

Ramazan Özçelik

2017-11-01

Full Text Available In this study, we assessed the performance of different types of taper equations for predicting tree diameters at specific heights and total stem volumes for mixed stands of Taurus cedar (Cedrus libani A. Rich. and Taurus fir (Abies cilicica Carr.. We used data from mixed stands containing a total of 131 cedar and 124 Taurus fir trees. We evaluated six commonly used and well-known forestry taper functions developed by a variety of researchers (Biging (1984, Zakrzewski (1999, Muhairwe (1999, Fang et al. (2000, Kozak (2004, and Sharma and Zhang (2004. To address problems related to autocorrelation and multicollinearity in the hierarchical data associated with the construction of taper models, we used appropriate statistical procedures for the model fitting. We compared model performances based on the analysis of three goodness-of-fit statistics and found the compatible segmented model of Fang et al. (2000 to be superior in describing the stem profile and stem volume of both tree species in mixed stands. The equation used by Zakrzewski (1999 exhibited the poorest fitting results of the three taper equations. In general, we found segmented taper equations to provide more accurate predictions than variable-form models for both tree species. Results from the non-linear extra sum of squares method indicate that stem tapers differ among tree species in mixed stands. Therefore, a different taper function should be used for each tree species in mixed stands in the Bucak district. Using individual-specific taper equations yields more robust estimations and, therefore, will enhance the prediction accuracy of diameters at different heights and volumes in mixed stands.

TAURUS observations of the emission-line velocity field of Centaurus A (NGC 5128)

International Nuclear Information System (INIS)

Taylor, K.; Atherton, P.D.

1983-01-01

Using TAURUS - an Imaging Fabry Perot system in conjunction with the IPCS on the AAT, the authors have studied the velocity field of the Hα emission line at a spatial resolution of 1.7'' over the dark lane structure of Centaurus A. The derived velocity field is quite symmetrical and strongly suggests that the emission line material is orbiting the elliptical component, as a warped disc. (orig.)

Taurus Hill Observatory Scientific Observations for Pulkova Observatory during the 2016-2017 Season

Science.gov (United States)

Hentunen, V.-P.; Haukka, H.; Heikkinen, E.; Salmi, T.; Juutilainen, J.

2017-09-01

Taurus Hill Observatory (THO), observatory code A95, is an amateur observatory located in Varkaus, Finland. The observatory is maintained by the local astronomical association Warkauden Kassiopeia. THO research team has observed and measured various stellar objects and phenomena. Observatory has mainly focused on exoplanet light curve measurements, observing the gamma rays burst, supernova discoveries and monitoring. We also do long term monitoring projects.

Diagnostic of the swine meat consumer profile in Aquidauana-MS Diagnóstico do perfil do consumidor de carne suína no município de Aquidauana-MS

Directory of Open Access Journals (Sweden)

Diovani Paiano

2011-03-01

Full Text Available This work aimed to diagnose the pork meat consumer profile in the city of Aquidauana-MS as the product knowledge and factors related to choice, frequency and amount of meat consumed. The diagnosis was made through semi-structured interviews with consumers directly at sale point. The preference for consumption of beef, chicken and fish, in instead of pork was observed, however, a significant part of the population said it was ready to increase this consumption. The highest frequency of pork meat consumption was once a month. The most consumed were processed bologna, ham, sausage and bacon. Reasons for not consuming pork were not being appreciated and considered a unhealthy food because of the high fat and cholesterol. Ignorance of production method, origin, nutrition, and the many ways to buy and prepare the pork has led to ratify the low local consumption. Consumers of pork meat consider it tasty and tender, however, unhealthy and expensive. Among the factors that could increase consumption stood out promotions, reduction of fat and cholesterol and reduction of price. Are suggested campaigns to increase consumption of pork meat based, especially in low prices, focused on clarifications regarding the nutritional and health qualities, and actions that allow people to find new ways of preparation and consumption.Este trabalho foi conduzido com o objetivo de diagnosticar o perfil do consumidor de carne suína no município de Aquidauana-MS quanto ao conhecimento do produto e os fatores relacionados à escolha, periodicidade e quantidade de carne consumida. O diagnóstico foi realizado por meio de entrevistas semi-estruturadas com consumidores diretamente nos postos de venda. Houve preferência no consumo de carne bovina, frango e peixes, e a carne suína mostrou-se a menos consumida, porém, uma parcela expressiva da população afirmou estar disposta a aumentar este consumo. A maior frequência de consumo de carne suína foi de uma vez ao mês e os

Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

Science.gov (United States)

Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

2010-01-01

A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

Improving meat quality through natural antioxidants Mejoramiento de la calidad de carne utilizando antioxidantes naturales

Directory of Open Access Journals (Sweden)

Valeria Velasco

2011-06-01

Full Text Available Nowadays, consumers are demanding more natural foods, obliging the industry to include natural antioxidants in foods. Natural antioxidants have been used instead of synthetic antioxidants to retard lipid oxidation in foods to improve their quality and nutritional value. This review discusses some aspects of recent research on antioxidant activity of plant extracts and natural compounds to improve meat quality. Many herbs, spices, and their extracts have been reported as having high antioxidant capacity, such as some plants of the Lamiaceae family, e.g., oregano (Origanum vulgare L., rosemary (Rosmarinus officinalis L., and sage (Salvia officinalis L.. The antioxidant activity of these plants is attributed to their phenolic compound content, which includes volatile compounds also known as essential oils. Several factors that cause some differences on the antioxidant activity of plant extracts include: type of solvent used during extraction, measurement method, and number of samples. Some studies have demonstrated that shelf-life and meat quality can be improved by using natural antioxidants in some stages of meat production. The main effects of these compounds are reducing microbial growth and lipid oxidation during storage. Nevertheless, more research is needed to determine antimicrobial activity of natural antioxidants in meat during storage, identify the main metabolic pathway of these compounds, and its effect on other meat quality parameters.Actualmente los consumidores están demandando alimentos más naturales, lo cual ha causado el interés de la industria de incluir antioxidantes naturales en los alimentos para retardar la oxidación de los lípidos, mejorar su calidad y valor nutricional, reemplazando los antioxidantes sintéticos. En esta revisión se discuten algunos aspectos de las investigaciones más recientes acerca de la actividad antioxidante de extractos vegetales y compuestos naturales y su uso para mejorar la calidad de carne

Efeito da maturação e da suplementação da dieta com vitamina E sobre a tenrura e a estabilidade colorimétrica da carne de bovino

OpenAIRE

Milharadas, Nuno Ricardo Duarte

2015-01-01

Dissertação de Mestrado Integrado em Medicina Veterinária A deterioração da qualidade da carne ocorre, entre outros fatores, devido à oxidação lipídica e dos pigmentos musculares. A oxidação dos lípidos leva ao desenvolvimento de odores e sabores desagradáveis e a oxidação dos pigmentos dos músculos torna a carne pouco apelativa ao consumidor no ato de compra, uma vez que afeta negativamente a cor (parâmetro fundamental para a aceitabilidade da carne). Esta deterioração é responsável pelo ...

