WorldWideScience

Sample records for carbon 9

  1. 46 CFR 78.47-9 - Carbon dioxide alarm.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Carbon dioxide alarm. 78.47-9 Section 78.47-9 Shipping... and Emergency Equipment, Etc. § 78.47-9 Carbon dioxide alarm. (a) All carbon dioxide alarms shall be conspicuously identified: “WHEN ALARM SOUNDS—VACATE AT ONCE. CARBON DIOXIDE BEING RELEASED.” (b)...

  2. 46 CFR 97.37-9 - Carbon dioxide alarm.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Carbon dioxide alarm. 97.37-9 Section 97.37-9 Shipping... Markings for Fire and Emergency Equipment, Etc. § 97.37-9 Carbon dioxide alarm. (a) All carbon dioxide alarms shall be conspicuously identified: “WHEN ALARM SOUNDS—VACATE AT ONCE. CARBON DIOXIDE...

  3. 46 CFR 196.37-9 - Carbon dioxide alarm.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Carbon dioxide alarm. 196.37-9 Section 196.37-9 Shipping... Markings for Fire and Emergency Equipment, etc. § 196.37-9 Carbon dioxide alarm. (a) All carbon dioxide alarms shall be conspicuously identified: “WHEN ALARM SOUNDS—VACATE AT ONCE. CARBON DIOXIDE...

  4. 9 CFR 313.5 - Chemical; carbon dioxide.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Chemical; carbon dioxide. 313.5... INSPECTION AND CERTIFICATION HUMANE SLAUGHTER OF LIVESTOCK § 313.5 Chemical; carbon dioxide. The slaughtering of sheep, calves and swine with the use of carbon dioxide gas and the handling in...

  5. Electrochemical impedance of poly(9-tosyl-9H-carbazole-co-pyrrole) electrocoated carbon fiber

    Energy Technology Data Exchange (ETDEWEB)

    Ates, Murat; Uludag, Nesimi [Department of Chemistry, Faculty of Arts and Sciences, Namik Kemal University, Degirmenalti Campus, 59030, Tekirdag (Turkey); Sarac, A. Sezai, E-mail: sarac@itu.edu.tr [Department of Chemistry, Polymer Science and Technology, Istanbul Technical University, Maslak, 34469, Istanbul (Turkey)

    2011-05-16

    Research highlights: {yields} Impedance study of poly(9-tosyl-9H-carbazole-co-pyrrole) electrocoated carbon fiber. {yields} Copolymer of 9-tosyl-9H-carbazole and pyrrole were electrocoated on carbon fiber. {yields} Impedance spectroscopy and circuit models of poly(9-tosyl-9H-carbazole-co-pyrrole). - Abstract: In this paper, copolymer of 9-tosyl-9H-carbazole (TCz) and pyrrole (Py) comonomers were electrochemically deposited onto carbon fiber micro electrode (CFME) as an active electrode material. An electrochemical impedance study on the prepared electrodes is reported. Poly(TCz-co-Py)/CFME is characterized by cyclic voltammetry (CV), Fourier transform infrared reflectance-attenuated total reflection spectroscopy (FTIR-ATR), scanning electron microscopy-energy dispersive X-ray analysis (SEM-EDX), and electrochemical impedance spectroscopy (EIS). Capacitive behaviors of modified CFMEs were defined via Nyquist, Bode-magnitude and Bode-phase plots. An examination is made of which equivalent circuits of R(C(R(Q(RW)))) and R(C(R(Q(RW))))(CR) used for modeling the system. The effect of monomer ratio (mole fraction, X{sub TCz} = n{sub TCz}/n{sub TCz} + n{sub Py}) on the formation of copolymer is reported in 0.1 M sodium perchlorate (NaClO{sub 4})/acetonitrile (ACN) solution. The inclusion of TCz in the copolymer structure was also confirmed by FTIR-ATR, SEM, and CV measurements. The highest low frequency capacitance (C{sub LF} = 22.7 for R(C(R(Q(RW)))) and C{sub LF} = 22.6 mF cm{sup -2} for R(C(R(Q(RW))))(CR)) were obtained for X{sub TCz} = 0.91.

  6. US EPA Region 9 carbon monoxide designated areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — Polygon Feature class of Nonattainment Areas for Carbon Monoxide. Nonattainment areas are geographic areas which have not met National Ambient Air Quality Standards...

  7. Controlled synthesis of the tricontinuous mesoporous material IBN-9 and its carbon and platinum derivatives

    KAUST Repository

    Zhao, Yunfeng

    2011-08-23

    Controlled synthesis of mesoporous materials with ultracomplicated pore configurations is of great importance for both fundamental research of nanostructures and the development of novel applications. IBN-9, which is the only tricontinuous mesoporous silica with three sets of interpenetrating three-dimensional channel systems, appears to be an excellent model mesophase for such study. The extensive study of synthesis space diagrams proves mesophase transition among the cylindrical MCM-41, tricontinuous IBN-9 and bicontinuous MCM-48, and also allows a more precise control of phase-pure synthesis. On the other hand, rational design of structure-directing agents offers a possibility to extend the synthesis conditions of IBN-9, as well as tailor its pore size. Moreover, an unprecedented helical structure consisting of twisted 3-fold interwoven mesoporous channels is reported here for the first time. The unique tricontinuous mesostructure of IBN-9 has been well-replicated by other functional materials (e.g., carbon and platinum) via a "hard- templating" synthesis route. The obtained carbon material possesses large surface area (∼1900 m2/g), high pore volume (1.56 cm 3/g), and remarkable gas adsorption capability at both cryogenic temperatures and room temperature. The platinum material has an ordered mesostructure composed of highly oriented nanocrystals. © 2011 American Chemical Society.

  8. Voltammetric determination of Δ9-THC in glassy carbon electrode: An important contribution to forensic electroanalysis.

    Science.gov (United States)

    Balbino, Marco Antonio; de Menezes, Matheus Manoel Teles; Eleotério, Izabel Cristina; Saczk, Adelir Aparecida; Okumura, Leonardo Luiz; Tristão, Heloísa Maria; de Oliveira, Marcelo Firmino

    2012-09-10

    A new voltammetric method for the determination of Δ(9)-tetrahydrocannabinol (Δ(9)-THC) is described. The voltammetric experiments were accomplished in N-N dimethylformamide/water (9:1, v/v), using tetrabutylammonium tetrafluoroborate (TBATFB) 0.1mol/L as supporting electrolyte and a glassy carbon disk electrode as the working electrode. The anodic peak current was observed at 0.0V (vs. Ag/AgCl) after a 30s pre-concentration step under an applied potential of -1.2V (vs. Ag/AgCl). A linear dependence of Δ(9)-THC detection was obtained in the concentration range 2.4-11.3ng/mL, with a linear correlation coefficient of 0.999 and a detection limit of 0.34ng/mL. The voltammetric method was used to measure the content of Δ(9)-THC in samples (hemp and hashish) confiscated by the police. The elimination of chemical interferences from the samples was promptly achieved through prior purification using the TLC technique, by employing methanol/water (4:1, v/v) as the mobile phase. The results showed excellent correlation with results attained by HPLC.

  9. Functionalization of oxidized single-walled carbon nanotubes with 4-benzo-9-crown-3 ether

    Indian Academy of Sciences (India)

    Ardeshir Khazaei; Maryam Kiani Borazjani; Khadijeh Mansouri Moradian

    2012-09-01

    Functionalization of oxidized single-walled carbon nanotubes (SWCNTs) by a zwitterionic interaction (COO−NH$^{+}_{3}$) between protonated amine on crown ether and an oxyanion from a carboxylic acid group on SWCNT has been described. This ionic interaction has led to a considerable increase in the solubility of SWCNTs in both organic and aqueous solvents such as ethanol, dimethyl sulphoxide, dimethylformamide, and H2O. The highest solubility was attained in DMF and DMSO. The ionic bonded 4-benzo-9-crown-3 ether allowed the hosting of Li+. The ionic bond of crown ether (4-(benzo-9-crown-3)) to SWCNT was identified and confirmed by infrared spectroscopy, transmission electron-microscopy, atomic force microscopy and thermogravimetric analysis methods.

  10. Microstructural evolution and mechanical properties of heat affected zones for 9Cr2WVTa steels with different carbon contents

    International Nuclear Information System (INIS)

    Highlights: • The weldability of 9Cr2WVTa steel with different carbon contents was studied. • The HAZs of the 9Cr2WVTa steel include three characteristic regions. • Residual delta-ferrite significantly deteriorates the impact property of HAZs. • The twin martensite deteriorates the impact toughness as a whole. • The 9Cr2WVTa steel with 0.14–0.17 wt.% carbon content has good weldability. - Abstract: The microstructures and mechanical properties of heat affected zones (HAZs) by Gas Tungsten Arc Welding (GTAW) were studied for 9Cr2WVTa steels with carbon content varying from 0.07 wt.% to 0.25 wt.%. Enlarged HAZs samples with 8 mm to 10 mm wide uniform temperature zone were prepared by the thermal–mechanical physical simulator Gleeble 1500 based on the Finite Element Method (FEM) numerical simulation and experimental measurement for the welding thermal cycle process and weld profile. The microstructures were observed by optical microscope (OM), scanning electron microscope (SEM) and transmission electron microscope (TEM). In addition, the mechanical properties tests including micro-hardness test, tensile test and impact test were carried out to investigate the effects of the carbon content and the welding thermal cycle. The results show that the big blocky delta ferrite in 9Cr2WVTa steel with lower carbon content deteriorates the impact property. On the other hand, the quenched martensite, especially for the twin martensite in 9Cr2WVTa steel with higher carbon content, deteriorates the impact toughness as well. The weldability of 9Cr2WVTa steel can be improved by adjusting the carbon content between 0.14 wt.% and 0.17 wt.%

  11. Welded, sandblasted, stainless steel corrugated bars in non-carbonated and carbonated mortars: A 9-year corrosion study

    OpenAIRE

    Bautista, A.; Paredes, E. C.; Álvarez, S. M.; Velasco, F.

    2016-01-01

    Three different stainless steel corrugated grades (UNS S20430, S30403 and S32205) were similar welded to stainless steel bars with the same composition and dissimilar welded to carbon steel (CS). After cleaning the welding oxides by sandblasting, the reinforcements were embedded in mortar with chlorides and some of the samples were carbonated. Corrosion activity was monitored using corrosion potential (Ecorr) and electrochemical impedance spectroscopy (EIS). After 8 years of exposure, the sam...

  12. Design of 9-meter carbon-fiberglass prototype blades : CX-100 and TX-100 : final project report.

    Energy Technology Data Exchange (ETDEWEB)

    Berry, Derek (TPI Composites, Inc., Warren, RI)

    2007-09-01

    TPI Composites, Inc. (TPI), Global Energy Concepts, LLC (GEC), and MDZ Consulting (MDZ) have collaborated on a project to design, manufacture, and test prototype carbon-fiberglass hybrid wind turbine blades of 9-m length. The project, funded by Sandia National Laboratories, involves prototype blades in both conventional (unidirectional spar fibers running along the blade span) and ''adaptive'' (carbon fibers in off-axis orientation to achieve bend-twist-coupling) configurations. After manufacture, laboratory testing is being conducted to determine the static and fatigue strength of the prototypes, in conjunction with field testing to evaluate the performance under operational conditions.

  13. Regioselective synthesis of isotopically labeled Δ9-tetrahydrocannabinolic acid A (THCA-A-D3) by reaction of Δ9-tetrahydrocannabinol-D3 with magnesium methyl carbonate.

    Science.gov (United States)

    Roth, Nadine; Wohlfarth, Ariane; Müller, Michael; Auwärter, Volker

    2012-10-10

    For the reliable quantification of Δ9-tetrahydrocannabinolic acid A (THCA-A), the biogenetic precursor of Δ9-tetrahydrocannabinol (THC), in biological matrices by LC-MS/MS and GC-MS(/MS), an isotopically labeled internal standard was synthesized starting from Δ9-tetrahydrocannabinol-D(3) (THC-D(3)). Synthesis strategy was based on a method reported by Mechoulam et al. in 1969 using magnesium methyl carbonate (MMC) as carboxylation reagent for the synthesis of cannabinoid acids. Preliminary experiments with THC to optimize yield of the product (THCA-A) resulted in the synthesis of the positional isomer tetrahydrocannabinolic acid B (THCA-B) as a byproduct. Using the optimized conditions for the desired isomer, THCA-A-D(3) was prepared and isolated with a yield of approx. 10% after two synthesis cycles. Isotope purity was estimated to be >99% by relative abundance of the molecular ions. The synthesized compound proved to be suitable as an internal standard for quantification of THCA-A in serum and hair samples of cannabis consumers.

  14. Co9S8 nanoparticles encapsulated in nitrogen-doped mesoporous carbon networks with improved lithium storage properties

    DEFF Research Database (Denmark)

    Mujtaba, Jawayria; Sun, Hongyu; Huang, Guoyong;

    2016-01-01

    We report the designed synthesis of unique Co9S8 nanoparticles encapsulated in nitrogen-doped mesoporous carbon networks (Co9S8@NMCN nanocomposites). Uniform zeolitic imidazolate framework-67 was first synthesized and then transformed into Co9S8@NMCN nanocomposites by thermal annealing with sulfu...

  15. Corrugated stainless steels embedded in carbonated mortars with and without chlorides: 9-year corrosion results

    OpenAIRE

    Bautista, A.; Álvarez, S. M.; Paredes, E. C.; Velasco, F.; Guzmán, S.

    2015-01-01

    The corrosion behavior of 5 corrugated stainless steel bars was evaluated in carbonated mortars: UNS S20430, S30400, S31603, S31635 and S32205. The tests were carried out under 3 different exposure conditions: at high relative humidity (C-HRH); partially immersed in 3.5% NaCl (C-PD; and with CaCl2 added during mortar mixing and exposed to high relative humidity (C-HRHCl). Corrosion potential (Ecorr) measurements and electrochemical impedance spectroscopy (EIS) were used to monitor the behavio...

  16. Modeling astronomically observed interstellar infrared spectra by ionized carbon pentagon-hexagon molecules (c9h7) n+

    CERN Document Server

    Ota, Norio

    2015-01-01

    Modeling a promising carrier of the astronomically observed polycyclic aromatic hydrocarbon (PAH), infrared (IR) spectra of ionized molecules (C9H7) n+ were calculated based on density functional theory (DFT). In a previous study, it was found that void induced coronene C23H12++ could reproduce observed spectra from 3 to 15 micron, which has carbon two pentagons connected with five hexagons. In this paper, we tried to test the simplest model, that is, one pentagon connected with one hexagon, which is indene like molecule (C9H7) n+ (n=0 to 4). DFT based harmonic frequency analysis resulted that observed spectrum could be almost reproduced by a suitable sum of ionized C9H7n+ molecules. Typical example is C9H7++. Calculated peaks were 3.2, 7.4, 7.6, 8.4, and 12.7 micron, whereas observed one 3.3, 7.6, 7.8, 8.6 and 12.7 micron. By a combination of different degree of ionized molecules, we can expect to reproduce total spectrum. For a comparison, hexagon-hexagon molecule naphthalene (C10H8) n+ was studied. Unfortu...

  17. Improved recovery demonstration for Williston Basin carbonates. Annual report, June 10, 1995--June 9, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Carrell, L.A.; Sippel, M.A.

    1996-09-01

    The purpose of this project is to demonstrate targeted infill and extension drilling opportunities, better determinations of oil-in-place, methods for improved completion efficiency and the suitability of waterflooding in Red River and Ratcliffe shallow-shelf carbonate reservoirs in the Williston Basin, Montana, North Dakota and South Dakota. Improved reservoir characterization utilizing three-dimensional and multi-component seismic are being investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterization tools are integrated with geological and engineering studies. Improved completion efficiency is being tested with extended-reach jetting lance and other ultra-short-radius lateral technologies. Improved completion efficiency, additional wells at closer spacing and better estimates of oil in place will result in additional oil recovery by primary and enhanced recovery processes.

  18. Poster 9: Isotopic Ratios of Carbon and Oxygen in Titan's CO using ALMA

    Science.gov (United States)

    Serigano, Joseph; Nixion, Conor A.; Cordiner, Martin A.; Irwin, Patrick G. J.; Teanby, Nick A.; Charnley, Steven B.; Lindberg, Johan E.

    2016-06-01

    The advent of the Atacama Large Millimeter/Submillimeter Array (ALMA) has provided a new and powerful facility for probing the atmospheres of solar system targets at long wavelengths (84-720 GHz) where the rotational lines of small, polar molecules are prominent. In the complex atmosphere of Titan, photochemical processes dissociate and ionize molecular nitrogen and methane in the upper atmosphere, creating a complex inventory of trace hydrocarbons and nitriles. Additionally, the existence of oxygen on Titan facilitates the synthesis of molecules of potential astrobiological importance. Utilization of ground-based submillimeter observations of Titan has proven to be a powerful tool to complement results from spacecraft observations. ALMA provides the ability to probe this region in greater detail with unprecedented spectral and spatial resolution at high sensitivity, allowing for the derivation of vertical mixing profiles, molecular detections, and observations of latitudinal and seasonal variations. Recent ALMA studies of Titan have presented spectrally and spatially-resolved maps of HNC and HC3N emission (Cordiner et al. 2014), as well as the first spectroscopic detection of ethyl cyanide (C2H5CN) in Titan's atmosphere (Cordiner et al. 2015). This poster will focus on ALMA observations of carbon monoxide (CO) and its isotopologues 13CO, C18O, and C 17O in Titan's atmosphere. Molecular abundances and the vertical atmospheric temperature profile were derived by modeling the observed emission line profiles using NEMESIS, a line-by-line radiative transfer code (Irwin et al. 2008). This study reports the first spectroscopic detection of 17O in the outer solar system with C17O detected at >8σ confidence. The abundances of these molecules and isotopic ratios of 12C/13C, 16O/18O, and 16O/17O will be presented. General implications for the history of Titan from these measurements will be discussed.

  19. MOF-Derived Hollow Co9 S8 Nanoparticles Embedded in Graphitic Carbon Nanocages with Superior Li-Ion Storage.

    Science.gov (United States)

    Liu, Jun; Wu, Chao; Xiao, Dongdong; Kopold, Peter; Gu, Lin; van Aken, Peter A; Maier, Joachim; Yu, Yan

    2016-05-01

    Novel electrode materials consisting of hollow cobalt sulfide nanoparticles embedded in graphitic carbon nanocages (HCSP⊂GCC) are facilely synthesized by a top-down route applying room-temperature synthesized Co-based zeolitic imidazolate framework (ZIF-67) as the template. Owing to the good mechanical flexibility and pronounced structure stability of carbon nanocages-encapsulated Co9 S8 , the as-obtained HCSP⊂GCC exhibit superior Li-ion storage. Working in the voltage of 1.0-3.0 V, they display a very high energy density (707 Wh kg(-1) ), superior rate capability (reversible capabilities of 536, 489, 438, 393, 345, and 278 mA h g(-1) at 0.2, 0.5, 1, 2, 5, and 10C, respectively), and stable cycling performance (≈26% capacity loss after long 150 cycles at 1C with a capacity retention of 365 mA h g(-1) ). When the work voltage is extended into 0.01-3.0 V, a higher stable capacity of 1600 mA h g(-1) at a current density of 100 mA g(-1) is still achieved.

  20. A European aerosol phenomenology -5: climatology of black carbon optical properties at 9 regional background sites across Europe

    Science.gov (United States)

    Zanatta, Marco; Cavalli, Fabrizia; Gysel, Martin; Weingartner, Ernest; Bukowiecki, Nicolas; Putaud, Jean Philippe; Müller, Thomas; Baltensperger, Urs; Laj, Paolo

    2016-04-01

    A reliable assessment of the optical properties of atmospheric black carbon is of crucial importance for an accurate estimation of radiative forcing. In this study we investigate the spatio-temporal variability of the mass absorption cross-section (MAC) of atmospheric black carbon, defined as light absorption coefficient (σap) divided by elemental carbon mass concentration (mEC). σap and mEC have been monitored at supersites of the ACTRIS network for a minimum period of one year. The 9 rural background sites considered in this study cover southern Scandinavia, central Europe and the Mediterranean. σap was determined using filter based absorption photometers and mEC using a thermo-optical technique. Homogeneity of the data set was ensured by harmonization of the instruments deployed at all sites during extensive intercomparison exercises at the European Center for Aerosol Calibration. Annual mean values of σap at a wavelength of 637 nm vary between 0.75 - 1.6 Mm-1 in southern Scandinavia, 4.1 - 11 Mm-1 in central Europen and 2.3-2.8 Mm-1 in the Mediterranean region. Annual mean values of mEC vary between 0.75 and 1.6 μg m-3 in southern Scandinavia, 0.28-1.1 in Central Europe and British Isles, and 0.22-0.26 in the Mediterranean. Both σap and mEC in southern Scandinavia and central Europe have a distinct seasonality with maxima during the cold season and minima during summer, whereas at the Mediterranean sites an opposite trend was observed. Annual mean MAC values were quite similar across all sites and the seasonal variability was small at most sites such that a MAC value of 10± 2.5 m2 g-1 (mean ± SD of station means) at a wavelength of 637 nm can be considered to be representative of the mixed boundary layer at European background sites. This is rather small spatial variability compared to the variability of values in previous literature, indicating that the harmonization efforts resulted in substantially increased precision of the reported MAC. However

  1. Effects of adding different types of carbon on the structure and magnetic properties of SmCo6.9Hf0.1 alloy

    Institute of Scientific and Technical Information of China (English)

    孙继兵; 步绍静; 杨薇; 王洪水; 崔春翔; 何辰辉

    2013-01-01

    In this paper, SmCo6.9Hf0.1 as-cast alloys and ribbons with the addition of either graphite (C) or carbon nanotubes (CNTs) were prepared by arc melting and melt-spinning, respectively. The effects of adding carbon on the structure and magnetic properties SmCo6.9Hf0.1 were investigated by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), magnetic force microscopy (MFM) and vibrating sample magnetometer (VSM). It was found that the micro-structure and magnetic structure of SmCo6.9Hf0.1 ribbons were changed obviously due to the introduction of C or CNTs, although their crystal structure was characterized as the same Sm(Co,Hf)7 single phase, no matter carbon was added or not. As a result, the magnetic properties of carbon-contained ribbons were enhanced in a certain degree. This was considered to be related to the refined equiaxed grains, small domain size and the pinning effect of C or CNTs-rich regions. The magnetic properties of SmCo6.9Hf0.1(CNTs)0.05 rib-bons reached Hc=12.5 kOe, Mr=57.0 emu/g and Mr/M2 T=0.788.

  2. N-Doped carbon coated hollow Ni(x)Co(9-x)S8 urchins for a high performance supercapacitor.

    Science.gov (United States)

    Zhang, Yufei; Sun, Chencheng; Su, Haiquan; Huang, Wei; Dong, Xiaochen

    2015-02-21

    N-doped carbon coated NixCo9-xS8 (NixCo9-xS8@C) hollow urchins have been synthesized via a two-step solvothermal synthesis and an in situ polymerization in dopamine together with a post-annealing process. The characterization indicated that NixCo9-xS8@C hollow urchins have urchin-like morphology and a uniform size distribution. Furthermore, there is a complete phrase transformation from the as obtained NiCo2S4/NixCo9-xS8 hybrid to NixCo9-xS8 during the thermal annealing process. More importantly, as electrochemical materials, NixCo9-xS8@C has a high specific capacitance (1404.0 F g(-1) at 2.0 A g(-1)) and excellent cycling performance (95.8% capacitance retention of the highest value after 2000 cycles). These results can be attributed to the coating of N-doped carbon, which gives the composite good conductivity. Additionally, the phase transformation from NiCo2S4/NixCo9-xS8 to NixCo9-xS8 during the thermal annealing greatly enhanced the redox reaction of the Co and Ni species.

  3. Evidence for Mg-rich carbonates on Mars from a 3.9 μm absorption feature

    Science.gov (United States)

    Palomba, Ernesto; Zinzi, Angelo; Cloutis, Edward A.; D'Amore, Mario; Grassi, Davide; Maturilli, Alessandro

    2009-09-01

    The origin and nature of the early atmosphere of Mars is still debated. The discovery of sulfate deposits on the surface, coupled with the evidence that there are not large abundances of carbonates detectable on Mars in the optically accessible part of the regolith, leaves open different paleoclimatic evolutionary pathways. Even if carbonates are responsible for the feature observed by TES and Mini-TES at 6.76 μm, alternative hypotheses suggest that it could be due to the presence of Hydrated Iron Sulfates (HIS). Carbonates can be discerned from HIS by investigating the spectral region in which a strong overtone carbonate band is present. The Planetary Fourier Spectrometer on board the Mars Express spacecraft has acquired several thousand martian spectra in the range 1.2-45 μm since January 2004, most of which show a weak absorption feature between 3.8 and 4 μm. A similar feature was observed previously from the Earth, but its origin could not be straightforwardly ascribed to surface materials, and specifically to carbonates. Here we show the surficial nature of this band that can be ascribed to carbonate mixed with the martian soil materials. The materials that best reproduce the detected feature are Mg-rich carbonates (huntite [CaMg 3(CO 3) 4] and/or magnesite [MgCO 3]). The presence of carbonates is demonstrated in both bright and dark martian regions. An evaluation of the likeliest abundance gives an upper limit of ˜10 wt%. The widespread distribution of carbonates supports scenarios that suggest carbonate formation occurred not by precipitation in a water-rich environment but by weathering processes.

  4. One-step preparation of carbon nanotubes doped mesoporous birnessite K2Mn4O9 achieving 77% of theoretical capacitance by a facile redox reaction

    Science.gov (United States)

    Kang, Litao; Li, Peiyang; Tao, Keyu; Wang, Xiaomin; Liang, Wei; Gao, Yanfeng

    2016-01-01

    A facile, scalable and cost-efficient redox reaction is developed to prepare micro-powders of a quasi-crystallised, mesoporous birnessite-type manganese oxide, K2Mn4O9. In 1 M KOH electrolyte, the K2Mn4O9 powder shows a high specific capacitance of 754 F g-1 at 1 A g-1 (calculated with the net weight of K2Mn4O9 micro-powder only). Meanwhile, the electrode retains 91% of its initial capacitance after 5000 cycles at a high current density of 5 A g-1. By simply adding carbon nanotubes (CNTs) into the reaction system, the specific capacitances of as-prepared K2Mn4O9/CNTs composites are further increased to 929 and 1055 F g-1 at 1 A g-1 in 1 and 6 M KOH electrolyte (corresponding to 69 and 77% of the theoretical capacitance of MnO2), or 600 and 674 F g-1 at 5 A g-1, respectively. Significantly, a maximum energy density of 62 Wh kg-1 at a power density of 852 W kg-1 could be achieved based on a K2Mn4O9/CNTs//activated carbon asymmetric supercapacitor (ASC). At the same time, the ASC device exhibits a decent long cycle life with 85% specific capacitance retained after 1000 cycles, suggesting its wide application potential in low-cost high energy density storage systems.

  5. Multiwalled carbon nanotube@a-C@Co9S8 nanocomposites: a high-capacity and long-life anode material for advanced lithium ion batteries

    Science.gov (United States)

    Zhou, Yanli; Yan, Dong; Xu, Huayun; Liu, Shuo; Yang, Jian; Qian, Yitai

    2015-02-01

    A one-dimensional MWCNT@a-C@Co9S8 nanocomposite has been prepared via a facile solvothermal reaction followed by a calcination process. The amorphous carbon layer between Co9S8 and MWCNT acts as a linker to increase the loading of sulfides on MWCNT. When evaluated as anode materials for lithium ion batteries, the MWCNT@a-C@Co9S8 nanocomposite shows the advantages of high capacity and long life, superior to Co9S8 nanoparticles and MWCNT@Co9S8 nanocomposites. The reversible capacity could be retained at 662 mA h g-1 after 120 cycles at 1 A g-1. The efficient synthesis and excellent performances of this nanocomposite offer numerous opportunities for other sulfides as a new anode for lithium ion batteries.A one-dimensional MWCNT@a-C@Co9S8 nanocomposite has been prepared via a facile solvothermal reaction followed by a calcination process. The amorphous carbon layer between Co9S8 and MWCNT acts as a linker to increase the loading of sulfides on MWCNT. When evaluated as anode materials for lithium ion batteries, the MWCNT@a-C@Co9S8 nanocomposite shows the advantages of high capacity and long life, superior to Co9S8 nanoparticles and MWCNT@Co9S8 nanocomposites. The reversible capacity could be retained at 662 mA h g-1 after 120 cycles at 1 A g-1. The efficient synthesis and excellent performances of this nanocomposite offer numerous opportunities for other sulfides as a new anode for lithium ion batteries. Electronic supplementary information (ESI) available: Infrared spectrogram (IR) of glucose treated MWCNT; TEM images of MWCNT@a-C treated by different concentrations of glucose; SEM and TEM images of the intermediate product obtained from the solvothermal reaction between thiourea and Co(Ac)2; EDS spectrum of MWCNT@a-C@Co9S8 composites; SEM and TEM images of MWCNT@Co9S8 nanocomposites obtained without the hydrothermal treatment by glucose; SEM and TEM images of Co9S8 nanoparticles; Galvanostatic discharge-charge profiles and cycling performance of MWCNT@a-C; TEM images

  6. Noble-metal-free carbon nanotube-Cd0.1Zn0.9S composites for high visible-light photocatalytic H2-production performance.

    Science.gov (United States)

    Yu, Jiaguo; Yang, Bin; Cheng, Bei

    2012-04-21

    Visible light photocatalytic H(2) production from water splitting using solar light is of great importance from the viewpoint of solar energy conversion and storage. In this study, a novel visible-light-driven photocatalyst multiwalled carbon nanotube modified Cd(0.1)Zn(0.9)S solid solution (CNT/Cd(0.1)Zn(0.9)S) was prepared by a simple hydrothermal method. The prepared samples exhibited enhanced photocatalytic H(2)-production activity under visible light. CNT content had a great influence on photocatalytic activity and an optimum amount of CNT was determined to be ca. 0.25 wt%, at which the CNT/Cd(0.1)Zn(0.9)S displayed the highest photocatalytic activity under visible light, giving an H(2)-production rate of 78.2 μmol h(-1) with an apparent quantum efficiency (QE) of 7.9% at 420 nm, even without any noble metal cocatalysts, exceeding that of pure Cd(0.1)Zn(0.9)S by more than 3.3 times. The enhanced photocatalytic activity was due to CNT as an excellent electron acceptor and transporter, thus reducing the recombination of charge carriers and enhancing the photocatalytic activity. Furthermore, the prepared sample was photostable and no photocorrosion was observed after photocatalytic recycling. Our findings demonstrated that CNT/Cd(0.1)Zn(0.9)S composites were a promising candidate for the development of high-performance photocatalysts in photocatalytic H(2) production. This work not only shows a possibility for the utilization of low cost CNT as a substitute for noble metals (such as Pt) in the photocatalytic H(2)-production but also for the first time shows a significant enhancement in the H(2)-production activity by using metal-free carbon materials as effective co-catalysts. PMID:22422167

  7. Carbon Dots and 9AA as a Binary Matrix for the Detection of Small Molecules by Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry.

    Science.gov (United States)

    Chen, Yongli; Gao, Dan; Bai, Hangrui; Liu, Hongxia; Lin, Shuo; Jiang, Yuyang

    2016-07-01

    Application of matrix-assisted laser-desorption/ionization mass spectrometry (MALDI MS) to analyze small molecules have some limitations, due to the inhomogeneous analyte/matrix co-crystallization and interference of matrix-related peaks in low m/z region. In this work, carbon dots (CDs) were for the first time applied as a binary matrix with 9-Aminoacridine (9AA) in MALDI MS for small molecules analysis. By 9AA/CDs assisted desorption/ionization (D/I) process, a wide range of small molecules, including nucleosides, amino acids, oligosaccharides, peptides, and anticancer drugs with a higher sensitivity were demonstrated in the positive ion mode. A detection limit down to 5 fmol was achieved for cytidine. 9AA/CDs matrix also exhibited excellent reproducibility compared with 9AA matrix. Moreover, by exploring the ionization mechanism of the matrix, the influence factors might be attributed to the four parts: (1) the strong UV absorption of 9AA/CDs due to their π-conjugated network; (2) the carboxyl groups modified on the CDs surface act as protonation sites for proton transfer in positive ion mode; (3) the thin layer crystal of 9AA/CDs could reach a high surface temperature more easily and lower transfer energy for LDI MS; (4) CDs could serve as a matrix additive to suppress 9AA ionization. Furthermore, this matrix was allowed for the analysis of glucose as well as nucleosides in human urine, and the level of cytidine was quantified with a linear range of 0.05-5 mM (R(2) > 0.99). Therefore, the 9AA/CDs matrix was proven to be an effective MALDI matrix for the analysis of small molecules with improved sensitivity and reproducibility. This work provides an alternative solution for small molecules detection that can be further used in complex samples analysis. Graphical Abstract ᅟ.

  8. Carbon Dots and 9AA as a Binary Matrix for the Detection of Small Molecules by Matrix-Assisted Laser Desorption/Ionization Mass Spectrometry

    Science.gov (United States)

    Chen, Yongli; Gao, Dan; Bai, Hangrui; Liu, Hongxia; Lin, Shuo; Jiang, Yuyang

    2016-07-01

    Application of matrix-assisted laser-desorption/ionization mass spectrometry (MALDI MS) to analyze small molecules have some limitations, due to the inhomogeneous analyte/matrix co-crystallization and interference of matrix-related peaks in low m/z region. In this work, carbon dots (CDs) were for the first time applied as a binary matrix with 9-Aminoacridine (9AA) in MALDI MS for small molecules analysis. By 9AA/CDs assisted desorption/ionization (D/I) process, a wide range of small molecules, including nucleosides, amino acids, oligosaccharides, peptides, and anticancer drugs with a higher sensitivity were demonstrated in the positive ion mode. A detection limit down to 5 fmol was achieved for cytidine. 9AA/CDs matrix also exhibited excellent reproducibility compared with 9AA matrix. Moreover, by exploring the ionization mechanism of the matrix, the influence factors might be attributed to the four parts: (1) the strong UV absorption of 9AA/CDs due to their π-conjugated network; (2) the carboxyl groups modified on the CDs surface act as protonation sites for proton transfer in positive ion mode; (3) the thin layer crystal of 9AA/CDs could reach a high surface temperature more easily and lower transfer energy for LDI MS; (4) CDs could serve as a matrix additive to suppress 9AA ionization. Furthermore, this matrix was allowed for the analysis of glucose as well as nucleosides in human urine, and the level of cytidine was quantified with a linear range of 0.05-5 mM (R2 > 0.99). Therefore, the 9AA/CDs matrix was proven to be an effective MALDI matrix for the analysis of small molecules with improved sensitivity and reproducibility. This work provides an alternative solution for small molecules detection that can be further used in complex samples analysis.

  9. CCRA-9 2014 update

    OpenAIRE

    Thompson, T. L.; Thomason, W.E.

    2014-01-01

    This PowerPoint summarizes the research activities and findings of SANREM’s soil quality and soil carbon sequestration cross-cutting research activity. The presentation describes studies of soil carbon dioxide, GIS agroclimatology comparisons, and density fractionation of soil carbon. CCRA-9 (Soil Quality and Soil Carbon Sequestration)

  10. Effect of carbon on creep rupture strength and toughness of 9Cr-2Mo heat-resisting steels with V and Nb

    International Nuclear Information System (INIS)

    The effect of carbon on creep rupture properties and room-temperature toughness of (9--10)Cr-(1.8--2)Mo heat resisting steels with V and Nb was studied. The amount of carbon content was varied from 0.02% to 0.23% in order to improve toughness without decrease in creep rupture strength. The difference in creep rupture strength and Charpy absorbed energy between 10Cr-2Mo steels and 9Cr-1.8Mo steels was studied with respect to the ratio of delta-ferrite to martensite, the precipitates, and the microstructure. The results indicated that the 9Cr-1.8Mo-0.1V-0.05Nb steels with 0.05--0.14%C tempered at 8000C showed good toughness, and that 104h rupture strength of the steel was as high as that of SUS 316 at 5500C and SUS 304 austenitic stainless steel at 6000C. It was concluded that the optimum amount of delta-ferrite with respect to both creep rupture strength and Charpy absorbed energy was 10--20%. (author)

  11. Physisorption of Nucleobases on C(9,1) and C(6,5) Single-Wall Carbon Nanotubes: A Density Functional Theory Study

    Science.gov (United States)

    Akdim, Brahim; Pachter, Ruth

    2009-03-01

    Selective enrichment of single-wall carbon nanotubes (SWCNTs) of a specific chirality by single-stranded DNA sequences has been shown experimentally by Zheng et al. [JACS 2007, 129, 6084], where a larger enrichment of C(6,5) as compared to C(9,1), which are SWCNTs of the same diameter but different chirality, was demonstrated with alternating guanine and thymine (GT) bases. In this work, we report density functional (DFT) calculations of (G) and (T) nucleobase adsorption on C(6,5) and C(9,1) SWCNTs, in order to gain an understanding of the selective sorting, specifically regarding adsorption characteristics, interface energetics, and electronic structures, as dependent on the tube chirality, also including specifically an empirical dispersion correction in the DFT functional.