Carcaça e qualidade da carne dez jacarés (Caiman latirostris ou jacaré de-papo amarelo e Caiman jacaré

Directory of Open Access Journals (Sweden)

María Elena Cossu

2007-10-01

Full Text Available Dez jacarés (Caiman latirostris ou jacaré de-papo amarelo e Caiman jacaré de diferentes comprimentos e pesos vivos foram carneados com o fim de determinar valores de rendimento de carcaça e qualidade da carne. O rendimento de carcaça foi de 54% correspondendo um 62% a porção cárnea. A relação Carne/Osso da carcaça se estimou em aproximadamente 1,51 enquanto que 6,4% correspondeu a depósitos gordurosos, fundamentalmente periviscerais. O rabo representou 27,4% do peso de carcaça estando composta por 21,9% de carne e 5,5% de osso. O valor de pH post mortem, 6,88 ± 0,22 medido no rabo, decresceu até 6,49 ± 0,23 às 24h e 5,85 ± 0,12 logo de descongelamento. As perdas de cocção se contiveram (<0,3% e a dureza Warner Bratzler mostrou valores inferiores a 3 kg. A análise da cor da carne crua permite caracterizá-la como una carne luminosa (L*=67,7 e clara (C*= 5,5. Enquanto que o conteúdo gorduroso variou significativamente em função do peso (2,5-29,8%MS, a porcentagem protéica foi relativamente constante e próxima a 65%MS. Do total de ácidos gorduroso do rabo, 41,4% foram saturados, 39,1% monoinsaturados e 10,7% poliinsaturados, com uma relação n-6/n-3 próxima a ótimo (3,16. O ácido gorduroso foi o predominante seguido pelos ácidos palmítico, esteárico y linoléico. Dentro dos insaturados, foi elevado o conteúdo de ácidos gordurosos essenciáis= araquidônico (4,34 e família n-3 (EPA=0,76 e DHA=0,57; a esta característica nutritiva positiva se soma o alto conteúdo em CLA (1,87%Agtot.

Correlations between the stellar and disc properties of Taurus PMS stars in the GASPS sample

NARCIS (Netherlands)

Alonso-Martínez, Miguel; Riviere-Marichalar, Pablo; Pascual, Natalia; Montesinos, Benjamín; Howard, Christian D.; Sandell, Göran; Meeus, Gwendolyn; Eiroa, Carlos; Dent, Bill

The Herschel Open Time Key Programme GASPS (P.I. B. Dent) has observed a large number of pre-main sequence TTauri stars in Taurus with PACS (photometry and spectroscopy). In addition, we have also carried out new ground-based optical and near-IR observations (photometry and spectroscopy) of most of

En el arca de Arreola, carne y palabra se buscan (sobre su Bestiario de 1958

Directory of Open Access Journals (Sweden)

François Gramusset

2015-01-01

Full Text Available Este artículo es un análisis del compendio “zoológico” presente en Bestiario de Juan José Arreola. El acercamiento al universo imaginario de Arreola se aborda en primer lugar a través de la puesta en diálogo del Bestiario con el Physiologos, texto embrionario de los bestiarios de la tradición occidental y en segundo lugar a través de un análisis de texto. En esencia se pretende subrayar el modo en que los animales del bestiario (a través de su lexicalización se encarnan en representaciones imaginarias, vinculadas éstas con los tiempos primordiales. Para tal fin estudiamos tres paradigmas clasificatorios de la carne animal que denominamos: tierra, aire, agua. Dicha clasificación pretende dar cuenta de la significación espiritual de la palabra en el libro de Arreola y a la vez reflejar la manera en que los animales del bestiario simbolizan la carne humana, hecha posible a través del lenguaje poético.

Comparison of milk fatty acid profiles measured on Kouri cows near Lake Chad and on dairy cattle as reported by meta-analytical data.

Science.gov (United States)

Bada Algom, O; Fabry, C; Leroy, P L; Hornick, J-L

2017-06-01

Kouri (Bos taurus) is a breed aboriginal from Lake Chad and threatened with extinction. This study aimed to compare milk fatty acid profiles measured on Kouri cows and on high-yielding dairy cattle in Europe and elsewhere as reported by meta-analytical data (22 experimentations). Milk samples were collected from 14 Kouri dairy cows in dry season (March to June) and fatty acids (FA) were determined by gas chromatography. Overall, 32 FA have been identified. Kouri showed lower values (P pastures by Kouri cows.

Dicty_cDB: AFH742 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AC115581 |pid:none) Dictyostelium discoideum chromosom... 477 e-133 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia...lus 2 days neonate thymus... 84 3e-17 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... ... |pid:none) Homo sapiens mRNA for achalasia, a... 79 4e-16 (Q9NRG9) RecName: Full...0826 fis, cl... 79 5e-16 BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 80 6e-16 EF14

Polimorfismo g.17924a>g en el gen fasn y su relación con la composición de ácidos grasos (MUFA y CLA) En la carne de novillos aberdeen angus

OpenAIRE

Inostroza, Karla; Larama, Giovanni; Sepúlveda, Néstor

2013-01-01

El interés en la composición de ácidos grasos de la carne bovina está relacionado con producir alimentos más saludables, por ejemplo, con altos contenidos de ácidos grasos monoinsaturados (MUFA) y ácido linoleico conjugado (CLA), debido a que la carne es considerada un alimento con un excesivo contenido graso. El principal objetivo fue determinar la relación del polimorfismo g.17924A>G en el gen FASN con la composición de ácidos grasos en la carne de bovinos Aberdeen Angu...

Efeito da idade de desmame e suplementação no desenvolvimento de novilhas de corte Effect of weaning age and supplementation on beef heifers growth

Directory of Open Access Journals (Sweden)

Luciane Salgueiro Pio de Almeida

2004-12-01

Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho de 47 novilhas de corte cruzas Bos taurus x Bos indicus até os dois anos de idade, desmamadas precocemente (DP, com idade média de 91 dias e peso mínimo de 70 kg de peso vivo, ou desmamadas à idade convencional (DC, com média de 170 dias de idade e 130,3 kg, suplementadas (Su ou não (NSu com suplemento comercial com 14% de proteína bruta e 75% de NDT, durante 91 dias no primeiro inverno pós-desmame. Os animais do DP e o grupo não-suplementado apresentaram menores pesos vivos até um ano de idade. A idade do desmame não influenciou a taxa de prenhez das novilhas (77,3 e 72%, para o DP e DC, respectivamente. A suplementação no primeiro inverno não influenciou o desempenho das novilhas aos dois anos de idade. O desmame precoce não afetou o desenvolvimento e a fertilidade das novilhas aos dois anos de idade, quando comparado ao desmame à idade convencional.The experiment was conducted to evaluate the performance of 47 Bos taurus x Bos indicus beef heifers until two years of age. Heifers were early weaned (EW with average age of 91 days and minimum of 70 kg of liveweight or weaned at conventional age with average of 170 days and average liveweight of 130.3 kg (CW, supplemented (Su or not (NSu with concentrate containing 14% crude protein and 75% total digestible nutrients (TDN during 91 days in the first winter. The early weaning and the no supplemented group were lightier until one year of age. Weaning age did not affect pregnancy rate (77.3% and 72% to EW and CW, respectively. The supplementation during the first winter did not affect the heifers performance until two years of age. Early weaning did not affected the growth and the fertility of heifers until two years of age when compaired with the weaning at the conventional age.

Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

Directory of Open Access Journals (Sweden)

Luchman Hakim

2015-09-01

Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

"I am in control of my life": the male homosexual stereotype in the movies A Navalha na carne (1969 and a Rainha Diaba (1974 "Na minha vida, mando eu": o estereótipo do homossexual masculino nos filmes A navalha na carne (1969 e A Rainha Diaba (1974

Directory of Open Access Journals (Sweden)

Rafael de Luna Freire

2009-09-01

Full Text Available "I am in control of my life": the male homosexual stereotype in the movies A Navalha na Carne (1969 and A Rainha Diaba (1974 — This paper discusses the question of male homosexual stereotyping in Brazilian cinema, taking as the object of study the homosexual characters of the movies A navalha na carne (directed by Braz Chediak, 1970 and A Rainha Diaba (directed by Antonio Carlos da Fontoura, 1974, based on the works of the author Plínio Marcos. Using texts by authors such as Richard Dyer, Robert Stam and Ella Shohat, I defend the need and importance of a historiographical analysis of stereotypes in cinema. O presente artigo discute a questão do estereótipo do homossexual masculino no cinema brasileiro, tomando como objeto de estudo os personagens homossexuais dos filmes A navalha na carne (1970 e A Rainha Diaba (1974, baseados em obras do autor santista Plínio Marcos. Através de textos de autores como Richard Dyer, Robert Stam e Ella Shohat, defendo a necessidade e a importância de uma análise historicizante dos estereótipos no cinema.

Comparison of methanogen diversity of yak (Bos grunniens) and cattle (Bos taurus) from the Qinghai-Tibetan plateau, China

Science.gov (United States)

2012-01-01

Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak) and normal animal (cattle) in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones) and four cattle (205 clones) from the Qinghai-Tibetan Plateau area (QTP). Overall, a total of 414 clones (i.e. sequences) were examined and assigned to 95 operational taxonomic units (OTUs) using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC) were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110) was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle. PMID:23078429

Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

Directory of Open Access Journals (Sweden)

Huang Xiao

2012-10-01

Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

Qualidade da carne maturada de bovinos Red Norte e Nelore Aged meat quality in Red Norte and Nellore cattle

Directory of Open Access Journals (Sweden)

Patrícia Lopes Andrade

2010-08-01

Full Text Available O objetivo neste trabalho foi avaliar a qualidade da carne do músculo longissimus thoracis de bovinos durante a maturação. Amostras de 22 bovinos Nelore e 22 Red Norte machos, com 24 meses de idade, foram coletadas às 24 horas post mortem, mantidas a 2oC e analisadas aos 1, 7, 14 e 21 dias. Os animais foram terminados em confinamento (112 dias com silagem de milho (50% e concentrado (50% à vontade. Os valores de pH final, perda por cocção, umidade, proteína, gordura e cinzas foram semelhantes entre as amostras de animais Nelore e Red Norte. O teor de vermelho (a* e a intensidade de amarelo (b* foram semelhantes entre as carnes dos dois grupos genéticos, porém a luminosidade (L* foi maior nas amostras de animais Red Norte. A maturação afetou significativamente a luminosidade, o teor de vermelho e amarelo, croma (C*, o ângulo de tonalidade (H* e a percepção subjetiva da cor (ΔE, de forma que as alterações de cor mais importantes ocorreram entre 7 e 14 dias. A força de cisalhamento na carne dos animais Red Norte foi cerca de 0.9 kg inferior às dos animais Nelore. A maturação influenciou a força de cisalhamento ao longo da maturação e determinou reduções de 1,09; 0,21 e 0,56 kg nos períodos de 1 a 7; 7 a 14 e 14 a 21 dias, respectivamente. O índice de fragmentação miofibrilar foi maior na carne dos animais Red Norte e nas amostras maturadas por 21 dias. A carne dos animais Red Norte apresentou maior luminosidade e maciez. A maturação melhora a maciez das carnes, por reduzir a força de cisalhamento, porém modifica a cor, cujas alterações mais importantes acontecem entre 7 e 14 dias. A escolha do tempo de maturação mais adequado para as carnes bovinas depende do atributo a ser valorizado.The objective in this study was to evaluate meat quality of longissimus thoracisi muscle during ageing. Samples from 22 Nelore bovines and 22 Red Norte males at 24 months of age were collected at 24 hours post mortem, kept at 2º

A Novel Bromophenol Derivative BOS-102 Induces Cell Cycle Arrest and Apoptosis in Human A549 Lung Cancer Cells via ROS-Mediated PI3K/Akt and the MAPK Signaling Pathway

Directory of Open Access Journals (Sweden)

Chuan-Long Guo

2018-01-01

Full Text Available Bromophenol is a type of natural marine product. It has excellent biological activities, especially anticancer activities. In our study of searching for potent anticancer drugs, a novel bromophenol derivative containing indolin-2-one moiety, 3-(4-(3-([1,4′-bipiperidin]-1′-ylpropoxy-3-bromo-5-methoxybenzylidene-N-(4-bromophenyl-2-oxoindoline-5-sulfonamide (BOS-102 was synthesized, which showed excellent anticancer activities on human lung cancer cell lines. A study of the mechanisms indicated that BOS-102 could significantly block cell proliferation in human A549 lung cancer cells and effectively induce G0/G1 cell cycle arrest via targeting cyclin D1 and cyclin-dependent kinase 4 (CDK4. BOS-102 could also induce apoptosis, including activating caspase-3 and poly (ADP-ribose polymerase (PARP, increasing the Bax/Bcl-2 ratio, enhancing reactive oxygen species (ROS generation, decreasing mitochondrial membrane potential (MMP, ΔΨm, and leading cytochrome c release from mitochondria. Further research revealed that BOS-102 deactivated the PI3K/Akt pathway and activated the mitogen-activated protein kinase (MAPK signaling pathway resulting in apoptosis and cell cycle arrest, which indicated that BOS-102 has the potential to develop into an anticancer drug.

Control de calidad y seguridad de la carne y productos cárnicos curados mediante el uso de sensores enzimáticos

OpenAIRE

HERNÁNDEZ CÁZARES, ALEIDA SELENE

2011-01-01

Inmediatamente después del sacrificio del animal, se inician en la carne un gran número de cambios bioquímicos que son críticos para definir el desarrollo de la calidad. La evaluación de algunos metabolitos derivados de estos procesos ha sido propuesta como método rápido y simple para determinar la calidad de la carne y de los productos cárnicos. Actualmente, la técnica más utilizada en la detección de estos compuestos es la cromatografía líquida de alta resolución (HPLC). Sin embargo, el cre...

Temperature Studies for ATLAS MDT BOS Chambers

CERN Document Server

Engl, A.; Biebel, O.; Mameghani, R.; Merkl, D.; Rauscher, F.; Schaile, D.; Ströhmer, R.

Data sets with high statistics taken at the cosmic ray facility, equipped with 3 ATLAS BOS MDT chambers, in Garching (Munich) have been used to study temperature and pressure effects on gas gain and drifttime. The deformation of a thermally expanded chamber was reconstructed using the internal RasNik alignment monitoring system and the tracks from cosmic data. For these studies a heating system was designed to increase the temperature of the middle chamber by up to 20 Kelvins over room temperature. For comparison the temperature effects on gas properties have been simulated with Garfield. The maximum drifttime decreased under temperature raise by -2.21 +- 0.08 ns/K, in agreement with the results of pressure variations and the Garfield simulation. The increased temperatures led to a linear increase of the gas gain of about 2.1% 1/K. The chamber deformation has been analyzed with the help of reconstructed tracks. By the comparison of the tracks through the reference chambers with these through the test chamber ...

Caracterização do consumidor de carne de frango da cidade de Porto Alegre Characterization of the chicken meat consumer of Porto Alegre, RS, Brazil

Directory of Open Access Journals (Sweden)

Dione Carina Francisco

2007-02-01

Full Text Available A preocupação com a segurança alimentar tem mudado a forma como os consumidores vêem os produtos cárneos, fazendo com que busquem informações sobre os alimentos que consomem. Neste sentido, esta pesquisa teve como objetivo caracterizar o consumidor porto-alegrense de carne de frango. Foram entrevistados 393 consumidores durante o período de abril a julho de 2004. Os resultados demonstram que a carne de frango é a segunda carne preferida dos consumidores e que os cortes e empanados de frango são os produtos mais consumidos. Os consumidores acreditam que a gripe do frango e a salmonelose são as principais doenças veiculadas por esta carne.The concern with the alimentary security has changed the form as the consumers see the meaty products; searching information on the foods that consume. In this direction, this research was aimed at characterizing the chicken meat consumer of Porto Alegre, Brazil. They had been interviewed 393 consumers during the period of April the July of 2004. The results demonstrate that the chicken meat is the second preferred meat of the consumers, and that the empanados cuts and of chicken are the most consumed products. The consumers believe that the bird flu and salmonelose are the main illnesses propagated by this meat.