  12. Treatability Test Report: Characterization of Vadose Zone Carbon Tetrachloride Source Strength Using Tomographic Methods at the 216-Z-9 Site

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J.; Carroll, Kenneth C.; Rohay, Virginia J.; Mackley, Rob D.; Parker, Kyle R.

    2012-09-28

    A treatability test was conducted in 2011 at the 216-Z-9 Trench to evaluate methods for collecting characterization information that supports refined assessment of SVE performance goals based on impact to groundwater. The characterization information can also provide input to operational strategies for continued SVE operation and decisions regarding closure of the SVE system or transition to other remedies, if necessary.

  13. 9,10-Dibromo-N-aryl-9,10-dihydro-9,10-[3,4]epipyrroloanthracene-12,14-diones: Synthesis and Investigation of Their Effects on Carbonic Anhydrase Isozymes I, II, IX, and XII.

    Science.gov (United States)

    Göksu, Haydar; Topal, Meryem; Keskin, Ali; Gültekin, Mehmet S; Çelik, Murat; Gülçin, İlhami; Tanc, Muhammet; Supuran, Claudiu T

    2016-06-01

    N-substituted maleimides were synthesized from maleic anhydride and primary amines. 1,4-Dibromo-dibenzo[e,h]bicyclo-[2,2,2]octane-2,3-dicarboximide derivatives (4a-f) were prepared by the [4+2] cycloaddition reaction of dibromoanthracenes with the N-substituted maleimide derivatives. The carbonic anhydrase (CA, EC 4.2.1.1) inhibitory effects of the new derivatives were assayed against the human (h) isozymes hCA I, II, IX, and XII. All tested bicyclo dicarboximide derivatives exhibited excellent inhibitory effects in the nanomolar range, with Ki values in the range of 117.73-232.87 nM against hCA I and of 69.74-111.51 nM against hCA II, whereas they were low micromolar inhibitors against hCA IX and XII. PMID:27174792

  14. Cobalt(III) complexes of [3(5)]adamanzane, 1,5,9,13-tetraazabicyclo[7.7.3]nonadecane. Report of an inert, chelate hydrogen carbonate ion

    DEFF Research Database (Denmark)

    Broge, Louise; Søtofte, Inger; Olsen, Carl Erik;

    2001-01-01

    .H2O (3a). The coordination geometry around the cobalt(III) ion is a distorted octahedron with the inorganic ligands at cis-positions. Complex 2 is the second example of a cobalt(III) complex for which the X-ray structure,sfiows a chelate binding mode of the hydrogen carbonate entity. The pK(a) value...... of the [Co([3(5)]adz)(HCO3)](2+) ion (2) was determined spectrophotometrically to be 0.27 (25 degreesC, I = 5.0 M). The protonation appears to occur at the noncoordinated carbonyl oxygen atom of the carbonate group, with hydrogen bonding to the crystal water molecule. Evidence is presented for this oxygen......-atom as the site of protonation in solution as well. In 5.0 M CF3SO3H a slow reaction of the carbonate complex, quantitatively yielding the [Co([3(5)]adz)(H2O)(2)](3+) ion, was observed. k(obs) 7.9(1) x 10(-6) s(-1) at 25 degreesC....

  15. The silicate and carbon-rich models of CoRoT-7b, Kepler-9d and Kepler-10b

    Institute of Scientific and Technical Information of China (English)

    Yan-Xiang Gong; Ji-Lin Zhout

    2012-01-01

    Possible bulk compositions of the super-Earth exoplanets CoRoT-7b,Kepler-9d,and Kepler-10b are investigated by applying a commonly used silicate model and a non-standard carbon model.Their internal structures are deduced using a suitable equation of state for the materials.The degeneracy problems of their compositions can be partly overcome,based on the fact that all three planets are extremely close to their host stars.By analyzing the numerical results,we conclude:1) the iron core of CoRoT-7b is not more than 27% of its total mass within lσ mass-radius error bars,so an Earth-like composition is less likely,but its carbon rich model can be compatible with an Earth-like core/mantle mass fraction; 2) Kepler-10b is more likely to have a Mercury-like composition,with its old age implying that its high iron content may be a result of strong solar wind or giant impact; 3) the transiting-only super-Earth Kepler-9d is also discussed.Combining its possible composition with the formation theory,we can place some constraints on its mass and bulk composition.

  16. Corrugated stainless steels embedded in mortar for 9 years: corrosion results of non-carbonated, chloride-contaminated samples

    OpenAIRE

    Bautista, A.; Paredes, E. C.; Velasco, F.; Álvarez, S. M.

    2015-01-01

    Mortar samples reinforced with 5 different corrugated stainless steels were tested for 9 years in 2 different conditions: partial immersion (PI) in 3.5% NaCl, and chloride addition to the mortar and exposure to high relative humidity (HRH). The monitoring during the exposures was carried out with corrosion potential (E-corr) and electrochemical impedance spectroscopy (EIS) measurements. A year before finishing (after 8 years of exposure), the reinforced mortar samples were anodically polarise...

  17. Paired carbon stable-isotope records for the Cenomanian Stage (100.5 -93.9 Ma): correlation tool and Late Cretaceous pCO2 record?

    Science.gov (United States)

    Jarvis, Ian; Gröcke, Darren; Laurin, Jiří; Selby, David; Roest-Ellis, Sascha; Miles, Andrew; Lignum, John; Gale, Andrew; Kennedy, Jim

    2016-04-01

    Carbon stable-isotope stratigraphy of marine carbonates (δ13Ccarb) provides remarkable insights into past variation in the global carbon cycle, and has become firmly established as a powerful global correlation tool. Continuous δ13Ccarb time series are becoming increasingly available for much of the geological record, including the Upper Cretaceous. However, our knowledge of stratigraphic variation in the carbon isotopic composition of sedimentary organic matter (δ13Corg) is much poorer, and is generally restricted to organic-rich sedimentary successions and/or key boundary intervals. Close coupling exists between the global isotopic composition of the reduced and oxidised carbon reservoirs on geological time scales, but the stratigraphic resolution of most long-term δ13Corg Mesozoic records is inadequate to identify leads and lags in the responses of the two reservoirs to carbon cycle perturbations. Cenomanian times (100.5-93.9 Ma) represent perhaps the best documented episode of eustatic rise in sea level in Earth history and the beginning of the Late Mesozoic thermal maximum, driving global expansion of epicontinental seas and the onset of widespread pelagic and hemipelagic carbonate deposition. Significant changes occurred in global stable-isotope records, including two prominent perturbations of the carbon cycle - the Mid-Cenomanian Event I (MCEI; ~96.5-96.2 Ma) and Oceanic Anoxic Event 2 (OAE2; ~94.5-93.8 Ma). OAE2, one of two truly global Cretaceous OAEs, was marked by the widespread deposition of black shales, and a global positive carbon stable-isotope excursion of 2.0 - 2.5‰ δ13Ccarb, and up to 7‰ in the sulphur-bound phytane biomarker. MCEI, by contrast, shows a Germany and Italy. Comparison of the Vergons δ13Ccarb vs. δ13Corg profiles demonstrates similar medium-term stratigraphic variation, but significant differences in both short- and long-term trends. Potential causes of the similarities and differences are examined, and it is concluded

  18. Carbon Tetrachloride Flow and Transport in the Subsurface of the 216-Z-9 Trench at the Hanford Site

    Science.gov (United States)

    Oostrom, M.; Rockhold, M.; Truex, M.; Thorne, P.; Last, G.; Rohay, V.

    2006-12-01

    Three-dimensional modeling was conducted with layered and heterogeneous models to enhance the conceptual model of CT distribution in the vertical and lateral direction beneath the 216-Z-9 trench and to investigate the effects of soil vapor extraction (SVE). This work supports the U.S. Department of Energy's (DOE's) efforts to characterize the nature and distribution of CT in the 200 West Area and subsequently select an appropriate final remedy. Simulations targeted migration of dense, nonaqueous phase liquid (DNAPL) consisting of CT and co-disposed organics in the subsurface beneath the 216-Z-9 trench as a function of the properties and distribution of subsurface sediments and of the properties and disposal history of the waste. Simulations of CT migration were conducted using the Subsurface Transport Over Multiple Phases (STOMP) simulator. Simulation results support a conceptual model for CT distribution where CT in the DNAPL phase is expected to have migrated primarily in a vertical direction below the disposal trench. Presence of small-scale heterogeneities tends to limit the extent of vertical migration of CT DNAPL due to enhanced retention of DNAPL compared to more homogeneous conditions, but migration is still predominantly in the vertical direction. Results also show that the Cold Creek units retain more CT DNAPL within the vadose zone than other hydrologic unit during SVE. A considerable amount of the disposed CT DNAPL may have partitioned to the vapor and subsequently water and sorbed phases. Presence of small-scale heterogeneities tends to increase the amount of volatilization. Any continued migration of CT from the vadose zone to the groundwater is likely through interaction of vapor phase CT with the groundwater and not through continued DNAPL migration. The results indicated that SVE appears to be an effective technology for vadose zone remediation, but additional effort is needed to improve simulation of the SVE process.

  19. Monitoring of black carbon and size-segregated particle number concentrations at 9-m and 65-m distances from a major road in Helsinki

    Energy Technology Data Exchange (ETDEWEB)

    Pakkanen, T.A.; Maekelae, T.; Hillamo, R.E. [Finnish Meteorological Inst., Helsinki (Finland); Virtanen, A.; Roenkkoe, T.; Keskinen, J. [Tampere Univ. of Technology, Inst. of Physics, Aerosol Physics Lab. , Tampere (Finland); Pirjola, L.; Parviainen, H. [Helsinki Polytechnic, Dept. of Technology, Helsinki (Finland); Hussein, T.; Haemeri, K. [Helsinki Univ., Dept. of Physical Sciences, Helsinki (Finland)

    2006-07-01

    In February and August 2003, black carbon (BC) and size-segregated particle number concentrations were monitored simultaneously at 9-m and 65-m distances from a major road in Helsinki, Finland, using aethalometers and electrical low-pressure impactors, respectively. During weekdays in winter, the average total particle number concentrations in the diameter range 0.007-1{mu}m increased during morning rush hours from the nighttime values of 17000 and 12000 cm{sup -3} to 190000 and 130000 cm{sup -3} at the 9-m and 65-m stations, respectively. The corresponding BC concentrations increased from 730 and 430 ng m{sup -3} to 2800 and 1550 ng m{sup -3}. Compared with those in winter, the average rush-hour particle number concentrations were much lower in summer, the likely reason being enhanced nucleation in cold winter conditions. BC concentrations were slightly higher during summer than during winter. Number size distributions measured at the 9-m and 65-m distances and at a background site had similar modal characteristics with the highest peak occurring below 0.03 {mu}m. Despite the different wind conditions in winter and summer, concentrations of total particle number and BC decreased similarly between the 9-m and 65-m stations, the likely principal mechanism being mixing with background air. The strong diurnal variation in concentrations during the weekdays, together with the large concentration difference between the 9-m and 65-m distances, suggests that local traffic was the main source of the measured pollutants, especially during rush hours at the 9-m site. In winter, the decrease in the particle number concentrations from the 9-m site to the 65-m site was most pronounced for the smallest exhaust particles. During an episodic pollution event in winter there were indications of condensational growth of 0.007-0.03 {mu}m particles, which increased the number concentration of 0.03-0.06 {mu}m particles at the 65-m site. (orig.)

  20. Unsaturated C3,5,7,9-Monocarboxylic Acids by Aqueous, One-Pot Carbon Fixation: Possible Relevance for the Origin of Life.

    Science.gov (United States)

    Scheidler, Christopher; Sobotta, Jessica; Eisenreich, Wolfgang; Wächtershäuser, Günter; Huber, Claudia

    2016-06-10

    All scientific approaches to the origin of life share a common problem: a chemical path to lipids as main constituents of extant cellular enclosures. Here we show by isotope-controlled experiments that unsaturated C3,5,7,9-monocarboxylic acids form by one-pot reaction of acetylene (C2H2) and carbon monoxide (CO) in contact with nickel sulfide (NiS) in hot aqueous medium. The primary products are toto-olefinic monocarboxylic acids with CO-derived COOH groups undergoing subsequent stepwise hydrogenation with CO as reductant. In the resulting unsaturated monocarboxylic acids the double bonds are mainly centrally located with mainly trans-configuration. The reaction conditions are compatible with an origin of life in volcanic-hydrothermal sub-seafloor flow ducts.

  1. The charge state distributions of 0.5-2.9 MeV Be, Al, Cl, Ti and Ni ions measured after carbon foil stripping

    International Nuclear Information System (INIS)

    Equilibrium charge state distributions have been measured for Be, Al, Cl, Ti and Ni ions stripped in the high-voltage terminal of an electrostatic tandem accelerator using a 2 μg/cm2 carbon foil. The series of measurements were made with a terminal voltage ranging from typically 1.5 to 2.9 MV. The charge state distributions were measured on the high-energy side of the accelerator, just in front of the analysing magnet, in order to take charge state-dependent transmission through the high-energy side of the accelerator into account. The obtained charge state distributions will be used for accelerator mass spectrometry measurements to find the optimum terminal voltage of the accelerator. (orig.)

  2. Differential cross sections on fragment (2 ≤ Z ≤ 9) production for carbon, aluminum and silicon induced by tens-of-MeV protons

    International Nuclear Information System (INIS)

    The double-differential cross sections (DDXs) for the inclusive reactions producing heavy nuclei with Z = 2-9 (fragments) from carbon, aluminum, and silicon targets induced by 50 and 70 MeV protons are systematically measured at several angles (30deg, 60deg, 90deg, and 135deg) using a specially developed Bragg curve counter and the energy-time-of-flight method. The DDXs of a silicon target for the proton-induced reaction producing fragments heavier than lithium were measured for the first time. The present results are compared with past experimental data, the LA150 evaluated data by the Los Alamos group and several intranuclear cascade models (Bertini and ISOBAR), and the JAEA-version quantum molecular dynamics model (JQMD) coupled with the Generalized Evaporation Model (GEM), which are implemented in the Particle and Heavy Ion Transport code System (PHITS). The present results agree well with the past experimental data and LA150 data for α-particle production. For the fragments heavier than lithium, the present results show forward-peak angular distributions rather than isotropic ones stored in LA150. Calculations with the ISOBAR and GEM models well reproduced our experimental results except for light fragments especially in the high-energy region. (author)

  3. Carbonate in Comets: A Comparison of Comets 1P/Halley, 9P/Temple 1, and 81P/Wild 2

    Science.gov (United States)

    Flynn, G. J.; Leroux, H.; Tomeoka, K.; Tomioka, N.; Ohnishi, I.; Mikouchi, T.; Wirick, S.; Keller, L. P.; Jacobsen, C.; Sanford, S. A.

    2008-01-01

    Comets are generally believed to have formed in a cold region, trapping in the cometary ices the original low-temperature condensate grains of our Solar System. These grains would have been preserved in cold-storage, at a temperature below the freezing point of CO2, for the last 4.5+ billion years. Carbonates are common in hydrous meteorites and hydrous interplanetary dust particles (IDPs), where they are believed to have formed by parent-body aqueous processing. Since simple models of cometary evolution involve no aqueous processing, carbonates were generally presumed not to occur in comets. However, Toppani et al. [1] have performed experiments that indicate carbonate can be formed by non-equilibrium condensation in circumstellar environments where water is present as a vapor, not as a liquid. This suggests carbonate might have condensed in cold regions of the Solar Nebula, and might be present in comets.

  4. Measurement of the tensor (Ayy) and vector (Ay) analyzing powers in the fragmentation of a 9-GeV/c deuteron on hydrogen and carbon nuclei at high proton transverse momenta

    International Nuclear Information System (INIS)

    Data on the tensor and vector analyzing powers (Ayy and Ay, respectively) in the fragmentation of a 9-GeV/c deuteron on hydrogen and carbon nuclei at high proton transverse momenta are presented. These data are compared with the results of relevant calculations performed within light-front dynamics by using various deuteron wave functions. The best description of the data is attained with the relativistic deuteron wave function derived within field-theory light-front dynamics

  5. Zur Reaktion von Pyroglutaminsäure-Derivaten mit Phosphorpentachlorid - Darstellung chlorierter Pyrrol-2-carbonsäure-Derivate (Aminosäuren ; 9)

    OpenAIRE

    Effenberger, Franz; Müller, Wolfgang; Isak, Heinz

    1987-01-01

    N-Benzyl-5-oxoprolinester 5 werden mit PCl5 über verschiedene chlorierte Zwischenstufen zu N-Benzyl-4,5-dichlor-1H-pyrrol-2-carbonsäureestern 6 chloriert, während N-Benzhydryl- L-3 und N-Acyl-5-oxoprolinester L-4 mit PCl5 unter Abspaltung des N-Substituenten L-4,4,5-Trichlor-3,4-dihydro-2H-pyrrol-2-carbon-säureester 18 bilden, die mit Base in die 4,5-Dichlor-1H-pyrrol-2-carbonsäureester 20 übergehen. Diese Umsetzungen stellen die beste Methode zur Herstellung von 4,5-Dichlor-1H-pyrrol-2-carbo...

  6. Electroanalytical Determination of Guanine and Uric Acid Using Double-Walled Carbon Nanotube-Graphene Nanosheet Hybrid Film/Acid Yellow 9 Modified Electrode%石墨烯-双壁碳纳米管/酸性黄9修饰电极电化学检测鸟嘌呤和尿酸

    Institute of Scientific and Technical Information of China (English)

    许冰冰; 王海军

    2012-01-01

    A new method for electroanalytical determination of guanine (GA) and uric acid (UA) based on double-walled carbon nanotube-graphene nanosheet hybrid film/acid yellow 9 modified glass carbon electrode ( DG/AY/GCE) is reported. The electrochemical behaviors of guanine and uric acid at DG/AY/GCE were investigated in details. It is found that the DG/AY/GCE exhibited excellent analytical performance for determination GA and UA in 0. 1 mol/L phosphate buffer solution (pH 4. 0) since it not only increases the oxidation peak current but also lowers the oxidation overpotential. The oxidation currents of GA and UA were found linearly related to concentration over the range 2. 0 × 10-9 to 6. 8 × 10-5 mol/L for GA and 5. 0 × 10-9 to 9. 5 × 10-5 mol/L for UA using amperometric method. The detection limits were found to be 6.67 × 10-10 mol/L (s/n = 3) for GA and 1.67 × 10-9 mol/L (s/n =3) for UA. The proposed method was used to detect GA and UA in human urine samples with satisfactory results.%制备了石墨烯-双壁碳纳米管/酸性黄9修饰玻碳电极(DG/AY/GCE),在浓度为0.1mol/L、pH为4.0的磷酸缓冲溶液中,探讨了鸟嘌呤(Guanine,GA)和尿酸(Uric acid,UA)在该修饰电极上的电化学行为.结果表明:GA和UA在该修饰电极上氧化电流可得到明显增强,过电位得以降低.利用计时电流法测定GA和UA,与GA和UA氧化电流呈线性关系的浓度范围分别为2.0×10-9 ~ 6.8×10-5 mol/L和5.0×10-99.5×10-5 mol/L,检测限(s/n=3)分别为6.67×10-10 mol/L和1.67×10-9 mol/L.该修饰电极已经成功应用于人类尿液中GA和UA的含量分析,结果令人满意.

  7. Study of the mechanism of corrosion of some ferritic steels in high-pressure carbon dioxide with the aid of oxygen-18 as a tracer: Pt. 3. Fe-9% Cr-1% Mo-0. 26% Sr

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, L.F.R.; Calvert, J.M.; Gleave, C.; Lees, D.G.; Rowlands, P.C.

    1989-04-08

    The oxidation mechanism of a commercial Fe-9% Cr steel in high-pressure (4.1 MPa) carbon dioxide at 913 K have been investigated with the aid of charged-particle nuclear techniques and /sup 18/O as a tracer. Duplex and multilayered oxide-scales were examined. Both types of scale grew at the oxide-gas interface. Substantial growth occurred in the inner half of the inner layer on the specimen with the duplex scale; very little growth occurred within the inner layer of the multilayered scale. A possible oxidation sequence which could account for the /sup 18/O distributions is proposed.

  8. 纯牛奶中18碳TFA及9c,11 t-CLA含量的测定研究%Study on 18-carbon trans fatty acid and 9c,11t-conjugated linoleic acid contents in milk

    Institute of Scientific and Technical Information of China (English)

    章萍萍; 赵培城

    2010-01-01

    为了精确测量出纯牛奶中18碳TFA及9c,11t-CLA的含量,本实验通过毛细管气相色谱法,并采用内标法,对纯牛奶进行了检测,结果显示,纯牛奶中18碳脂肪酸的质量百分比约为35.43% ,18碳TFA的质量百分比约为2.27%,而其中C18:1-llt的质量百分比达到1.28%,占所有18碳TFA的一半以上,约为56.36%,同时,牛奶中C18:2 -9c,11t的质量百分比只为0.11%,其含量远少于TFA.

  9. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the Nine R/V Korr Cruises Comprising the Indian Ocean CO2Survey (WOCE Sections I8SI9S, I9N, I8NI5E, I3, I5WI4, I7N, I1, I10, and I2; December 1, 1994-January 19, 1996)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, A.V.

    2003-09-15

    This document describes the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) and total alkalinity (TALK) at hydrographic stations taken during the R/V Knorr Indian Ocean cruises (Sections I8SI9S, I9N, I8NI5E, I3, I5WI4, I7N, I1, I10, and I2) in 1994-1996. The measurements were conducted as part of the World Ocean Circulation Experiment (WOCE). The expedition began in Fremantle, Australia, on December 1, 1994, and ended in Mombasa, Kenya, on January 22, 1996. During the nine cruises, 12 WOCE sections were occupied. Total carbon dioxide was extracted from water samples and measured using single-operator multiparameter metabolic analyzers (SOMMAs) coupled to coulometers. The overall precision and accuracy of the analyses was {+-} 1.20 {micro}mol/kg. The second carbonate system parameter, TALK, was determined by potentiometric titration. The precision of the measurements determined from 962 analyses of certified reference material was {+-} 4.2 {micro}mol/kg (REFERENCE). This work was supported by grants from the National Science Foundation, the U. S. Department of Energy, and the National Oceanographic and Atmospheric Administration. The R/V Knorr Indian Ocean data set is available as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of 18 oceanographic data files, two FORTRAN 77 data retrieval routine files, a readme file, and this printed documentation, which describes the contents and format of all files as well as the procedures and methods used to obtain the data. Instructions for accessing the data are provided.

  10. 广州白云山9种林分光合固碳放氧价值核算%Valuation of Photosynthetic Carbon Sequestration and Oxygen Production of the 9 Forest Stands in Baiyunshan Scenic Spot, Guangzhou, China

    Institute of Scientific and Technical Information of China (English)

    贾小容; 曾曙才; 苏志尧

    2006-01-01

    采用收获法计算了广州白云山林分改造后9种新建林分的生物量,并在此基础上评估了这些林分的光合固碳和放氧价值.各种林分的光合固碳和放氧的总价值分别为:木荷851 477.17 USD/hm2,石栎244 597.27 USD/hm2,大叶相思603 695.00 USD/hm2,马占相思372 768.99 USD/hm2,藜蒴289 537.77USD/hm2,中华锥437 500.48 USD/hm2,降真香109 758.10 USD/hm2,尖叶杜英146 324.94 USD/hm2,加勒比松138 039.68 USD/hm2.以木荷和大叶相思的光合固碳和放氧价值最高.

  11. 9.ENDOCRINOLOGY

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    9.1.Diabetes mellitus930638 A study on insulin receptor of liver plasmamembranes from streptozotocin-induced diabeticrats.QIN Guangca,et al.Dept Endocrinol,1st Affili Hosp,West-China Med Univ,Chengdu,610041.Chin J Endocrinol & Metabol 1993;9(2):102

  12. Sox9

    DEFF Research Database (Denmark)

    Seymour, Philip A

    2014-01-01

    Over the last decade, it has been discovered that the transcription factor Sox9 plays several critical roles in governing the development of the embryonic pancreas and the homeostasis of the mature organ. While analysis of pancreata from patients affected by the Sox9 haploinsufficiency syndrome...... endocrine differentiation and maintaining pancreatic ductal identity, and it has recently been unveiled as a key player in the initiation of pancreatic cancer. These functions of Sox9 are discussed in this article, with special emphasis on the knowledge gained from various loss-of-function and lineage...... tracing mouse models. Also, current controversies regarding Sox9 function in healthy and injured adult pancreas and unanswered questions and avenues of future study are discussed....

  13. The potential protective effect of Physalis peruviana L. against carbon tetrachloride-induced hepatotoxicity in rats is mediated by suppression of oxidative stress and downregulation of MMP-9 expression.

    Science.gov (United States)

    Al-Olayan, Ebtisam M; El-Khadragy, Manal F; Aref, Ahmed M; Othman, Mohamed S; Kassab, Rami B; Abdel Moneim, Ahmed E

    2014-01-01

    The active constituent profile in Cape gooseberry (Physalis peruviana L.) juice was determined by GC-MS. Quercetin and kaempferol were active components in the juice. In this study we have evaluated its potential protective effect on hepatic injury and fibrosis induced by carbon tetrachloride (CCl4). Twenty-eight rats divided into 4 groups: Group I served as control group, and Group II received weekly i.p. injection of 2 mL CCl4/kg bwt for 12 weeks. Group III were supplemented with Physalis juice via the drinking water. The animals of Group IV received Physalis juice as Group III and also were intraperitoneally injected weekly with 2 mL CCl4/kg bwt for 12 weeks. Hepatoprotective effect was evaluated by improvement in liver enzymes serum levels, reduction in collagen areas, downregulation in expression of the fibrotic marker MMP-9, reduction in the peroxidative marker malonaldehyde and the inflammatory marker nitric oxide, and restoration of the activity of antioxidant enzymatic and nonenzymatic systems, namely, glutathione content, superoxide dismutase, catalase, glutathione-S-transferase, glutathione peroxidase, and glutathione reductase activities. The results show that the potential hepatoprotective effects of Physalis peruviana may be due to physalis acts by promotion of processes that restore hepatolobular architecture and through the inhibition of oxidative stress pathway. PMID:24876910

  14. Thermal Infrared Imaging and Atmospheric Modeling of VHS J125601.92-125723.9 b: Evidence for Moderately Thick Clouds and Equilibrium Carbon Chemistry in a Hierarchical Triple System

    CERN Document Server

    Rich, Evan A; Wisniewski, John P; Hashimoto, Jun; Brandt, Timothy D; Carson, Joseph C; Kuzuhara, Masayuki; Uyama, Taichi

    2016-01-01

    We present and analyze Subaru/IRCS L' and M' images of the nearby M dwarf VHS J125601.92-125723.9 (VHS 1256), which was recently claimed to have a ~11 M_Jup companion (VHS 1256 b) at ~102 au separation. Our AO images partially resolve the central star into a binary, whose components are nearly equal in brightness and separated by 0.106" +/- 0.001". VHS 1256 b occupies nearly the same near-IR color-magnitude diagram position as HR 8799 bcde and has a comparable L' brightness. However, it has a substantially redder H - M' color, implying a relatively brighter M' flux density than for the HR 8799 planets and suggesting that non-equilibrium carbon chemistry may be less significant in VHS 1256 b. We successfully match the entire SED (optical through thermal infrared) for VHS 1256 b to atmospheric models assuming chemical equilibrium, models which failed to reproduce HR 8799 b at 5 microns. Our modeling favors slightly thick clouds in the companion's atmosphere, although perhaps not quite as thick as those favored ...

  15. The Potential Protective Effect of Physalis peruviana L. against Carbon Tetrachloride-Induced Hepatotoxicity in Rats Is Mediated by Suppression of Oxidative Stress and Downregulation of MMP-9 Expression

    Directory of Open Access Journals (Sweden)

    Ebtisam M. Al-Olayan

    2014-01-01

    Full Text Available The active constituent profile in Cape gooseberry (Physalis peruviana L. juice was determined by GC-MS. Quercetin and kaempferol were active components in the juice. In this study we have evaluated its potential protective effect on hepatic injury and fibrosis induced by carbon tetrachloride (CCl4. Twenty-eight rats divided into 4 groups: Group I served as control group, and Group II received weekly i.p. injection of 2 mL CCl4/kg bwt for 12 weeks. Group III were supplemented with Physalis juice via the drinking water. The animals of Group IV received Physalis juice as Group III and also were intraperitoneally injected weekly with 2 mL CCl4/kg bwt for 12 weeks. Hepatoprotective effect was evaluated by improvement in liver enzymes serum levels, reduction in collagen areas, downregulation in expression of the fibrotic marker MMP-9, reduction in the peroxidative marker malonaldehyde and the inflammatory marker nitric oxide, and restoration of the activity of antioxidant enzymatic and nonenzymatic systems, namely, glutathione content, superoxide dismutase, catalase, glutathione-S-transferase, glutathione peroxidase, and glutathione reductase activities. The results show that the potential hepatoprotective effects of Physalis peruviana may be due to physalis acts by promotion of processes that restore hepatolobular architecture and through the inhibition of oxidative stress pathway.

  16. Carbon Carbon Composites: An Overview .

    OpenAIRE

    G. Rohini Devi; K. Rama Rao

    1993-01-01

    Carbon carbon composites are a new class of engineering materials that are ceramic in nature but exhibit brittle to pseudoplastic behaviour. Carbon-carbon is a unique all-carbon composite with carbon fibre embeded in carbon matrix and is known as an inverse composite. Due to their excellent thermo-structural properties, carbon-carbon composites are used in specialised application like re-entry nose-tips, leading edges, rocket nozzles, and aircraft brake discs apart from several indust...

  17. Carbon Carbon Composites: An Overview .

    Directory of Open Access Journals (Sweden)

    G. Rohini Devi

    1993-10-01

    Full Text Available Carbon carbon composites are a new class of engineering materials that are ceramic in nature but exhibit brittle to pseudoplastic behaviour. Carbon-carbon is a unique all-carbon composite with carbon fibre embeded in carbon matrix and is known as an inverse composite. Due to their excellent thermo-structural properties, carbon-carbon composites are used in specialised application like re-entry nose-tips, leading edges, rocket nozzles, and aircraft brake discs apart from several industrial and biomedical applications. The multidirectional carbon-carbon product technology is versatile and offers design flexibility. This paper describes the multidirectional preform and carbon-carbon process technology and research and development activities within the country. Carbon-carbon product experience at DRDL has also been discussed. Development of carbon-carbon brake discs process technology using the liquid impregnation process is described. Further the test results on material characterisation, thermal, mechanical and tribological properties are presented.

  18. Kepler-9

    DEFF Research Database (Denmark)

    Holman...[], Matthew J.; Fabrycky, D. C.; Ragozzine, D.;

    2010-01-01

    The Kepler spacecraft is monitoring more than 150,000 stars for evidence of planets transiting those stars. We report the detection of two Saturn-size planets that transit the same Sun-like star, based on 7 months of Kepler observations. Their 19.2- and 38.9-day periods are presently increasing...... and decreasing at respective average rates of 4 and 39 minutes per orbit; in addition, the transit times of the inner body display an alternating variation of smaller amplitude. These signatures are characteristic of gravitational interaction of two planets near a 2:1 orbital resonance. Six radial......-velocity observations show that these two planets are the most massive objects orbiting close to the star and substantially improve the estimates of their masses. After removing the signal of the two confirmed giant planets, we identified an additional transiting super-Earth–size planet candidate with a period of 1...

  19. 血清白细胞介素-6、白细胞介素-17和基质金属蛋白酶9水平与一氧化碳中毒迟发性脑病的关系%The relationship between the level of interleukin-6, interleukin-17 matrix metallo proteinase 9 and delayed encephalopathy after acute carbon monoxide poisoning

    Institute of Scientific and Technical Information of China (English)

    陈艳荣; 李晓; 徐化利; 潘双双; 李丽

    2016-01-01

    Objective To explore the relationship between the level of IL-6,IL-17 and matrix metallo proteinase 9 (MMP9) with deleyed encephelopathy after aucte carbon monoxide poisoning metal protease (DEACMP).Methods Rarcdomly selected 58 healthy people and 71 (delayed encephalopathy after acute carbon monoxide poisoning,DEACMP) patients were taken as control and experimental group,respectively.Enzyme-linked immunosorbent assay(ELISA) was used to detect the expression of IL-6,IL-17 and MMP9.Results Compared with control,the expression of IL-6 and MMP9 were significantly increased in mild and severe DEACMP patients,while both IL-6 and MMP9 showed largest increase in severe DEACMP patients with statistical significanc (F =22.47,F =36.51,P < 0.05).There was no significant expression changes of IL-17 (F =19.62,P > 0.05).Pearson analysis showed that the expressions of IL-6 and MMP9 were positively correlated with DEACMP (r =0.58,P < 0.05).Conclusions The expression of IL-6 and MMP9 in serum of DEACMP patients were associated with the degree of carbon monoxide poisoning.%目的 探讨白细胞介素(IL)-6)、IL-17和基质金属蛋白酶9(MMP9)与一氧化碳中毒迟发性脑病(DEACMP)的关系.方法 随机抽取58例体检健康人群为对照组,抽取71例DEACMP患者为实验组,采用酶联免疫吸附试验(ELISA)检测DEACMP患者血清中IL-6、IL-17和MMP9的表达水平.结果 和对照组相比,轻重度DEACMP患者血清中IL-6和MMP9表达水平升高(F=22.47、F=36.51,P<0.05),其中在重度DEACMP患者血清中升高最显著;IL-17表达水平未有显著变化,差异无统计学意义(F=19.62,P>0.05).Pearson相关分析显示,DEACMP患者血清IL-6和MMP9浓度呈正相关(r=0.58,P<0.05).结论 DEACMP患者血清中IL-6和MMP9的表达水平与一氧化碳中毒的程度和预后密切相关.

  20. 27 CFR 9.210 - Lehigh Valley.

    Science.gov (United States)

    2010-04-01

    ... Section 9.210 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT...), Pennsylvania, 1979; (4) Carbon County, Pennsylvania, 1991; (5) Monroe County, Pennsylvania, 1980; (6... Valley viticultural area is located in portions of Lehigh, Northampton, Berks, Schuylkill, Carbon,...

  1. n型掺杂PTCDA复合材料对有机发光二极管性能的提高%Lithium Carbonate Doped 3,4,9,10-perylenetetracarboxylic Dianhydride for Enhanced Performance in Organic Light Emitting Diode

    Institute of Scientific and Technical Information of China (English)

    程翠然; 陈玉焕; 秦大山; 全威; 刘金锁

    2011-01-01

    采用碳酸锂(Li2CO3)为n型掺杂剂,苝四甲酸二酐(3,4,9,10 perylenetetracarboxylic dianhydride,PTCDA)为母体材料,通过真空热蒸发方式制备了n型掺杂的PTCDA复合材料,将其作为电子注入材料应用到NPB/Alq3异质结有机电致发光器件中.研究发现,同LI2CO3:BCP(1:4)/Al结构和LiF/Al结构相比,Li2CO3:PTCDA(1:1)/Al结构能显著提高发光器件的亮度,器件功率效率也有所增加.发光器件性能的提高可以归因于两点:一是Li2CO3:PTCDA(1:1)的电导率显著高于Li2CO3:BCP(1:4)和本征Alq3,能够有效降低电流传导过程中的欧姆损失;二是阴极Al原子的渗透使Alq3/Li2CO3:PTCDA界面变成欧姆接触.%Lithium carbonate doped 3,4,9,10-perylenetetracarboxylic dianhydride ( Li2CO3∶ PTCDA) was fabricated as electron injection layer in NPB/AIq3 heterojunction based organic light emitting diodes (OLEDs). It was found that the current of OLED using Li2CO3∶ PTCDA was strongly dependent on the Li2CO3 doping concentration. The OLED using Li2CO3∶ PTCDA( 1∶1 ) with A1 as the cathode exhibits an improved power etficiency and significantly increased luminance, comparing with the one using Li2CO3∶ BCP(1∶4) with Al as the cathode and the one using the regular LiF/Al cathode. It is because the electron conductivity for Li2CO3∶ PTCDA/( 1∶1 ) is much higher than that Li2CO3∶ BCP(1∶4) and neat Alq3. In addition, it is found that there exist a Schottky barrier at the intrinsic interface of Alq3 and Li2CO3∶ PTCDA( 1∶1 ), which suppress the electron transfer from Li2CO3∶ PTCDA( 1∶1 ) into Alq3. However, the release of Li atoms upon the Al deposition onto 1∶1 Li2CO3∶ PTCDA could turn the interface into an ohmic contact, thereby delivering efficient electron injection from Li2CO3∶ PTCDA( 1∶1 ) into Alq3. We provided a class of high-function, low-cost, and easily fabricated n-doped material for the performance enhancement of OLEDs.

  2. 15 CFR 9.9 - Consumer education.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Consumer education. 9.9 Section 9.9 Commerce and Foreign Trade Office of the Secretary of Commerce PROCEDURES FOR A VOLUNTARY LABELING PROGRAM FOR HOUSEHOLD APPLIANCES AND EQUIPMENT TO EFFECT ENERGY CONSERVATION § 9.9 Consumer education....