Utilização do trigo e do centeio na alimentação do frango de carne

OpenAIRE

Mourão, J.L

2001-01-01

Estudo realizado a fim de conhecer os efeitos do centeio e da sua suplementação com xilanases nas performances de crescimento do frango de carne. A centeio afetou negativamente os resultados mas os enzimas não tiveram efeitos evidentes.

NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0952 ref|NP_003851.1| barrier to autointegration factor 1 [Homo sapien...s] ref|NP_892033.1| barrier to autointegration factor 1 [Bos taurus] ref|XP_854776.1| PREDICTED: similar to barrier to autointegratio...n factor 1 [Canis familiaris] ref|XP_001111817.1| PREDICTED: similar to barrier to autointegration...: similar to barrier to autointegration factor 1 isoform 2 [Macaca mulatta] ref|XP_001111884.1| PREDICTED: s...imilar to barrier to autointegration factor 1 isoform 3 [Macaca mulatta] ref|XP_001111924.1| PREDICTED: similar to barrier to autoint

Complete cDNA sequence and amino acid analysis of a bovine ribonuclease K6 gene.

Science.gov (United States)

Pietrowski, D; Förster, M

2000-01-01

The complete cDNA sequence of a ribonuclease k6 gene of Bos Taurus has been determined. It codes for a protein with 154 amino acids and contains the invariant cysteine, histidine and lysine residues as well as the characteristic motifs specific to ribonuclease active sites. The deduced protein sequence is 27 residues longer than other known ribonucleases k6 and shows amino acids exchanges which could reflect a strain specificity or polymorphism within the bovine genome. Based on sequence similarity we have termed the identified gene bovine ribonuclease k6 b (brk6b).

Dicty_cDB: Contig-U08780-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Y4) RecName: Full=Uncharacterized protein DDB_G0276777; &A... 138 5e-31 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia...s... 84 1e-17 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... 82 4e-17 AY891872_1( AY8...509 |pid:none) Homo sapiens mRNA for achalasia, a... 79 2e-16 (Q9NRG9) RecName: Full=Aladin; AltName: Full=A... BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 80 3e-16 E

Interstellar extinction in the dark Taurus clouds. Pt. 1

International Nuclear Information System (INIS)

Straizys, V.; Meistas, E.

1980-01-01

The results of photoelectric photometry of 74 stars in the Vilnius seven-color system in the area of Taurus dark clouds with coordinates (1950) 4sup(h)20sup(m)-4sup(h)48sup(m)+24 0 .5-+27 0 are presented. Photometric spectral types, absolute magnitudes, color excesses, interstellar extinctions and distances of the stars are determined. The dark cloud Khavtassi 286, 278 and the surrounding absorbing nebulae are found to extend from 140 to 175 pc from the sun. The average interstellar extinction Asub(V) on both sides of the dark cloud is of the order of 1sup(m).5. We find no evidence of the existence of several absorbing clouds situated at various distances. (author)

MAPPING STUDY OF 71 PLANCK COLD CLUMPS IN THE TAURUS, PERSEUS, AND CALIFORNIA COMPLEXES

International Nuclear Information System (INIS)

Meng, Fanyi; Wu, Yuefang; Liu, Tie

2013-01-01

A mapping study of 71 Planck cold clumps was made with 12 CO(1-0), 13 CO(1-0), and C 18 O(1-0) lines at the 13.7 m telescope of Purple Mountain Observatory. For all the clumps, 12 CO(1-0) and 13 CO(1-0) emissions were detected, while for 55 of them, C 18 O(1-0) emissions were detected. Of the 71 Clumps, 34 are in the Taurus Complex, 24 in the California Complex, and 13 are in the Perseus Complex. In the 76 velocity components, 38 cores are found in 27 clumps; 19 of these cores are in the Taurus Complex, 16 in the California Complex, and 3 in the Perseus Complex. We acquired V lsr , T A and FWHM of lines. Physical parameters including T ex , N H 2 , σ Therm , σ NT , and σ 3D were calculated. Generally, the cores are of T ex = 2-16 K, N H 2 =10 21 --10 22 cm –2 , and σ 3D = 0.2-1.0 km s –1 . In the Taurus Complex, the cores are less dense on average and have smaller σ Therm than the cores in the Perseus and California Complexes. Two of the three cores in the Perseus Complex are revealed to have larger T ex , N H 2 , and σ 3D than the mean values in the other two regions. Most of the cores have σ NT larger than σ Therm , suggesting a dominance of turbulence in our cores. The majority of the cores have M vir /M LTE >> 1, which indicates these cores are not bound and will disperse. By comparing our results with the dust properties revealed by the Planck Early Release Cold Cores Catalog, we investigated the coupling of gas and dust components. We found that most of the cores have dust temperatures higher than their gas temperatures. The stellar objects associated with our sources were checked and 90% of the cores were found to be starless

Identificação de Demanda e Preferências no Consumo de Carne Ovina com Apoio de Técnicas de Estatística Multivariada

Directory of Open Access Journals (Sweden)

Ricardo Firetti

Full Text Available Resumo: Este trabalho visa comprovar a existência de mercado para a carne ovina em cidades médias próximas a Presidente Prudente (mercado regional e a percepção desses consumidores sobre os produtos que adquirem. Foram entrevistados 3.249 pessoas em oito cidades médias próximas utilizando-se formulários implementados em dispositivos portáteis. Investigou-se a frequência de consumo (atual e potencial e opiniões sobre as características da carne ovina, e preferências de aquisição e consumo. Parte dos dados obtidos, referentes aos consumidores de carne ovina, foi tabulada e submetida a testes de validação e consistência interna; técnicas de estatística descritiva e multivariada. Do total de pessoas entrevistadas, 38,5% foram considerados consumidores de fato. O estudo comprovou que existe grande demanda de carne ovina nos municípios analisados em consumo domiciliar mensal, preferencialmente, na forma assada (68,5% na brasa e 18,8% no forno. A aquisição de produtos sem garantias oficiais de inspeção continua elevada, sendo que os supermercados apresentaram os piores níveis de satisfação em relação ao preço praticado (ao contrário da compra direta do produtor, mas, mesmo assim, este canal de comercialização de varejo é reconhecido como fornecedor de produtos seguros do ponto de vista higiênico-sanitário.

Jejum alimentar e qualidade da carne de frango de corte tipo caipira

OpenAIRE

OLIVEIRA,Felipe Rosa; BOARI,Cleube Andrade; PIRES,Aldrin Vieira; MOGNATO,João Carlos; CARVALHO,Rúbio Madureira de Souza; SANTOS JÚNIOR,Marco Aurélio; MATTIOLI,Cristiano Campos

2015-01-01

ResumoObjetivou-se avaliar as características de qualidade da carne de frango de corte tipo caipira em diferentes tempos de jejum alimentar. Aves, machos, da linhagem “pesadão vermelho”, criadas até 85 dias de idade em sistema semiextensivo, foram submetidas aos tempos de zero, três, seis, nove e 12 horas de jejum alimentar. Obteve-se o peso vivo, peso da carcaça, o rendimento de carcaça fria, o peso do trato gastrintestinal das aves. Foram avaliados o pH24h, a luminosidade (L*), ...

Diseño de una planta de procesamiento de carne de pollo

OpenAIRE

Vera Pilco, Gabriel Ernesto

2008-01-01

El presente trabajo desarrolla el Diseño de una Planta Procesadora de Carne de Pollos para la producción de pollos enteros y bandejas de presas seleccionas empacados al vació tal y como todas las personas compran estos producto en supermercados, tiendas y demás lugares de distribución. Se elaboro de la forma más detallada y cuidadosa ajustar el diseño de la planta a las condiciones locales (Ecuador), teniendo como finalidad abastecer el mercado de consumidores con un producto de excelente cal...

Propriedades da carne e perfil de ácidos graxos do pernil de catetos (Tayassu tajacu) alimentados com torta de babaçu (Orbignya phalerata)

OpenAIRE

Albuquerque,N.I.; Contreras,C.C.; Alencar,S.; Meirelles,C.F.; Aguiar,A.P.; Moreira,J.A.; Packer,I.U.

2009-01-01

Analisaram-se as propriedades da carne e o perfil de ácidos graxos do pernil de catetos alimentados com dietas contendo diferentes porcentagens de torta de babaçu, usada como fonte energética alternativa substituindo parte do milho na alimentação, em sistemas de produção em cativeiro. Avaliou-se o pernil de 12 animais quanto às suas propriedades - perda de peso ao cozimento, força de cisalhamento, pH e capacidade de retenção de água-, depois extraiu-se o óleo da carne e determinou-se o perfil...

Egoísmo de tres cuartillos: el sabotaje de los hacendados al tajón público de carnes en Santafé, 1798-1817

OpenAIRE

Sergio Mejía

2015-01-01

Se estudia una serie de anomalías en el abasto de carnes de Santafé de Bogotá entre 1798 y 1817, causadas por la reticencia de los hacendados a acatar la orden del virrey Mendinueta de expender sus productos en una nueva carnicería o tajón en el centro de la ciudad. Decididos a no pagar el acarreo correspondiente, y valiéndose del cabildo (del que eran dueños), estos hacendados terminaron por imponer su voluntad sobre el virrey, quien transigió con un aumento del 50 % en el precio de la carne...

Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

DEFF Research Database (Denmark)

Andersen, Hans Skifter

Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

DOSAGEM DE NITRITO E NITRATO EM PRODUTOS EMBUTIDOS DE CARNE

Directory of Open Access Journals (Sweden)

Pedro Alves de SOUZA

2009-07-01

Full Text Available

RESUMO: Foram avaliadas 110 amostras de produtos embutidos de carne, de diferentes marcas comerciais, para dosar os teores residuais de nitrito e nitrato. Os resultados indicam que as indústrias fabricantes dos produtos analisados estão atentas às recomendações dos órgãos governamentais quanto à utilização destes aditivos na formulação de embutidos, tendo em vista que apenas três amostras de lingüiças, duas de salsichas e uma de presunto, ultrapassa os 200 ppm, limite estabelecido pela legislação vigente. PALAVRAS – CHAVE: Nitrito; nitrato; produtos cárneos.

Transient periodic x-ray source in Taurus, A0535+26

International Nuclear Information System (INIS)

Bradt, H.; Mayer, W.; Buff, J.; Clark, G.W.; Doxsey, R.; Hearn, D.; Jernigan, G.; Joss, P.C.; Laufer, B.; Lewin, W.; Li, F.; Matilsky, T.; McClintock, J.; Primini, F.; Rappaport, S.; Schnopper, H.

1976-01-01

Light curves of the 104 s periodicity in the transient X-ray source in Taurus (A0535+26) are presented for six energy intervals in the range 1-35 keV for the period 1975 May 30-June 2. The pulse structure ranges from an apparently simple modulation at higher energies to a very complex pattern at lower energies. No Doppler shift is observed in the 104 s pulse period during the three days of observations. This places severe constraints upon possible binary orbital motion. Upper limits on the power at other periodicities are approximately-less-than10 percent for 2 ms-2s and approximately-less-than2 percent for 2 s-2000 s

ULTRAVIOLET-SELECTED FIELD AND PRE-MAIN-SEQUENCE STARS TOWARD TAURUS AND UPPER SCORPIUS

International Nuclear Information System (INIS)

Findeisen, K.; Hillenbrand, L.

2010-01-01

We have carried out a Galaxy Evolution Explorer (GALEX) Cycle 1 guest investigator program covering 56 deg 2 near the Taurus T association and 12 deg 2 along the northern edge of the Upper Scorpius OB association. We combined photometry in the GALEX far-ultraviolet and near-ultraviolet bands with data from the Two Micron All Sky Survey to identify candidate young (∼<100 Myr old) stars as those with an ultraviolet excess relative to older main-sequence stars. Follow-up spectroscopy of a partial sample of these candidates suggests five new members of Taurus, with 8-20 expected from additional observations, and five new members of Upper Scorpius, with three to six expected from additional observations. These candidate new members appear to represent a distributed, non-clustered population in either region, although our sample statistics are as of yet too poor to constrain the nature or extent of this population. Rather, our study demonstrates the ability of GALEX observations to identify young stellar populations distributed over a wide area of the sky. We also highlight the necessity of a better understanding of the Galactic ultraviolet source population to support similar investigations. In particular, we report a large population of stars with an ultraviolet excess but no optical indicators of stellar activity or accretion, and briefly argue against several interpretations of these sources.

Influencia de la suplementación de antioxidantes y de la administración de enrofloxacina en la calidad y seguridad de la carne de ave

OpenAIRE

Carreras Ferrer, Irene

2005-01-01

Los fenómenos oxidativos y en particular la oxidación lipídica son uno de los principales responsables de la pérdida de calidad en la carne y en los productos cárnicos. Como consecuencia de estos procesos se generan compuestos que pueden afectar el flavor, color y textura de la carne disminuyendo la aceptabilidad por parte del consumidor y reduciendo su valor nutritivo. Por otro lado, el estrés oxidativo está relacionado con la etiología de diversas enfermedades comunes en nuestra sociedad. L...

Características sensoriais da carne ovina Sensorial characteristics of sheep meat

Directory of Open Access Journals (Sweden)

José Carlos da Silveira Osório

2009-07-01

Full Text Available Considerando que a tendência mundial é produzir o que se consome e que a ciência da carne busca o mais alto grau de satisfação do consumidor, o estudo aborda as características que propiciam essa satisfação na carne ovina. A utilização dos órgãos dos sentidos humanos na percepção das características que propiciam a mais alta satisfação do consumidor, passou a ser definição de "qualidade"; que aponta como características sensoriais importantes da carne ovina a suculência (capacidade de retenção de água, cor, textura (dureza ou maciez, odor e sabor e o flavor (odor + sabor. Estas características variam de acordo com a espécie, raça, idade, sexo, alimentação, manejo pós-mortem e as condições e tempo de conservação do produto. Sendo que á maioria das investigações relacionam estas características direta ou indiretamente com as do produto cárnico cozido. O produtor, a indústria e os segmentos da cadeia devem ter em conta que as propriedades sensoriais aceitáveis são fundamentais no momento da venda e consumo. No agronegócio da carne, todos os segmentos da cadeia são responsáveis e participam direta ou indiretamente na máxima satisfação do consumidor, quer através dos atributos do produto ou pelo preço. Assim, o aperfeiçoamento dos processos de produção, industrialização e comercialização para obter um produto de qualidade serão consolidados se existirem técnicas claras e práticas para descrever os caracteres relacionados com a qualidade da carne, que possam ser medidos na carcaça e que tenham relação biológica com uma avaliação in vivo. A carne de qualidade é a que provoca o mais alto grau de satisfação do consumidor e as características sensoriais estão relacionadas à porção comestível, principalmente a relação músculo/gordura e composição e valor biológico destes. Porém, não basta somente estudar o alimento, é importante ter presente que a meta é o consumidor e

Characterization of promoter sequence of toll-like receptor genes in Vechur cattle

Directory of Open Access Journals (Sweden)

R. Lakshmi

2016-06-01

Full Text Available Aim: To analyze the promoter sequence of toll-like receptor (TLR genes in Vechur cattle, an indigenous breed of Kerala with the sequence of Bos taurus and access the differences that could be attributed to innate immune responses against bovine mastitis. Materials and Methods: Blood samples were collected from Jugular vein of Vechur cattle, maintained at Vechur cattle conservation center of Kerala Veterinary and Animal Sciences University, using an acid-citrate-dextrose anticoagulant. The genomic DNA was extracted, and polymerase chain reaction was carried out to amplify the promoter region of TLRs. The amplified product of TLR2, 4, and 9 promoter regions was sequenced by Sanger enzymatic DNA sequencing technique. Results: The sequence of promoter region of TLR2 of Vechur cattle with the B. taurus sequence present in GenBank showed 98% similarity and revealed variants for four sequence motifs. The sequence of the promoter region of TLR4 of Vechur cattle revealed 99% similarity with that of B. taurus sequence but not reveals significant variant in motifregions. However, two heterozygous loci were observed from the chromatogram. Promoter sequence of TLR9 gene also showed 99% similarity to B. taurus sequence and revealed variants for four sequence motifs. Conclusion: The results of this study indicate that significant variation in the promoter of TLR2 and 9 genes in Vechur cattle breed and may potentially link the influence the innate immunity response against mastitis diseases.