  3. Carbon isotope anomalies in carbonates of the Karelian series

    Science.gov (United States)

    Iudovich, Ia. E.; Makarikhin, V. V.; Medvedev, P. V.; Sukhanov, N. V.

    1990-07-01

    Results are presented on carbon isotope distributions in carbonates of the Karelian complex. A highly anomalous isotopic composition was found in carbonate rocks aged from 2.6 to 1.9 b.y. In the stromatolitic carbonates of the Onega water table, delta-(C-13) reaches a value of +18 percent, while the shungite layer of the Zaonega horizon is characterized by a wide dispersion (from +7.9 to -11.8 percent). These data are in good agreement with the known geochemical boundary (about 2.2 b.y. ago) in the history of the earth.

  4. Dynamic carbon allocation significantly changed land carbon sink and carbon pool sizes

    Science.gov (United States)

    Xia, J.; Yuan, W.

    2015-12-01

    The allocation of photosynthate among the plant components (e.g., leaves, stems, and roots) plays an important role in regulating plant growth, competition, and terrestrial carbon cycle. However, the carbon allocation process is still a weak part in the earth system models (ESMs). In this study, the Integrated BIosphere Simulator (IBIS) model coupled with a dynamic carbon allocation model (IBISAL) is used to explore the impact of carbon allocation on the terrestrial carbon cycle. This dynamic carbon allocation model suggests that plants should allocate the largest part of carbon to the plant components which need to capture the most limiting resources, such as light, water and nitrogen. In comparison to the results of original IBIS model using fixed allocation ratios, the net ecosystem productivity, global biomass and soil organic carbon simulated by IBISAL model decreased by13.4% , 9.9% and 20.8%, respectively . The dynamic allocation scheme tends to benefit roots allocation. Because roots had short turnover times, high roots allocation led to the decreases of global carbon sink and carbon pool sizes. The observations showed that the carbon allocation ratios changed with temperature and precipitation. The dynamic carbon allocation model could reproduce this phenomenon correctly. The results show that the dynamic carbon allocation ratios of boreal evergreen forests and C3 grasses are consistent well with the observations. However, the IBISAL, and another three ESMs (i.e., CESM1-BGC, IPSL-CM5A-MR and NorESM1-ME models) adopting dynamic allocation scheme overestimated the stems allocation of tropical forests. This study shows the substantial influences of carbon allocation on the carbon sink and carbon pool sizes. Therefore, improving estimations of carbon allocation by ESMs are an important and effective path to reduce uncertainties in the global carbon cycle simulation and climate change prediction.

  5. 9 CFR 166.9 - Recordkeeping.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Recordkeeping. 166.9 Section 166.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE SWINE HEALTH PROTECTION SWINE HEALTH PROTECTION General Provisions § 166.9 Recordkeeping. (a) Each...

  6. Carbon dioxide, hydrographic, and chemical data obtained during the R/Vs Roger Revelle and Thomas Thompson repeat hydrography cruises in the Pacific Ocean: CLIVAR CO2 sections P16S-2005 (9 January - 19 February, 2005) and P16N-2006 (13 February - 30 March, 2006)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center; Feely, R. A. [Pacific Marine Environmental Laboratory, NOAA, Seattle, WA (United States); Sabine, C. L. [Pacific Marine Environmental Laboratory, NOAA, Seattle, WA (United States); Millero, F. J. [University of Miami, Miami, FL (United States). Rosenstiel School of Marine and Atmospheric Science; Langdon, C. [University of Miami, Miami, FL (United States). Rosenstiel School of Marine and Atmospheric Science; Dickson, A. G. [Univ. of California, San Diego, CA (United States). Scripps Institution of Oceanography; Fine, R. A. [University of Miami, Miami, FL (United States). Rosenstiel School of Marine and Atmospheric Science; Bullister, J. L. [Pacific Marine Environmental Laboratory, NOAA, Seattle, WA (United States); Hansell, D. A. [University of Miami, Miami, FL (United States). Rosenstiel School of Marine and Atmospheric Science; Carlson, C. A. [Univ. of California, Santa Barbara, CA (United States); Sloyan, B. M. [Woods Hole Oceanographic Institution, Woods Hole, MA (United States); McNichol, A. P. [Woods Hole Oceanographic Institution, Woods Hole, MA (United States); Key, R. M. [Princeton Univ., NJ (United States); Byrne, R. H. [Univ. of South Florida, Tampa, FL (United States); Wanninkhof, R. [Atlantic Oceanographic and Meteorological Laboratory, NOAA, Miami, FL (United States)

    2009-05-01

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrients, total carbon dioxide (TCO2), total alkalinity (TALK), pH, discrete CO2 partial pressure (pCO2), dissolved organic carbon (DOC), chlorofluorocarbons (CFCs), radiocarbon, δ13C, and underway carbon measurements performed during the P16S-2005 (9 January - 19 February 2005) and P16N-2006 (13 February - 30 March, 2006) cruises in the Pacific Ocean. The research vessel (R/V) Roger Revelle departed Papeete, Tahiti, on January 9, 2005 for the Repeat Section P16S, nominally along 150°W, ending in Wellington, New Zealand, on February 19. During this cruise, samples were taken from 36 depths at 111 CTD stations between 16°S and 71°S. The Repeat Section P16N, nominally along 152°W, consisted of two legs. Leg 1 started on February 13, 2006 in Papeete, Tahiti, and finished on March 3, in Honolulu, Hawaii. The R/V Thomas G. Thompson departed Honolulu for Leg 2 on March 10, 2006 and arrived in Kodiak, Alaska, on March 30. During the P16N cruises, samples were taken from 34 or 36 depths at 84 stations between 17°S and 56.28°N. The research conducted on these cruises was part of a series of repeat hydrography sections jointly funded by the National Oceanic and Atmospheric Administration (NOAA) and the National Science Foundation (NSF) as part of the Climate Variability Program (CLIVAR)/CO2 Repeat Hydrography Program. The P16S and P16N data sets are available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  7. Expression of MMP-9 and VEGF in Human Cervical Cancer Cell Line CaSki after Carbon Dioxide Treatment%CO2气腹对人宫颈癌CaSki细胞MMP-9和VEGF表达的影响

    Institute of Scientific and Technical Information of China (English)

    苏东方; 李莉

    2014-01-01

    目的 探讨腹腔镜二氧化碳(CO2)气腹对人宫颈癌CaSki细胞株基质金属蛋白酶-9(matrix metalloproteinase-9,MMP-9)和血管内皮生长因子(vascular endothelial growth factor,VEGF)表达的影响.方法 建立腹腔镜CO2气腹体外模型,将CaSki细胞株分别置于0、7和14mmHg的CO2气腹环境下培养1、2、4和8h.采用RT-PCR和Western blot法分别检测处理后各组CaSki细胞株中MMP-9和VEGF表达情况.结果 RT-PCR和Western blot结果显示,与0 mmHg CO2气腹组相比,7和14 mmHg CO2气腹组CaSki细胞株MMP-9和VEGF的mRNA和蛋白表达显著增加(P<0.05),且随着处理时间的延长MMP-9和VEGF的表达呈上升趋势(P<0.05),处理4h时MMP-9和VEGF的表达量达到高峰;在同一时间点时,7mmHg CO2气腹组的MMP-9和VEGF表达量最高(P<0.05).结论 在一定压力和作用时间范围内,CO2气腹可能是通过上调MMP-9和VEGF的表达,进而促进肿瘤生长.

  8. Conducting carbonized polyaniline nanotubes

    Science.gov (United States)

    Mentus, Slavko; Ćirić-Marjanović, Gordana; Trchová, Miroslava; Stejskal, Jaroslav

    2009-06-01

    Conducting nitrogen-containing carbon nanotubes were synthesized by the carbonization of self-assembled polyaniline nanotubes protonated with sulfuric acid. Carbonization was carried out in a nitrogen atmosphere at a heating rate of 10 °C min-1 up to a maximum temperature of 800 °C. The carbonized polyaniline nanotubes which have a typical outer diameter of 100-260 nm, with an inner diameter of 20-170 nm and a length extending from 0.5 to 0.8 µm, accompanied with very thin nanotubes with outer diameters of 8-14 nm, inner diameters 3.0-4.5 nm and length extending from 0.3 to 1.0 µm, were observed by scanning and transmission electron microscopies. Elemental analysis showed 9 wt% of nitrogen in the carbonized product. Conductivity of the nanotubular PANI precursor, amounting to 0.04 S cm-1, increased to 0.7 S cm-1 upon carbonization. Molecular structure of carbonized polyaniline nanotubes has been analyzed by FTIR and Raman spectroscopies, and their paramagnetic characteristics were compared with the starting PANI nanotubes by EPR spectroscopy.

  9. Conducting carbonized polyaniline nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Mentus, Slavko; Ciric-Marjanovic, Gordana [Faculty of Physical Chemistry, University of Belgrade, Studentski trg 12-16, 11158 Belgrade (Serbia); Trchova, Miroslava; Stejskal, Jaroslav [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovsky Square 2, 162 06 Prague 6 (Czech Republic)], E-mail: gordana@ffh.bg.ac.rs

    2009-06-17

    Conducting nitrogen-containing carbon nanotubes were synthesized by the carbonization of self-assembled polyaniline nanotubes protonated with sulfuric acid. Carbonization was carried out in a nitrogen atmosphere at a heating rate of 10 deg. C min{sup -1} up to a maximum temperature of 800 deg. C. The carbonized polyaniline nanotubes which have a typical outer diameter of 100-260 nm, with an inner diameter of 20-170 nm and a length extending from 0.5 to 0.8 {mu}m, accompanied with very thin nanotubes with outer diameters of 8-14 nm, inner diameters 3.0-4.5 nm and length extending from 0.3 to 1.0 {mu}m, were observed by scanning and transmission electron microscopies. Elemental analysis showed 9 wt% of nitrogen in the carbonized product. Conductivity of the nanotubular PANI precursor, amounting to 0.04 S cm{sup -1}, increased to 0.7 S cm{sup -1} upon carbonization. Molecular structure of carbonized polyaniline nanotubes has been analyzed by FTIR and Raman spectroscopies, and their paramagnetic characteristics were compared with the starting PANI nanotubes by EPR spectroscopy.

  10. The Potential Protective Effect of Physalis peruviana L. against Carbon Tetrachloride-Induced Hepatotoxicity in Rats Is Mediated by Suppression of Oxidative Stress and Downregulation of MMP-9 Expression

    OpenAIRE

    Al-Olayan, Ebtisam M.; El-Khadragy, Manal F.; Aref, Ahmed M.; Othman, Mohamed S.; Kassab, Rami B.; Ahmed E. Abdel Moneim

    2014-01-01

    The active constituent profile in Cape gooseberry (Physalis peruviana L.) juice was determined by GC-MS. Quercetin and kaempferol were active components in the juice. In this study we have evaluated its potential protective effect on hepatic injury and fibrosis induced by carbon tetrachloride (CCl4). Twenty-eight rats divided into 4 groups: Group I served as control group, and Group II received weekly i.p. injection of 2 mL CCl4/kg bwt for 12 weeks. Group III were supplemented with Physalis j...

  11. 38 CFR 9.9 - Conversion privilege.

    Science.gov (United States)

    2010-07-01

    ... LIFE INSURANCE AND VETERANS' GROUP LIFE INSURANCE § 9.9 Conversion privilege. (a) With respect to a... disability incurred or aggravated during such a period of duty. (b) The individual policy of life insurance... loss due to such excess mortality among the reinsurers and converters....

  12. New generation of hybrid carbon/Ni(OH)2 electrochemical capacitor using functionalized carbon electrode

    Science.gov (United States)

    Le Comte, Annaïg; Brousse, Thierry; Bélanger, Daniel

    2016-09-01

    Tailoring carbon based negative electrode by grafting electroactive 9,10-phenanthrenequinone molecules on porous carbon drastically improves the performance of a carbon/Ni(OH)2 hybrid electrochemical capacitor. The grafted-quinone moieties add a Faradaic contribution to the double layer capacitance of carbon leading to a significant increase of the charge stored by the full devices. Good cyclability is ensured due to the strong bond between 9,10-phenanthrenequinone molecules and the carbon surface. More importantly, by increasing the total capacity, the grafting improves the energy density of the full hybrid device while maintaining fast charge/discharge kinetics and thus without affecting the power density.

  13. Porous carbons

    Indian Academy of Sciences (India)

    Satish M Manocha

    2003-02-01

    Carbon in dense as well as porous solid form is used in a variety of applications. Activated porous carbons are made through pyrolysis and activation of carbonaceous natural as well as synthetic precursors. Pyrolysed woods replicate the structure of original wood but as such possess very low surface areas and poor adsorption capacities. On activation, these exhibit increased adsorption volumes of 0.5–0.8 cm3 /gm and surface areas of 700–1800 m2 /gm depending on activation conditions, whether physical or chemical. Former carbons possess mixed pore size distribution while chemically activated carbons predominantly possess micropores. Thus, these carbons can be used for adsorption of wide distributions of molecules from gas to liquid. The molecular adsorption within the pores is due to single layer or multilayer molecule deposition at the pore walls and hence results in different types of adsorption isotherm. On the other hand, activated carbon fibres with controlled microporous structure and surface area in the range of 2500 m2 /gm can be developed by controlled pyrolysis and physical activation of amorphous carbon fibres. Active carbon fibres with unmatchable pore structure and surface characteristics are present and futuristic porous materials for a number of applications from pollution control to energy storage.

  14. Analysis of 10-9 Level H2S in Food Additive Carbon Dioxide—Flame Photometric Gas Chromatography%食品添加剂二氧化碳中10-9级硫化氢的分析—火焰光度法

    Institute of Scientific and Technical Information of China (English)

    宋庆明; 刘键夫

    2014-01-01

    食品添加剂二氧化碳中10-9级的H2S采用全氟气路,微量硫专用色谱柱,钝化阀进样系统的气相色谱火焰光度法检测,该方法重复性好,操作方便,非常适用于食品添加剂二氧化碳的实验室质量控制.

  15. Two isomers of C6H6F9O9Tb

    International Nuclear Information System (INIS)

    Two isomeric forms of terbium tetrahydrate trifluoroacetate, featuring the composition C6H6F9O9Tb, were prepared as a result of interaction between terbium hydroxide or carbonate and trifluoroacetic acid. The compounds were characterized by the methods of elementary analysis, IR spectroscopy and X-ray diffraction analysis. It has been ascertained that isomerism of the compounds stems from different positions of protons. Crystals of both forms are isostructural, forming a continuous series of solid solutions with C6H6F9O9Eu

  16. HEASARC SAOImage DS9

    Data.gov (United States)

    National Aeronautics and Space Administration — SAOImage DS9 is an astronomical imaging and data visualization application. DS9 supports FITS images and binary tables, multiple frame buffers, region manipulation,...

  17. Synthesis, Characterization of 9, 9'-Bianthracene and Fabrication of 9, 9'-Bianthracene Field-Effect Transistors

    Institute of Scientific and Technical Information of China (English)

    LI Jian-Feng; CHANG Wen-Li; TAO Chun-Lan; OU Gu-Ping; ZHANG Fu-Jia

    2008-01-01

    @@ We synthesize and purify 9, 9'-bianthracene with the purity up to 96.4%.The electronic and crystallographic structures of 9, 9'-bianthracene are studied. The results of a joint experimental investigation based on a combina-tion of x-ray diffraction (XRD) spectra, hydrogen nuclear magnetic (HNMR) spectra, infrared absorption (FT-IR) spectra, and mass spectra (MS) of 9, 9'-bianthracene are obtained.The uniform compact film is observed by an atomic-force microscope (AFM).Organic field effect transistors (OFETs) with an active layer based on the syn-thesized 9, 9'-bianthracene are fabricated for the first time. Its field-effect mobility is as large as 0.067 cm2 /(V.s) and the on/off ratio is above 5 × 104. The result demonstrates that the oligomerization of a small semiconductor molecule is an effective method to develop high-mobility organic semiconductors.

  18. Calcium Carbonate

    Science.gov (United States)

    ... before being swallowed; do not swallow them whole. Drink a full glass of water after taking either the regular or chewable tablets or capsules. Some liquid forms of calcium carbonate must be shaken well before use.Do not ...

  19. Carbon Stars

    Indian Academy of Sciences (India)

    T. Lloyd Evans

    2010-12-01

    In this paper, the present state of knowledge of the carbon stars is discussed. Particular attention is given to issues of classification, evolution, variability, populations in our own and other galaxies, and circumstellar material.

  20. Fresh carbon input differentially impacts soil carbon decomposition across natural and managed systems.

    Science.gov (United States)

    Luo, Zhongkui; Wang, Enli; Smith, Chris

    2015-10-01

    The amount of fresh carbon input into soil is experiencing substantial changes under global change. It is unclear what will be the consequences of such input changes on native soil carbon decomposition across ecosystems. By synthesizing data from 143 experimental comparisons, we show that, on average, fresh carbon input stimulates soil carbon decomposition by 14%. The response was lower in forest soils (1%) compared with soils from other ecosystems (> 24%), and higher following inputs of plant residue-like substrates (31%) compared to root exudate-like substrates (9%). The responses decrease with the baseline soil carbon decomposition rate under no additional carbon input, but increase with the fresh carbon input rate. The rates of these changes vary significantly across ecosystems and with the carbon substrates being added. These findings can be applied to provide robust estimates of soil carbon balance across ecosystems under changing aboveground and belowground inputs as consequence of climate and land management changes. PMID:26649400

  1. IGSF9 Family Proteins

    DEFF Research Database (Denmark)

    Hansen, Maria; Walmod, Peter Schledermann

    2013-01-01

    The Drosophila protein Turtle and the vertebrate proteins immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1) and IGSF9B are members of an evolutionarily ancient protein family. A bioinformatics analysis of the protein family revealed that invertebrates contain only a single IGSF9 family gene......, the longest isoforms of the proteins have the same general organization as the neural cell adhesion molecule family of cell adhesion molecule proteins, and like this family of proteins, IGSF9 family members are expressed in the nervous system. A review of the literature revealed that Drosophila Turtle...... facilitates homophilic cell adhesion. Moreover, IGSF9 family proteins have been implicated in the outgrowth and branching of neurites, axon guidance, synapse maturation, self-avoidance, and tiling. However, despite the few published studies on IGSF9 family proteins, reports on the functions of both Turtle...

  2. A New Process for Synthesis of Dimethyl Carbonate from Ethylene Carbonate and Methanol without any Catalyst under Supercritical Conditions

    Institute of Scientific and Technical Information of China (English)

    Xiu Juan FENG; Xiao Gang LI; Ren HE; Hui ZHOU

    2005-01-01

    Dimethyl carbonate was synthesized by transesterification reaction between ethylene carbonate and methanol under supercritical conditions without any catalyst. Experimental results showed that the residence time and the molar ratio of methanol to ethylene carbonate all can affect the conversion of ethylene carbonate. When the molar ratio of methanol to ethylene carbonate was 8:1, 81.2 % conversion can be achieved at 9.0 MPa and 250℃ after 8 h.

  3. Fluid phase equilibria during propylene carbonate synthesis from propylene oxide in carbon dioxide medium

    DEFF Research Database (Denmark)

    Gharnati, Loubna; Musko, Nikolai; Jensen, Anker Degn;

    2013-01-01

    In the present study the influence of the amount of carbon dioxide on the catalytic performance during the propylene carbonate synthesis from propylene oxide and CO2 was investigated. The reaction was performed in high-pressure batch autoclaves using immobilized 1-hydroxyethyl-9-propyl-cyclic gua......In the present study the influence of the amount of carbon dioxide on the catalytic performance during the propylene carbonate synthesis from propylene oxide and CO2 was investigated. The reaction was performed in high-pressure batch autoclaves using immobilized 1-hydroxyethyl-9-propyl...

  4. Carbon isotope effects in carbonate systems

    Science.gov (United States)

    Deines, Peter

    2004-06-01

    Global carbon cycle models require a complete understanding of the δ 13C variability of the Earth's C reservoirs as well as the C isotope effects in the transfer of the element among them. An assessment of δ 13C changes during CO 2 loss from degassing magmas requires knowledge of the melt-CO 2 carbon isotope fractionation. In order to examine the potential size of this effect for silicate melts of varying composition, 13C reduced partition functions were computed in the temperature range 275 to 4000 K for carbonates of varying bond strengths (Mg, Fe, Mn, Sr, Ba, Pb, Zn, Cd, Li, and Na) and the polymorphs of calcite. For a given cation and a given pressure the 13C content increases with the density of the carbonate structure. For a given structure the tendency to concentrate 13C increases with pressure. The effect of pressure (‰/10 kbar) on the size of the reduced partition function of aragonite varies with temperature; in the pressure range 1 to 10 5 bars the change is given by: Δ 13C p average=-0.01796+0.06635∗ 10 3/T+0.006875∗ 10 6/T2 For calcite III the pressure effect is on average 1.4× larger than that for aragonite at all temperatures. The nature of the cation in a given structure type has a significant effect on the carbon isotope fractionation properties. The tendency to concentrate 13C declines in the series magnesite, aragonite, dolomite, strontianite, siderite, calcite, smithonite, witherite, rhodochrosite, otavite, cerrusite. For divalent cations a general expression for an estimation of the reduced partition function (β) from the reduced mass (μ = [M Cation × M Carbonate]/[M Cation + M Carbonate]) is: 1000 lnβ=(0.032367-0.072563∗ 10 3/T-0.01073∗ 10 6/T2)∗μ-14.003+29.953∗ 10 3/T+9.4610∗ 10 6/T2 For Mg-calcite the 13C content varies with the Mg concentration. The fractionation between Mg-calcite (X = mole fraction of MgCO 3) and calcite is given by: 1000 ln(α MgCalite- Calcite)=[0.013702-0.10957× 10 3/T+1.35940× 10 6/T2

  5. 我国9省(市)3~18岁儿童青少年碳酸饮料消费现状分析%Analysis on status of carbonated beverage consumption among children and adolescents aged 3 -18 years in ;nine provinces of China

    Institute of Scientific and Technical Information of China (English)

    刘飒娜; 陶婉亭; 毛伟峰; 刘爱东; 刘兆平; 张兵

    2015-01-01

    Objective To learn status of carbonated beverage consumption among children and adolescents aged 3 -18 years in nine provinces of China and provide scientific evidence for instruction on soft drinks consumption of children and youth .Methods Multi-stage stratified random sampling method was used and 2585 children of youth aged 3 -18 years among 9 provinces were selected in 2013.Consumption data were collected by using consecutive 3 day 24h recalls and one month food frequency survey.Results Differences of consumption were found among 3 -18 years old children and youth regarding to both amout and frequency in nine provinces.Subjectives in urban areas have higher consumption ratio of 45.1%than those in rural area (χ2 =19.529,P <0.01).Children aged 7 -13 years have the highest consumption frequency of 1 -3 times per week in view of soda drinks,which is around 45.4%.Children and youth in urban area consumed higher amount of carbonated beverage than those in rural area (P < 0.05 ), which is 31.4mL/d and 15.1mL/d respectively.Meanwhile,male subjectives drank more carbonated beverage than female subjectives (P <0.05),which is 28.8 mL/d and 19.5 mL/d respectively.The average amount of consumption was highest in subjectives from families at mid-dle income level,followed by that of families at high and low income levels,which were 19.7 mL/d,28.5 mL/d and 19.2 mL/d respectively.Conclusion The consumption of carbonated beverage manifested an increasing trend among children and youth in China .Subsequently,effective intervention measures should be applied to instruct children and youth to select and consume carbonated beverage wisely.%目的:了解我国9省(市)3~18岁儿童青少年碳酸饮料消费现状,为指导我国儿童青少年饮料合理消费提供科学依据。方法采用多阶段分层随机整群抽样方法,2013年在我国9个省(市)选取了2585名3~18岁儿童青少年;消费量数据采用非连续3d 24h 回顾法和

  6. High capacity carbon dioxide sorbent

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, Steven Dean; Alptekin, Gokhan; Jayaraman, Ambalavanan

    2015-09-01

    The present invention provides a sorbent for the removal of carbon dioxide from gas streams, comprising: a CO.sub.2 capacity of at least 9 weight percent when measured at 22.degree. C. and 1 atmosphere; an H.sub.2O capacity of at most 15 weight percent when measured at 25.degree. C. and 1 atmosphere; and an isosteric heat of adsorption of from 5 to 8.5 kilocalories per mole of CO.sub.2. The invention also provides a carbon sorbent in a powder, a granular or a pellet form for the removal of carbon dioxide from gas streams, comprising: a carbon content of at least 90 weight percent; a nitrogen content of at least 1 weight percent; an oxygen content of at most 3 weight percent; a BET surface area from 50 to 2600 m.sup.2/g; and a DFT micropore volume from 0.04 to 0.8 cc/g.

  7. Voltammetric Response of Epinephrine at Carbon Nanotube Modified Glassy Carbon Electrode and Activated Glassy Carbon Electrode

    Institute of Scientific and Technical Information of China (English)

    WANG Juan; TANG Ping; ZHAO Fa-qiong; ZENG Bai-zhao

    2005-01-01

    The electrochemical behavior of epinephrine at activated glassy carbon electrode and carbon nanotube-coated glassy carbon electrode was studied. Epinephrine could exhibit an anodic peak at about 0.2 V (vs. SCE) at bare glassy carbon electrode, but it was very small.However, when the electrode was activated at certain potential (i. e. 1.9V) or modified with carbon nanotube, the peak became more sensitive,resulting from the increase in electrode area in addition to the electrostatic attraction. Under the selected conditions, the anodic peak current was linear to epinephrine concentration in the range of 3.3 × 10-7-1.1 × 10-5mol/L at activated glassy carbon electrode and in the range of 1.0 × 10-6-5.0 × 10-5 mol/L at carbon nanotube-coated electrode. The correlation coefficients were 0. 998 and 0. 997, respectively. The determination limit was 1.0 × 10-7 mol/L. The two electrodes have been successfully applied for the determination of epinephrine in adrenaline hydrochloride injection with recovery of 95%-104%.

  8. Region 9 Tribal Lands

    Data.gov (United States)

    U.S. Environmental Protection Agency — Dataset of all Indian Reservations in US EPA Region 9 (California, Arizona and Nevada) with some reservation border areas of adjacent states included (adjacent...

  9. R9 Air Districts

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Region 9 Air Districts layer is a compilation of polygons representing the California Air Pollution Control and Air Quality Management Districts, Arizona Air...

  10. Global carbon budget 2014

    Science.gov (United States)

    Le Quéré, C.; Moriarty, R.; Andrew, R. M.; Peters, G. P.; Ciais, P.; Friedlingstein, P.; Jones, S. D.; Sitch, S.; Tans, P.; Arneth, A.; Boden, T. A.; Bopp, L.; Bozec, Y.; Canadell, J. G.; Chini, L. P.; Chevallier, F.; Cosca, C. E.; Harris, I.; Hoppema, M.; Houghton, R. A.; House, J. I.; Jain, A. K.; Johannessen, T.; Kato, E.; Keeling, R. F.; Kitidis, V.; Klein Goldewijk, K.; Koven, C.; Landa, C. S.; Landschützer, P.; Lenton, A.; Lima, I. D.; Marland, G.; Mathis, J. T.; Metzl, N.; Nojiri, Y.; Olsen, A.; Ono, T.; Peng, S.; Peters, W.; Pfeil, B.; Poulter, B.; Raupach, M. R.; Regnier, P.; Rödenbeck, C.; Saito, S.; Salisbury, J. E.; Schuster, U.; Schwinger, J.; Séférian, R.; Segschneider, J.; Steinhoff, T.; Stocker, B. D.; Sutton, A. J.; Takahashi, T.; Tilbrook, B.; van der Werf, G. R.; Viovy, N.; Wang, Y.-P.; Wanninkhof, R.; Wiltshire, A.; Zeng, N.

    2015-05-01

    component of the global carbon budget. For the last decade available (2004-2013), EFF was 8.9 ± 0.4 GtC yr-1, ELUC 0.9 ± 0.5 GtC yr-1, GATM 4.3 ± 0.1 GtC yr-1, SOCEAN 2.6 ± 0.5 GtC yr-1, and SLAND 2.9 ± 0.8 GtC yr-1. For year 2013 alone, EFF grew to 9.9 ± 0.5 GtC yr-1, 2.3% above 2012, continuing the growth trend in these emissions, ELUC was 0.9 ± 0.5 GtC yr-1, GATM was 5.4 ± 0.2 GtC yr-1, SOCEAN was 2.9 ± 0.5 GtC yr-1, and SLAND was 2.5 ± 0.9 GtC yr-1. GATM was high in 2013, reflecting a steady increase in EFF and smaller and opposite changes between SOCEAN and SLAND compared to the past decade (2004-2013). The global atmospheric CO2 concentration reached 395.31 ± 0.10 ppm averaged over 2013. We estimate that EFF will increase by 2.5% (1.3-3.5%) to 10.1 ± 0.6 GtC in 2014 (37.0 ± 2.2 GtCO2 yr-1), 65% above emissions in 1990, based on projections of world gross domestic product and recent changes in the carbon intensity of the global economy. From this projection of EFF and assumed constant ELUC for 2014, cumulative emissions of CO2 will reach about 545 ± 55 GtC (2000 ± 200 GtCO2) for 1870-2014, about 75% from EFF and 25% from ELUC. This paper documents changes in the methods and data sets used in this new carbon budget compared with previous publications of this living data set (Le Quéré et al., 2013, 2014). All observations presented here can be downloaded from the Carbon Dioxide Information Analysis Center (doi:10.3334/CDIAC/GCP_2014).

  11. 不同碳源对苯并[a]芘降解菌生长和降解性能影响的研究%Effect of Different Kinds of Extra Carbon Sources on the Biomass Production and BaP Removal by Bacillus pumilus Strain Bap9

    Institute of Scientific and Technical Information of China (English)

    朱婷婷; 倪晋仁

    2012-01-01

    采用从受户外烧烤影响的土壤中分离出的苯并[a]芘降解菌Bacillus pumilus strain Bap9,利用摇床实验研究了不同外加碳源对其生长和苯并[a]芘降解性能的影响。结果表明,苯并[a]芘初始浓度为40mg/L时,蔗糖、葡萄糖、麦芽糖的存在会抑制菌株对苯并[a]芘的降解,可溶性淀粉的影响不明显。以醋酸钠为外加碳源可明显促进菌株的降解作用,添加40mg/L的醋酸钠,20天后可将菌株Bap9的降解率提高了8.8%,但过量的碳源会抑制菌株对苯并[a]芘的降解。添加适量的低分子量菲(PAXH)作为共代谢底物,菲的促进作用大于同浓度的醋酸钠,添加40mg/L的菲,20天后菌株对苯并[a]芘的降解率提高了26.4%。%Batch experiments were conducted in order to investigate the effects of extra carbon sources on benzo[a]pyrene (BaP) biodegradation by Bacillus pumilus strain Bap9, which was isolated from polluted soil collected from open-air barbecue market. In the culture system under initial BaP concentration of 40 mg/L, the addition of sucrose, glucose, maltose reduced the degradation rates, the presence of soluble starch had no obvious effect on the biodegradation, while the supplement of sodium acetate increased by 8.8% of the degradation rates most effectively. However, if the concentrations were too high, sodium acetate would show the inhibition of biodegradation. The supplementation of phenanthrene (Phe), was more effective on increasing the degradation rate than sodium acetate of the same concentration. The biodegradation rate of BaP increased 26.4% after a 20 days incubation period, while Phe of 40 mg/L was used as the co-metabolism substrate.

  12. Carbon taxes and India

    Energy Technology Data Exchange (ETDEWEB)

    Fisher-Vanden, K.A.; Pitcher, H.M.; Edmonds, J.A.; Kim, S.H. [Pacific Northwest Lab., Richland, WA (United States); Shukla, P.R. [Indian Institute of Management, Ahmedabad (India)

    1994-07-01

    Using the Indian module of the Second Generation Model 9SGM, we explore a reference case and three scenarios in which greenhouse gas emissions were controlled. Two alternative policy instruments (carbon taxes and tradable permits) were analyzed to determine comparative costs of stabilizing emissions at (1) 1990 levels (the 1 X case), (2) two times the 1990 levels (the 2X case), and (3) three times the 1990 levels (the 3X case). The analysis takes into account India`s rapidly growing population and the abundance of coal and biomass relative to other fuels. We also explore the impacts of a global tradable permits market to stabilize global carbon emissions on the Indian economy under the following two emissions allowance allocation methods: (1) {open_quotes}Grandfathered emissions{close_quotes}: emissions allowances are allocated based on 1990 emissions. (2) {open_quotes}Equal per capita emissions{close_quotes}: emissions allowances are allocated based on share of global population. Tradable permits represent a lower cost method to stabilize Indian emissions than carbon taxes, i.e., global action would benefit India more than independent actions.

  13. Carbon taxes and India

    International Nuclear Information System (INIS)

    Using the Indian module of the Second Generation Model 9SGM, we explore a reference case and three scenarios in which greenhouse gas emissions were controlled. Two alternative policy instruments (carbon taxes and tradable permits) were analyzed to determine comparative costs of stabilizing emissions at (1) 1990 levels (the 1 X case), (2) two times the 1990 levels (the 2X case), and (3) three times the 1990 levels (the 3X case). The analysis takes into account India's rapidly growing population and the abundance of coal and biomass relative to other fuels. We also explore the impacts of a global tradable permits market to stabilize global carbon emissions on the Indian economy under the following two emissions allowance allocation methods: (1) open-quotes Grandfathered emissionsclose quotes: emissions allowances are allocated based on 1990 emissions. (2) open-quotes Equal per capita emissionsclose quotes: emissions allowances are allocated based on share of global population. Tradable permits represent a lower cost method to stabilize Indian emissions than carbon taxes, i.e., global action would benefit India more than independent actions

  14. 46 CFR 9.9 - Two hours between broken periods.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Two hours between broken periods. 9.9 Section 9.9... COMPENSATION FOR OVERTIME SERVICES § 9.9 Two hours between broken periods. Where 2 hours or more intervene between broken periods, one-half day's extra pay will be allowed for each distinct 2-hour period or...

  15. Global Carbon Budget 2015

    Science.gov (United States)

    Le Quéré, C.; Moriarty, R.; Andrew, R. M.; Canadell, J. G.; Sitch, S.; Korsbakken, J. I.; Friedlingstein, P.; Peters, G. P.; Andres, R. J.; Boden, T. A.; Houghton, R. A.; House, J. I.; Keeling, R. F.; Tans, P.; Arneth, A.; Bakker, D. C. E.; Barbero, L.; Bopp, L.; Chang, J.; Chevallier, F.; Chini, L. P.; Ciais, P.; Fader, M.; Feely, R. A.; Gkritzalis, T.; Harris, I.; Hauck, J.; Ilyina, T.; Jain, A. K.; Kato, E.; Kitidis, V.; Klein Goldewijk, K.; Koven, C.; Landschützer, P.; Lauvset, S. K.; Lefèvre, N.; Lenton, A.; Lima, I. D.; Metzl, N.; Millero, F.; Munro, D. R.; Murata, A.; Nabel, J. E. M. S.; Nakaoka, S.; Nojiri, Y.; O'Brien, K.; Olsen, A.; Ono, T.; Pérez, F. F.; Pfeil, B.; Pierrot, D.; Poulter, B.; Rehder, G.; Rödenbeck, C.; Saito, S.; Schuster, U.; Schwinger, J.; Séférian, R.; Steinhoff, T.; Stocker, B. D.; Sutton, A. J.; Takahashi, T.; Tilbrook, B.; van der Laan-Luijkx, I. T.; van der Werf, G. R.; van Heuven, S.; Vandemark, D.; Viovy, N.; Wiltshire, A.; Zaehle, S.; Zeng, N.

    2015-12-01

    carbon budget. For the last decade available (2005-2014), EFF was 9.0 ± 0.5 GtC yr-1, ELUC was 0.9 ± 0.5 GtC yr-1, GATM was 4.4 ± 0.1 GtC yr-1, SOCEAN was 2.6 ± 0.5 GtC yr-1, and SLAND was 3.0 ± 0.8 GtC yr-1. For the year 2014 alone, EFF grew to 9.8 ± 0.5 GtC yr-1, 0.6 % above 2013, continuing the growth trend in these emissions, albeit at a slower rate compared to the average growth of 2.2 % yr-1 that took place during 2005-2014. Also, for 2014, ELUC was 1.1 ± 0.5 GtC yr-1, GATM was 3.9 ± 0.2 GtC yr-1, SOCEAN was 2.9 ± 0.5 GtC yr-1, and SLAND was 4.1 ± 0.9 GtC yr-1. GATM was lower in 2014 compared to the past decade (2005-2014), reflecting a larger SLAND for that year. The global atmospheric CO2 concentration reached 397.15 ± 0.10 ppm averaged over 2014. For 2015, preliminary data indicate that the growth in EFF will be near or slightly below zero, with a projection of -0.6 [range of -1.6 to +0.5] %, based on national emissions projections for China and the USA, and projections of gross domestic product corrected for recent changes in the carbon intensity of the global economy for the rest of the world. From this projection of EFF and assumed constant ELUC for 2015, cumulative emissions of CO2 will reach about 555 ± 55 GtC (2035 ± 205 GtCO2) for 1870-2015, about 75 % from EFF and 25 % from ELUC. This living data update documents changes in the methods and data sets used in this new carbon budget compared with previous publications of this data set (Le Quéré et al., 2015, 2014, 2013). All observations presented here can be downloaded from the Carbon Dioxide Information Analysis Center (doi:10.3334/CDIAC/GCP_2015).