Implementação de programas de segurança alimentar e o uso de ICT pela cadeia exportadora de carne suína brasileira

OpenAIRE

Edson Talamini

2003-01-01

O presente trabalho de pesquisa refere-se à análise dos níveis de disponibilidade e implementação de programas de rastreabilidade, transparência e garantia ao longo da Cadeia Exportadora de Carne Suína Brasileira. Além disso, analisa o uso de práticas de ICT relacionadas à implementação desses programas e à valorização de atributos da carne suína. Os acontecimentos relativamente recentes envolvendo a falta de segurança alimentar levaram os consumidores a rever muitos hábitos de compra e consu...

Alternativas a la producción y mercadeo para la carne de conejo en Tlaxcala, México

Directory of Open Access Journals (Sweden)

Rodrigo Olivares Pineda

2009-01-01

Full Text Available La cunicultura es una actividad importante en Tlaxcala, en comparación con otras entidades productoras, por lo que se elaboró un diagnóstico técnico-económico sobre ella. Además, se analizaron algunos de los canales de comercialización, para proponer estrategias que faciliten la venta de la carne. Se realizó un estudio técnico de las granjas, complementado con entrevistas semiestructuradas a criadores seleccionados aleatoriamente, a informantes clave de los eslabones de producción y comercialización y visitas periódicas a puntos de venta. Uno de los aspectos típicos de la cunicultura en Tlaxcala es el predominio de un sistema extensivo, combinado con características de otros como el semiintensivo y empresarial. Algunas alternativas para mejorar la comercialización de la carne de conejo son: incrementar la eficiencia en su acopio, generar centros de distribución y puntos de venta, emplear economías de escala y diferenciar el producto que se expende al consumidor.

Carne caprina de animais mestiços: estudos do perfil aromático Goat meat of "mestiço" animals: volatile profile analysis

Directory of Open Access Journals (Sweden)

M. S. Madruga

2003-12-01

Full Text Available Análises do perfil aromático da carne caprina cozida de animais mestiços foram realizadas utilizando-se animais castrados e inteiros, abatidos com idades de 175, 220, 265 e 310 dias. O perfil aromático da carne caprina foi constituído por 108 voláteis, sendo que 69 foram positivamente identificados e 39 parcialmente caracterizados utilizando-se análises de CG-EM. O perfil aromático da carne caprina foi formado por hidrocarbonetos alifáticos e alicíclicos, aldeídos, compostos benzênicos, álcoois, cetonas, terpenóides, ésteres e compostos heterocíclicos sulfurados, hexadecanal, benzeno, heptano e octadecanal foram os voláteis que apresentaram os maiores índices de abundância relativa. Nas análises quantitativa e qualitativa observaram-se uma predominância de voláteis nos extratos de carne de caprinos castrados. O número total de voláteis e a abundância relativa das diferentes classes de compostos não foram claramente afetados pelo fator idade de abate.The volatile profile of cooked goat meat was analysed using meat from castrated and intact animals slaughtered at 175, 220, 265 and 310 days. A total of 108 volatiles was detected and from them 69 was identified and a further 39 were partially characterised by GC-MS. The volatile profile was composed by hydrocarbons aliphatic and alicyclic, aldehydes, benzenoid compounds, alcohols, ketones, terpenoids, esters and sulfur compounds. Hexadecanal, benzen, heptane and octadecanal were among the volatiles with highest relative abundance. In both qualitative and quantitative analyses extracts from castrated meat had higher production of volatiles. The total number and the relative abundance of different classes of compounds seemed not to be cleared affected by slaughter age factor.

Arroz integral, seleno-levedura e acetato de alfa-tocoferol na dieta de frangos de corte: efeitos sobre a qualidade da carne

Directory of Open Access Journals (Sweden)

Aline Arassiana Piccini Roll

2017-05-01

Full Text Available Foram estudados os efeitos da suplementação com acetato de alfa-tocoferol (VE e seleno-levedura (SeL Sel-Plex, Alltech® Inc, sobre o pH, a capacidade de retenção de água (CRA, perdas por cocção (PC, perdas por gotejamento (PG, cor do músculo e a concentração de selênio no peito de frangos alimentados com dietas a base de milho ou arroz. A partir de 21 dias de idade 200 frangos de corte Cobb foram alojados em 38 boxes (unidade experimental num delineamento casualizado num arranjo fatorial 2x2x2 em que foram fixados os níveis de suplementação “on top” de VE (0 e 200 mg/kg, SeL (0 e 0,3 ppm e dois ingredientes da dieta (100% milho e 100% arroz integral totalizando oito tratamentos: T1 milho + 0SeL + 0VE (controle; T2 milho + 200mg/kg VE + 0SeL; T3 milho + 0VE + 0,3ppm SeL; T4 milho + 200mg/kg VE + 0,3ppm SeL; T5 arroz + 0VE +0SeL; T6 arroz + 200mg/kg VE + 0SeL; T7 arroz + 0VE + 0,3ppm SeL; T8 arroz + 200mg/kg VE + 0,3ppm SeL. A quantidade de selênio no peito foi maior (P < 0,0001 com a inclusão de 200mg/kg de VE, em comparação com os demais tratamentos. Entretanto, observou-se uma interação positiva entre VE e SeL na dieta sobre a quantidade de selênio recuperada na carne (P = 0,06. Foi encontrada melhor CRA com a inclusão de SeL e VE em dietas a base de arroz. A substituição do milho por arroz nas dietas reduziu a cor amarela na carne (P < 0,05. PC e PG não foram significativamente afetadas pelos tratamentos. O pH da carne do peito foi significativamente mais elevado nas aves recebendo dietas suplementadas de SeL. Em conclusão, a interação entre VE e SeL aumenta o selênio na carne, porém, melhorando a CRA somente em dietas a base de arroz. A substituição de milho por arroz integral reduz a intensidade da coloração amarela da carne do peito de frangos.

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds.

Directory of Open Access Journals (Sweden)

Yao Xu

Full Text Available Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus and Qinchuan (Bos taurus are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 to 12 fold on average of 97.86% and 98.98% coverage of genomes, respectively. Comparison with the Bos_taurus_UMD_3.1 reference assembly yielded 9,010,096 SNPs for Nanyang, and 6,965,062 for Qinchuan cattle, 51% and 29% of which were novel SNPs, respectively. A total of 154,934 and 115,032 small indels (1 to 3 bp were found in the Nanyang and Qinchuan genomes, respectively. The SNP and indel distribution revealed that Nanyang showed a genetically high diversity as compared to Qinchuan cattle. Furthermore, a total of 2,907 putative cases of copy number variation (CNV were identified by aligning Nanyang to Qinchuan genome, 783 of which (27% encompassed the coding regions of 495 functional genes. The gene ontology (GO analysis revealed that many CNV genes were enriched in the immune system and environment adaptability. Among several CNV genes related to lipid transport and fat metabolism, Lepin receptor gene (LEPR overlapping with CNV_1815 showed remarkably higher copy number in Qinchuan than Nanyang (log2 (ratio = -2.34988; P value = 1.53E-102. Further qPCR and association analysis investigated that the copy number of the LEPR gene presented positive correlations with transcriptional expression and phenotypic traits, suggesting the LEPR CNV may contribute to the higher fat deposition in muscles of Qinchuan cattle. Our findings provide evidence that the distinct phenotypes of Nanyang and Qinchuan breeds may be due to the different genetic variations including SNPs

Efeitos do sexo e do tempo de maturação sobre a qualidade da carne ovina The effects of sex and aging on lamb meat quality

Directory of Open Access Journals (Sweden)

Lorrance A. G. Gonçalves

2004-09-01

Full Text Available Foi realizado um estudo para verificar os efeitos do sexo e do tempo de maturação sobre a qualidade da carne de alguns cortes de ovinos. Foram utilizados os músculos Longissimus dorsi e Semimembranosus de cinco machos inteiros, cinco machos castrados e cinco fêmeas, com peso aproximado de 35kg. As variáveis pH, índice de fragmentação miofibrilar, perdas na cocção, força de cisalhamento, gordura intramuscular, cor e maciez sensorial foram determinadas após 1, 3, 7 e 14 dias de maturação da carne em refrigeração a 2ºC. A carne dos machos castrados e a das fêmeas apresentaram menor força de cisalhamento e maior maciez sensorial do que as de macho inteiro. Na carne de animais castrados foi observado um maior nível de gordura e menores perdas na cocção que na dos animais inteiros. O tempo de maturação da carne não afetou significativamente (p>0,05 a força de cisalhamento e maciez sensorial, indicando que a comercialização da carne destes animais, principalmente a dos machos castrados, poderá ser realizada com um dia (24 horas de acondicionamento sob refrigeração a 2ºC.A study to verify the effects of sex and aging time of selected carcass cuts on meat quality was conducted. Longissimus dorsi and Semimembranous muscles from five intact males, five castrated males and five female lambs with average slaughter weight of about 35kg were used. Meat pH, myofibrillar fragmentation index, cooking losses, shear force, intramuscular lipids, color and sensorial tenderness were measured after 1, 3, 7 and 14 days of aging at 2ºC. Meat from castrated males and from female lambs showed lower shear force values than those from intact male lambs. Higher levels of fat and lower cooking losses were observed in meat from castrated animals related to those from intact lambs. Aging time did not significantly (p>0.05 affect shear force or sensory tenderness of meats. This observation suggests that lamb meat, mainly from castrated males, can

Guia prático: marcas de carne e produtos cárneos

OpenAIRE

Teixeira, A. (Ed.)

2017-01-01

La globalización ha dado lugar a un aumento de la competencia a la cual la producción de carne y de productos cárnicos no es ajena, requiriendo un aumento de la competitividad en la producción, transformación y comercialización. En España y Portugal, el camino iniciado ya hace algún tiempo por una apuesta del sector cárnico en sistemas de calidad diferenciada ha propiciado un incremento de marcas de calidad registradas por la Unión Europea (DOP, IGP y ETG). Pensamos que esta ex...

Sexual behaviour in cattle

International Nuclear Information System (INIS)

King, G.J.

1990-01-01

Short duration or weak expression of oestrus are frequently cited as major reasons for poor results when artificial insemination of Bos indicus breeds is attempted. The existing literature on sexual behaviour certainly indicates that oestrus sometimes lasts for only a few hours in Bos indicus, but similar patterns are also reported in Bos taurus animals. The period of sexual receptivity in suckled Hereford or Hereford-dairy cross-breds maintained in small, totally confined groups ranged from 1 to 18 h, with a mean of 4.4 h and a median of 3.5 h. In totally confined Holstein cows the onset of the LH surge always followed the beginning of homosexual activity by 1 or 2 h even when the period of receptivity was very short. Thus, the beginning rather than the end of oestrus should be used for estimating ovulation time. The expression of sexual behaviour is modified by many factors, including environmental conditions, the number of peri-oestrous females in the group and the presence of observers. In Hereford beef, Holstein dairy and probably all other cattle breeds, the variability in duration and intensity of oestrous activity is very large, so generalizations on a typical individual behavioural pattern are not possible. (author). 39 refs, 1 fig., 2 tabs

Clotting of cow (Bos taurus) and goat milk (Capra hircus) using calve ...

African Journals Online (AJOL)

STORAGESEVER

2008-10-06

Oct 6, 2008 ... Goat and cow milk protein are 24 and 27 g×L-1 respectively. These values .... Formagramm obtained by kid rennet on cow milk (raw picture was .... structure, and functionality of low-fat Iranian white cheese made with different ...

Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

Directory of Open Access Journals (Sweden)

Roberto César Araujo Lima

2014-02-01

Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

La demanda de carnes y pescados en Túnez: un enfoque dinámico

OpenAIRE

Gil, José M.ª; Dhehibi, B.; Angulo, Ana Maria

2001-01-01

El objetivo de este trabajo consiste en analizar la demanda de carnes y pescado en Túnez utilizando sistemas econométricos multiecuacionales en base a datos de series temporales para el período 1973-1997. Se ha prestado especial atención a la especificación del modelo y al cumplimiento de las restricciones teóricas. Desde el primer punto de vista, se ha optado por un enfoque dinámico general que permite seleccionar la forma funcional que mejor se ajusta a los datos. Los resultados del análisi...

Influência da Idade de Abate e da Castração nas Qualidades Físico-Químicas, Sensoriais e Aromáticas da Carne Caprina

Directory of Open Access Journals (Sweden)

Marta Suely Madruga

2002-06-01

Full Text Available Grupos de caprinos mestiços castrados e inteiros foram abatidos com idades de 175, 220, 265 e 310 dias. Os efeitos da castração e idade de abate nas qualidades físico-químicas, sensoriais e aromáticos da carne caprina foi pesquisado. O efeito castração foi observado apenas para o conteúdo de cálcio, no entanto a idade de abate apresentou um efeito significativo nos teores de umidade, proteína, cálcio, ferro e pH. Os fatores idade de abate e castração não apresentaram efeito significativo nos percentuais de fosfolipídeos porém, a idade de abate afetou os percentuais de colesterol. Caprinos castrados apresentaram maior percentual de ácidos graxos insaturados e, conseqüentemente, maior relação PUFA/SFA. Os ácidos graxos foram afetados significativamente pela castração. Não foram observadas variações nos percentuais dos ácidos graxos saturados e insaturados da carne caprina de animais abatidos com diferentes idades. O fator idade de abate apresentou maior efeito nos atributos sensoriais analisados do que o fator castração. Nos extratos da carne caprina foram identificados um total de cento e oito voláteis, sendo estes: 41 hidrocarbonetos alifáticos, 12 hidrocarbonetos alicíclicos, 19 aldeídos, 9 compostos benzênicos, 9 álcoois, 7 cetonas, 4 compostos sulfurados, 2 terpenoídes, 2 ésteres e 3 outros compostos. Os extratos da carne de caprinos castrados continham maior número de compostos voláteis do que os extratos de animais inteiros. O fator idade de abate foi o parâmetro que mais afetou as características físico-químicas e sensoriais da carne caprina. O fator castração afetou diretamente a produção de voláteis.

Efecto del tiempo de maduración sobre la calidad organoléptica de la carne de vacuno

OpenAIRE

Oliván, Mamen; Sierra, Verónica; García, Pepa

2013-01-01

La carne de vacuno es un alimento fundamental en la dieta humana, por ser fuente rica en proteínas, ácidos grasos esenciales, vitaminas y minerales. Además, presenta unas características sensoriales excepcionales que la convierten en uno de los alimentos de origen animal mejor valorado por el consumidor.