  16. CANDU 9 design

    International Nuclear Information System (INIS)

    AECL has made significant design improvements in the latest CANDU nuclear power plant (NPP) - the CANDU 9. The CANDU 9 operates with the energy efficient heavy water moderated reactor and natural uranium fuel and utilizes proven technology. The CANDU 9 NPP design is similar to the world leading CANDU 6 but is based upon the single unit adaptation of the 900 MWe class reactors currently operating in Canada as in integrated four-unit configurations. The evolution of the CANDU family of heavy water reactors (HAIR) is based on a continuous product improvement approach. Proven equipment and systems from operating stations are standardized and used in new products. As a result of the flexibility of the technology, evolution of the current design will ensure that any new requirements can be met, and there is no need to change the basic concept. This paper will provide an overview for some of the key features of the CANDU 9 NPP such as nuclear systems and equipment, advanced control and computer systems, safety design and protection features, and plant layout. The safety enhancements and operability improvements implemented in this design are described and some of the advantages that can be expected by the operating utility are highlighted. (author)

  17. 9th ISAAC Congress

    CERN Document Server

    Ruzhansky, Michael; Analytic Methods in Interdisciplinary Applications

    2015-01-01

    The book includes lectures given by the plenary and key speakers at the 9th International ISAAC Congress held 2013 in Krakow, Poland. The contributions treat recent developments in analysis and surrounding areas, concerning topics from the theory of partial differential equations, function spaces, scattering, probability theory, and others, as well as applications to biomathematics, queueing models, fractured porous media and geomechanics.

  18. UPS9: Hardware Manual

    International Nuclear Information System (INIS)

    The UPS9 printed circuit board is a power pulsed supply controlled by voltage that allow multiple output modes. Isolated output pulses of up to 200 V amplitude can be generated with either positive or negative polarity from a single 24 VDC power source. This circuit was designed and optimized for driving both solenoid and piezoelectric type gas valves. (Author)

  19. Carbon classified?

    DEFF Research Database (Denmark)

    Lippert, Ingmar

    2012-01-01

    . Using an actor- network theory (ANT) framework, the aim is to investigate the actors who bring together the elements needed to classify their carbon emission sources and unpack the heterogeneous relations drawn on. Based on an ethnographic study of corporate agents of ecological modernisation over...... a period of 13 months, this paper provides an exploration of three cases of enacting classification. Drawing on ANT, we problematise the silencing of a range of possible modalities of consumption facts and point to the ontological ethics involved in such performances. In a context of global warming...

  20. CARBONIZER TESTS WITH LAKELAND FEEDSTOCKS

    Energy Technology Data Exchange (ETDEWEB)

    C. Lu; Z. Fan; R. Froehlich; A. Robertson

    2003-09-01

    Research has been conducted under United States Department of Energy Contract (USDOE) DE-AC21-86MC21023 to develop a new type of coal-fired plant for electric power generation. This new type of plant, called a Second Generation Pressurized Fluidized Bed Combustion Plant (2nd Gen PFB), offers the promise of efficiencies greater than 48%, with both emissions and a cost of electricity that are significantly lower than those of conventional pulverized coal-fired (PC) plants with wet flue gas desulfurization/scrubbers. The 2nd Gen PFB plant incorporates the partial gasification of coal in a carbonizer, the combustion of carbonizer char in a pressurized circulating fluidized (PCFB) bed boiler, and the combustion of carbonizer syngas in a topping combustor to achieve gas turbine inlet temperatures of 2700 F and higher. Under the USDOE Clean Coal V Demonstration Plant Program, a nominal 260 MWe plant demonstrating 2nd Gen PFB technology has been proposed for construction at the McIntosh Power Plant of the City of Lakeland, Florida. In the September-December 1997 time period, four test runs were conducted in Foster Wheeler's 12-inch diameter carbonizer pilot plant in Livingston New Jersey to ascertain carbonizer performance characteristics with the Kentucky No. 9 coal and Florida limestone proposed for use in the Lakeland plant. The tests were of a short-term nature exploring carbonizer carbon conversions, sulfur capture efficiencies and syngas alkali levels. The tests were successful; observed carbonizer performance was in agreement with predictions and no operating problems, attributed to the planned feedstocks, were encountered. The results of the four test runs are reported herein.

  1. Carbon Nanomembranes.

    Science.gov (United States)

    Turchanin, Andrey; Gölzhäuser, Armin

    2016-08-01

    Carbon nanomembranes (CNMs) are synthetic 2D carbon sheets with tailored physical or chemical properties. These depend on the structure, molecular composition, and surroundings on either side. Due to their molecular thickness, they can be regarded as "interfaces without bulk" separating regions of different gaseous, liquid, or solid components and controlling the materials exchange between them. Here, a universal scheme for the fabrication of 1 nm-thick, mechanically stable, functional CNMs is presented. CNMs can be further modified, for example perforated by ion bombardment or chemically functionalized by the binding of other molecules onto the surfaces. The underlying physical and chemical mechanisms are described, and examples are presented for the engineering of complex surface architectures, e.g., nanopatterns of proteins, fluorescent dyes, or polymer brushes. A simple transfer procedure allows CNMs to be placed on various support structures, which makes them available for diverse applications: supports for electron and X-ray microscopy, nanolithography, nanosieves, Janus nanomembranes, polymer carpets, complex layered structures, functionalization of graphene, novel nanoelectronic and nanomechanical devices. To close, the potential of CNMs in filtration and sensorics is discussed. Based on tests for the separation of gas molecules, it is argued that ballistic membranes may play a prominent role in future efforts of materials separation. PMID:27281234

  2. Trading forest carbon

    Science.gov (United States)

    The nature of carbon in forests is discussed from the perspective of carbon trading. Carbon inventories, specifically in the area of land use and forestry are reviewed for the Pacific Northwest. Carbon turnover in forests is discussed as it relates to carbon sequestration. Scient...

  3. Synthesis of carbon nanofibers on impregnated powdered activated carbon as cheap substrate

    OpenAIRE

    Mamun, A. A.; Y.M. Ahmed; S.A. Muyibi; M.F.R. Al-Khatib; A.T. Jameel; M.A. AlSaadi

    2016-01-01

    The catalysis and characterization of carbon nanofibers (CNFs) composite are reported in this work. Carbon nanofibers were produced on oil palm shell powdered activated carbon (PAC), which was impregnated with nickel. Chemical Vapor Deposition (CVD) of C2H2 was used in the presence of hydrogen at ∼650 °C. The flow rates of carbon source and hydrogen were fixed. The CNFs formed directly on the surface of the impregnated PAC. Variable weight percentages (1%, 3%, 5%, 7% and 9%) of the catalyst s...

  4. Ultrasound-intensified mineral carbonation

    International Nuclear Information System (INIS)

    Several aspects of ultrasound-assisted mineral carbonation were investigated in this work. The objectives were to intensify the CO2 sequestration process to improve reaction kinetics and maximal conversion. Stainless steel slags, derived from the Argon Oxygen Decarburization (AOD) and Continuous Casting/Ladle Metallurgy (CC/LM) refining steps, were used for assessing the technical feasibility of this concept, as they are potential carbon sinks and can benefit from reduction in alkalinity (pH) by mineral carbonation. Ultrasound was applied by use of an ultrasound horn into the reaction slurry, where mineral carbonation reaction took place at 50 °C for up to 4 h; comparison was made to solely mechanically mixed process. It was found that sonication increases the reaction rate after the initial stage, and permits achieving higher carbonate conversion and lower pH. AOD slag conversion increased from 30% to 49%, and pH decreased from 10.6 to 10.1; CC slag conversion increased from 61% to 73% and pH decreased from 10.8 to 9.9. The enhancement effect of ultrasound was attributed to the removal of passivating layers (precipitated calcium carbonate and depleted silica) that surround the unreacted particle core and inhibit mass transfer. Significant particle size reduction was observed for sonicated powders, compared to particle size growth in the case of stirring-only; D[4,3] values increased without sonication by 74% and 50%, and decreased with sonication by 64% and 52%, respectively for AOD and CC slags. Considerations on scale-up of this technology, particularly with regards to energy efficiency, are also discussed. Highlights: ► Ultrasound increased CaO, AOD and CC slags mineral carbonation rates and conversions. ► Enhancement effect linked to removal of mass transfer inhibiting passivating layers. ►Carbonated particle size grew with stirring-only, and decreased with sonication. ► Lower pH of slags with greater carbonation extent can reduce heavy metal leaching

  5. Carbon Farming as a Carbon Negative Technology

    Science.gov (United States)

    Anderson, C.; Laird, D.; Hayes, D. J.

    2015-12-01

    Carbon farms have a pivotal role in national and international efforts to mitigate and adapt to climate change. A carbon farm in its broadest sense is one that reduces greenhouse gas (GHG) emissions or captures and holds carbon in vegetation and soils. Their capacity to remove carbon from the air and store it safely and permanently, while providing additional human and ecosystem benefits, means they could contribute significantly to national efforts to stabilize or reduce GHGs. We examine carbon farms in the context of corn and soybean production agriculture. We illustrate, using Iowa data but with relevance across United States corn and soybean production, the potential for carbon farms to reduce human GHG emissions and sequester carbon permanently at a rate that has meaningful impact on global greenhouse gas concentration. Carbon has been viewed as a next generation cash crop in Iowa for over a decade. The carbon farm perspective, however, goes beyond carbon as cash crop to make carbon the center of an entire farm enterprise. The transformation is possible through slight adjustment crop practices mixed with advances in technology to sequester carbon through biochar. We examine carbon balance of Iowa agriculture given only the combination of slight reduction in fertilizer and sequestration by biochar. We find the following. Iowa carbon farms could turn Iowa agriculture into a carbon sink. The estimated range of GHG reduction by statewide implementation of carbon farms is 19.46 to 90.27 MMt CO2-equivalent (CO2-e), while the current agricultural CO2-e emission estimate is 35.38 MMt CO2-e. Iowa carbon farm GHG reduction would exceed Iowa GHG reduction by wind energy (8.7 MMt CO2-e) and could exceed combined reductions from wind energy and corn grain ethanol (10.7 MMt CO2-e; 19.4 MMt CO2-e combined). In fact, Iowa carbon farms alone could exceed GHG reduction from national corn grain ethanol production (39.6 MMt CO2-e). A carbon price accessible to agricultural

  6. Net Ecosystem Carbon Flux

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Net Ecosystem Carbon Flux is defined as the year-over-year change in Total Ecosystem Carbon Stock, or the net rate of carbon exchange between an ecosystem and the...

  7. Carbon Monoxide (CO)

    Science.gov (United States)

    ... IAQ) » Carbon Monoxide's Impact on Indoor Air Quality Carbon Monoxide's Impact on Indoor Air Quality On this ... length of exposure. Top of Page Sources of Carbon Monoxide Sources of CO include: unvented kerosene and ...

  8. Carbon Monoxide Poisoning

    Science.gov (United States)

    ... Recommend on Facebook Tweet Share Compartir What is Carbon Monoxide? Carbon monoxide, or “CO,” is an odorless, colorless gas that can kill you. Carbon monoxide detector Where is CO found? CO is ...

  9. TOGAF version 9

    CERN Document Server

    Group, The Open

    2010-01-01

    This is the official Open Group Pocket Guide for TOGAF Version 9 Enterprise Edition. This pocket guide is published by Van Haren Publishing on behalf of The Open Group.TOGAF, The Open Group Architectural Framework is a fast growing, worldwide accepted standard that can help organisations build their own Enterprise Architecture in a standardised way. This book explains why the in?s and out?s of TOGAF in a concise manner.This book explains how TOGAF can help to make an Enterprise Architecture. Enterprise Architecture is an approach that can help management to understand this growing complexity.

  10. Telltale Animation (Sol 9)

    Science.gov (United States)

    2008-01-01

    This animation of the NASA's Phoenix Mars Lander's telltale was made from five images taken by Phoenix's Stereo Surface Imager (SSI) just after 4:37 PM local Mars time on the ninth Martian day of the mission, or Sol 9 (June 3, 2008). The images were taken with a blue filter (450 nanometer, R6) that focuses at items on the deck rather than the workspace or horizon. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  11. Integral Ring Carbon-Carbon Piston

    Science.gov (United States)

    Northam, G. Burton (Inventor)

    1999-01-01

    An improved structure for a reciprocating internal combustion engine or compressor piston fabricate from carbon-carbon composite materials is disclosed. An integral ring carbon-carbon composite piston, disclosed herein, reduces the need for piston rings and for small clearances by providing a small flexible, integral component around the piston that allows for variation in clearance due to manufacturing tolerances, distortion due to pressure and thermal loads, and variations in thermal expansion differences between the piston and cylinder liner.

  12. Carbon dioxide sequestration by mineral carbonation

    OpenAIRE

    Huijgen, W.J.J.

    2007-01-01

    The increasing atmospheric carbon dioxide (CO2) concentration, mainly caused by fossil fuel combustion, has lead to concerns about global warming. A possible technology that can contribute to the reduction of carbon dioxide emissions is CO2 sequestration by mineral carbonation. The basic concept behind mineral CO2 sequestration is the mimicking of natural weathering processes in which calcium or magnesium containing minerals react with gaseous CO2 and form solid calcium or magnesium carbonate...

  13. RERTR-9 Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    D. M. Perez

    2011-05-01

    The RERTR-9 experiment was designed to test the effect of modified fuel/clad interfaces in monolithic fuel plates and to demonstrate that the addition of Si to the matrix material in dispersion plates continued to be effective at high loading (~8.5 g U/cc). Several monolithic fuel plates were fabricated by Hot Isostatic Pressing (HIP) and Friction Bonding (FB) with thin layers of Si inserted and by HIP with a Zr diffusion barrier between the fuel and cladding. Si was applied to the interface by thermal spray of Al Si mixtures and by the insertion of thin Si-rich Al alloy foil between the fuel/clad interface. The dispersion fuel plates were fabricated by semi-standard rolling techniques (the reduction by rolling was lowered to limit fabrication defects). Matrix materials consisted of Al-Si alloys and mixtures with various levels of Si. The following report summarizes the life of the RERTR-9A/B experiment through end of irradiation, including as-run neutronic analysis, thermal analysis and hydraulic testing results.

  14. 9 CFR 53.9 - Mortgage against animals or materials.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mortgage against animals or materials. 53.9 Section 53.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT....9 Mortgage against animals or materials. When animals or materials have been destroyed pursuant...

  15. Carbon Residence Times in Pedogenic Carbonate Pools

    Science.gov (United States)

    Monger, H.; Feng, Y.; Karnjanapiboonwang, A.

    2013-12-01

    Soil carbonate is a huge pool of terrestrial carbon that contains at least 930 to 940 Pg C and has influx rates on the order of 1 to 12 g CaCO3/m2/yr. Such large mass to flux ratios yield long mean residence times for carbon (e.g., 85,000 years)--assuming steady state. Like other global carbon pools, the soil carbonate pool has smaller sub-pools with higher influx rates and shorter mean residence times. For example, pedogenic carbonate in coppice dunes known to have formed since 1858 and carbonate formed on lithic artifacts in soils at archaeology sites suggests mean residence times can be as short as 120 years--again assuming steady state. Harder to assess are efflux rates as CO2 emissions or bicarbonate leaching. Some Bowen-ratio studies have nevertheless found evidence for CO2 emissions resulting from carbonate dissolution, and other studies have found evidence for bicarbonate leaching based on dissolution pipes through calcic horizons using soil morphology studies. Since an understanding of mean residence times are prerequisite for a better understanding of soil carbonate in the global carbon cycle, especially in a scenario of an expanding Aridosphere, more influx and efflux measurements are needed to evaluate the possibility of carbon sequestration by soil carbonate in hyperarid, arid, semiarid, or subhumid soils.

  16. Carbon dioxide sequestration by mineral carbonation

    NARCIS (Netherlands)

    Huijgen, W.J.J.

    2007-01-01

    The increasing atmospheric carbon dioxide (CO2) concentration, mainly caused by fossil fuel combustion, has lead to concerns about global warming. A possible technology that can contribute to the reduction of carbon dioxide emissions is CO2 sequestration by mineral carbonation. The basic concept beh

  17. Carbon Segregation of Bearing Steel Concasting Billet

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The formation mechanism of “white band” and central carbon segregation of high-carbon Cr bearing steel concasting billets are discussed in this paper. The maximum oxygen content in the steel produced by concasting process was 13x10-6 with an average oxygen content of 9.3x 10-6.Comparison of metallurgical quality and fatigue property between the concasting steel (CC) andingot casting steel (IC) showed that the carbon segregation (C/C0) in former steel was 0.92~1.10and its fatigue life was equal to that of the latter steel.

  18. IFRS9 - rahoitusinstrumentit

    OpenAIRE

    Ojanen, Valtteri

    2012-01-01

    Työssäni on tarkoitus tutkia, miten IFRS9 tulee vaikuttamaan tilinpäätöksen laadintaan ja sitä kautta finanssialan yrityksen tilinpäätöksen lukuihin. Työssä on myös tarkoitus tuoda esiin esimerkiksi finanssivalvonnan ja tilintarkastajien näkökannat, jolloin pystytään tuomaan erilaisten toimijoiden näkökulmia. Lähtökohtana ovat pohjatiedot omasta IFRS opinnäytetyöstä ja se päälle sitten tiedot, jotka olen kerännyt työtä tehdessä. Työn tutkimusosio toteutetaan haastattelemalla yksittäisiä ...

  19. Fluoren-9-one oxime

    OpenAIRE

    Bernhard Bugenhagen; Yosef Al Jasem; Mariam Al-Azani; Thies Thiemann

    2014-01-01

    In the title mol­ecule, C13H9NO, the fluorene system and the oxime group non-H atoms are essentially coplanar, with a maximum deviation from the fluorene mean plane of 0.079 (2) Å for the oxime O atom. A short intra­molecular C—H⋯O generates an S(6) ring. In the crystal, mol­ecules related by a twofold screw axis are connected by O—H⋯N hydrogen bonds, forming [100] chains Within these chains, mol­ecules related by a unit translation along [100] show π–π stacking inter­actions between their fl...

  20. Fluoren-9-one oxime

    Directory of Open Access Journals (Sweden)

    Bernhard Bugenhagen

    2014-03-01

    Full Text Available In the title molecule, C13H9NO, the fluorene system and the oxime group non-H atoms are essentially coplanar, with a maximum deviation from the fluorene mean plane of 0.079 (2 Å for the oxime O atom. A short intramolecular C—H...O generates an S(6 ring. In the crystal, molecules related by a twofold screw axis are connected by O—H...N hydrogen bonds, forming [100] chains Within these chains, molecules related by a unit translation along [100] show π–π stacking interactions between their fluorene ring systems with an interplanar distance of 3.347 (2 Å. The dihedral angle between the fluorene units of adjacent molecules along the helix is 88.40 (2°. There is a short C—H...π contact between the fluorene groups belonging to neighbouring chains.

  1. Isotopic composition of carbon-13 and oxygen-18 from authigenic carbonates, Black Sea region

    Science.gov (United States)

    Logvina, E.; Mazurenko, L.; Prasolov, E.

    2004-05-01

    Several types of authigenic carbonates related to the fluid discharge zones were sampled during the international expeditions onboard R/V "Professor Vodyanitskiy" (56th cruise) and R/V "Professor Logachev" (11th cruise of UNESCO-TTR) in the northwest part of the Black sea. These carbonates are represented as mounds, build-ups and chimney-like structures, cemented sediments, crusts and concretions. The isotope analyses of carbonates were conducted using mass-spectrometer MS-20 in the Laboratory of Isotope Geology (St.Petersburg State University). The obtained values of oxygen-18 varied from +0,6 to -1,9 per mille (up to C0.8 per mille on average). This value is corresponding to normal seawater oxygen-18 value (about 0 per mille); we suspect, that the source of oxygen for carbonate formation is the seawater. The carbonates are characterized by low carbon-13 (from -35,4 to -42,6 per mille) in comparison with normal marine carbonates (about 0 per mille). We have reason to suppose that carbonates associated with fluid venting were formed by light isotopic composition of carbon dioxide (carbon-13 -45 to -52 per mille), which forming under methane microbiologic oxidation with such isotopic composition. This is because of crossing fluid process of carbon dioxide to carbonate with 8~10 degrees temperature carbon became heaver to 10- 11 per mille. The isotopic composition study of carbonate build-ups is of interest because its association with the gas hydrate accumulations is quite often in the gas seeps. This work is financially supported by Russian Foundation for Basic Research, grant 02-05-64346.

  2. Sequestration of Soil Carbon as Secondary Carbonates (Invited)

    Science.gov (United States)

    Lal, R.

    2013-12-01

    Rattan Lal Carbon Management and Sequestration Center The Ohio State University Columbus, OH 43210 USA Abstract World soils, the major carbon (C) reservoir among the terrestrial pools, contain soil organic C (SOC) and soil inorganic C (SIC). The SIC pool is predominant in soils of arid and semi-arid regions. These regions cover a land area of about 4.9x109 ha. The SIC pool in soils containing calcic and petrocalcic horizons is estimated at about 695-748 Pg (Pg = 1015 g = 1 gigaton) to 1-m depth. There are two types of carbonates. Lithogenic or primary carbonates are formed from weathering of carbonaceous rocks. Pedogenic or secondary carbonates are formed by dissolution of CO2 in the soil air to form carbonic acid and precipitation as carbonates of Ca+2 or Mg+2. It is the availability of Ca+2 or Mg+2 from outside the ecosystem that is essential to sequester atmospheric CO2. Common among outside sources of Ca+2 or Mg+2 are irrigation water, aerial deposition, sea breeze, fertilizers, manure and other amendments. The decomposition of SOC and root respiration may increase the partial pressure of CO2 in the soil air and lead to the formation of HCO_3^- upon dissolution in H20. Precipitation of secondary carbonates may result from decreased partial pressure of CO2 in the sub-soil, increased concentration of Ca+2, Mg+2 and HCO_3^- in soil solution, and decreased soil moisture content by evapotranspiration. Transport of bicarbonates in irrigated soils and subsequent precipitation above the ground water (calcrete), activity of termites and other soil fauna, and management of urban soils lead to formation of secondary carbonates. On a geologic time scale, weathering of silicate minerals and transport of the by-products into the ocean is a geological process of sequestration of atmospheric CO2. Factors affecting formation of secondary carbonates include land use, and soil and crop management including application of biosolids, irrigation and the quality of irrigation water

  3. Carbon Footprint of Beef Cattle

    Directory of Open Access Journals (Sweden)

    Jim Dyer

    2012-12-01

    Full Text Available The carbon footprint of beef cattle is presented for Canada, The United States, The European Union, Australia and Brazil. The values ranged between 8 and 22 kg CO2e per kg of live weight (LW depending on the type of farming system, the location, the year, the type of management practices, the allocation, as well as the boundaries of the study. Substantial reductions have been observed for most of these countries in the last thirty years. For instance, in Canada the mean carbon footprint of beef cattle at the exit gate of the farm decreased from 18.2 kg CO2e per kg LW in 1981 to 9.5 kg CO2e per kg LW in 2006 mainly because of improved genetics, better diets, and more sustainable land management practices. Cattle production results in products other than meat, such as hides, offal and products for rendering plants; hence the environmental burden must be distributed between these useful products. In order to do this, the cattle carbon footprint needs to be reported in kg of CO2e per kg of product. For example, in Canada in 2006, on a mass basis, the carbon footprint of cattle by-products at the exit gate of the slaughterhouse was 12.9 kg CO2e per kg of product. Based on an economic allocation, the carbon footprints of meat (primal cuts, hide, offal and fat, bones and other products for rendering were 19.6, 12.3, 7 and 2 kg CO2e per kg of product, respectively.

  4. From carbon nanotubes to carbon atomic chains

    Science.gov (United States)

    Casillas García, Gilberto; Zhang, Weijia; José-Yacamán, Miguel

    2010-10-01

    Carbyne is a linear allotrope of carbon. It is formed by a linear arrangement of carbon atoms with sp-hybridization. We present a reliable and reproducible experiment to obtain these carbon atomic chains using few-layer-graphene (FLG) sheets and a HRTEM. First the FLG sheets were synthesized from worm-like exfoliated graphite and then drop-casted on a lacey-carbon copper grid. Once in the TEM, two holes are opened near each other in a FLG sheet by focusing the electron beam into a small spot. Due to the radiation, the carbon atoms rearrange themselves between the two holes and form carbon fibers. The beam is concentrated on the carbon fibers in order excite the atoms and induce a tension until multi wall carbon nanotube (MWCNT) is formed. As the radiation continues the MWCNT breaks down until there is only a single wall carbon nanotube (SWCNT). Then, when the SWCNT breaks, an atomic carbon chain is formed, lasts for several seconds under the radiation and finally breaks. This demonstrates the stability of this carbon structure.

  5. Aquatic carbon cycling in the conterminous United States and implications for terrestrial carbon accounting.

    Science.gov (United States)

    Butman, David; Stackpoole, Sarah; Stets, Edward; McDonald, Cory P; Clow, David W; Striegl, Robert G

    2016-01-01

    Inland water ecosystems dynamically process, transport, and sequester carbon. However, the transport of carbon through aquatic environments has not been quantitatively integrated in the context of terrestrial ecosystems. Here, we present the first integrated assessment, to our knowledge, of freshwater carbon fluxes for the conterminous United States, where 106 (range: 71-149) teragrams of carbon per year (TgC⋅y(-1)) is exported downstream or emitted to the atmosphere and sedimentation stores 21 (range: 9-65) TgC⋅y(-1) in lakes and reservoirs. We show that there is significant regional variation in aquatic carbon flux, but verify that emission across stream and river surfaces represents the dominant flux at 69 (range: 36-110) TgC⋅y(-1) or 65% of the total aquatic carbon flux for the conterminous United States. Comparing our results with the output of a suite of terrestrial biosphere models (TBMs), we suggest that within the current modeling framework, calculations of net ecosystem production (NEP) defined as terrestrial only may be overestimated by as much as 27%. However, the internal production and mineralization of carbon in freshwaters remain to be quantified and would reduce the effect of including aquatic carbon fluxes within calculations of terrestrial NEP. Reconciliation of carbon mass-flux interactions between terrestrial and aquatic carbon sources and sinks will require significant additional research and modeling capacity.

  6. Aquatic carbon cycling in the conterminous United States and implications for terrestrial carbon accounting

    Science.gov (United States)

    Butman, David; Stackpoole, Sarah; Stets, Edward; McDonald, Cory P.; Clow, David W.; Striegl, Robert G.

    2016-01-01

    Inland water ecosystems dynamically process, transport, and sequester carbon. However, the transport of carbon through aquatic environments has not been quantitatively integrated in the context of terrestrial ecosystems. Here, we present the first integrated assessment, to our knowledge, of freshwater carbon fluxes for the conterminous United States, where 106 (range: 71–149) teragrams of carbon per year (TgC⋅y−1) is exported downstream or emitted to the atmosphere and sedimentation stores 21 (range: 9–65) TgC⋅y−1 in lakes and reservoirs. We show that there is significant regional variation in aquatic carbon flux, but verify that emission across stream and river surfaces represents the dominant flux at 69 (range: 36–110) TgC⋅y−1 or 65% of the total aquatic carbon flux for the conterminous United States. Comparing our results with the output of a suite of terrestrial biosphere models (TBMs), we suggest that within the current modeling framework, calculations of net ecosystem production (NEP) defined as terrestrial only may be overestimated by as much as 27%. However, the internal production and mineralization of carbon in freshwaters remain to be quantified and would reduce the effect of including aquatic carbon fluxes within calculations of terrestrial NEP. Reconciliation of carbon mass–flux interactions between terrestrial and aquatic carbon sources and sinks will require significant additional research and modeling capacity. PMID:26699473

  7. Carbon nanotube composite materials

    Energy Technology Data Exchange (ETDEWEB)

    O' Bryan, Gregory; Skinner, Jack L; Vance, Andrew; Yang, Elaine Lai; Zifer, Thomas

    2015-03-24

    A material consisting essentially of a vinyl thermoplastic polymer, un-functionalized carbon nanotubes and hydroxylated carbon nanotubes dissolved in a solvent. Un-functionalized carbon nanotube concentrations up to 30 wt % and hydroxylated carbon nanotube concentrations up to 40 wt % can be used with even small concentrations of each (less than 2 wt %) useful in producing enhanced conductivity properties of formed thin films.

  8. Mutagenicity of carbon nanomaterials

    DEFF Research Database (Denmark)

    Wallin, Håkan; Jacobsen, Nicklas Raun; White, Paul A;

    2011-01-01

    Carbon nanomaterials such carbon nanotubes, graphene and fullerenes are some the most promising nanomaterials. Although carbon nanomaterials have been reported to possess genotoxic potential, it is imperitive to analyse the data on the genotoxicity of carbon nanomaterials in vivo and in vitro...

  9. Electroanalysis with carbon paste electrodes

    CERN Document Server

    Svancara, Ivan; Walcarius, Alain; Vytras, Karel

    2011-01-01

    Introduction to Electrochemistry and Electroanalysis with Carbon Paste-Based ElectrodesHistorical Survey and GlossaryField in Publication Activities and LiteratureCarbon Pastes and Carbon Paste ElectrodesCarbon Paste as the Binary MixtureClassification of Carbon Pastes and Carbon Paste ElectrodesConstruction of Carbon Paste HoldersCarbon Paste as the Electrode MaterialPhysicochemical Properties of Carbon PastesElectrochemical Characteristics of Carbon PastesTesting of Unmodified CPEsIntera

  10. Mesoporous carbon materials

    Science.gov (United States)

    Dai, Sheng; Fulvio, Pasquale Fernando; Mayes, Richard T.; Wang, Xiqing; Sun, Xiao-Guang; Guo, Bingkun

    2014-09-09

    A conductive mesoporous carbon composite comprising conductive carbon nanoparticles contained within a mesoporous carbon matrix, wherein the conductive mesoporous carbon composite possesses at least a portion of mesopores having a pore size of at least 10 nm and up to 50 nm, and wherein the mesopores are either within the mesoporous carbon matrix, or are spacings delineated by surfaces of said conductive carbon nanoparticles when said conductive carbon nanoparticles are fused with each other, or both. Methods for producing the above-described composite, devices incorporating them (e.g., lithium batteries), and methods of using them, are also described.

  11. Pyrolyzed thin film carbon

    Science.gov (United States)

    Tai, Yu-Chong (Inventor); Liger, Matthieu (Inventor); Harder, Theodore (Inventor); Konishi, Satoshi (Inventor); Miserendino, Scott (Inventor)

    2010-01-01

    A method of making carbon thin films comprises depositing a catalyst on a substrate, depositing a hydrocarbon in contact with the catalyst and pyrolyzing the hydrocarbon. A method of controlling a carbon thin film density comprises etching a cavity into a substrate, depositing a hydrocarbon into the cavity, and pyrolyzing the hydrocarbon while in the cavity to form a carbon thin film. Controlling a carbon thin film density is achieved by changing the volume of the cavity. Methods of making carbon containing patterned structures are also provided. Carbon thin films and carbon containing patterned structures can be used in NEMS, MEMS, liquid chromatography, and sensor devices.

  12. Fluoren-9-one oxime

    Science.gov (United States)

    Bugenhagen, Bernhard; Al Jasem, Yosef; Al-Azani, Mariam; Thiemann, Thies

    2014-01-01

    In the title mol­ecule, C13H9NO, the fluorene system and the oxime group non-H atoms are essentially coplanar, with a maximum deviation from the fluorene mean plane of 0.079 (2) Å for the oxime O atom. A short intra­molecular C—H⋯O generates an S(6) ring. In the crystal, mol­ecules related by a twofold screw axis are connected by O—H⋯N hydrogen bonds, forming [100] chains Within these chains, mol­ecules related by a unit translation along [100] show π–π stacking inter­actions between their fluorene ring systems with an inter­planar distance of 3.347 (2) Å. The dihedral angle between the fluorene units of adjacent mol­ecules along the helix is 88.40 (2)°. There is a short C—H⋯π contact between the fluorene groups belonging to neighbouring chains. PMID:24764980

  13. Lianas reduce carbon accumulation and storage in tropical forests.

    Science.gov (United States)

    van der Heijden, Geertje M F; Powers, Jennifer S; Schnitzer, Stefan A

    2015-10-27

    Tropical forests store vast quantities of carbon, account for one-third of the carbon fixed by photosynthesis, and are a major sink in the global carbon cycle. Recent evidence suggests that competition between lianas (woody vines) and trees may reduce forest-wide carbon uptake; however, estimates of the impact of lianas on carbon dynamics of tropical forests are crucially lacking. Here we used a large-scale liana removal experiment and found that, at 3 y after liana removal, lianas reduced net above-ground carbon uptake (growth and recruitment minus mortality) by ∼76% per year, mostly by reducing tree growth. The loss of carbon uptake due to liana-induced mortality was four times greater in the control plots in which lianas were present, but high variation among plots prevented a significant difference among the treatments. Lianas altered how aboveground carbon was stored. In forests where lianas were present, the partitioning of forest aboveground net primary production was dominated by leaves (53.2%, compared with 39.2% in liana-free forests) at the expense of woody stems (from 28.9%, compared with 43.9%), resulting in a more rapid return of fixed carbon to the atmosphere. After 3 y of experimental liana removal, our results clearly demonstrate large differences in carbon cycling between forests with and without lianas. Combined with the recently reported increases in liana abundance, these results indicate that lianas are an important and increasing agent of change in the carbon dynamics of tropical forests.

  14. M4C9 +(M = Ti, V): New gas phase clusters

    Indian Academy of Sciences (India)

    R Selvan; L Gowrishankar; T Pradeep

    2001-10-01

    New metal-carbon clusters, M4C9 +(M = Ti, V), generated using a combined thermal arc discharge evaporation set-up, have been studied with quadrupole mass spectrometry. Reactivities of these clusters have been investigated by means of association reactions with H2O. Metal-carbon clusters of other compositions have also been studied. We speculate on the mechanism of formation of larger metal-carbon clusters.

  15. Carbon allocation, sequestration and carbon dioxide mitigation under plantation forests of north western Himalaya, India

    Directory of Open Access Journals (Sweden)

    Bandana Devi

    2013-05-01

    Full Text Available The organic carbon and soils of the world comprise bulk of the terrestrial carbon and serve as a major sink and source of atmospheric carbon. Increasing atmospheric concentrations of green house gases may be mitigated by increasing carbon sequestration in vegetation and soil. The study attempted to estimate biomass production and carbon sequestration potential of different plantation ecosystems in north western Himalaya, India. Biomass, carbon density of biomass, soil, detritus, carbon sequestration and CO2 mitigation potential were studied under different plantation forest ecosystems comprising of eight different tree species: Quercus leucotrichophora, Pinus roxburghii, Acacia catechu, Acacia mollissima, Albizia procera, Alnusnitida, Eucalyptus tereticornis and Ulmus villosa. Above (185.57±48.99tha-1 and below ground (42.47±10.38 tha-1 biomass was maximum in Ulmus villosa. The vegetation carbon density was maxium in Albizia procera(118.37±1.49 tha-1 and minimum (36.50±9.87 tha-1 in Acacia catechu. Soil carbon density was maximum (219.86±10.34 tha-1 in Alnus nitida, and minimum (170.83±20.60 tha-1 in Pinus roxburghii. Detritus was higher in Pinus roxburghii (6.79±2.0 tha-1. Carbon sequestration (7.91±3.4 tha-1 and CO2 mitigation potential (29.09±12.78 tha-1 was maximum in Ulmus villosa. Pearson correlation matrix revealed significant positive relationship of ecosystem carbon with plantation biomass, soil carbon and CO2 mitigation potential. With the emerging threat of climate change, such assessment of forest and soil carbon inventory would allow to devise best land management and policy decisions for sustainable management of fragile hilly ecosystem.

  16. Carbon allocation, sequestration and carbon dioxide mitigation under plantation forests of north western Himalaya, India

    Directory of Open Access Journals (Sweden)

    Bandana Devi

    2013-07-01

    Full Text Available The organic carbon and soils of the world comprise bulk of the terrestrial carbon and serve as amajorsink and source of atmospheric carbon. Increasing atmospheric concentrations of green house gases may be mitigated by increasing carbon sequestration in vegetation and soil. The study attempted to estimate biomass production and carbon sequestration potential of different plantation ecosystems in north western Himalaya, India. Biomass, carbon density of biomass, soil, detritus, carbon sequestration and CO2 mitigation potential were studied underdifferent plantation forest ecosystems comprising of eight different tree species viz. Quercus leucotrichophora, Pinus roxburghii, Acacia catechu, Acacia mollissima, Albizia procera, Alnus nitida, Eucalyptus tereticornis and Ulmus villosa. Above (185.57 ą 48.99 tha-1 and below ground (42.47 ą 10.38 tha-1 biomass was maximum in Ulmus villosa. The vegetation carbon density was maxium in Albizia procera (118.37 ą 1.49 tha-1 and minimum (36.50 ą 9.87 tha-1 in Acacia catechu. Soil carbon density was maximum (219.86ą 10.34 tha-1 in Alnus nitida, and minimum (170.83ą 20.60 tha-1in Pinus roxburghii. Detritus was higher in Pinus roxburghii (6.79 ą 2.0 tha-1. Carbon sequestration (7.91ą 3.4 tha-1 and CO2 mitigation potential (29.09 ą 12.78 tha-1 was maximum in Ulmus villosa. Pearson correlation matrix revealed significant positive relationship of ecosystem carbon with plantation biomass, soil carbon and CO2 mitigation potential. With the emerging threat of climate change, such assessment of forest and soil carbon inventory would allow to devise best land management and policy decisions forsustainable management of fragile hilly ecosystem. 

  17. TOGAF 9 certified study guide

    CERN Document Server

    Group, The Open

    2010-01-01

    The TOGAF 9 certification program is a knowledge-based certification program. It has two levels, leading to certification for TOGAF 9 Foundation and TOGAF 9 Certified, respectively. The purpose of certification to TOGAF 9 Certified is to provide validation that, in addition to the knowledge and comprehension of TOGAF 9 Foundation level, the Candidate is able to analyze and apply this knowledge. The learning objectives at this level therefore focus on application and analysis in addition to knowledge and comprehension.This Study Guide supports students in preparation for the TOGAF 9 Part 2 Exam

  18. 2,6-Bis(9-ethyl-9H-carbazolylmethylenecyclohexanone

    Directory of Open Access Journals (Sweden)

    Abdullah M. Asiri

    2009-10-01

    Full Text Available The title compound, 2,6-bis(ethyl-9-ethyl-9H-carbazolylmethylenecyclohexanone has been synthesized by condensation of 9-ethylcarbazole-3-aldehyde and cyclohexanone in ethanol in the presence of pyridine. The structure of this new compound was confirmed by elemental analysis, IR, 1H NMR, 13C NMR and EI-MS spectral analysis.

  19. Solid State Structure of Poly(9,9-dinonylfluorene)

    DEFF Research Database (Denmark)

    Torkkeli, Mika; Galbrecht, Frank; Scherf, Ullrich;

    2015-01-01

    We report on X-ray diffraction and grazing-incidence X-ray diffraction data of poly(9,9-dinonylfluorene) (PF9) in bulk, thin films and in the 1% methylcyclohexane gel. We denote the main crystalline phase as alpha phase and propose that the unit cell is monoclinic (a = 29.31 angstrom, b = 23.65 a...

  20. 9 CFR 51.9 - Claims not allowed.

    Science.gov (United States)

    2010-01-01

    ... search has been made for the brucellosis reactor animal and the brucellosis reactor animal could not be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Claims not allowed. 51.9 Section 51.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF...

  1. 9 CFR 108.9 - Dressing rooms and other facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dressing rooms and other facilities. 108.9 Section 108.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS...

  2. 9 CFR 113.9 - New potency test.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false New potency test. 113.9 Section 113.9 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Applicability §...

  3. Studies on the Simultaneous Synthesis of Dimethyl Carbonate and Poly(ethylene terephthalate):Ⅰ. Catalytic Activity of Metal Acetate in Transesterification of Ethylene Carbonate with Dimethyl Terephthalate

    Institute of Scientific and Technical Information of China (English)

    Dan ZHANG; Shu Yong JIA; Yue WANG; Jie YAO; Yi ZENG; Gong Ying WANG

    2006-01-01

    A novel direct method for preparation of dimethyl carbonate and poly(ethylene terephthalate) from ethylene carbonate and dimethyl terephthalate has been demonstrated in the presence of metal acetate catalysts, lithium acetate dihydrate showed highest catalytic activity with 47.9% yield of dimethyl carbonate. This method was a green chemical process.

  4. Carbonate precipitation by the thermophilic archaeon Archaeoglobus fulgidus: a model of carbon flow for an ancient microorganism

    Directory of Open Access Journals (Sweden)

    P. Ostrom

    2008-08-01

    Full Text Available Microbial carbonate precipitation experiments were conducted using the archaeon bacteria Archaeoglobus fulgidus to determine chemical and isotopic fractionation of organic and inorganic carbon into mineral phases. Carbonate precipitation was induced in two different experiments using A. fulgidus to determine the relative abundance of organically derived carbon incorporated into carbonate minerals as well as to define any distinct phases or patterns that could be attributed to the precipitation process. One experiment used a medium containing 13C-depleted organic carbon and 13C-enriched inorganic carbon, and the other used a 14C-labeled organic carbon source. Results indicated that 0.9–24.8% organic carbon was incorporated into carbonates precipitated by A. fulgidus and that this process was mediated primarily by pH and CO2 emission from cells. Data showed that the carbon in the CO2 produced from this microorganism is incorporated into carbonates and that the rate at which precipitation occurs and the dynamics of the carbonate precipitation process are strongly mediated by the specific steps involved in the biochemical process for lactate oxidation by A. fulgidus.

  5. Adsorption of Carbon Dioxide on Activated Carbon

    Institute of Scientific and Technical Information of China (English)

    Bo Guo; Liping Chang; Kechang Xie

    2006-01-01

    The adsorption of CO2 on a raw activated carbon A and three modified activated carbon samples B, C, and D at temperatures ranging from 303 to 333 K and the thermodynamics of adsorption have been investigated using a vacuum adsorption apparatus in order to obtain more information about the effect of CO2 on removal of organic sulfur-containing compounds in industrial gases. The active ingredients impregnated in the carbon samples show significant influence on the adsorption for CO2 and its volumes adsorbed on modified carbon samples B, C, and D are all larger than that on the raw carbon sample A. On the other hand, the physical parameters such as surface area, pore volume, and micropore volume of carbon samples show no influence on the adsorbed amount of CO2. The Dubinin-Radushkevich (D-R) equation was the best model for fitting the adsorption data on carbon samples A and B, while the Freundlich equation was the best fit for the adsorption on carbon samples C and D. The isosteric heats of adsorption on carbon samples A, B, C, and D derived from the adsorption isotherms using the Clapeyron equation decreased slightly increasing surface loading. The heat of adsorption lay between 10.5 and 28.4 kJ/mol, with the carbon sample D having the highest value at all surface coverages that were studied. The observed entropy change associated with the adsorption for the carbon samples A, B, and C (above the surface coverage of 7 ml/g) was lower than the theoretical value for mobile adsorption. However, it was higher than the theoretical value for mobile adsorption but lower than the theoretical value for localized adsorption for carbon sample D.

  6. Accelerating Mineral Carbonation Using Carbonic Anhydrase.

    Science.gov (United States)

    Power, Ian M; Harrison, Anna L; Dipple, Gregory M

    2016-03-01

    Carbonic anhydrase (CA) enzymes have gained considerable attention for their potential use in carbon dioxide (CO2) capture technologies because they are able to catalyze rapidly the interconversion of aqueous CO2 and bicarbonate. However, there are challenges for widespread implementation including the need to develop mineralization process routes for permanent carbon storage. Mineral carbonation of highly reactive feedstocks may be limited by the supply rate of CO2. This rate limitation can be directly addressed by incorporating enzyme-catalyzed CO2 hydration. This study examined the effects of bovine carbonic anhydrase (BCA) and CO2-rich gas streams on the carbonation rate of brucite [Mg(OH)2], a highly reactive mineral. Alkaline brucite slurries were amended with BCA and supplied with 10% CO2 gas while aqueous chemistry and solids were monitored throughout the experiments (hours to days). In comparison to controls, brucite carbonation using BCA was accelerated by up to 240%. Nesquehonite [MgCO3·3H2O] precipitation limited the accumulation of hydrated CO2 species, apparently preventing BCA from catalyzing the dehydration reaction. Geochemical models reproduce observed reaction progress in all experiments, revealing a linear correlation between CO2 uptake and carbonation rate. Data demonstrates that carbonation in BCA-amended reactors remained limited by CO2 supply, implying further acceleration is possible. PMID:26829491

  7. Carbon fuel cells with carbon corrosion suppression

    Science.gov (United States)

    Cooper, John F.

    2012-04-10

    An electrochemical cell apparatus that can operate as either a fuel cell or a battery includes a cathode compartment, an anode compartment operatively connected to the cathode compartment, and a carbon fuel cell section connected to the anode compartment and the cathode compartment. An effusion plate is operatively positioned adjacent the anode compartment or the cathode compartment. The effusion plate allows passage of carbon dioxide. Carbon dioxide exhaust channels are operatively positioned in the electrochemical cell to direct the carbon dioxide from the electrochemical cell.

  8. Cas9 Functionally Opens Chromatin

    OpenAIRE

    Barkal, Amira A.; Srinivasan, Sharanya; Hashimoto, Tatsunori; Gifford, David K.; Sherwood, Richard I.

    2016-01-01

    Using a nuclease-dead Cas9 mutant, we show that Cas9 reproducibly induces chromatin accessibility at previously inaccessible genomic loci. Cas9 chromatin opening is sufficient to enable adjacent binding and transcriptional activation by the settler transcription factor retinoic acid receptor at previously unbound motifs. Thus, we demonstrate a new use for Cas9 in increasing surrounding chromatin accessibility to alter local transcription factor binding.

  9. Cas9 Functionally Opens Chromatin

    OpenAIRE

    Barkal, Amira A.; Srinivasan, Sharanya; Gifford, David K.; Sherwood, Richard I.; Hashimoto, Tatsunori Benjamin

    2015-01-01

    Using a nuclease-dead Cas9 mutant, we show that Cas9 reproducibly induces chromatin accessibility at previously inaccessible genomic loci. Cas9 chromatin opening is sufficient to enable adjacent binding and transcriptional activation by the settler transcription factor retinoic acid receptor at previously unbound motifs. Thus, we demonstrate a new use for Cas9 in increasing surrounding chromatin accessibility to alter local transcription factor binding.

  10. Cas9 Functionally Opens Chromatin.

    Directory of Open Access Journals (Sweden)

    Amira A Barkal

    Full Text Available Using a nuclease-dead Cas9 mutant, we show that Cas9 reproducibly induces chromatin accessibility at previously inaccessible genomic loci. Cas9 chromatin opening is sufficient to enable adjacent binding and transcriptional activation by the settler transcription factor retinoic acid receptor at previously unbound motifs. Thus, we demonstrate a new use for Cas9 in increasing surrounding chromatin accessibility to alter local transcription factor binding.

  11. Synthesis of carbon black/carbon nitride intercalation compound composite for efficient hydrogen production.

    Science.gov (United States)

    Wu, Zhaochun; Gao, Honglin; Yan, Shicheng; Zou, Zhigang

    2014-08-21

    The photoactivity of g-C3N4 is greatly limited by its high recombination rate of photogenerated carriers. Coupling g-C3N4 with other materials has been demonstrated to be an effective way to facilitate the separation and transport of charge carriers. Herein we report a composite of conductive carbon black and carbon nitride intercalation compound synthesized through facile one-step molten salt method. The as-prepared carbon black/carbon nitride intercalation compound composite was characterized by X-ray diffraction (XRD) and transmission electron microscopy (TEM), UV-vis absorption spectrum and photoluminescence spectroscopy (PL). The carbon black nanoparticles, homogeneously dispersed on the surface of carbon nitride intercalation compound, efficiently enhanced separation and transport of photogenerated carriers, thus improving the visible-light photocatalytic activity. The composite of 0.5 wt% carbon black and carbon nitride intercalation compound exhibited a H2 production rate of 68.9 μmol h(-1), which is about 3.2 times higher than hydrogen production on pristine carbon nitride intercalation compound.

  12. The Formation of Carbon Nanofibers on Powdered Activated Carbon Impregnated with Nickel

    Science.gov (United States)

    Ahmed, Y. M.; Al-Mamun, A. A.; Muyibi, S. A.; Al-Khatib, M. F. R.; Jameel, A. T.; AlSaadi, M. A.

    2009-06-01

    In the present work, the production and characterization of carbon nanofibers (CNFs) composite is reported. Carbon nanofibers (CNF) were produced on powdered activated carbon PAC—impregnated with nickel—by Chemical Vapor Deposition (CVD) of a hydrocarbon in the presence of hydrogen at ˜780° C. The flow rates of carbon source and hydrogen were fixed. The CNFs were formed directly over the impregnated AC. Variable weight percentage ratios of the catalyst salt (Ni+2) were used for the impregnation (1, 3, 5, 7 and 9%, respectively). The product displays a relatively high surface area, essentially constituted by the external surface, and the absence of the bottled pores encountered with activated carbon. FSEM, TEM and TGA were used for the characterization of the product.

  13. Enzymatic coproduction of biodiesel and glycerol carbonate from soybean oil and dimethyl carbonate.

    Science.gov (United States)

    Seong, Pil-Je; Jeon, Byoung Wook; Lee, Myunggu; Cho, Dae Haeng; Kim, Duk-Ki; Jung, Kwang S; Kim, Seung Wook; Han, Sung Ok; Kim, Yong Hwan; Park, Chulhwan

    2011-05-01

    The enzymatic coproduction of biodiesel and glycerol carbonate by the transesterification of soybean oil was studied using lipase as catalyst in organic solvent. To produce biodiesel and glycerol carbonate simultaneously, experiments were designed sequentially. Enzyme screening, the molar ratio of dimethyl carbonate (DMC) to soybean oil, reaction temperature and solvent effects were investigated. The results of enzyme screening, at 100 g/L Novozym 435 (immobilized Candida antarctica lipase B), biodiesel and glycerol carbonate showed conversions of 58.7% and 50.7%, respectively. The optimal conditions were 60 °C, 100 g/L Novozym 435, 6.0:1 molar ratio with tert-butanol as solvent: 84.9% biodiesel and 92.0% glycerol carbonate production was achieved. PMID:22113023

  14. Opportunities and Challenges for Being a Carbon Black Great Power

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    1. The "Uth Five-year Plan" Lay- ing the Foundation for Carbon Black Great Power 1.1 Rapid growth of carbon black output and production capacity During the "llth Five-year Plan" Period, China carbon black output was increased by 1.1 times and realized doubling; and the production capacity of carbon black realized an average annu- al growth of 16.9%. In 2011, the carbon black output was 3.853 million tons, increased by 14.2% compared with that of the last year, and the pro- portion of carbon black output in the world carbon black output was increased from 16% to 36%. The carbon black production capacity was 5.345 mil- lion tons, increased by 6% compared with that of the last year, and the proportion of carbon black production capacity in the world carbon black out- put reached 38%. Chinese carbon black output has been ranking the 1st place throughout the world for 6 years successively, and China has become a great power of carbon black production in the world.

  15. Global deforestation: contribution to atmospheric carbon dioxide.

    Science.gov (United States)

    Woodwell, G M; Hobbie, J E; Houghton, R A; Melillo, J M; Moore, B; Peterson, B J; Shaver, G R

    1983-12-01

    A study of effects of terrestrial biota on the amount of carbon dioxide in the atmosphere suggests that the global net release of carbon due to forest clearing between 1860 and 1980 was between 135 x 10(15) and 228 x 10(15) grams. Between 1.8 x 10(15) and 4.7 x 10(15) grams of carbon were released in 1980, of which nearly 80 percent was due to deforestation, principally in the tropics. The annual release of carbon from the biota and soils exceeded the release from fossil fuels until about 1960. Because the biotic release has been and remains much larger than is commonly assumed, the airborne fraction, usually considered to be about 50 percent of the release from fossil fuels, was probably between 22 and 43 percent of the total carbon released in 1980. The increase in carbon dioxide in the atmosphere is thought by some to be increasing the storage of carbon in the earth's remaining forests sufficiently to offset the release from deforestation. The interpretation of the evidence presented here suggests no such effect; deforestation appears to be the dominant biotic effect on atmospheric carbon dioxide. If deforestation increases in proportion to population, the biotic release of carbon will reach 9 x 10(15) grams per year before forests are exhausted early in the next century. The possibilities for limiting the accumulation of carbon dioxide in the atmosphere through reduction in use of fossil fuels and through management of forests may be greater than is commonly assumed. PMID:17747369

  16. Deglacial climate, carbon cycle and ocean chemistry changes in response to a terrestrial carbon release

    Science.gov (United States)

    Simmons, C. T.; Matthews, H. D.; Mysak, L. A.

    2016-02-01

    Researchers have proposed that a significant portion of the post-glacial rise in atmospheric CO2 could be due to the respiration of permafrost carbon stocks that formed over the course of glaciation. In this paper, we used the University of Victoria Earth System Climate Model v. 2.9 to simulate the deglacial and interglacial carbon cycle from the last glacial maximum to the present. The model's sensitivity to mid and high latitude terrestrial carbon storage is evaluated by including a 600 Pg C carbon pool parameterized to respire in concert with decreases in ice sheet surface area. The respiration of this stored carbon during the early stages of deglaciation had a large effect on the carbon cycle in these simulations, allowing atmospheric CO2 to increase by 40 ppmv in the model, with an additional 20 ppmv increase occurring in the case of a more realistic, prescribed CO2 radiative warming. These increases occurred prior to large-scale carbon uptake due to the reestablishment of boreal forests and peatlands in the proxy record (beginning in the early Holocene). Surprisingly, the large external carbon input to the atmosphere and oceans did not increase sediment dissolution and mean ocean alkalinity relative to a control simulation without the high latitude carbon reservoir. In addition, our simulations suggest that an early deglacial terrestrial carbon release may come closer to explaining some observed deglacial changes in deep-ocean carbonate concentrations than simulations without such a release. We conclude that the respiration of glacial soil carbon stores may have been an important contributor to the deglacial CO2 rise, particularly in the early stages of deglaciation.

  17. Conductive Carbon Coatings for Electrode Materials

    International Nuclear Information System (INIS)

    A simple method for optimizing the carbon coatings on non-conductive battery cathode material powders has been developed at Lawrence Berkeley National Laboratory. The enhancement of the electronic conductivity of carbon coating enables minimization of the amount of carbon in the composites, allowing improvements in battery rate capability without compromising energy density. The invention is applicable to LiFePO4 and other cathode materials used in lithium ion or lithium metal batteries for high power applications such as power tools and hybrid or plug-in hybrid electric vehicles. The market for lithium ion batteries in consumer applications is currently $5 billion/year. Additionally, lithium ion battery sales for vehicular applications are projected to capture 5% of the hybrid and electric vehicle market by 2010, and 36% by 2015 (http://www.greencarcongress.com). LiFePO4 suffers from low intrinsic rate capability, which has been ascribed to the low electronic conductivity (10-9 S cm-1). One of the most promising approaches to overcome this problem is the addition of conductive carbon. Co-synthesis methods are generally the most practical route for carbon coating particles. At the relatively low temperatures (4, however, only poorly conductive disordered carbons are produced from organic precursors. Thus, the carbon content has to be high to produce the desired enhancement in rate capability, which decreases the cathode energy density

  18. Trading forest carbon - OSU

    Science.gov (United States)

    Issues associate with trading carbon sequestered in forests are discussed. Scientific uncertainties associated with carbon measurement are discussed with respect to proposed accounting procedures. Major issues include: (1) Establishing baselines. (2) Determining additivity from f...

  19. Soil Organic Carbon Stock

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Soil organic carbon (SOC) is the carbon held within soil organic constituents (i.e., products produced as dead plants and animals decompose and the soil microbial...

  20. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Education / Safety Education Centers En Español Carbon Monoxide Information Center The Invisible Killer Carbon monoxide, also known ... Install one and check its batteries regularly. View Information About CO Alarms Other CO Topics Safety Tips ...

  1. Biomass Carbon Stock

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Biomass carbon includes carbon stored in above- and below-ground live plant components (such as leaf, branch, stem and root) as well as in standing and down dead...

  2. Carbon Monoxide Safety

    Science.gov (United States)

    ... with the Media Fire Protection Technology Carbon monoxide safety outreach materials Help inform residents in your community ... KB | Spanish PDF 645 KB Handout: carbon monoxide safety Download this handout and add your organization's logo ...

  3. Calcium carbonate overdose

    Science.gov (United States)

    Tums overdose; Calcium overdose ... Calcium carbonate can be dangerous in large amounts. ... Some products that contain calcium carbonate are certain: ... and mineral supplements Other products may also contain calcium ...

  4. Potassium carbonate poisoning

    Science.gov (United States)

    Potassium carbonate is a white powder used to make soap, glass, and other items. This article discusses poisoning from swallowing or breathing in potassium carbonate. This article is for information only. Do ...

  5. Carbon nanotube nanoelectrode arrays

    Science.gov (United States)

    Ren, Zhifeng; Lin, Yuehe; Yantasee, Wassana; Liu, Guodong; Lu, Fang; Tu, Yi

    2008-11-18

    The present invention relates to microelectode arrays (MEAs), and more particularly to carbon nanotube nanoelectrode arrays (CNT-NEAs) for chemical and biological sensing, and methods of use. A nanoelectrode array includes a carbon nanotube material comprising an array of substantially linear carbon nanotubes each having a proximal end and a distal end, the proximal end of the carbon nanotubes are attached to a catalyst substrate material so as to form the array with a pre-determined site density, wherein the carbon nanotubes are aligned with respect to one another within the array; an electrically insulating layer on the surface of the carbon nanotube material, whereby the distal end of the carbon nanotubes extend beyond the electrically insulating layer; a second adhesive electrically insulating layer on the surface of the electrically insulating layer, whereby the distal end of the carbon nanotubes extend beyond the second adhesive electrically insulating layer; and a metal wire attached to the catalyst substrate material.

  6. Discovery of indole inhibitors of chemokine receptor 9 (CCR9).

    Science.gov (United States)

    Pandya, Bhaumik A; Baber, Christian; Chan, Audrey; Chamberlain, Brian; Chandonnet, Haoqun; Goss, Jennifer; Hopper, Timothy; Lippa, Blaise; Poutsiaka, Katherine; Romero, Jan; Stucka, Sabrina; Varoglu, Mustafa; Zhang, Jing; Zhang, Xin

    2016-07-15

    Irritable bowel diseases (IBD) such as Crohn's disease (CD) and ulcerative colitis (UC) are serious chronic diseases affecting millions of patients worldwide. Studies of human chemokine biology has suggested C-C chemokine receptor 9 (CCR9) may be a key mediator of pro-inflammatory signaling. Discovery of agents that inhibit CCR9 may lead to new therapies for CD and UC patients. Herein we describe the evolution of a high content screening hit (1) into potent inhibitors of CCR9, such as azaindole 12. PMID:27256913

  7. Metal filled porous carbon

    Science.gov (United States)

    Gross, Adam F.; Vajo, John J.; Cumberland, Robert W.; Liu, Ping; Salguero, Tina T.

    2011-03-22

    A porous carbon scaffold with a surface and pores, the porous carbon scaffold containing a primary metal and a secondary metal, where the primary metal is a metal that does not wet the surface of the pores of the carbon scaffold but wets the surface of the secondary metal, and the secondary metal is interspersed between the surface of the pores of the carbon scaffold and the primary metal.

  8. Studies on the sublimation of tungsten single crystal (110) face and the influence of carbon

    International Nuclear Information System (INIS)

    Evaporation of tungsten single crystals face (110) is studied in ultrahigh vacuum (better than 1x10-9 torr) by Langmuir method. Small admixtures of carbon are shown to markedly influence the process. Carbon hinders the evaporation and increases the sublimation energy by 25 kcal. The data obtained show that the reported parametres of tungsten evaporation refer to a carbon-containing material

  9. Protolytic carbon film technology

    Energy Technology Data Exchange (ETDEWEB)

    Renschler, C.L.; White, C.A.

    1996-04-01

    This paper presents a technique for the deposition of polyacrylonitrile (PAN) on virtually any surface allowing carbon film formation with only the caveat that the substrate must withstand carbonization temperatures of at least 600 degrees centigrade. The influence of processing conditions upon the structure and properties of the carbonized film is discussed. Electrical conductivity, microstructure, and morphology control are also described.

  10. Carbon nanotube quantum dots

    NARCIS (Netherlands)

    Sapmaz, S.

    2006-01-01

    Low temperature electron transport measurements on individual single wall carbon nanotubes are described in this thesis. Carbon nanotubes are small hollow cylinders made entirely out of carbon atoms. At low temperatures (below ~10 K) finite length nanotubes form quantum dots. Because of its small si

  11. Carbon Goes To…

    Science.gov (United States)

    Savasci, Funda

    2014-01-01

    The purposes of this activity are to help middle school students understand the carbon cycle and realize how human activities affect the carbon cycle. This activity consists of two parts. The first part of the activity focuses on the carbon cycle, especially before the Industrial Revolution, while the second part of the activity focuses on how…

  12. Chapter 4: Geological Carbon Sequestration

    Energy Technology Data Exchange (ETDEWEB)

    Friedmann, J; Herzog, H

    2006-06-14

    Carbon sequestration is the long term isolation of carbon dioxide from the atmosphere through physical, chemical, biological, or engineered processes. The largest potential reservoirs for storing carbon are the deep oceans and geological reservoirs in the earth's upper crust. This chapter focuses on geological sequestration because it appears to be the most promising large-scale approach for the 2050 timeframe. It does not discuss ocean or terrestrial sequestration. In order to achieve substantial GHG reductions, geological storage needs to be deployed at a large scale. For example, 1 Gt C/yr (3.6 Gt CO{sub 2}/yr) abatement, requires carbon capture and storage (CCS) from 600 large pulverized coal plants ({approx}1000 MW each) or 3600 injection projects at the scale of Statoil's Sleipner project. At present, global carbon emissions from coal approximate 2.5 Gt C. However, given reasonable economic and demand growth projections in a business-as-usual context, global coal emissions could account for 9 Gt C. These volumes highlight the need to develop rapidly an understanding of typical crustal response to such large projects, and the magnitude of the effort prompts certain concerns regarding implementation, efficiency, and risk of the enterprise. The key questions of subsurface engineering and surface safety associated with carbon sequestration are: (1) Subsurface issues: (a) Is there enough capacity to store CO{sub 2} where needed? (b) Do we understand storage mechanisms well enough? (c) Could we establish a process to certify injection sites with our current level of understanding? (d) Once injected, can we monitor and verify the movement of subsurface CO{sub 2}? (2) Near surface issues: (a) How might the siting of new coal plants be influenced by the distribution of storage sites? (b) What is the probability of CO{sub 2} escaping from injection sites? What are the attendant risks? Can we detect leakage if it occurs? (3) Will surface leakage negate or

  13. Carbon/Carbon Pistons for Internal Combustion Engines

    Science.gov (United States)

    Taylor, A. H.

    1986-01-01

    Carbon/carbon piston performs same function as aluminum pistons in reciprocating internal combustion engines while reducing weight and increasing mechanical and thermal efficiencies of engine. Carbon/carbon piston concept features low piston-to-cylinder wall clearance - so low piston rings and skirts unnecessary. Advantages possible by negligible coefficient of thermal expansion of carbon/carbon.

  14. Synthesis of N-Doped meso-macroporous carbon and its application to SO2 absorption

    Science.gov (United States)

    Liu, Chao; Zhang, Lei; Hu, Yongqi; Chen, Aibing; Wang, Xiaojing

    2014-12-01

    N-Doped meso-macroporous carbon materials were synthesized using melamine-formaldehyde resin as carbon precursor and silica spheres as a removable template. The as-synthesized carbon materials with a bimodal pores structure (about 3.9 and ˜50-200 nm) display a high surface nitrogen content of 30 wt %. The macropores of carbon materials can be modulated by changing the diameter of template. The SO2 adsorption experiments demonstrate a high adsorption capacity of 78.6 mg g-1 and a considerable stability even over 9 cycles for the carbon materials.

  15. 12 CFR 9.9 - Audit of fiduciary activities.

    Science.gov (United States)

    2010-01-01

    ... calendar year, a national bank shall arrange for a suitable audit (by internal or external auditors) of all... discrete audit (by internal or external auditors) of each significant fiduciary activity (i.e., on an... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Audit of fiduciary activities. 9.9 Section...

  16. Systemic effects of geoengineering by terrestrial carbon dioxide removal on carbon related planetary boundaries

    Science.gov (United States)

    Heck, Vera; Donges, Jonathan; Lucht, Wolfgang

    2015-04-01

    The planetary boundaries framework as proposed by Rockström et al. (2009) provides guidelines for ecological boundaries, the transgression of which is likely to result in a shift of Earth system functioning away from the relatively stable Holocene state. As the climate change boundary is already close to be transgressed, several geoengineering (GE) methods are discussed, aiming at a reduction of atmospheric carbon concentrations to control the Earth's energy balance. One of the proposed GE methods is carbon extraction from the atmosphere via biological carbon sequestration. In case mitigation efforts fail to substantially reduce greenhouse gas emissions, this form of GE could act as potential measure to reduce atmospheric carbon dioxide concentrations. We here study the possible influences of human interactions in the Earth system on carbon related planetary boundaries in the form of geoengineering (terrestrial carbon dioxide removal). We use a conceptual model specifically designed to investigate fundamental carbon feedbacks between land, ocean and atmosphere (Anderies et al., 2013) and modify it to include an additional geoengineering component. With that we analyze the existence and stability of a safe operating space for humanity, which is here conceptualized in three of the 9 proposed dimensions, namely climate change, ocean acidification and land-use. References: J. M. Anderies et al., The topology of non-linear global carbon dynamics: from tipping points to planetary boundaries. Environ. Res. Lett., 8(4):044048 (2013) J. Rockström et al., A safe operating space for humanity. Nature 461 (7263), 472-475 (2009)

  17. Carbon-14 waste management

    International Nuclear Information System (INIS)

    Carbon-14 occurs in nature, but is also formed in nuclear reactors. Because of its long half-life and the biological significance of carbon, releases from nuclear facilities could have a significant radiological impact. Waste management strategies for carbon-14 are therefore of current concern. Carbon-14 is present in a variety of waste streams both at reactors and at reprocessing plants. A reliable picture of the production and release of carbon-14 from various reactor systems has been built up for the purposes of this study. A possible management strategy for carbon-14 might be the reduction of nitrogen impurity levels in core materials, since the activation of 14N is usually the dominant source of carbon-14. The key problem in carbon-14 management is its retention of off-gas streams, particularly in the dissolver off-gas stream at reprocessing plants. Three alternative trapping processes that convert carbon dioxide into insoluble carbonates have been suggested. The results show that none of the options considered need be rejected on the grounds of potential radiation doses to individuals. All exposures should be as low as reasonably achievable, economic and social factors being taken into account. If, on these grounds, retention and disposal of carbon-14 is found to be beneficial, then, subject to the limitations noted, appropriate retention, immobilization and disposal technologies have been identified

  18. Spatial dynamics of carbon storage: a case study from Turkey.

    Science.gov (United States)

    Sivrikaya, Fatih; Baskent, Emin Zeki; Bozali, Nuri

    2013-11-01

    Forest ecosystems have an important role in carbon cycle at both regional and global scales as an important carbon sink. Forest degradation and land cover changes, caused by deforestation and conversion to non-forest area, have a strong impact on carbon storage. The carbon storage of forest biomass and its changes over time in the Hartlap planning unit of the southeastern part of Turkey have been estimated using the biomass expansion factor method based on field measurements of forests plots with forest inventory data between 1991 and 2002. The amount of carbon storage associated with land use and land cover changes were also analyzed. The results showed that the total forested area of the Hartlap planning unit slightly increased by 2.1%, from 27,978.7 ha to 28,282.6 ha during the 11-year period, and carbon storage increased by 9.6%, from 390,367.6 to 427,826.9 tons. Carbon storage of conifer and mixed forests accounted for about 70.6% of carbon storage in 1991, and 67.8% in 2002 which increased by 14,274.6 tons. Land use change and increasing forest area have a strong influence on increasing biomass and carbon storage. PMID:23771281

  19. Characterization of Biochar from Switchgrass Carbonization

    Directory of Open Access Journals (Sweden)

    Samy Sadaka

    2014-01-01

    Full Text Available Switchgrass is a high yielding, low-input intensive, native perennial grass that has been promoted as a major second-generation bioenergy crop. Raw switchgrass is not a readily acceptable feedstock in existing power plants that were built to accommodate coal and peat. The objective of this research was to elucidate some of the characteristics of switchgrass biochar produced via carbonization and to explore its potential use as a solid fuel. Samples were carbonized in a batch reactor under reactor temperatures of 300, 350 and 400 °C for 1, 2 and 3 h residence times. Biochar mass yield and volatile solids decreased from 82.6% to 35.2% and from 72.1% to 43.9%, respectively, by increasing carbonization temperatures from 300 °C to 400 °C and residence times from 1 h to 3 h. Conversely, biochar heating value (HV and fixed carbon content increased from 17.6 MJ kg−1 to 21.9 MJ kg−1 and from 22.5% to 44.9%, respectively, under the same conditions. A biomass discoloration index (BDI was created to quantify changes in biochar colors as affected by the two tested parameters. The maximum BDI of 77% was achieved at a carbonization temperature of 400 °C and a residence time of 3 h. The use of this index could be expanded to quantify biochar characteristics as affected by thermochemical treatments. Carbonized biochar could be considered a high quality solid fuel based on its energy content.

  20. Accounting methods for carbon credits: Impacts on the minimum area of CDM forestry projects

    OpenAIRE

    Locatelli, Bruno; Pedroni, Lucio

    2004-01-01

    International audience The Ninth Conference of the Parties (COP-9) decided to adopt an accounting system based on expiring carbon credits to address the problem of non-permanent carbon storage in forests established under the Clean Development Mechanism (CDM). This article reviews and discusses carbon accounting methods that were under consideration before COP-9 and presents a model which calculates the minimum area that forest plantation projects should reach to be able to compensate CDM ...

  1. Photophysics of polymer-wrapped single-walled carbon nanotubes

    NARCIS (Netherlands)

    Gao, J; Loi, M.A.

    2010-01-01

    Single-walled carbon nanotubes (SWNTs) are successfully dispersed in two conjugated polymer poly(9,9-dioctylfluorenyl-2,7-diyl) (PFO) and poly[2-methoxy-5-(2’-ethyl-hexyloxy)-1,4-phenylene vinylene] (MEHPPV) solutions. Steady-state and time-resolved photoluminescence spectroscopy in the near-infrare

  2. Antihyperlipidemic therapies targeting PCSK9.

    Science.gov (United States)

    Weinreich, Michael; Frishman, William H

    2014-01-01

    Hyperlipidemia is a major cause of cardiovascular disease despite the availability of first-line cholesterol-lowering agents such as statins. A new therapeutic approach to lowering low-density lipoprotein-cholesterol (LDL-C) acts by blocking LDL-receptor degradation by serum proprotein convertase subtilisin kexin 9 (PCSK9). Human monoclonal antibodies that target PCSK9 and its interaction with the LDL receptor are now in clinical trials (REGN727/SAR23653, AMG145, and RN316). These agents are administered by either subcutaneous or intravenous routes, and have been shown to have major LDL-C and apolipoprotein B effects when combined with statins. A phase III clinical trial program evaluating clinical endpoints is now in progress. Other PCSK9-targeted approaches are in early stages of investigation, including natural inhibitors of PCSK9, RNA interference, and antisense inhibitors.

  3. Recent developments in carbon fibre composite

    Energy Technology Data Exchange (ETDEWEB)

    Matsui, J.; Norita, T.; Hirata, M.

    1985-12-01

    To fulfill requirements of carbon fiber composite for aircraft structures, intermediate modulus (295 GPa) and higher strength (5600 MPa) carbon fiber TORAYCA T800 was developed. T800 composite shows greatly improved composite properties dominated by fiber such as tensile modulus, compressive modulus, tensile strength without hole and with hole, and through-penetration impact load. There is no effect on transverse tensile strength, compressive strengths, and shear strength with increase of fiber properties. Status of matrix resin developments is also discussed in terms of improvements in transverse cracking and compressive strength after impact. 9 references.

  4. Carbon isotopes in mollusk shell carbonates

    Science.gov (United States)

    McConnaughey, Ted A.; Gillikin, David Paul

    2008-10-01

    Mollusk shells contain many isotopic clues about calcification physiology and environmental conditions at the time of shell formation. In this review, we use both published and unpublished data to discuss carbon isotopes in both bivalve and gastropod shell carbonates. Land snails construct their shells mainly from respired CO2, and shell δ13C reflects the local mix of C3 and C4 plants consumed. Shell δ13C is typically >10‰ heavier than diet, probably because respiratory gas exchange discards CO2, and retains the isotopically heavier HCO3 -. Respired CO2 contributes less to the shells of aquatic mollusks, because CO2/O2 ratios are usually higher in water than in air, leading to more replacement of respired CO2 by environmental CO2. Fluid exchange with the environment also brings additional dissolved inorganic carbon (DIC) into the calcification site. Shell δ13C is typically a few ‰ lower than ambient DIC, and often decreases with age. Shell δ13C retains clues about processes such as ecosystem metabolism and estuarine mixing. Ca2+ ATPase-based models of calcification physiology developed for corals and algae likely apply to mollusks, too, but lower pH and carbonic anhydrase at the calcification site probably suppress kinetic isotope effects. Carbon isotopes in biogenic carbonates are clearly complex, but cautious interpretation can provide a wealth of information, especially after vital effects are better understood.