Calidad de la carne de cerdo, efecto de la congelacion y descongelacion, uso del calentamiento dielectrico para la descongelacion y la espectroscopia dielectrica para evaluar la calidad tecnologica

OpenAIRE

Bekele Beshah, Wondwossen

2014-01-01

La calidad de la carne de cerdo está determinada por múltiples factores que están interrelacionados entre sí, ya que durante el periodo antes del sacrificio, los animales experimentan situaciones de estrés que repercuten en su bienestar. Estos elementos relacionados con el periodo ante-mortem pueden posteriormente afectar la calidad de la carne. Por tal motivo, el objetivo fundamental de esta tesis documental es revisar los factores relacionados con la genética y los periodos ante-mortem y po...

Observations of the polarized emission of Taurus A, Cas A and Cygnus A at 9-mm wavelength

International Nuclear Information System (INIS)

Flett, A.M.; Henderson, C.

1979-01-01

Measurements of the total intensity and degree of linear polarization of the supernova remnants Taurus A and Cas A and of the radiogalaxy Cygnus A have been made at lambda 9 mm using the 25-m radiotelescope at Chilbolton. A new experimental technique involving Faraday rotation of the incoming polarized radiation was employed. Taurus A shows the expected strong and uniform polarization over the central area investigated, and Cas A the ring-like distribution observed at other wavelengths. The beamwidth of 1.5 arcmin resolves the two major components of Cygnus A and it is found that the polarization in the E component has a position angle of 53 +- 3 0 and P = 7.5 +- 1.2 per cent, and the W component a position angle of 133 +- 3 0 and P = 9.6 +-1.1 per cent. When these results are combined with earlier data at longer wavelengths, the large rotation measure of the E component and the fall of the degree of polarization of the W component at short wavelength are further established. (author)

MOLECULAR OUTFLOWS IN THE SUBSTELLAR DOMAIN: MILLIMETER OBSERVATIONS OF YOUNG VERY LOW MASS OBJECTS IN TAURUS AND ρ OPHIUCHI

International Nuclear Information System (INIS)

Ngoc Phan-Bao; Lee, Chin-Fei; Ho, Paul T. P.; Tang, Ya-Wen

2011-01-01

We report here our search for molecular outflows from young very low mass stars and brown dwarfs in Taurus and ρ Ophiuchi. Using the Submillimeter Array and the Combined Array for Research in Millimeter-wave Astronomy, we have observed four targets at 1.3 mm wavelength (230 GHz) to search for CO J = 2 → 1 outflows. A young very low mass star MHO 5 (in Taurus) with an estimated mass of 90 M J , which is just above the hydrogen-burning limit, shows two gas lobes that are likely outflows. While the CO map of MHO 5 does not show a clear structure of outflow, possibly due to environment gas, its position-velocity diagram indicates two distinct blue- and redshifted components. We therefore conclude that they are components of a bipolar molecular outflow from MHO 5. We estimate an outflow mass of 7.0 x 10 -5 M sun and a mass-loss rate of 9.0 x 10 -10 M sun . These values are over two orders of magnitude smaller than the typical ones for T Tauri stars and somewhat weaker than those we have observed in the young brown dwarf ISO-Oph 102 of 60 M J in ρ Ophiuchi. This makes MHO 5 the first young very low mass star showing a bipolar molecular outflow in Taurus. The detection boosts the scenario that very low mass objects form like low-mass stars but in a version scaled down by a factor of over 100.

Physiological Responses and Lactation to Cutaneous Evaporative Heat Loss in , , and Their Crossbreds

Directory of Open Access Journals (Sweden)

Wang Jian

2015-11-01

Full Text Available Cutaneous evaporative heat loss in Bos indicus and Bos taurus has been well documented. Nonetheless, how crossbreds with different fractional genetic proportions respond to such circumstances is of interest. A study to examine the physiological responses to cutaneous evaporative heat loss, also lactation period and milk yield, were conducted in Sahiwal (Bos indicus, n = 10, 444±64.8 kg, 9±2.9 years, Holstein Friesian (Bos taurus, HF100% (n = 10, 488±97.9 kg, 6±2.8 years and the following crossbreds: HF50% (n = 10, 355±40.7 kg, 2±0 years and HF87.5% (n = 10, 489±76.8 kg, 7±1.8 years. They were allocated so as to determine the physiological responses of sweating rate (SR, respiration rate (RR, rectal temperature (RT, and skin temperature (ST with and without hair from 06:00 h am to 15:00 h pm. And milk yield during 180 days were collected at days from 30 to 180. The ambient temperature-humidity-index (THI increased from less than 80 in the early morning to more than 90 in the late afternoon. The interaction of THI and breed were highly affected on SR, RR, RT, and ST (p0.05 but did change over time. The ST with and without hair were similar, and was higher in HF100% (37.4°C; 38.0°C and their crossbred HF50% (35.5°C; 35.5°C and HF87.5% (37.1°C; 37.9°C than Sahiwal (34.8°C; 34.8°C (p<0.01. Moreover, the early lactation were higher at HF100% (25 kg and 87.5% (25 kg than HF50% (23 kg which were higher than Sahiwal (18 kg while the peak period of lactation was higher at HF100% (35 kg than crossbreds both HF87.5% and HF50% (32 kg which was higher than Sahiwal (26 kg (p<0.05. In conclusion, sweating and respiration were the main vehicle for dissipating excess body heat for Sahiwal, HF and crossbreds, respectively. The THI at 76 to 80 were the critical points where the physiological responses to elevated temperature displayed change.

Municipio y mercado en el Aragón moderno : el abasto de carne en Zaragoza (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

2003-01-01

Full Text Available Estudio relativo a la política desarrollada por el Concejo de Zaragoza sobre el mercado de carne durante los siglos XVI y XVII. La prosperidad económica del reino de Aragón, la ciudad y municipio de Zaragoza durante el siglo XVI permitieron aumentar el control público sobre las transacciones de carne para asegurar a la población un suministro suficiente, así como sustentar la demanda local. Sin embargo, el declive económico del reino de Aragón y el creciente endeudamiento municipal durante el siglo XVII obligaron a reducir la presencia pública en el mercado y la defensa de la demanda local en el mercado de carne. El reajuste de la política municipal promovió la paulatina integración del mercado aragonés, proceso que continuó en el siglo XVIII para afianzarse durante la crisis final del Antiguo Régimen.This paper studies municipal politics carried out by the Zaragoza city council concerning the meat market during the sixteenth and seventeenth centuries. Economic prosperity in the kingdom of Aragón, Zaragoza city and council during the sixteenth century allowed to increase public control of meat transactions in order to supply efficiently the population, as well as to support local demand. However, economic decline of the kingdom and raising municipal indebtedness during the seventeenth century led to reduce public intervention and support of local demand on the meat market. Readjustment of municipal politics gradually promoted the integration of the market in Aragón. This process continued during the eighteenth century and became firmly established during the final crisis of the "Ancien Régime".

Overlapping Open Clusters NGC 1750 and NGC 1758 behind the Taurus Dark Clouds. II. CCD Photometry in the Vilnius System

Directory of Open Access Journals (Sweden)

Straižys V.

2003-09-01

Full Text Available Seven-color photometry in the Vilnius system has been obtained for 420 stars down to V = 16 mag in the area containing the overlapping open clusters NGC 1750 and NGC 1758 in Taurus. Spectral and luminosity classes, color excesses, interstellar extinctions and distances are given for 287 stars. The classification of stars is based on their reddening-free Q-parameters. 18 stars observed photoelectrically were used as standards. The extinction vs. distance diagram exhibits the presence of one dust cloud at a distance of 175 pc which almost coincides with a distance of other dust clouds in the Taurus complex. The clusters NGC 1750 and NGC 1758 are found to be at the same distance of ~760 pc and may penetrate each other. Their interstellar extinction AV is 1.06 mag which corresponds to EB-V = 0.34 mag.