  5. Global Uncertainty Accounting for Forest Carbon

    Science.gov (United States)

    Cooke, R. M.; Saatchi, S. S.; Hagen, S. C.

    2015-12-01

    Uncertainty in Global Forest Carbon There are 11.3 E9 global hectares of biologically productive surface, of which approximately 4E9 are forested. The terrestrial biosphere reservoir contains carbon in organic compounds in vegetation living biomass (450 to 650 PgC, IPCC AR5 ). Houghton et al (2009) give 385 - 650 GtC, of which 70 ~90% is forest. Using 80%, that gives a range of 360 ~ 520 (IPCC) or 308 ~ 520 (Houghton) GtC in Earth's forests. The IPCC values give a forest carbon global density range of 90 ~ 130 tC/ha. Assuming that 360 and 520 GtC are two independent samples from our uncertainty on the global forest carbon pool, we may ballpark this uncertainty as STD(global forest carbon pool) ~ [½(160)2 [GtC]2]½= 113 E9 [tC].If Xi,…XN have average variance s2 and average covariance c then VAR(SXi) = s2N + N(N-1)c, and: 1) 28.3 = s(2.5E-10 + r)½. where s is the root of the average variance of forest carbon in [t/ha], and r = c/s2 is the "global correlation". r is equal to the average correlation over all pairs of hectares if the variances per hectare are constant, but r £ 1 holds in any case. Uncertainty accounting.If r = 0, then (1) entails that s = 1.8 E6 tC, which is not defensible. Suppose an uncertainty requirement for carbon monitoring systems stipulates that the standard deviation per hectare should not exceed 10% of the mean. With a mean of 110 tC/ha, s = 11, and substitution in (1) would give r½ = 2.6, which is impossible. If r = 1, then s = 28.3 which is 26% of the mean. In this case it can be shown that the error in the estimate in any hectare is perfectly correlated with errors in every other hectare: removing the uncertainty in ONE hectare on the Earth would remove uncertainty in ALL hectares. Neither r = 0, r = 1 are reasonable. Uncertainty accounting requires consistent estimates of global forest carbon uncertainty, uncertainty in hectare-wise estimates and global correlation. Consistent estimates do not exist at present. This research charts

  6. Frontiers of graphene and carbon nanotubes devices and applications

    CERN Document Server

    2015-01-01

    This book focuses on carbon nanotubes and graphene as representatives of nano-carbon materials, and describes the growth of new technology and applications of new devices. As new devices and as new materials, nano-carbon materials are expected to be world pioneers that could not have been realized with conventional semiconductor materials, and as those that extend the limits of conventional semiconductor performance. This book introduces the latest achievements of nano-carbon devices, processes, and technology growth. It is anticipated that these studies will also be pioneers in the development of future research of nano-carbon devices and materials. This book consists of 18 chapters. Chapters 1 to 8 describe new device applications and new growth methods of graphene, and Chapters 9 to 18, those of carbon nanotubes. It is expected that by increasing the advantages and overcoming the weak points of nanocarbon materials, a new world that cannot be achieved with conventional materials will be greatly expanded. W...

  7. The Uncertain Carbon Emissions in China (Invited)

    Science.gov (United States)

    Liu, Z.; Guan, D.

    2013-12-01

    Anthropogenic fossil fuel emissions are considered as being well understood with a low uncertainty (9.1 × 0.5Gt C yr-1). By using full transparency emission inventory which the energy consumption, fuel heating values, carbon content and oxidation rate reported separately in sectoal level, here we found new 2.1 Gt C yr-1 (23% of global total) uncertainties of carbon emission inventory, which mainly contributed by the mass energy use and consumption coal quality in China and by misunderstanding of fuel quality in international fossil fuel trade. Increment of coal's carbon emission in China and India are equivalent to 130 % of global total coal's emission growth during 2008-2010, by using macro energy statistics and bottom up coal mine datasets, the difference carbon emission estimates from China and India can up to 1.32 C yr-1. Emissions from international trade of coal could produce another 0.08 Gt C yr-1 uncertainty. These new emerging 1.4 Gt C yr-1 uncertainties implies a significant mis-estimation of human induced carbon emissions and a new dominating factor in contributing the global carbon budget residual.

  8. Organic carbon biostimulates rapid rhizodegradation of perchlorate.

    Science.gov (United States)

    Yifru, Dawit D; Nzengung, Valentine A

    2008-12-01

    Previous hydroponics and field studies identified phytodegradation and rhizodegradation as the two main mechanisms by which plants metabolize perchlorate. Plant uptake and phytodegradation of perchlorate is a slower and undesired process that poses ecological risks resulting from phytoaccumulation of some fraction of the perchlorate. Meanwhile, rhizodegradation is a more rapid and favored process involving perchlorate-degrading bacteria utilizing dissolved organic carbon (DOC) as a carbon and energy (electron) source to rapidly degrade perchlorate to innocuous chloride. In the present study, rhizodegradation of perchlorate by willow trees (Salix nigra) was biostimulated using electron sources obtained from natural and artificial carbon sources. In bioreactors provided with carbon sources as 500 mg/L DOC, 25 to 40 mg/L of initial perchlorate concentrations were removed to below the ion chromatography method detection limit of 2 microg/L in approximately 9 d. For planted controls provided with no electron donors, the time required for the complete removal of the same doses of perchlorate was up to 70 d. Enhancement of rhizodegradation by organic carbon reduced the phytoaccumulated fraction of perchlorate by an order of magnitude from approximately 430 to 20 mg/kg. The implication of the present study is that the high fraction uptake and phytoaccumulation of perchlorate in agricultural products and the recycling of perchlorate into the ecosystem can be significantly curtailed by supplying electron donors derived from organic carbon sources to the root zone of plants. PMID:18593217

  9. Vegetation and soil carbon storage in China

    Institute of Scientific and Technical Information of China (English)

    LI; Kerang; WANG; Shaoqiang; CAO; Mingkui

    2004-01-01

    This study estimated the current vegetation and soil carbon storage in China using a biogeochemical model driven with climate, soil and vegetation data at 0.5°latitude-longitude grid spatial resolution. The results indicate that the total carbon storage in China's vegetation and soils was 13.33 Gt C and 82.65 Gt C respectively, about 3% and 4% of the global total. The nationally mean vegetation and soil carbon densities were 1.47 kg C/m2 and 9.17 kg C/m2, respectively, differing greatly in various regions affected by climate, vegetation, and soil types. They were generally higher in the warm and wet Southeast China and Southwest China than in the arid Northwest China; whereas vegetation carbon density was the highest in the warm Southeast China and Southwest China, soil carbon density was the highest in the cold Northeast China and southeastern fringe of the Qinghai-Tibetan Plateau. These spatial patterns are clearly correlated with variations in the climate that regulates plant growth and soil organic matter decomposition, and show that vegetation and soil carbon densities are controlled by different climatic factors.

  10. The Spreading Layer of GX 9+9

    CERN Document Server

    Vilhu, Osmi; Hannikainen, Diana; Schultz, Juho; Beckmann, Volker

    2007-01-01

    The spreading layer (SL) on neutron star surface of GX 9+9 during the upper banana state was studied using INTEGRAL and RXTE observations. The SL-area becomes larger with increasing accretion rate while the SL-temperature remains close to the critical Eddington value, confirming predictions by Inogamov and Sunyaev (1999) and Suleimanov and Poutanen (2006). However, at low accretion rate the observed temperature is higher and SL-belt shallower than those predicted, requiring confirmation and theoretical explananation.

  11. BDKRB2 GENE -9/+9 POLYMORPHISM AND SWIMMING PERFORMANCE

    OpenAIRE

    Grenda, A.; Leońska-Duniec, A.; Cięszczyk, P; P. Zmijewski

    2014-01-01

    The aim of the study was to evaluate the association between swimming performance and the -9/+9 (rs5810761) polymorphism within the BDKRB2 gene in successful competitive swimmers. Best individual swimming results expressed in FINA points achieved at short, middle and long distance events of 157 well-trained Polish swimmers were incorporated into an analysis. Athletes’ genotype and allele distributions were analysed in comparison to 230 unrelated sedentary subjects who served as controls with ...

  12. Carbon dioxide sensor

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, Prabir K. (Worthington, OH); Lee, Inhee (Columbus, OH); Akbar, Sheikh A. (Hilliard, OH)

    2011-11-15

    The present invention generally relates to carbon dioxide (CO.sub.2) sensors. In one embodiment, the present invention relates to a carbon dioxide (CO.sub.2) sensor that incorporates lithium phosphate (Li.sub.3PO.sub.4) as an electrolyte and sensing electrode comprising a combination of lithium carbonate (Li.sub.2CO.sub.3) and barium carbonate (BaCO.sub.3). In another embodiment, the present invention relates to a carbon dioxide (CO.sub.2) sensor has a reduced sensitivity to humidity due to a sensing electrode with a layered structure of lithium carbonate and barium carbonate. In still another embodiment, the present invention relates to a method of producing carbon dioxide (CO.sub.2) sensors having lithium phosphate (Li.sub.3PO.sub.4) as an electrolyte and sensing electrode comprising a combination of lithium carbonate (Li.sub.2CO.sub.3) and barium carbonate (BaCO.sub.3).

  13. Plumbing carbon nanotubes

    Science.gov (United States)

    Jin, Chuanhong; Suenaga, Kazu; Iijima, Sumio

    2008-01-01

    Since their discovery, the possibility of connecting carbon nanotubes together like water pipes has been an intriguing prospect for these hollow nanostructures. The serial joining of carbon nanotubes in a controlled manner offers a promising approach for the bottom-up engineering of nanotube structures-from simply increasing their aspect ratio to making integrated carbon nanotube devices. To date, however, there have been few reports of the joining of two different carbon nanotubes. Here we demonstrate that a Joule heating process, and associated electro-migration effects, can be used to connect two carbon nanotubes that have the same (or similar) diameters. More generally, with the assistance of a tungsten metal particle, this technique can be used to seamlessly join any two carbon nanotubes-regardless of their diameters-to form new nanotube structures.

  14. Progressing towards post-2012 carbon markets

    Energy Technology Data Exchange (ETDEWEB)

    Soeren Luetken, S.; Holm Olsen, K.

    2011-11-15

    Confronting the end of the first Kyoto Commitment period in 2012 with no agreed outcome for global cooperation on future emission reductions, there is an urgent need to look for new opportunities for public and private cooperation to drive broad-based progress in living standards and keep projected future warming below the politically agreed 2 degrees Celsius. Responding jointly to these global challenges the United Nations environmental Program (UNEP) and its UNEP Risoe Centre (URC) have in cooperation with the Global Green Growth Institute (GGGI) prepared the Perspectives 2011. The publication focuses on the role of carbon markets in contributing to low carbon development and new mechanisms for green growth, as one core area of action to address the challenges noted above. The publication explores in ten articles, how carbon markets at national, regional and global levels can be developed and up-scaled to sustain the involvement of the private sector in leveraging finance and innovative solutions to reduce greenhouse gas emissions. The titles of the ten articles are: 1) Fragmentation of international climate policy - doom or boom for carbon markets?; 2) Perspectives on the EU carbon market; 3) China carbon market; 4) The national context of U.S. state policies for a global commons problem; 5) Mind the gap - the state-of-play of Canadian greenhouse gas mitigation; 6) Role of the UN and multilateral policies in integrating an increasingly fragmented global carbon market; 7) Making CDM work for poor and rich Africa beyond 2012 - a series of dos and don'ts; 8) Voluntary market - future perspectives; 9) Sectoral approaches as a way forward for the carbon market?; 10) The Durban outcome - a post 2012 framework approach for green house gas markets. (LN)

  15. 2002 Rose Site 9P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 9P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 31, 1999. The site was originally...

  16. 1999 Rose Site 9P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 9P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 31, 1999. The site was originally...

  17. 2004 Rose Site 9P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 9P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 31, 1999. The site was originally...

  18. 2012 Rose Site 9P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 9P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 31, 1999. The site was originally...

  19. 2006 Rose Site 9P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 9P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 31, 1999. The site was originally...

  20. Region 9 NPL Sites - 2014

    Data.gov (United States)

    U.S. Environmental Protection Agency — NPL site point locations for the US EPA Region 9. NPL (National Priorities List) sites are hazardous waste sites that are eligible for extensive long-term cleanup...

  1. Potential Carbon Negative Commercial Aviation through Land Management

    Science.gov (United States)

    Hendricks, Robert C.

    2008-01-01

    Brazilian terra preta soil and char-enhanced soil agricultural systems have demonstrated both enhanced plant biomass and crop yield and functions as a carbon sink. Similar carbon sinking has been demonstrated for both glycophyte and halophyte plants and plant roots. Within the assumption of 3.7 t-C/ha/yr soils and plant root carbon sinking, it is possible to provide carbon neutral U.S. commercial aviation using about 8.5% of U.S. arable lands. The total airline CO2 release would be offset by carbon credits for properly managed soils and plant rooting, becoming carbon neutral for carbon sequestered synjet processing. If these lands were also used to produce biomass fuel crops such as soybeans at an increased yield of 60 bu/acre (225gal/ha), they would provide over 3.15 10(exp 9) gallons biodiesel fuel. If all this fuel were refined into biojet it would provide a 16% biojet-84% synjet blend. This allows the U.S. aviation industry to become carbon negative (carbon negative commercial aviation through carbon credits). Arid land recovery could yield even greater benefits.

  2. Reinforcing economic incentives for carbon credits for forests

    Energy Technology Data Exchange (ETDEWEB)

    Cairns, R.D. [McGill Univ., Montreal, PQ (Canada); Lasserre, P. [Quebec Univ., Montreal, PQ (Canada)

    2004-03-01

    Some countries can potentially meet their Kyoto Protocol commitments through afforestation. Since trees absorb a quantity of carbon which is proportional to the growth of their biomass, increasing forest areas could be a method to reduce atmospheric carbon dioxide (CO{sub 2}), a greenhouse gas. This paper suggests that countries which increase their forest base or improve their forestry practices should receive carbon credits under the Kyoto Protocol. Credits for carbon sequestration can be discerned and evaluated through markets for emissions permits. This paper also outlines the challenge facing the strategy of carbon credits for forests. Forests are at risk of destruction by forest fires or deterioration due to pests. These events could release substantial quantities of carbon at irregular intervals. The efficiency of carbon credits for forests can be improved through permits markets, the use of green accounting, and insurance markets for sudden emissions. This report presents algorithms which demonstrate the value of fixing carbon. It also outlines a carbon credit implementation scheme which can help mitigate the greenhouse effect. It was emphasized that an afforestation policy would be more effective with economic instruments such as carbon taxes or tradeable emissions permits. 9 refs.

  3. Nanographene reinforced carbon/carbon composites

    Science.gov (United States)

    Bansal, Dhruv

    Carbon/Carbon Composites (CCC) are made of carbon reinforcement in carbon matrix and have high thermal stability and fatigue resistance. CCC are used in nose cones, heat shields and disc brakes of aircrafts due to their exceptional mechanical properties at high temperature. The manufacturing process of CCC involves a carbonization stage in which unwanted elements, except carbon, are eliminated from the polymer precursor. Carbonization results in the formation of voids and cracks due to the thermal mismatch between the reinforcement and the matrix and expulsion of volatiles from the polymer matrix. Thermal cracks and voids decrease the density and mechanical properties of the manufactured CCC. In this work, Nanographene Platelets (NGP) were explored as nanofillers to fill the voids/cracks and reduce thermal shrinkage in CCC. They were first compared with Vapor Grown Carbon Nanofibers (VGCNF) by dispersion of different concentrations (0.5wt%, 1.5wt%, 3wt%) in resole-type phenolic resin and were characterized to explore their effect on rheology, heat of reaction and wetting behavior. The dispersions were then cured to form nanocomposites and were characterized for morphology, flexure and thermal properties. Finally, NGP were introduced into the carbon/carboncomposites in two stages, first by spraying in different concentrations (0.5wt%, 1.5wt%, 3wt%, 5wt %) during the prepreg formation and later during densification by directly mixing in the corresponding densification mix. The manufactured NGP reinforced CCC were characterized for microstructure, porosity, bulk density and mechanical properties (Flexure and ILSS) which were further cross-checked by non-destructive techniques (vibration and ultrasonic). In this study, it was further found that at low concentration (≤ 1.5 wt%) NGP were more effective in increasing the heat of reaction and in decreasing the viscosity of the phenolic resin. The decrease in viscosity led to better wetting properties of NGP / phenolic

  4. Life Cycle Analysis of Carbon Flow and Carbon Footprint of Harvested Wood Products of Larix principis-rupprechtii in China

    Directory of Open Access Journals (Sweden)

    Fei Lun

    2016-03-01

    Full Text Available Larix principis-rupprechtii is a native tree species in North China with a large distribution; and its harvested timbers can be used for producing wood products. This study focused on estimating and comparing carbon flows and carbon footprints of different harvested wood products (HWPs from Larix principis-ruppechtii based on the life cycle analysis (from seedling cultivation to HWP final disposal. Based on our interviews and surveys, the system boundary in this study was divided into three processes: the forestry process, the manufacturing process, and the use and disposal process. By tracking carbon flows of HWPs along the entire life cycle, we found that, for one forest rotation period, a total of 26.81 tC/ha sequestered carbon was transferred into these HWPs, 66.2% of which were still stored in the HWP when the rotation period had ended; however, the HWP carbon storage decreased to 0.25 tC/ha (only 0.9% left in the 100th year after forest plantation. The manufacturing process contributed more than 90% of the total HWP carbon footprint, but it was still smaller than the HWP carbon storage. In terms of the carbon storage and the carbon footprint, construction products had the largest net positive carbon balance compared to furniture and panel products. In addition, HWP are known to have a positive impact on global carbon mitigation because they can store parts of the sequestered carbon for a certain period of time and they have a substitution effect on carbon mitigation. Furthermore, there still exist great opportunities for carbon mitigation from HWPs through the use of cleaner energy and increasing the utilization efficiency of wood fuel.

  5. Hexagonal silicon nanotube confined inside a carbon nanotube: A first-principles study

    Science.gov (United States)

    Zhu, Weijuan; Yan, Xiaohong; Xiao, Yang

    2008-02-01

    We studied the stability, geometrical structures and electronic energy band of hexagonal silicon nanotube (SiNT) confined inside carbon nanotubes based on first-principle calculations. The results show that the encapsulating process of SiNT is exothermic in ( 9,9) carbon nanotube while endothermic in ( 8,8) and ( 7,7) carbon nanotubes. When the SiNT is inserted into ( 9,9) carbon nanotube, the insertion energy is about 0.09 eV. Energy band of SiNT@( 9,9) nanotube is not distorted greatly compared with the superposition of bands of isolated SiNT and ( 9,9) carbon nanotube. Especially, a parabolic band occurs near the Fermi level of energy band in SiNT@( 7,7) nanotube. Such a band could be a nearly free electronic state originating from carbon nanotube. Moreover, we discuss the variation of total energy as the SiNT rotates around its axis inside carbon nanotubes.

  6. Physics of carbon nanostructures

    International Nuclear Information System (INIS)

    Carbon is a prominent element that appears in various structures with new promising technological applications. The physics of carbon nanostructures is one of the hot topics in modern condensed matter theory. I plan to present a brief introduction into the theory of variously shaped carbon nanostructures paying special attention to generic field-theory models. The preliminary plan is the following: (1) a brief historical excursus, (2) the most interesting experimental observations, (3) generic models for the description of electronic states in carbon nanoparticles (Dirac-type equations, defects, geometry, etc.), (4) open problems. (author)

  7. Carbon Monoxide Toxicity

    Science.gov (United States)

    Aniol, Michael J.

    1992-01-01

    Of all fatal poisonings in the United States, an estimated half are due to carbon monoxide. The number of non-lethal poisonings due to carbon monoxide is difficult to estimate because signs and symptoms of carbon monoxide poisoning cover a wide spectrum and mimic other disorders. Misdiagnosis is serious, as the patient often returns to the contaminated environment. Those not receiving proper treatment are at significant risk, as high as 10% to 12%, of developing late neurological sequelae. The diagnosis of carbon monoxide poisoning depends upon precise history taking, careful physical examination, and a high index of suspicion. ImagesFigure 2 PMID:21221282

  8. Nanoindentation of Carbon Nanostructures.

    Science.gov (United States)

    Kumar, Dinesh; Singh, Karamjit; Verma, Veena; Bhatti, H S

    2016-06-01

    In the present research paper carbon nanostructures viz. single walled carbon nanotubes, multi-walled carbon nanotubes, single walled carbon nanohorns and graphene nanoplatelets have been synthesized by CVD technique, hydrothermal method, DC arc discharge method in liquid nitrogen and microwave technique respectively. After synthesis 5 mm thick pallets of given nanomaterial are prepared by making a paste in isopropyl alcohol and using polyvinylidene difluoride as a binder and then these pallets were used for nanoindentation measurements. Hardness, reduced modulus, stiffness, contact height and contact area have been measured using nanoindenter. PMID:27427726

  9. Big Sky Carbon Sequestration Partnership

    Energy Technology Data Exchange (ETDEWEB)

    Susan Capalbo

    2005-12-31

    The Big Sky Carbon Sequestration Partnership, led by Montana State University, is comprised of research institutions, public entities and private sectors organizations, and the Confederated Salish and Kootenai Tribes and the Nez Perce Tribe. Efforts under this Partnership in Phase I are organized into four areas: (1) Evaluation of sources and carbon sequestration sinks that will be used to determine the location of pilot demonstrations in Phase II; (2) Development of GIS-based reporting framework that links with national networks; (3) Design of an integrated suite of monitoring, measuring, and verification technologies, market-based opportunities for carbon management, and an economic/risk assessment framework; (referred to below as the Advanced Concepts component of the Phase I efforts) and (4) Initiation of a comprehensive education and outreach program. As a result of the Phase I activities, the groundwork is in place to provide an assessment of storage capabilities for CO{sub 2} utilizing the resources found in the Partnership region (both geological and terrestrial sinks), that complements the ongoing DOE research agenda in Carbon Sequestration. The geology of the Big Sky Carbon Sequestration Partnership Region is favorable for the potential sequestration of enormous volume of CO{sub 2}. The United States Geological Survey (USGS 1995) identified 10 geologic provinces and 111 plays in the region. These provinces and plays include both sedimentary rock types characteristic of oil, gas, and coal productions as well as large areas of mafic volcanic rocks. Of the 10 provinces and 111 plays, 1 province and 4 plays are located within Idaho. The remaining 9 provinces and 107 plays are dominated by sedimentary rocks and located in the states of Montana and Wyoming. The potential sequestration capacity of the 9 sedimentary provinces within the region ranges from 25,000 to almost 900,000 million metric tons of CO{sub 2}. Overall every sedimentary formation investigated

  10. Brain MRI findings of carbon disulfide poisoning

    International Nuclear Information System (INIS)

    To evaluate the findings of brain MRI in patients with carbon disulfide poisoning. Ninety-one patients who had suffered carbon disulfide poisoning [male:female=87:4; age, 32-74 (mean 53.3) years] were included in this study. To determine the extent of white matter hyperintensity (Grade 0-V) and lacunar infarction, T2-weighted MR imaging of the brain was performed. T2-weighted images depicted white matter hyperintensity in 70 patients (76.9%) and lacunar infarcts in 27 (29.7%). In these patients, the prevalent findings at T2-weighted MR imaging of the brain were white matter hyperintensity and lacunar infarcts. Disturbance of the cardiovascular system by carbon disulfide might account for these results

  11. Double layer capacitance of carbon foam electrodes

    Science.gov (United States)

    Delnick, F. M.; Ingersoll, D.; Firsich, D.

    We have evaluated a wide variety of microcellular carbon foams prepared by the controlled pyrolysis and carbonization of several polymers including: polyacrylonitrile (PAN), polymethacrylonitrile (PMAN), resorcinol/formaldehyde (RF), divinylbenzene/methacrylonitrile (DVB), phenolics (furfuryl/alcohol), and cellulose polymers such as Rayon. The porosity may be established by several processes including: gelation (1-5), phase separation (1-3,5-8), emulsion (1,9,10), aerogel/xerogel formation (1,11,12,13), replication (14), and activation. In this report we present the complex impedance analysis and double layer charging characteristics of electrodes prepared from one of these materials for double layer capacitor applications, namely activated cellulose derived microcellular carbon foam.

  12. Maximally aligned states in sup 9 sup 9 Ag

    CERN Document Server

    Sohler, D; Bednarczyk, P; Blomqvist, J M; Cederkäll, J; De Angelis, G; De Poli, M; Dombrádi, Z; Fahlander, C; Foltescu, D; Grawe, H; Huijnen, J; Jerrestam, D; Johnson, A; Juutinen, S; Klamra, W; Kownacki, J P; Kérek, A; Likar, A; Lipoglavsek, M; Maekelae, E; Norlin, L O; Nyberg, J; Palacz, M; Persson, J; Roth, H A; Seweryniak, D; Shizuma, T; Skeppstedt, Ö; Sletten, G; Timar, J; Toermaenen, S; Weiszflog, M

    2003-01-01

    Excited states of sup 9 sup 9 Ag were populated via the sup 5 sup 0 Cr+ sup 5 sup 8 Ni (261 MeV) reaction using the NORDBALL detector array equipped with charged-particle and neutron detector systems for reaction channel separation. On the basis of the measured gamma gamma-coincidence relations and angular distribution ratios a significantly extended level scheme has been constructed up to E sub x propor to 7.8 MeV and I=35/2. The experimental results were described within the framework of the shell model. Candidates for states fully aligned in the pi g sub 9 sub / sub 2 sup - sup 3 nu(d sub 5 sub / sub 2 , g sub 7 sub / sub 2) sup 2 valence configuration space were found at 4109 and 6265 keV. (orig.)

  13. The synthesis of mono- and diacetyl-9H-fluorenes. Reactivity and selectivity in the Lewis acid catalyzed Friedel-Crafts acetylation of 9H-fluorene

    DEFF Research Database (Denmark)

    Titinchi, Salam J.J.; Kamounah, Fadhil S.; Abbo, Hanna S.;

    2008-01-01

    Friedel-Crafts acetylation of 9H-fluorene is an effective route for the preparation of mono- and diacetyl-9H-fluorenes. Using acetylchloride as the reagent and aluminum chloride as the Lewis acid catalyst the effect of the solvent polarity, the temperature, the reaction time and the mode of......-fluorene was obtained in 5-11 % yield when carbon disulfide was used as the solvent. Acetylation of 9H-fluorene in dichloroethane and carbon disulfide, using an excess of acetyl chloride and aluminum chloride at reflux temperature, gives 2,7-diacetyl-9H-fluorene exclusively in high yields (> 97%). Attempts to...

  14. Microbially mediated mineral carbonation

    Science.gov (United States)

    Power, I. M.; Wilson, S. A.; Dipple, G. M.; Southam, G.

    2010-12-01

    Mineral carbonation involves silicate dissolution and carbonate precipitation, which are both natural processes that microorganisms are able to mediate in near surface environments (Ferris et al., 1994; Eq. 1). (Ca,Mg)SiO3 + 2H2CO3 + H2O → (Ca,Mg)CO3 + H2O + H4SiO4 + O2 (1) Cyanobacteria are photoautotrophs with cell surface characteristics and metabolic processes involving inorganic carbon that can induce carbonate precipitation. This occurs partly by concentrating cations within their net-negative cell envelope and through the alkalinization of their microenvironment (Thompson & Ferris, 1990). Regions with mafic and ultramafic bedrock, such as near Atlin, British Columbia, Canada, represent the best potential sources of feedstocks for mineral carbonation. The hydromagnesite playas near Atlin are a natural biogeochemical model for the carbonation of magnesium silicate minerals (Power et al., 2009). Field-based studies at Atlin and corroborating laboratory experiments demonstrate the ability of a microbial consortium dominated by filamentous cyanobacteria to induce the precipitation of carbonate minerals. Phototrophic microbes, such as cyanobacteria, have been proposed as a means for producing biodiesel and other value added products because of their efficiency as solar collectors and low requirement for valuable, cultivable land in comparison to crops (Dismukes et al., 2008). Carbonate precipitation and biomass production could be facilitated using specifically designed ponds to collect waters rich in dissolved cations (e.g., Mg2+ and Ca2+), which would allow for evapoconcentration and provide an appropriate environment for growth of cyanobacteria. Microbially mediated carbonate precipitation does not require large quantities of energy or chemicals needed for industrial systems that have been proposed for rapid carbon capture and storage via mineral carbonation (e.g., Lackner et al., 1995). Therefore, this biogeochemical approach may represent a readily

  15. Novel carbon nanostructures

    International Nuclear Information System (INIS)

    The discovery of carbon nanotubes in 1991 opened up a challenging new area of research, because they are expected to be ideal building blocks for nanoscale applications due to their extraordinary mechanical and electronic properties. Various production methods have been developed, however precise control of nanotube morphology (e.g. length, diameter) has yet to be realised, a fact which has delayed industrial exploitation. Thus a comprehensive understanding of nanotube growth is essential, and this thesis is concerned with this important problem, i.e. the controlled production of novel carbon nanomaterials. Chapter 1 surveys production methods for fullerenes, carbon nanotubes and other carbon-based materials, such as fibres, particles etc. The sophisticated tools required for this work, e.g. high resolution transmission electron microscopy (HRTEM), high resolution electron energy loss spectroscopy (HREELS), etc. are reviewed in Chapter 2. Chapter 3 describes a novel approach to carbon nanotubes, using laser etching techniques, which generates aligned tubes of uniform diameter and length. The mode of catalyst preparation, as well as the nature of the precursor, play crucial roles in this process. The preparation of modified carbon nanotubes by the pyrolysis of metallocene, e.g. ferrocene in conjunction with various hydrocarbons, is discussed in Chapter 4. Superconducting interference device measurements (SQUID) show that Fe-filled carbon nanotubes exhibit enhanced coercivities in the 430-1070 Oe range, i.e. greater than those reported for Ni and Co nanowires. Carbon nanotubes can be also modified by replacing atoms of the carbon network with nitrogen, boron or both. The creation of large arrays of nitrogen-doped carbon nanotubes, for example CNx nanofibres, as well as the formation of BxCyNz onions is described in Chapter 5. Electron irradiation of these onions generates pure carbon onions. Finally (Chapter 6), the catalytic behaviour of metal particles in different

  16. Mineral Carbonation Employing Ultramafic Mine Waste

    Science.gov (United States)

    Southam, G.; McCutcheon, J.; Power, I. M.; Harrison, A. L.; Wilson, S. A.; Dipple, G. M.

    2014-12-01

    Carbonate minerals are an important, stable carbon sink being investigated as a strategy to sequester CO2 produced by human activity. A natural playa (Atlin, BC, CAN) that has demonstrated the ability to microbially-accelerate hydromagnesite formation was used as an experimental model. Growth of microbial mats from Atlin, in a 10 m long flow-through bioreactor catalysed hydromagnesite precipitation under 'natural' conditions. To enhance mineral carbonation, chrysotile from the Clinton Creek Asbestos Mine (YT, CAN) was used as a target substrate for sulphuric acid leaching, releasing as much as 94% of the magnesium into solution via chemical weathering. This magnesium-rich 'feedstock' was used to examine the ability of the microbialites to enhance carbonate mineral precipitation using only atmospheric CO2 as the carbon source. The phototrophic consortium catalysed the precipitation of platy hydromagnesite [Mg5(CO3)4(OH)2·4H2O] accompanied by magnesite [MgCO3], aragonite [CaCO3], and minor dypingite [Mg5(CO3)4(OH)2·5H2O]. Scanning Electron Microscopy-Energy Dispersive Spectroscopy indicated that cell exteriors and extracellular polymeric substances (EPS) served as nucleation sites for carbonate precipitation. In many cases, entire cyanobacteria filaments were entombed in magnesium carbonate coatings, which appeared to contain a framework of EPS. Cell coatings were composed of small crystals, which intuitively resulted from rapid crystal nucleation. Excess nutrient addition generated eutrophic conditions in the bioreactor, resulting in the growth of a pellicle that sealed the bioreactor contents from the atmosphere. The resulting anaerobic conditions induced fermentation and subsequent acid generation, which in turn caused a drop in pH to circumneutral values and a reduction in carbonate precipitation. Monitoring of the water chemistry conditions indicated that a high pH (> 9.4), and relatively high concentrations of magnesium (> 3000 ppm), compared with the natural

  17. Biodegradation of carbon nanohorns in macrophage cells

    Science.gov (United States)

    Zhang, Minfang; Yang, Mei; Bussy, Cyrill; Iijima, Sumio; Kostarelos, Kostas; Yudasaka, Masako

    2015-02-01

    With the rapid developments in the medical applications of carbon nanomaterials such as carbon nanohorns (CNHs), carbon nanotubes, and graphene based nanomaterials, understanding the long-term fate, health impact, excretion, and degradation of these materials has become crucial. Herein, the in vitro biodegradation of CNHs was determined using a non-cellular enzymatic oxidation method and two types of macrophage cell lines. Approximately 60% of the CNHs was degraded within 24 h in a phosphate buffer solution containing myeloperoxidase. Furthermore, approximately 30% of the CNHs was degraded by both RAW 264.7 and THP-1 macrophage cells within 9 days. Inflammation markers such as pro-inflammatory cytokines interleukin 6 and tumor necrosis factor α were not induced by exposure to CNHs. However, reactive oxygen species were generated by the macrophage cells after uptake of CNHs, suggesting that these species were actively involved in the degradation of the nanomaterials rather than in an inflammatory pathway induction.With the rapid developments in the medical applications of carbon nanomaterials such as carbon nanohorns (CNHs), carbon nanotubes, and graphene based nanomaterials, understanding the long-term fate, health impact, excretion, and degradation of these materials has become crucial. Herein, the in vitro biodegradation of CNHs was determined using a non-cellular enzymatic oxidation method and two types of macrophage cell lines. Approximately 60% of the CNHs was degraded within 24 h in a phosphate buffer solution containing myeloperoxidase. Furthermore, approximately 30% of the CNHs was degraded by both RAW 264.7 and THP-1 macrophage cells within 9 days. Inflammation markers such as pro-inflammatory cytokines interleukin 6 and tumor necrosis factor α were not induced by exposure to CNHs. However, reactive oxygen species were generated by the macrophage cells after uptake of CNHs, suggesting that these species were actively involved in the degradation of the

  18. Method for Making a Carbon-Carbon Cylinder Block

    Science.gov (United States)

    Ransone, Phillip O. (Inventor)

    1997-01-01

    A method for making a lightweight cylinder block composed of carbon-carbon is disclosed. The use of carbon-carbon over conventional materials. such as cast iron or aluminum, reduces the weight of the cylinder block and improves thermal efficiency of the internal combustion reciprocating engine. Due to the negligible coefficient of thermal expansion and unique strength at elevated temperatures of carbon-carbon, the piston-to-cylinder wall clearance can be small, especially when the carbon-carbon cylinder block is used in conjunction with a carbon-carbon piston. Use of the carbon-carbon cylinder block has the effect of reducing the weight of other reciprocating engine components allowing the piston to run at higher speeds and improving specific engine performance.

  19. Phanerozoic and Neoproterozoic Negative Carbon Isotope Excursions, Diagenesis and Terrestrialization

    Science.gov (United States)

    Paul, K.; Kennedy, M. J.

    2008-12-01

    Comprehensive data sets of Phanerozoic and late Precambrian carbon isotope data derived from carbonate rocks show a similar positive relation when cross-plotted with oxygen isotope values. The range and slope between the time periods is identical and the processes responsible for the relation have been well documented in Quaternary sediments. These processes include the stabilization of isotope values to ambient meteoric water values during shallow burial and flushing of carbonate sediments. Both data sets show strongly depleted carbon (-9 per mil PDB) and oxygen isotope values that retain seemingly systematic stratigraphic patterns with the Quaternary and Phanerozoic examples that demonstrably record meteroric water values. Similar values and patterns in the Precambrian are interpreted as primary marine in origin with significant implications for an ocean carbon mass balance not possible in the Phanerozoic carbon cycle. A similar compilation of carbonates older than one billion years do not show a relation between carbon and oxygen isotopes, lacking the negative carbon values evident in the younger record. We hypothesize that this difference records the onset of significant organic carbon on the land surface and the alteration of meteoric waters toward Phanerozoic values. We demonstrate the meteoric affinities of Neoproterozoic carbonates containing prominent negative isotope excursions recorded in the Shuram and Wonoka Formations of Oman and South Australia commonly attributed to whole ocean isotope variation. The conspicuous absence of negative carbon isotope values with normal marine oxygenisotope values in the Phanerozoic and Neoproterozic identifies a consistent relation between these time intervals and suggests that, as well accepted in the Phanerozoic, negative carbon isotope excursions less than -3 per mil are not a record of marine processes, but rather the later terrestrial biotic influence on meteoric water values.

  20. 9 CFR 114.9 - Outline of Production guidelines.

    Science.gov (United States)

    2010-01-01

    .... Principle of the test (ELISA, latex agglutination, etc.). 2. Antigen or antibody detection test. 3. Sample(s... exemption as provided in 9 CFR 113.4. B. Safety. In vitro products are exempt from safety tests. C. Potency..., conditions, age, and general health. B. Examination, preparation, care, quarantine, tests, and treatment...

  1. CA 19-9 (Cancer Antigen 19-9)

    Science.gov (United States)

    ... as a tumor marker : To help differentiate between cancer of the pancreas and other conditions, such as pancreatitis To monitor ... levels of CA 19-9 are seen in cancer of the exocrine pancreas. This cancer arises in the tissues that produce ...

  2. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Consumers Businesses Contact CPSC Website Design Feedback Consumers: Español Businesses: Español , 中文 , Tiếng Việt Connect with Us : Twitter YouTube ... Safely Home / Safety Education / Safety Education Centers En Español Carbon Monoxide Information Center The Invisible Killer Carbon ...

  3. Carbon black recovery

    International Nuclear Information System (INIS)

    A process and apparatus for recovering carbon black from hot smoke which comprises passing the smoke through a cyclone separation zone following cooling, then through aggregate filter beds and regeneration of filter beds with clean off-gas which is recycled to the carbon black reaction zone as quench

  4. Carbon for sensing devices

    CERN Document Server

    Tagliaferro, Alberto

    2015-01-01

    This book reveals why carbon is playing such an increasingly prominent role as a sensing material. The various steps that transform a raw material in a sensing device are thoroughly presented and critically discussed.  The authors deal with all aspects of carbon-based sensors, starting from the various hybridization and allotropes of carbon, with specific focus on micro and nanosized carbons (e.g., carbon nanotubes, graphene) and their growth processes. The discussion then moves to the role of functionalization and the different routes to achieve it. Finally, a number of sensing applications in various fields are presented, highlighting the connection with the basic properties of the various carbon allotropes.  Readers will benefit from this book’s bottom-up approach, which starts from the local bonding in carbon solids and ends with sensing applications, linking the local hybridization of carbon atoms and its modification by functionalization to specific device performance. This book is a must-have in th...

  5. Fly ash carbon passivation

    Science.gov (United States)

    La Count, Robert B; Baltrus, John P; Kern, Douglas G

    2013-05-14

    A thermal method to passivate the carbon and/or other components in fly ash significantly decreases adsorption. The passivated carbon remains in the fly ash. Heating the fly ash to about 500 and 800 degrees C. under inert gas conditions sharply decreases the amount of surfactant adsorbed by the fly ash recovered after thermal treatment despite the fact that the carbon content remains in the fly ash. Using oxygen and inert gas mixtures, the present invention shows that a thermal treatment to about 500 degrees C. also sharply decreases the surfactant adsorption of the recovered fly ash even though most of the carbon remains intact. Also, thermal treatment to about 800 degrees C. under these same oxidative conditions shows a sharp decrease in surfactant adsorption of the recovered fly ash due to the fact that the carbon has been removed. This experiment simulates the various "carbon burnout" methods and is not a claim in this method. The present invention provides a thermal method of deactivating high carbon fly ash toward adsorption of AEAs while retaining the fly ash carbon. The fly ash can be used, for example, as a partial Portland cement replacement in air-entrained concrete, in conductive and other concretes, and for other applications.

  6. Carbon Capture and Storage

    NARCIS (Netherlands)

    Benson, S.M.; Bennaceur, K.; Cook, P.; Davison, J.; Coninck, H. de; Farhat, K.; Ramirez, C.A.; Simbeck, D.; Surles, T.; Verma, P.; Wright, I.

    2012-01-01

    Emissions of carbon dioxide, the most important long-lived anthropogenic greenhouse gas, can be reduced by Carbon Capture and Storage (CCS). CCS involves the integration of four elements: CO 2 capture, compression of the CO2 from a gas to a liquid or a denser gas, transportation of pressurized CO 2

  7. COMMITTED TO CARBON REDUCTION

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Chinese efforts to lower carbon emissions through environmentally friendly means begin gaining momentum Efforts to curb carbon emissions continue to take shape as China adheres to its pledge for a brighter, greener future. More importantly, as environmental measures take hold and develop

  8. Amorphous iron (II) carbonate

    DEFF Research Database (Denmark)

    Sel, Ozlem; Radha, A.V.; Dideriksen, Knud;

    2012-01-01

    Abstract The synthesis, characterization and crystallization energetics of amorphous iron (II) carbonate (AFC) are reported. AFC may form as a precursor for siderite (FeCO3). The enthalpy of crystallization (DHcrys) of AFC is similar to that of amorphous magnesium carbonate (AMC) and more...

  9. Carbon Dioxide Fountain

    Science.gov (United States)

    Kang, Seong-Joo; Ryu, Eun-Hee

    2007-01-01

    This article presents the development of a carbon dioxide fountain. The advantages of the carbon dioxide fountain are that it is odorless and uses consumer chemicals. This experiment also is a nice visual experiment that allows students to see evidence of a gaseous reagent being consumed when a pressure sensor is available. (Contains 3 figures.)…

  10. Carbon dioxide recycling

    Science.gov (United States)

    The recycling of carbon dioxide to methanol and dimethyl ether is seen to offer a substantial route to renewable and environmentally carbon neutral fuels. One of the authors has championed the “Methanol Economy" in articles and a book. By recycling ambient CO2, the authors argue ...

  11. De-carbonizingChina

    Institute of Scientific and Technical Information of China (English)

    zhou; Xiaoyan

    2013-01-01

    Innovation in the energy sector will pave the way for the country’slow-carbon future Although its per-capita emission is roughly on par with the world’s average, China is the world’s largest carbon dioxide emitter,

  12. Big Sky Carbon Sequestration Partnership

    Energy Technology Data Exchange (ETDEWEB)

    Susan Capalbo

    2005-12-31

    The Big Sky Carbon Sequestration Partnership, led by Montana State University, is comprised of research institutions, public entities and private sectors organizations, and the Confederated Salish and Kootenai Tribes and the Nez Perce Tribe. Efforts under this Partnership in Phase I are organized into four areas: (1) Evaluation of sources and carbon sequestration sinks that will be used to determine the location of pilot demonstrations in Phase II; (2) Development of GIS-based reporting framework that links with national networks; (3) Design of an integrated suite of monitoring, measuring, and verification technologies, market-based opportunities for carbon management, and an economic/risk assessment framework; (referred to below as the Advanced Concepts component of the Phase I efforts) and (4) Initiation of a comprehensive education and outreach program. As a result of the Phase I activities, the groundwork is in place to provide an assessment of storage capabilities for CO{sub 2} utilizing the resources found in the Partnership region (both geological and terrestrial sinks), that complements the ongoing DOE research agenda in Carbon Sequestration. The geology of the Big Sky Carbon Sequestration Partnership Region is favorable for the potential sequestration of enormous volume of CO{sub 2}. The United States Geological Survey (USGS 1995) identified 10 geologic provinces and 111 plays in the region. These provinces and plays include both sedimentary rock types characteristic of oil, gas, and coal productions as well as large areas of mafic volcanic rocks. Of the 10 provinces and 111 plays, 1 province and 4 plays are located within Idaho. The remaining 9 provinces and 107 plays are dominated by sedimentary rocks and located in the states of Montana and Wyoming. The potential sequestration capacity of the 9 sedimentary provinces within the region ranges from 25,000 to almost 900,000 million metric tons of CO{sub 2}. Overall every sedimentary formation investigated

  13. Informatica发布Informatica 9

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    近日,Informatica正式发布了全球首个支持数据驱动型企业的数据平台Inforrnatica9。据悉,Informatica9是目前业内唯一的全面、统一且开放式数据集成平台,可以轻松部署在预装系统或”云”网络中。通过Inforamtica9,企业可以从容应对数据集成、数据质量、B2B数据交换、应用信息生命周期管理、复杂事件处理和“云”数据集成,从而最大化数据的商业价值。

  14. Plumbing the global carbon cycle: Integrating inland waters into the terrestrial carbon budget

    Science.gov (United States)

    Cole, J.J.; Prairie, Y.T.; Caraco, N.F.; McDowell, W.H.; Tranvik, L.J.; Striegl, R.G.; Duarte, C.M.; Kortelainen, Pirkko; Downing, J.A.; Middelburg, J.J.; Melack, J.

    2007-01-01

    Because freshwater covers such a small fraction of the Earth's surface area, inland freshwater ecosystems (particularly lakes, rivers, and reservoirs) have rarely been considered as potentially important quantitative components of the carbon cycle at either global or regional scales. By taking published estimates of gas exchange, sediment accumulation, and carbon transport for a variety of aquatic systems, we have constructed a budget for the role of inland water ecosystems in the global carbon cycle. Our analysis conservatively estimates that inland waters annually receive, from a combination of background and anthropogenically altered sources, on the order of 1.9 Pg C y-1 from the terrestrial landscape, of which about 0.2 is buried in aquatic sediments, at least 0.8 (possibly much more) is returned to the atmosphere as gas exchange while the remaining 0.9 Pg y-1 is delivered to the oceans, roughly equally as inorganic and organic carbon. Thus, roughly twice as much C enters inland aquatic systems from land as is exported from land to the sea. Over prolonged time net carbon fluxes in aquatic systems tend to be greater per unit area than in much of the surrounding land. Although their area is small, these freshwater aquatic systems can affect regional C balances. Further, the inclusion of inland, freshwater ecosystems provides useful insight about the storage, oxidation and transport of terrestrial C, and may warrant a revision of how the modern net C sink on land is described. ?? 2007 Springer Science+Business Media, LLC.

  15. FileMaker Pro 9

    CERN Document Server

    Coffey, Geoff

    2007-01-01

    FileMaker Pro 9: The Missing Manual is the clear, thorough and accessible guide to the latest version of this popular desktop database program. FileMaker Pro lets you do almost anything with the information you give it. You can print corporate reports, plan your retirement, or run a small country -- if you know what you're doing. This book helps non-technical folks like you get in, get your database built, and get the results you need. Pronto.The new edition gives novices and experienced users the scoop on versions 8.5 and 9. It offers complete coverage of timesaving new features such as the Q

  16. Climate change, fire and the carbon balance

    International Nuclear Information System (INIS)

    On average, forest fires have burned 2 to 3 million hectares annually in Canada over the last twenty years. Over the last 40 years, this amounts to 20 per cent of the amount of carbon released through fossil fuel emissions in Canada. This paper analyses the extent to which climate change may contribute to a disturbance in the carbon balance due to increased fire activity. In addition, data from FLUXNET-Canada was examined, indicating that carbon fluxes from younger forests show dramatic changes in diurnal carbon flux patterns, caused by reduced photosynthetic uptake during the day and less root respiration at night. Increases in fire are expected throughout much of the boreal forest towards the end of this century, with a lengthening of the fire season and increases in severity and intensity. It was concluded that there is the possibility of a positive feedback, where climate change could cause more fires, resulting in a greater release of carbon and thereby increasing greenhouse gas concentrations. Evidence that smoke promoted positive lightning strikes while reducing precipitation was also presented. It was suggested that certain self-limiting factors may prevent a run-away scenario. Changes to human and lightning ignition patterns, for example, may have an impact. It was also suggested that research efforts should focus on refining climate change estimates that account for landscape change and other aspects that control fire in Canada. 9 refs., 2 figs

  17. Major carbon industries in India

    Energy Technology Data Exchange (ETDEWEB)

    Jain, P.K.

    1982-01-01

    The history of the major carbon industries in India, their growth, present status, problems and future prospects are described. Chapters cover: raw petroleum coke, calcined petroleum coke, graphite electrodes and anodes, carbon electrode paste, calcined anthracite coal, low-ash metallurgical coke, carbon black industry, activated carbon, midget electrodes, cinema arc carbons, carbon blocks and brushes for electrical machinery, and the growth of the aluminium industry and its impact on the calcined petroleum coke industry.

  18. Synthesis of hydrated lutetium carbonate

    Energy Technology Data Exchange (ETDEWEB)

    Song Liu [South China Univ. of Technology, Dept. of Applied Chemistry, Guangdong (China); Rong-jun Ma [Changsha Research Institute of Minig and Metallurgy, Hunan (China)

    1997-09-01

    Crystalline lutetium carbonate was synthesized for the corresponding chloride using ammonium bicarbonate as precipitant. The chemical analyses suggest that the synthesized lutetium carbonate is a hydrated basic carbonate or oxycarbonate. The X-ray powder diffraction data are presented. The IR data for the compound show the presence of two different carbonate groups. There is no stable intermediate carbonate in the process of thermal decomposition of the lutetium carbonate. (au) 15 refs.

  19. Improved Dispersion of Carbon Nanotubes in Polymers at High Concentrations

    OpenAIRE

    Chao-Xuan Liu; Jin-Woo Choi

    2012-01-01

    The polymer nanocomposite used in this work comprises elastomer poly(dimethylsiloxane) (PDMS) as a polymer matrix and multi-walled carbon nanotubes (MWCNTs) as a conductive nanofiller. To achieve uniform distribution of carbon nanotubes within the polymer, an optimized dispersion process was developed, featuring a strong organic solvent—chloroform, which dissolved PDMS base polymer easily and allowed high quality dispersion of MWCNTs. At concentrations as high as 9 wt.%, MWCNTs were...

  20. Carbon cycle uncertainty in the Alaskan Arctic

    Directory of Open Access Journals (Sweden)

    J. B. Fisher

    2014-02-01

    Full Text Available Climate change is leading to a disproportionately large warming in the high northern latitudes, but the magnitude and sign of the future carbon balance of the Arctic are highly uncertain. Using 40 terrestrial biosphere models for Alaska, we provide a baseline of terrestrial carbon cycle structural and parametric uncertainty, defined as the multi-model standard deviation (σ against the mean (x for each quantity. Mean annual uncertainty (σ/x was largest for net ecosystem exchange (NEE (−0.01± 0.19 kg C m−2 yr−1, then net primary production (NPP (0.14 ± 0.33 kg C m−2 yr−1, autotrophic respiration (Ra (0.09 ± 0.20 kg C m−2 yr−1, gross primary production (GPP (0.22 ± 0.50 kg C m−2 yr−1, ecosystem respiration (Re (0.23 ± 0.38 kg C m−2 yr−1, CH4 flux (2.52 ± 4.02 g CH4 m−2 yr−1, heterotrophic respiration (Rh (0.14 ± 0.20 kg C m−2 yr−1, and soil carbon (14.0± 9.2 kg C m−2. The spatial patterns in regional carbon stocks and fluxes varied widely with some models showing NEE for Alaska as a strong carbon sink, others as a strong carbon source, while still others as carbon neutral. Additionally, a feedback (i.e., sensitivity analysis was conducted of 20th century NEE to CO2 fertilization (β and climate (γ, which showed that uncertainty in γ was 2x larger than that of β, with neither indicating that the Alaskan Arctic is shifting towards a certain net carbon sink or source. Finally, AmeriFlux data are used at two sites in the Alaskan Arctic to evaluate the regional patterns; observed seasonal NEE was captured within multi-model uncertainty. This assessment of carbon cycle uncertainties may be used as a baseline for the improvement of experimental and modeling activities, as well as a reference for future trajectories in carbon cycling with climate change in the Alaskan Arctic.

  1. Carbon footprint of electronic devices

    Science.gov (United States)

    Sloma, Marcin

    2013-07-01

    Paper assesses the greenhouse gas emissions related to the electronic sectors including information and communication technology and media sectors. While media often presents the carbon emission problem of other industries like petroleum industry, the airlines and automobile sectors, plastics and steel manufacturers, the electronics industry must include the increasing carbon footprints caused from their applications like media and entertainment, computers and cooling devices, complex telecommunications networks, cloud computing and powerful mobile phones. In that sense greenhouse gas emission of electronics should be studied in a life cycle perspective, including regular operational electricity use. Paper presents which product groups or processes are major contributors in emission. From available data and extrapolation of existing information we know that the information and communication technology sector produced 1.3% and media sector 1.7% of global gas emissions within production cycle, using the data from 2007.In the same time global electricity use of that sectors was 3.9% and 3.2% respectively. The results indicate that for both sectors operation leads to more gas emissions than manufacture, although impacts from the manufacture is significant, especially in the supply chain. Media electronics led to more emissions than PCs (manufacture and operation). Examining the role of electronics in climate change, including disposal of its waste, will enable the industry to take internal actions, leading to lowering the impact on the climate change within the sector itself.

  2. Synthesis of (9Z, 12E-, (9E, 12Z-[1-14C]-linoleic acid, (9Z, 12Z, 15E-, (9E, 12Z, 15Z-[1-14C]-linolenic acid and (5Z, 8Z, 11Z, 14E-[1-14C]-arachidonic acid

    Directory of Open Access Journals (Sweden)

    Enard, Thierry

    1996-04-01

    Full Text Available Trans polyunsaturated fatty acids are produced in vegetable oils during heat treatment (240-250 °C.ln order to study the metabolic pathway of 9c, 12t and 9t, 12c linoleic acid and 9c, 12c, 15t and 9t, 12c, 15c linolenic acid, these products were prepared labelled with carbon 14 in the carboxylic position. 5c, 8c, 11c, 14t-Arachidonic acid was also labelled on the carboxylic position with carbon 14 in order to study its physiological effects. To introduce the labelling (E-bromo precursors with a 17 carbons chain or a 19 carbon chain were needed. The different syntheses were done by elongation steps and creation of cis double bonds via highly stereospecific Wittig reactions. The radioactive carbon atom was introduced from [14C]-potassium cyanide. The final radioactive fatty acids had a specific activity greater than 50 mCi/mmol and a radioactive purity better than 99 % for linoleic and linolenic and better than 98.6 % for arachidonic acid.

  3. Carbon Cryogel Silicon Composite Anode Materials for Lithium Ion Batteries

    Science.gov (United States)

    Woodworth James; Baldwin, Richard; Bennett, William

    2010-01-01

    A variety of materials are under investigation for use as anode materials in lithium-ion batteries, of which, the most promising are those containing silicon. 10 One such material is a composite formed via the dispersion of silicon in a resorcinol-formaldehyde (RF) gel followed by pyrolysis. Two silicon-carbon composite materials, carbon microspheres and nanofoams produced from nano-phase silicon impregnated RF gel precursors have been synthesized and investigated. Carbon microspheres are produced by forming the silicon-containing RF gel into microspheres whereas carbon nano-foams are produced by impregnating carbon fiber paper with the silicon containing RF gel to create a free standing electrode. 1-4,9 Both materials have demonstrated their ability to function as anodes and utilize the silicon present in the material. Stable reversible capacities above 400 mAh/g for the bulk material and above 1000 mAh/g of Si have been observed.

  4. Stable Carbon and Oxygen Isotopes of Pedogenic Carbonates in Ustic Vertisols: Implications for Paleoenvironmental Change

    Institute of Scientific and Technical Information of China (English)

    HUANG Cheng-Min; WANG Cheng-Shan; TANG Ya

    2005-01-01

    Pedogenic carbonates, found extensively in arid and semiarid regions, are important in revealing regional climatic and environmental changes as well as the carbon cycle. In addition, stable carbon and oxygen isotopic compositions of pedogenic carbonates have been used to rebuild paleoecology (biomass and vegetation) and to estimate paleotemperature and paleoprecipitation during past geological time. By utilizing the stable carbon and oxygen isotopic compositions (δ13C and δ18O) of secondary nodules in Ustic Vertisols, this study looked into the climatic and environmental changes in the dry valleys of the Yuanmou Basin, Yunnan Province, in southwestern China. The results showed that during the early Holocene, a warm-humid or hot-humid climate existed in the Yuanmou Basin, but since then fluctuations in climate have occurred, with a dry climate prevailing. A highly significant correlation (r = 0.92, n= 9) between δ13C and δ18O values of carbonates illustrated that there had been a continual shifting between cold-humid and warm-dry climates in southwestern China including the Yuanmou Basin since the early Holocene.

  5. The Importance of Uncertainty and Sensitivity Analysis in Process-based Models of Carbon and Nitrogen Cycling in Terrestrial Ecosystems with Particular Emphasis on Forest Ecosystems — Selected Papers from a Workshop Organized by the International Society for Ecological Modelling (ISEM) at the Third Biennal Meeting of the International Environmental Modelling and Software Society (IEMSS) in Burlington, Vermont, USA, August 9-13, 2006

    Science.gov (United States)

    Larocque, Guy R.; Bhatti, Jagtar S.; Liu, Jinxun; Ascough, James C.; Gordon, Andrew M.

    2008-01-01

    Many process-based models of carbon (C) and nitrogen (N) cycles have been developed for terrestrial ecosystems, including forest ecosystems. They address many basic issues of ecosystems structure and functioning, such as the role of internal feedback in ecosystem dynamics. The critical factor in these phenomena is scale, as these processes operate at scales from the minute (e.g. particulate pollution impacts on trees and other organisms) to the global (e.g. climate change). Research efforts remain important to improve the capability of such models to better represent the dynamics of terrestrial ecosystems, including the C, nutrient, (e.g. N) and water cycles. Existing models are sufficiently well advanced to help decision makers develop sustainable management policies and planning of terrestrial ecosystems, as they make realistic predictions when used appropriately. However, decision makers must be aware of their limitations by having the opportunity to evaluate the uncertainty associated with process-based models (Smith and Heath, 2001 and Allen et al., 2004). The variation in scale of issues currently being addressed by modelling efforts makes the evaluation of uncertainty a daunting task.

  6. Analysis of trace amounts of carbon dioxide, oxygen and carbon monoxide in nitrogen using dual capillary columns and a pulsed discharge helium ionisation detector.

    Science.gov (United States)

    Janse van Rensburg, M; Botha, A; Rohwer, E

    2007-10-01

    Gas mixtures of trace amounts of carbon dioxide (CO(2)), dioxygen (O(2)), and carbon monoxide (CO) in dinitrogen (N(2)) were separated and quantified using parallel dual capillary columns and pulsed discharge helium ionisation detection (PDHID). The detection limits (9 x 10(-9) mol mol(-1) for CO(2), 7 x 10(-9) mol mol(-1) for O(2) and 37 x 10(-9) mol mol(-1) for CO) were lower than those reported previously for similar methods. Uncertainties were calculated and results were validated by comparison of the CO and CO(2) results with those obtained using conventional methods. The method was also used to analyse nitrogen, carbon dioxide and carbon monoxide in oxygen. PMID:17765907

  7. Small diameter carbon nanopipettes

    Science.gov (United States)

    Singhal, Riju; Bhattacharyya, Sayan; Orynbayeva, Zulfiya; Vitol, Elina; Friedman, Gary; Gogotsi, Yury

    2010-01-01

    Nanoscale multifunctional carbon probes facilitate cellular studies due to their small size, which makes it possible to interrogate organelles within living cells in a minimally invasive fashion. However, connecting nanotubes to macroscopic devices and constructing an integrated system for the purpose of fluid and electrical signal transfer is challenging, as is often the case with nanoscale components. We describe a non-catalytic chemical vapor deposition based method for batch fabrication of integrated multifunctional carbon nanopipettes (CNPs) with tip diameters much smaller (10-30 nm) than previously reported (200 nm and above) and approaching those observed for multiwalled carbon nanotubes. This eliminates the need for complicated attachment/assembly of nanotubes into nanofluidic devices. Variable tip geometries and structures were obtained by controlled deposition of carbon inside and outside quartz pipettes. We have shown that the capillary length and gas flow rate have a marked effect on the carbon deposition. This gives us a flexible protocol, useful for growing carbon layers of different thicknesses at selective locations on a glass pipette to yield a large variety of cellular probes in bulk quantities. The CNPs possess an open channel for fluid transfer with the carbon deposited inside at 875 °C behaving like an amorphous semiconductor. Vacuum annealing of the CNP tips at temperatures up to 2000 °C yields graphitic carbon structures with an increase in conductivity of two orders of magnitude. Penetration of the integrated carbon nanoprobes into cells was shown to produce minimal Ca2+ signals, fast recovery of basal Ca2+ levels and no adverse activation of the cellular metabolism during interrogation times as long as 0.5-1 h.

  8. Small diameter carbon nanopipettes

    International Nuclear Information System (INIS)

    Nanoscale multifunctional carbon probes facilitate cellular studies due to their small size, which makes it possible to interrogate organelles within living cells in a minimally invasive fashion. However, connecting nanotubes to macroscopic devices and constructing an integrated system for the purpose of fluid and electrical signal transfer is challenging, as is often the case with nanoscale components. We describe a non-catalytic chemical vapor deposition based method for batch fabrication of integrated multifunctional carbon nanopipettes (CNPs) with tip diameters much smaller (10-30 nm) than previously reported (200 nm and above) and approaching those observed for multiwalled carbon nanotubes. This eliminates the need for complicated attachment/assembly of nanotubes into nanofluidic devices. Variable tip geometries and structures were obtained by controlled deposition of carbon inside and outside quartz pipettes. We have shown that the capillary length and gas flow rate have a marked effect on the carbon deposition. This gives us a flexible protocol, useful for growing carbon layers of different thicknesses at selective locations on a glass pipette to yield a large variety of cellular probes in bulk quantities. The CNPs possess an open channel for fluid transfer with the carbon deposited inside at 875 deg. C behaving like an amorphous semiconductor. Vacuum annealing of the CNP tips at temperatures up to 2000 deg. C yields graphitic carbon structures with an increase in conductivity of two orders of magnitude. Penetration of the integrated carbon nanoprobes into cells was shown to produce minimal Ca2+ signals, fast recovery of basal Ca2+ levels and no adverse activation of the cellular metabolism during interrogation times as long as 0.5-1 h.

  9. Oxygen reduction on teflon-bonded carbon electrode

    Institute of Scientific and Technical Information of China (English)

    周德璧; 黄可龙; 张世民

    2004-01-01

    Oxygen reduction on Teflon-bonded carbon gas diffusion electrode without catalyst in 6 mol/L KOH solution was investigated with acimpedance spectroscopy and other electrochemical techniques. The kinetic parameters were measured with an exchange current density of J0= 3.44 × 10-9 and a Tafel slope of 46 mV/dec in low overpotential range (-0.05 --0.14 V vs SCE), which are comparable with those reported on carbon supported platinum electrode. The reaction mechanism of OR and the active effect of carbon black were examined.

  10. Dense carbon monoliths for supercapacitors with outstanding volumetric capacitances

    OpenAIRE

    Kunowsky, Mirko; García Gómez, Alejandra; Barranco, V.; Rojo, José M.; Ibáñez Ulargui, Joaquín; Carruthers, James Donald; Linares Solano, Ángel

    2014-01-01

    A commercially available dense carbon monolith (CM) and four carbon monoliths obtained from it have been studied as electrochemical capacitor electrodes in a two-electrode cell. CM has: (i) very high density (1.17 g cm−3), (ii) high electrical conductivity (9.3 S cm−1), (iii) well-compacted and interconnected carbon spheres, (iv) homogeneous microporous structure and (v) apparent BET surface area of 957 m2g−1. It presents interesting electrochemical behaviors (e.g., excellent gravimetric capa...

  11. Anthropogenic perturbation of the carbon fluxes from land to ocean

    KAUST Repository

    Regnier, Pierre

    2013-06-09

    A substantial amount of the atmospheric carbon taken up on land through photosynthesis and chemical weathering is transported laterally along the aquatic continuum from upland terrestrial ecosystems to the ocean. So far, global carbon budget estimates have implicitly assumed that the transformation and lateral transport of carbon along this aquatic continuum has remained unchanged since pre-industrial times. A synthesis of published work reveals the magnitude of present-day lateral carbon fluxes from land to ocean, and the extent to which human activities have altered these fluxes. We show that anthropogenic perturbation may have increased the flux of carbon to inland waters by as much as 1.0 Pg C yr -1 since pre-industrial times, mainly owing to enhanced carbon export from soils. Most of this additional carbon input to upstream rivers is either emitted back to the atmosphere as carbon dioxide (∼0.4 Pg C yr -1) or sequestered in sediments (∼0.5 Pg C yr -1) along the continuum of freshwater bodies, estuaries and coastal waters, leaving only a perturbation carbon input of ∼0.1 Pg C yr -1 to the open ocean. According to our analysis, terrestrial ecosystems store ∼0.9 Pg C yr -1 at present, which is in agreement with results from forest inventories but significantly differs from the figure of 1.5 Pg C yr -1 previously estimated when ignoring changes in lateral carbon fluxes. We suggest that carbon fluxes along the land-ocean aquatic continuum need to be included in global carbon dioxide budgets.

  12. Carbon Ion Therapy

    DEFF Research Database (Denmark)

    Bassler, Niels; Hansen, David Christoffer; Herrmann, Rochus;

    On the importance of choice of target size for selective boosting of hypoxic tumor subvolumina in carbon ion therapy Purpose: Functional imaging methods in radiotherapy are maturing and can to some extent uncover radio resistant structures found within a tumour entity. Selective boost of identified...... effect. All cell lines investigated here did not reach an OER of 1, even for the smaller structures, which may indicate that the achievable dose average LET of carbon ions is too low, and heavier ions than carbon may be considered for functional LET-painting....

  13. Acridin-9-ylmethoxycarbonyl (Amoc): A New Photochemically Removable Protecting Group for Alcohols

    Institute of Scientific and Technical Information of China (English)

    WANG Hong-Bo; TANG Wen-Jian; YU Jing-Yu; SONG Qin-Hua

    2006-01-01

    Synthesis and photochemistry of acridin-9-ylmethoxycarbonyl (Amoc) as a new photochemically removable protecting group for alcohols were described. Three carbonates of alcohols 1-3 were synthesized through condensation of 9-hydroxymethylacridine and chloroformates of alcohols, including benzyl alcohol, phenethyl alcohol and one galactose derivative. The photolysis of protected alcohols can efficiently release the corresponding alcohol in the efficiencies (Qu1ε) of 100-200 (quantum yield Qu1=0.011-0.023, and molar absorptivity ε=9.1 × 103-9.8 × 103 mol-1·L·cm-1) under 360 nm light.

  14. 46 CFR 151.50-41 - Carbon disulfide (carbon bisulfide).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Carbon disulfide (carbon bisulfide). 151.50-41 Section... CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-41 Carbon disulfide (carbon bisulfide). (a) All openings shall be in the top of the tank. (b) Loading lines...

  15. Photophysics of polymer-wrapped single-walled carbon nanotubes

    OpenAIRE

    Gao, J.; Loi, M.A.

    2010-01-01

    Single-walled carbon nanotubes (SWNTs) are successfully dispersed in two conjugated polymer poly(9,9-dioctylfluorenyl-2,7-diyl) (PFO) and poly[2-methoxy-5-(2’-ethyl-hexyloxy)-1,4-phenylene vinylene] (MEHPPV) solutions. Steady-state and time-resolved photoluminescence spectroscopy in the near-infrared and visible spectral regions are used to study the interaction of the dispersed carbon nanotube and the wrapped polymer in the nano-hybrids. The SWNTs infrared emission is the signatures of the s...

  16. Carbon Stock and Carbon Cycle of Wetland Ecosystem

    Institute of Scientific and Technical Information of China (English)

    Zhangquan; ZENG; Canming; ZHANG; Jiao; LI; Nan; YANG; Xihao; LI; Yandong; NIU; Zijian; WU

    2014-01-01

    Wetland ecosystem is an essential ecosystem in the world. Its organic carbon stock and carbon cycle are important basis of global carbon cycle researches and also major contents of global climate change researches. Researches have shown that wetland protection and restoration can promote carbon accumulation and reduce emission of greenhouse gases. This paper discussed influence of carbon stock and carbon balance of wetland ecosystem and emission of greenhouse gases,as well as the relationship between wetland and global climate changes. Finally,it made prospect on researches about carbon cycle of Dongting Lake.

  17. A novel carbon fiber based porous carbon monolith

    Energy Technology Data Exchange (ETDEWEB)

    Burchell, T.D.; Klett, J.W.; Weaver, C.E.

    1995-06-01

    A novel porous carbon material based on carbon fibers has been developed. The material, when activated, develops a significant micro- or mesopore volume dependent upon the carbon fiber type utilized (isotropic pitch or polyacrylonitrile). The materials will find applications in the field of fluid separations or as a catalyst support. Here, the manufacture and characterization of our porous carbon monoliths are described. A novel adsorbent carbon composite material has been developed comprising carbon fibers and a binder. The material, called carbon fiber composite molecular sieve (CFCMS), was developed through a joint research program between Oak Ridge National Laboratory (ORNL) and the University of Kentucky, Center for Applied Energy Research (UKCAER).

  18. Authigenic Carbonate and the History of the Global Carbon Cycle

    Science.gov (United States)

    Schrag, Daniel P.; Higgins, John. A.; Macdonald, Francis A.; Johnston, David T.

    2013-02-01

    We present a framework for interpreting the carbon isotopic composition of sedimentary rocks, which in turn requires a fundamental reinterpretation of the carbon cycle and redox budgets over Earth's history. We propose that authigenic carbonate, produced in sediment pore fluids during early diagenesis, has played a major role in the carbon cycle in the past. This sink constitutes a minor component of the carbon isotope mass balance under the modern, high levels of atmospheric oxygen but was much larger in times of low atmospheric O2 or widespread marine anoxia. Waxing and waning of a global authigenic carbonate sink helps to explain extreme carbon isotope variations in the Proterozoic, Paleozoic, and Triassic.

  19. Investigating carbonate formation in urban soils as a method for capture and storage of atmospheric carbon.

    Science.gov (United States)

    Washbourne, C-L; Renforth, P; Manning, D A C

    2012-08-01

    This paper investigates the potential for engineered urban soils to capture and store atmospheric carbon (C). Calcium (Ca) and magnesium (Mg) bearing waste silicate minerals within the soil environment can capture and store atmospheric C through the process of weathering and secondary carbonate mineral precipitation. Anthropogenic soils, known to contain substantial quantities of Ca and Mg-rich minerals derived from demolition activity (particularly cement and concrete), were systematically sampled at the surface across a 10 ha brownfield site, Science Central, located in the urban centre of Newcastle upon Tyne, U.K. Subsequent analysis yielded average carbonate contents of 21.8±4.7% wt CaCO(3). Isotopic analysis demonstrated δ(18)O values between -9.4‰ and -13.3‰ and δ(13)C values between -7.4‰ and -13.6‰ (relative to Pee Dee Belemnite), suggesting that up to 39.4±8.8% of the carbonate C has been captured from the atmosphere through hydroxylation of dissolved CO(2) in high pH solutions. The remaining carbonate C is derived from lithogenic sources. 37.4 kg of atmospheric CO(2) has already been captured and stored as carbonate per Mg of soil across the site, representing a carbon dioxide (CO(2)) removal rate of 12.5 kg CO(2) Mg(-1) yr(-1). There is the potential for capture and storage of a further 27.3 kg CO(2) Mg(-1) in residual reactive materials, which may be exploited through increased residence time (additional in situ weathering). Overall, the Science Central site has the potential to capture and store a total of 64,800 Mg CO(2) as carbonate minerals. This study illustrates the potential for managing urban soils as tools of C capture and storage, an important ecosystem service, and demonstrates the importance of studying C storage in engineering urban anthropogenic soils. PMID:22683756

  20. Evaluation of Powdered Activated Carbon Efficiency in Removal of Dissolved Organic Carbon inWater Treatment

    Directory of Open Access Journals (Sweden)

    G.R Bonyadi nejad

    2010-07-01

    Full Text Available "n "nBackgrounds and Objectives: Powdered Activated$ carbon is known as a suitable absorbent for organic materials. The aim of this research is evaluation of Powdered Activated-Carbon (PAC efficiency in removal of Dissolved Organic Carbon (DOC in water treatment in Isfahan."nMaterials and Methods : The increase of PAC for DOC reduction has done in three paths in the Isfahan water treatment plant (WTP. These paths including: 1 Intake up to entrance of WTP 2 Intake to exit ofWTP 3 Between entrance and exit of waterworks. The paths were simulated by the Jar test system. Then DOC and UV254 absorption were analyzed and SUVA parameter for samples and activated-carbon adsorption isotherm was calculated."nResults: The injected PAC doses of 20,40,60,80 and 100 mg/l caused decreasing in DOC and UV254 absorption in every sample in all paths. The average of this decrease, from intake to WTP.s exit (second path was the greatest 69.8± 3.9%and the commonWTP process had capability of removing 35% of DOC. The first path also showed that PAC can reduce 33± 2% DOC of raw water by itself. Activated-carbon absorption results were adhered from Freundlich adsorption isotherm."nConclusion: In the third path therewas lessDOCremoval efficiency than exceptedwhen Activated- Carbon injected in rapid mixed basin with coagulant. Powdered activated carbon porosity reduction due to effect of coagulant can be the reason for this issue.Also according to different paths, the point of intake is more suitable for powdered activated carbon addition.

  1. High performance carbon-carbon composites

    Indian Academy of Sciences (India)

    Lalit M Manocha

    2003-02-01

    Carbon-carbon composites rank first among ceramic composite materials with a spectrum of properties and applications in various sectors. These composites are made of fibres in various directions and carbonaceous polymers and hydrocarbons as matrix precursors. Their density and properties depend on the type and volume fraction of reinforcement, matrix precursor used and end heat treatment temperature. Composites made with thermosetting resins as matrix precursors possess low densities (1.55–1.75 g/cm3) and well-distributed microporosity whereas those made with pitch as the matrix precursor, after densification exhibit densities of 1.8–2.0 g/cm3 with some mesopores, and those made by the CVD technique with hydrocarbon gases, possess intermediate densities and matrices with close porosities. The former (resin-based) composites exhibit high flexural strength, low toughness and low thermal conductivity, whereas the latter (pitch- and CVD-based) can be made with very high thermal conductivity (400–700 W/MK) in the fibre direction. Carbon-carbon composites are used in a variety of sectors requiring high mechanical properties at elevated temperatures, good frictional properties for brake pads in high speed vehicles or high thermal conductivity for thermal management applications. However, for extended life applications, these composites need to be protected against oxidation either through matrix modification with Si, Zr, Hf etc. or by multilayer oxidation protection coatings consisting of SiC, silica, zircon etc.

  2. Carbon aerogels; Les aerogels de carbone

    Energy Technology Data Exchange (ETDEWEB)

    Berthon-Fabry, S.; Achard, P

    2003-06-15

    The carbon aerogel is a nano-porous material at open porosity, electrical conductor. The aerogels morphology is variable in function of the different synthesis parameters. This characteristic offers to the aerogels a better adaptability to many applications: electrodes (super condensers, fuel cells). The author presents the materials elaboration and their applications. It provides also the research programs: fundamental research, realization of super-condenser electrodes, fuel cells electrodes, gas storage materials and opaque materials for thermal insulation. (A.L.B.)

  3. Sodium carbonate poisoning

    Science.gov (United States)

    Sodium carbonate is found in: Automatic dishwashing soaps Clinitest (diabetes testing) tablets Glass products Pulp and paper products Some bleaches Some bubble bath solutions Some steam iron cleaners Note: This list is not all-inclusive.

  4. Carbon monoxide poisoning

    Science.gov (United States)

    ... heater). Many carbon monoxide poisonings occur in the winter months when furnaces, gas fireplaces, and portable heaters ... 16567227 www.ncbi.nlm.nih.gov/pubmed/16567227 . Nelson LS, Hoffman RS. Inhaled toxins. In: Marx JA, ...

  5. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... United States die every year from accidental non-fire related CO poisoning. Products that can produce deadly ... Driven Generators, 2004-2014 January 07, 2016 Non-Fire Carbon Monoxide Deaths Associated with the Use of ...

  6. FLUIDIZATION OF CARBON NANOTUBES

    Institute of Scientific and Technical Information of China (English)

    Fei Wei; Cang Huang; Yao Wang

    2005-01-01

    Carbon nanotubes (CNTs) can be fluidized in the form of fluidlike agglomerates made of many three-dimensional sub-agglomerates, having a multi-stage agglomerate (MSA) structure and containing large amounts of twisting CNTs of micrometer magnitude.

  7. Carbon nanotubes: Fibrillar pharmacology

    Science.gov (United States)

    Kostarelos, Kostas

    2010-10-01

    The mechanisms by which chemically functionalized carbon nanotubes flow in blood and are excreted through the kidneys illustrate the unconventional behaviour of these fibrillar nanostructures, and the opportunities they offer as components for the design of advanced delivery vehicles.

  8. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Safety More CO Blogs Research & Statistics March 09, 2016 Supplemental Memos Regarding Some of the Hazards Associated with Engine-Driven Generators, 2004-2014 January 07, 2016 Non-Fire Carbon Monoxide Deaths Associated with the ...

  9. The Carbon Emission Game

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    When Chinese President Hu Jintao attended the UN climate summit on September22,he made a solemn commitment that China will cut its per GDP unit carbon emission to a significant amount in 2020 compared with that of 2005.

  10. Total Ecosystem Carbon Stock

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Total ecosystem carbon includes above- and below-ground live plant components (such as leaf, branch, stem and root), dead biomass (such as standing dead wood, down...

  11. Carbon monoxide intoxication

    Energy Technology Data Exchange (ETDEWEB)

    Kales, S.N. (Cambridge Hospital, MA (United States))

    1993-11-01

    Carbon monoxide poisoning usually results from inhalation of exhaust fumes from motor vehicles, smoke from fires or fumes from faulty heating systems. Carbon monoxide has a high affinity for hemoglobin, with which it forms carboxyhemoglobin. The resulting decrease in both oxygen-carrying capacity and oxygen release can lead to end-organ hypoxia. The clinical presentation is nonspecific. Headache, dizziness, fatigue and nausea are common in mild to moderate carbon monoxide poisoning. In more severe cases, tachycardia, tachypnea and central nervous system depression occur. When carbon monoxide intoxication is suspected, empiric treatment with 100 percent oxygen should be initiated immediately. The diagnosis is confirmed by documenting an elevated carboxyhemoglobin level. Hyperbaric oxygen therapy is recommended in patients with neurologic dysfunction, cardiac dysfunction or a history of unconsciousness. 26 refs.

  12. Carbon partitioning in photosynthesis.

    Science.gov (United States)

    Melis, Anastasios

    2013-06-01

    The work seeks to raise awareness of a fundamental problem that impacts the renewable generation of fuels and chemicals via (photo)synthetic biology. At issue is regulation of the endogenous cellular carbon partitioning between different biosynthetic pathways, over which the living cell exerts stringent control. The regulation of carbon partitioning in photosynthesis is not understood. In plants, microalgae and cyanobacteria, methods need be devised to alter photosynthetic carbon partitioning between the sugar, terpenoid, and fatty acid biosynthetic pathways, to lower the prevalence of sugar biosynthesis and correspondingly upregulate terpenoid and fatty acid hydrocarbons production in the cell. Insight from unusual but naturally occurring carbon-partitioning processes can help in the design of blueprints for improved photosynthetic fuels and chemicals production.

  13. Carbon and oxygen isotope microanalysis of carbonate.

    Science.gov (United States)

    Velivetskaya, Tatiana A; Ignatiev, Alexander V; Gorbarenko, Sergey A

    2009-08-30

    Technical modification of the conventional method for the delta(13)C and delta(18)O analysis of 10-30 microg carbonate samples is described. The CO(2) extraction is carried out in vacuum using 105% phosphoric acid at 95 degrees C, and the isotopic composition of CO(2) is measured in a helium flow by gas chromatography/isotope ratio mass spectrometry (GC/IRMS). The feed-motion of samples to the reaction vessel provides sequential dropping of only the samples (without the sample holder) into the acid, preventing the contamination of acid and allowing us to use the same acid to carry out very large numbers of analyses. The high accuracy and high reproducibility of the delta(13)C and delta(18)O analyses were demonstrated by measurements of international standards and comparison of results obtained by our method and by the conventional method. Our method allows us to analyze 10 microg of the carbonate with a standard deviation of +/-0.05 per thousand for delta(13)C and delta(18)O. The method has been used successfully for the analyses of the oxygen and carbon isotopic composition of the planktonic and benthic foraminifera in detailed palaeotemperature reconstructions of the Okhotsk Sea. PMID:19603476

  14. Carbonate concretions as a significant component of ancient marine carbon cycles: Insights from paired organic and inorganic carbon isotope analyses of a Cretaceous shale

    Science.gov (United States)

    Loyd, S. J.

    2014-12-01

    Carbonate concretions often occur within fine-grained, organic-rich sedimentary rocks. This association reflects the common production of diagenetic minerals through biologic cycling of organic matter. Chemical analysis of carbonate concretions provides the rare opportunity to explore ancient shallow diagenetic environments, which are inherently transient due to progressive burial but are an integral component of the marine carbon cycle. The late Cretaceous Holz Shale (~80 Ma) contains abundant calcite concretions that exhibit textural and geochemical characteristics indicative of relatively shallow formation (i.e., near the sediment-water interface). Sampled concretions contain between 5.4 and 9.8 wt.% total inorganic carbon (TIC), or ~45 and 82 wt.% CaCO3, compared to host shale values which average ~1.5 wt.% TIC. Organic carbon isotope compositions (δ13Corg) are relatively constant in host and concretion samples ranging from ­-26.3 to -24.0‰ (VPDB). Carbonate carbon isotope compositions (δ13Ccarb) range from -22.5 to -3.4‰, indicating a significant but not entirely organic source of carbon. Concretions of the lower Holz Shale exhibit considerably elevated δ13Ccarb values averaging -4.8‰, whereas upper Holz Shale concretions express an average δ13Ccarb value of -17.0‰. If the remaining carbonate for lower Holz Shale concretions is sourced from marine fluids and/or dissolved marine carbonate minerals (e.g., shells), a simple mass balance indicates that ~28% of concretion carbon was sourced from organic matter and ~72% from late Cretaceous marine inorganic carbon (with δ13C ~ +2.5‰). Upper Holz Shale calculations indicate a ~73% contribution from organic matter and a ~27% contribution from inorganic carbon. When normalized for carbonate, organic contents within the concretions are ~2-13 wt.% enriched compared to host contents. This potentially reflects the protective nature of cementation that acts to limit permeability and chemical destruction of

  15. States and carbon

    International Nuclear Information System (INIS)

    The climate challenge appeals to an unprecedented mutation of our societies. From north to south, all our life styles will have to be changed from dwelling, to transport and feeding. These changes will have sense only at a worldwide scale and will impact our way of development. How can we reduce our energy consumption and greenhouse impact with answering everyone's essential needs at the same time? How can we invent a carbon-free economy in the North and preserve the big socio-economical equilibria at the same time? How can we get rid of poverty in the South without compromising the well-being of the future generations with an increase of CO2 emissions? Such difficulties cannot be overcome without innovations in terms of public policies. This book takes stock of the new possible instruments and policies at the global scale and involving fiscality, standards, investments and social justice. Content: 1 - the carbon threat: a changing climate and energies becoming scarce (the climate threat, an increasing energy insecurity); carbon and modern economy (human greenhouse gas emissions, a carbon-free well-being); governments and carbon control (a global challenge requiring an international control, the experiments era from Rio to the present day, the challenge of the state in front of the carbon threat); 2 - the political instruments of environment: standards as first instruments of climate public policies (standards efficiency in some sectors, standards limitations, standards and innovation); emissions quotas and market instruments (Kyoto protocol and CO2 market, the future of 'cap and trade' and of individual and regional quotas); carbon tax, fiscal instruments and new regulations (carbon tax as an alternative or a complement, other fiscal and para-fiscal instruments, new regulation instruments); investing in climate (managing the transition, governments as transition administrators). (J.S)

  16. 22 CFR 9a.4 - Classification.

    Science.gov (United States)

    2010-04-01

    ... State shall follow the standards in E.O. 11652 and the provisions of 22 CFR 9.5 through 9.8. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification. 9a.4 Section 9a.4 Foreign... ENERGY PROGRAMS; RELATED MATERIAL § 9a.4 Classification. (a) Section 1 of E.O. 11932, August 4,...

  17. Carbon based prosthetic devices

    Energy Technology Data Exchange (ETDEWEB)

    Devlin, D.J.; Carroll, D.W.; Barbero, R.S.; Archuleta, T. [Los Alamos National Lab., NM (US); Klawitter, J.J.; Ogilvie, W.; Strzepa, P. [Ascension Orthopedics (US); Cook, S.D. [Tulane Univ., New Orleans, LA (US). School of Medicine

    1998-12-31

    This is the final report of a one-year, Laboratory Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL). The project objective was to evaluate the use of carbon/carbon-fiber-reinforced composites for use in endoprosthetic devices. The application of these materials for the metacarpophalangeal (MP) joints of the hand was investigated. Issues concerning mechanical properties, bone fixation, biocompatibility, and wear are discussed. A system consisting of fiber reinforced materials with a pyrolytic carbon matrix and diamond-like, carbon-coated wear surfaces was developed. Processes were developed for the chemical vapor infiltration (CVI) of pyrolytic carbon into porous fiber preforms with the ability to tailor the outer porosity of the device to provide a surface for bone in-growth. A method for coating diamond-like carbon (DLC) on the articulating surface by plasma-assisted chemical vapor deposition (CVD) was developed. Preliminary results on mechanical properties of the composite system are discussed and initial biocompatibility studies were performed.

  18. Visible absorptions of potential diffuse ISM hydrocarbons: C$_9$H$_9$ and C$_9$H$_5$ radicals

    CERN Document Server

    Steglich, Mathias; Maier, John P

    2016-01-01

    The laboratory detection of previously unobserved resonance-stabilized C$_9$H$_5$ and C$_9$H$_9$ radicals in the supersonic expansion of a hydrocarbon discharge source is reported. The radicals are tentatively assigned as acetylenic-substituted cyclopentadienyl C$_9$H$_5$ and vinyl-substituted benzyl C$_9$H$_9$ species. They are found to feature visible absorption bands that coincide with a few very weak diffuse interstellar bands toward HD183143 and HD204827.

  19. Black carbon in marine sediments

    NARCIS (Netherlands)

    Middelburg, J.J.; Nieuwenhuize, J.; Van Breugel, P.

    1999-01-01

    Concentrations of black carbon were determined for a number of marine sediments. A comparison of black carbon based on thermal oxidation and hot concentrated nitric acid pretreatments revealed that the latter significantly overestimates combustion derived carbon phases. Black carbon accounts for abo

  20. Nano-Carbons as Theranostics

    Directory of Open Access Journals (Sweden)

    Zhuang Liu, Xing-Jie Liang

    2012-01-01

    Full Text Available Nano-carbons, including fullerenes, carbon nanoparticles, carbon nanotubes, graphene, and nano-diamonds, are an important class of nanostructures attracting tremendous interests in the past two decades. In this special issue, seven review articles and research reports are collected, to summarize and present the latest progress in the exploration of various nano-carbons for theranostic applications.

  1. Method for synthesizing carbon nanotubes

    Science.gov (United States)

    Fan, Hongyou

    2012-09-04

    A method for preparing a precursor solution for synthesis of carbon nanomaterials, where a polar solvent is added to at least one block copolymer and at least one carbohydrate compound, and the precursor solution is processed using a self-assembly process and subsequent heating to form nanoporous carbon films, porous carbon nanotubes, and porous carbon nanoparticles.

  2. Carbon balance of Russian agricultural land

    Science.gov (United States)

    Schepaschenko, D.; Shvidenko, A.; Schepaschenko, M.

    2012-04-01

    Russia managed 218.7 mln ha agricultural land (2009) in accordance with national statistics (FSSS, 2011: http://www.gks.ru/dbscripts/Cbsd/DBInet.cgi#1). Among that, 91.75 mln ha is arable land; 92.05 mln ha - hayfield and pasture; 34.9 mln ha - abandoned arable and fallow. Abandoned arable area is not indicated directly in the statistics, but can be calculated as a difference between "arable" and "cultivated" area. We estimated carbon balance of agricultural land by accounting carbon fluxes. Carbon sink includes: net primary productivity (NPP), applying fertilizes and liming. Carbon losses include soil respiration (SR), harvest and lateral flux. The initial data (cultivated area and harvest distribution by regions and crop) was derived from national agriculture statistics (FSSS, 2011). NPP was estimated via harvest and set of regression models. Average NPP for agricultural land was estimated at 435 g C m-2 (530 g C m-2 for crops). Soil respiration was calculated by a model (Mukhortova et. al., 1011: http://www.iiasa.ac.at/Research/FOR/forest_cdrom/Articles/Mukhortova_2011_IBFRA_SR.pdf) developed for Russia which is based on all available empirical data and accounted for climatic parameters, soil type and management practice. Average SR of agricultural land is 344 g C m-2 (372 g C m-2 for the cropland). We applied the IPCC method (National inventory, 2010; IPCC, 2006) for fertilizer and lateral fluxes assessment. The total carbon balance of agricultural land is almost in equilibrium (-0.04 t C ha-1) in spite of arable land is a carbon source (-0.84 t C ha-1). The highest sink (1.21 t C ha-1) is provided by abandoned land. Carbon fluxes vary substantially depending on seasonal weather conditions. For example grains' NPP in 2010 (dry and hot summer in major agricultural regions of European Russia) was estimated at 32% less compare to 2009 and the total carbon balance of this land category decreased by order of magnitude. We used Russian land cover (Schepaschenko et al

  3. Stocks of organic carbon in Estonian soils

    Directory of Open Access Journals (Sweden)

    Kõlli, Raimo

    2009-06-01

    Full Text Available The soil organic carbon (SOC stocks (Mg ha–1 ofautomorphic mineral (9 soil groups, hydromorphic mineral (7, and lowland organic soils (4 are given for the soil cover or solum layer as a whole and also for its epipedon (topsoil layer. The SOC stocks for forest, arable lands, and grasslands and for the entire Estonian soil cover were calculated on the basis of the mean SOC stock and distribution area of the respective soil type. In the Estonian soil cover (42 400 km2, a total of 593.8 ± 36.9 Tg of SOC is retained, with 64.9% (385.3 ± 27.5 Tg in the epipedon layer (O, H, and A horizons and 35.1% in the subsoil (B and E horizons. The pedo-ecological regularities of SOC retention in soils are analysed against the background of the Estonian soil ordination net.

  4. Aspects of carbon dioxide utilization

    Energy Technology Data Exchange (ETDEWEB)

    Omae, Iwao [Omae Research Laboratories, 335-23 Mizuno, Sayama, Saitama 350-1317 (Japan)

    2006-06-30

    Carbon dioxide reacts with hydrogen, alcohols, acetals, epoxides, amines, carbon-carbon unsaturated compounds, etc. in supercritical carbon dioxide or in other solvents in the presence of metal compounds as catalysts. The products of these reactions are formic acid, formic acid esters, formamides, methanol, dimethyl carbonate, alkylene carbonates, carbamic acid esters, lactones, carboxylic acids, polycarbonate (bisphenol-based engineering polymer), aliphatic polycarbonates, etc. Especially, the productions of formic acid, formic acid methyl ester and dimethylformamide with a ruthenium catalyst; dimethyl carbonate and urethanes with a dialkyltin catalyst; 2-pyrone with a nickel-phosphine catalyst; diphenyl carbonate with a lead phenoxide catalyst; the alternating copolymerization of carbon dioxide and epoxides with a zinc catalyst has attracted attentions as the industrial utilizations of carbon dioxide. The further development of these production processes is expected. (author)

  5. Inorganic carbon acquisition in red tide dinoflagellates.

    Science.gov (United States)

    Rost, Björn; Richter, Klaus-Uwe; Riebesell, Ulf; Hansen, Per Juel

    2006-05-01

    Carbon acquisition was investigated in three marine bloom-forming dinollagellates-Prorocentrum minimum, Heterocapsa triquetra and Ceratium lineatum. In vivo activities of extracellular and intracellular carbonic anhydrase (CA), photosynthetic O2 evolution, CO2 and HCO3- uptake rates were measured by membrane inlet mass spectrometry (MIMS) in cells acclimated to low pH (8.0) and high pH (8.5 or 9.1). A second approach used short-term 14C-disequilibrium incubations to estimate the carbon source utilized by the cells. All three species showed negligible extracellular CA (eCA) activity in cells acclimated to low pH and only slightly higher activity when acclimated to high pH. Intracellular CA (iCA) activity was present in all three species, but it increased only in P. minimum with increasing pH. Half-saturation concentrations (K1/2) for photosynthetic O2 evolution were low compared to ribulose 1,5-bisphosphate carboxylase/oxygenase (Rubisco) kinetics. Moreover, apparent affinities for inorganic carbon (Ci) increased with increasing pH in the acclimation, indicating the operation of an efficient CO2 concentration mechanism (CCM) in these dinoflagellates. Rates of CO2 uptake were comparably low and could not support the observed rates of photosynthesis. Consequently, rates of HCO3- uptake were high in the investigated species, contributing more than 80% of the photosynthetic carbon fixation. The affinity for HCO3- and maximum uptake rates increased under higher pH. The strong preference for HCO3- was also confirmed by the 14C-disequilibrium technique. Modes of carbon acquisition were consistent with the 13C-fractionation pattern observed and indicated a strong species-specific difference in leakage. These results suggest that photosynthesis in marine dinoflagellates is not limited by Ci even at high pH, which may occur during red tides in coastal waters. PMID:17087465

  6. The global carbon budget 1959–2011

    Directory of Open Access Journals (Sweden)

    C. Le Quéré

    2012-12-01

    Full Text Available Accurate assessment of anthropogenic carbon dioxide (CO2 emissions and their redistribution among the atmosphere, ocean, and terrestrial biosphere is important to better understand the global carbon cycle, support the climate policy process, and project future climate change. Present-day analysis requires the combination of a range of data, algorithms, statistics and model estimates and their interpretation by a broad scientific community. Here we describe datasets and a methodology developed by the global carbon cycle science community to quantify all major components of the global carbon budget, including their uncertainties. We discuss changes compared to previous estimates, consistency within and among components, and methodology and data limitations. Based on energy statistics, we estimate that the global emissions of CO2 from fossil fuel combustion and cement production were 9.5 ± 0.5 PgC yr−1 in 2011, 3.0 percent above 2010 levels. We project these emissions will increase by 2.6% (1.9–3.5% in 2012 based on projections of Gross World Product and recent changes in the carbon intensity of the economy. Global net CO2 emissions from Land-Use Change, including deforestation, are more difficult to update annually because of data availability, but combined evidence from land cover change data, fire activity in regions undergoing deforestation and models suggests those net emissions were 0.9 ± 0.5 PgC yr−1 in 2011. The global atmospheric CO2 concentration is measured directly and reached 391.38 ± 0.13 ppm at the end of year 2011, increasing 1.70 ± 0.09 ppm yr−1 or 3.6 ± 0.2 PgC yr−1 in 2011. Estimates from four ocean models suggest that the ocean CO2 sink was 2.6 ± 0.5 PgC yr−1 in 2011, implying a global residual terrestrial CO2 sink of 4.1 ± 0.9 PgC yr−1. All uncertainties are reported as ±1

  7. The Origin of Magnetite Crystals in ALH84001 Carbonate Disks

    Science.gov (United States)

    Thomas-Keprta, K. L.; Clemett, S. J.; Wentworth, S. J.; McKay, D. S.; Gibson, E. K., Jr.

    2012-01-01

    Martian meteorite ALH84001 preserves evidence of interaction with aqueous fluids while on Mars in the form of microscopic carbonate disks believed to have formed approx 3.9 Ga ago at beginning of the Noachian epoch. Intimately associated within and throughout these carbonate disks are nanocrystal magnetites (Fe3O4) with unusual chemical and physical properties, whose origins have become the source of considerable debate. One group of hypotheses argues that these magnetites are the product of partial thermal decomposition of the host carbonate. Alternatively, the origins of magnetite and carbonate may be unrelated; that is, from the perspective of the carbonate the magnetite is allochthonous. We have sought to resolve between these hypotheses through the detailed characterized of the compositional and structural relationships between the carbonate disks, their associated magnetites and the orthopyroxene matrix in which they are embedded. Comparison of these results with experimental thermal decomposition studies of sideritic carbonates conducted under a range of heating scenarios suggests that the magnetite nanocrystals in the ALH84001 carbonate disks are not the products of thermal decomposition.

  8. A kind of carbon whiskers in new structure and morphology

    Institute of Scientific and Technical Information of China (English)

    DONG; Jian

    2001-01-01

    [1]Endo, M., Saito, R., Dresselhaus, M. S. et al. From carbon fibers to nanotubes, in Carbon Nanotubes Preparations and Properties (ed. Ebbesen, T. W.), New York: CRC Press Inc., 1997, 54-66.[2]Baker, R. T. K., Baker, M. A., Harris, P. S. et al., Nucleation and growth of carbon deposits from the nickel catalyzed de-composition of acetylene, J.Catal., 1972, 26(7): 51.[3]Audier, M., Coulon, M., Kinetic and microscopic aspects of catalytic carbon growth, Carbon, 1985, 23(3): 317.[4]Oberlin, A., Endo, M., Koyama, T., High resolution microscope observations of graphitized carbon fibers, Carbon, 1976, 14(1): 133.[5]Bacon, R., Growth, structure, and properties of graphite whiskers, Journal of Applied Physics, 1960, 31(2): 283.[6]Murayama, H., Maeda, M., A novel form of filamentous graphite, Nature, 1990, 345(28): 791.[7]Pimpinelli, A., Villain, J., Physics of Crystal Growth, New York: Cambridge University Press, 1998, 62-64.[8]Minkoff, I., Solidification and Cast Structure, Chichester: Wiley, 1986, 42-47.[9]Pierson, H. O., Handbook of Carbon, Graphite, Diamond, and Fullerenes: Properties, Processing, and Applications, Park Ridge: Noyes Publications, 1993, 151.[10]Bennema, P., Spiral growth and surface roughing: Developments since Burton, Cabrera and Frank, Journal of Crystal Growth, 1984, 69(2): 182.

  9. Surface State of Carbon Fibers Modified by Electrochemical Oxidation

    Institute of Scientific and Technical Information of China (English)

    Yunxia GUO; Jie LIU; Jieying LIANG

    2005-01-01

    Surface of polyacrylonitrile (PAN)-based carbon fibers was modified by electrochemical oxidation. The modification effect on carbon fibers surface was explored using atomic force microscopy (AFM), X-ray photoelectron spectroscopy (XPS) and X-ray diffraction (XRD). Results showed that on the modified surface of carbon fibers, the carbon contents decreased by 9.7% and the oxygen and nitrogen contents increased by 53.8% and 7.5 times, respectively. The surface roughness and the hydroxyl and carbonyl contents also increased. The surface orientation index was reduced by 1.5%which decreased tensile strength of carbon fibers by 8.1%, and the microcrystalline dimension also decreased which increased the active sites of carbon fiber surface by 78%. The physical and chemical properties of carbon fibers surface were modified through the electrochemical oxidative method, which improved the cohesiveness between the fibers and resin matrix and increased the interlaminar shear strength (ILSS) of carbon fibers reinforced epoxy composite (CFRP) over 20%.

  10. Investigating carbonate formation in urban soils as a method for capture and storage of atmospheric carbon

    International Nuclear Information System (INIS)

    This paper investigates the potential for engineered urban soils to capture and store atmospheric carbon (C). Calcium (Ca) and magnesium (Mg) bearing waste silicate minerals within the soil environment can capture and store atmospheric C through the process of weathering and secondary carbonate mineral precipitation. Anthropogenic soils, known to contain substantial quantities of Ca and Mg-rich minerals derived from demolition activity (particularly cement and concrete), were systematically sampled at the surface across a 10 ha brownfield site, Science Central, located in the urban centre of Newcastle upon Tyne, U.K. Subsequent analysis yielded average carbonate contents of 21.8 ± 4.7% wt CaCO3. Isotopic analysis demonstrated δ18O values between − 9.4‰ and − 13.3‰ and δ13C values between − 7.4‰ and − 13.6‰ (relative to Pee Dee Belemnite), suggesting that up to 39.4 ± 8.8% of the carbonate C has been captured from the atmosphere through hydroxylation of dissolved CO2 in high pH solutions. The remaining carbonate C is derived from lithogenic sources. 37.4 kg of atmospheric CO2 has already been captured and stored as carbonate per Mg of soil across the site, representing a carbon dioxide (CO2) removal rate of 12.5 kgCO2 Mg−1 yr−1. There is the potential for capture and storage of a further 27.3 kgCO2 Mg−1 in residual reactive materials, which may be exploited through increased residence time (additional in situ weathering). Overall, the Science Central site has the potential to capture and store a total of 64,800 Mg CO2 as carbonate minerals. This study illustrates the potential for managing urban soils as tools of C capture and storage, an important ecosystem service, and demonstrates the importance of studying C storage in engineering urban anthropogenic soils. Highlights: ► Urban soils potentially capture 12.5 kgCO2 Mg−1 yr−1 (value £51,843–£77,765 ha−1). ► Formation of carbonate may be significant and exploitable storage

  11. Erosion of Organic Carbon from Permafrost Zones in the Arctic as a Geological Carbon Dioxide Sink

    Science.gov (United States)

    Hilton, R. G.; Galy, V.; Gaillardet, J.; Dellinger, M.; Bryant, C.; O'Regan, M.; Gröcke, D. R.; Coxall, H.; Bouchez, J.; Calmels, D.

    2015-12-01

    Soils of the northern high latitudes store carbon over millennial timescales and contain almost double the carbon stock of the atmosphere. The exposure and decomposition of aged organic matter in these soils is a carbon dioxide (CO2) source to the atmosphere. Permafrost thaw over the coming century may result in a significant CO2 release. However, some of this soil organic carbon in permafrost zones can be eroded and input to rivers. If it escapes degradation during river transport and is buried in ocean sediments, it instead contributes to a longer-term (>104 yr), geological CO2sink. Despite this recognition, the erosional flux and fate of particulate organic carbon (POC) in large rivers draining permafrost zones remains poorly constrained. We quantify POC source, flux and fate in the Mackenzie River Basin, the main sediment supplier to the Arctic Ocean, using radiocarbon, stable carbon isotopes and element ratios to correct for rock-derived POC. The eroded biospheric POC has resided in the basin for millennia, with a mean radiocarbon age of 5800±800 yr. Rivers eroding continuous permafrost zones contribute the oldest biospheric POC. Based on the measured biospheric POC content and annual sediment flux, we calculate a biospheric POC flux of 2.2 (+1.3/-0.9) TgC yr-1 from the Mackenzie River to the Arctic Ocean, three times the CO2 drawdown by silicate weathering. Offshore we find evidence for efficient terrestrial carbon burial over the Holocene period. Our findings demonstrate how erosion of organic carbon-rich, high latitude soils can result in a significant geological CO2sink. We postulate that this geological CO2 sink is sensitive to climate conditions in the Arctic. The transfer can operate when high latitudes host carbon stocks in soil, and while rivers can erode and transfer sediments to the Arctic Ocean. Over the last 1Ma, the erosional transfer was likely to have been enhanced during interglacials. We propose that erosion of biospheric carbon by large

  12. Characterization of the tank 51 alternate reductant sludge batch 9 slurry sample (HTF-51-15-130)

    Energy Technology Data Exchange (ETDEWEB)

    Reboul, S. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-02-01

    Tank 51 slurry sample HTF-51-15-130 was collected following sludge washing at the Tank Farm. The sample was received at SRNL and then characterized in preparation for qualification of the alternate reductant Sludge Batch 9 (SB9) flowsheet. In this characterization, densities, solids distribution, elemental constituents, anionic constituents, carbon content, and select radioisotopes were quantified.

  13. Organic modification of carbon nanotubes

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The organic modification of carbon nanotubes is a novel research field being developed recently. In this article, the history and newest progress of organic modification of carbon nanotubes are reviewed from two aspects:organic covalent modification and organic noncovalent modification of carbon nanotubes. The preparation and properties of organic modified carbon nanotubes are discussed in detail. In addition, the prospective development of organic modification of carbon nanotubes is suggested.

  14. Microwave absorption properties of helical carbon nanofibers-coated carbon fibers

    Directory of Open Access Journals (Sweden)

    Lei Liu

    2013-08-01

    Full Text Available Helical carbon nanofibers (HCNFs coated-carbon fibers (CFs were fabricated by catalytic chemical vapor deposition method. TEM and Raman spectroscopy characterizations indicate that the graphitic layers of the HCNFs changed from disorder to order after high temperature annealing. The electromagnetic parameters and microwave absorption properties were measured at 2–18 GHz. The maximum reflection loss is 32 dB at 9 GHz and the widest bandwidth under −10 dB is 9.8 GHz from 8.2 to 18 GHz for the unannealed HCNFs coated-CFs composite with 2.5 mm in thickness, suggesting that HCNFs coated-CFs should have potential applications in high performance microwave absorption materials.

  15. Highly stable perovskite solar cells with an all-carbon hole transport layer.

    Science.gov (United States)

    Wang, Feijiu; Endo, Masaru; Mouri, Shinichiro; Miyauchi, Yuhei; Ohno, Yutaka; Wakamiya, Atsushi; Murata, Yasujiro; Matsuda, Kazunari

    2016-06-01

    Nano-carbon materials (carbon nanotubes, graphene, and graphene oxide) have potential application for photovoltaics because of their excellent optical and electronic properties. Here, we demonstrate that a single-walled carbon nanotubes/graphene oxide buffer layer greatly improves the photovoltaic performance of organo-lead iodide perovskite solar cells. The carbon nanotubes/graphene oxide buffer layer works as an efficient hole transport/electron blocking layer. The photovoltaic conversion efficiency of 13.3% was achieved in the organo-lead iodide perovskite solar cell due to the complementary properties of carbon nanotubes and graphene oxide. Furthermore, the great improvement of photovoltaic performance stability in the perovskite solar cells using carbon nanotubes/graphene oxide/polymethyl methacrylate was demonstrated in comparison with that using a typical organic hole transport layer of 2,2',7,7'-tetrakis-(N,N-di-4-methoxyphenylamino)-9,9'-spirobifluorene.

  16. β-Thioxoketones. Part 9

    DEFF Research Database (Denmark)

    Berg, Ulf; Sandström, Jan; Carlsen, Lars;

    1983-01-01

    Thioacetylacetone (I), 2-acetylcyclohexanethione (II), and 2-thioacetylcyclohexanone (III) have been studied by dynamic 1H n.m.r. spectroscopy from ambient temperature down to ca. 130 K. The general co-existence of two tautomeric constituents has been established, and the constituents, in the cas...... of (I) and (III), directly observed. These were identified as the strongly chelated (Z)-enol form and the weakly chelated (Z)-enethiol form. Band-shape analysis provided ΔG‡(enol → enethiol) 8.9 ± 0.1 kcal mol–1 for (I) and 7.6 ± 0.1 kcal mol–1 for (III)....

  17. Spectators After 9/11

    OpenAIRE

    Diaz Gandasegui, Vicente

    2009-01-01

    The (un)reality of films was superseded by reality on 9/11 and therefore cinema required a different kind of perception to offer to the spectators as the boundaries of imagination became altered. The events that followed the devastation which occurred on the 11th September 2001 in New York affected the way in which we perceive films, transforming our symbolic and epistemological system. This episode was beyond our imagination, beyond our words and, in Lacanian terms, we can say that it was ne...

  18. DB2 9 for Developers

    CERN Document Server

    Gunning, Philip K

    2008-01-01

    Written by an "in-the-trenches" consultant, this guide hails the newest version of DB2 as a major release, highlighting the large number of totally new features, most notably the addition of XML capabilities. Packed with the information DB2 developers and administrators need to know when implementing version 9, the discussion covers upgrading from prior releases of DB2, converting relational data to XML data, and how DB2 supports industry standard schemas. With detailed examples and useful scripts, users learn how to develop DB2 XML applications, design an XML database, and tune the

  19. Advances in magnetic resonance 9

    CERN Document Server

    Waugh, John S

    2013-01-01

    Advances in Magnetic Resonance, Volume 9 describes the magnetic resonance in split constants and dipolar relaxation. This book discusses the temperature-dependent splitting constants in the ESR spectra of organic free radicals; temperature-dependent splittings in ion pairs; and magnetic resonance induced by electrons. The electron impact excitation of atoms and molecules; intramolecular dipolar relaxation in multi-spin systems; and dipolar cross-correlation problem are also elaborated. This text likewise covers the NMR studies of molecules oriented in thermotropic liquid crystals and diffusion

  20. Energy biotechnology in the CRISPR-Cas9 era.

    Science.gov (United States)

    Estrela, Raissa; Cate, Jamie Harrison Doudna

    2016-04-01

    The production of bioenergy from plant biomass previously relied on using microorganisms that rapidly and efficiently convert simple sugars into fuels and chemicals. However, to exploit the far more abundant carbon fixed in plant cell walls, future industrial production hosts will need to be engineered to leverage the most efficient biochemical pathways and most robust traits that can be found in nature. The CRISPR-Cas9 genome editing technology now enables writing the genome at will, which will allow biotechnology to become an 'information science.' This review covers recent advances in using CRISPR-Cas9 to engineer the genomes of a wide variety of organisms that could be use in the industrial production of biofuels and renewable chemicals.

  1. Carbon dioxide and climate

    International Nuclear Information System (INIS)

    Global climate change is a serious environmental concern, and the US has developed ''An Action Agenda'' to deal with it. At the heart of the US effort is the US Global Change Research Program (USGCRP), which has been developed by the Committee on Earth and Environmental Sciences (CEES) of the Federal Coordinating Council for Sciences, Engineering, and Technology (FCCSET). The USGCRP will provide the scientific basis for sound policy making on the climate-change issue. The DOE contribution to the USGCRP is the Carbon Dioxide Research Program, which now places particular emphasis on the rapid improvement of the capability to predict global and regional climate change. DOE's Carbon Dioxide Research Program has been addressing the carbon dioxide-climate change connection for more than twelve years and has provided a solid scientific foundation for the USGCRP. The expansion of the DOE effort reflects the increased attention that the Department has placed on the issue and is reflected in the National Energy Strategy (NES) that was released in 1991. This Program Summary describes projects funded by the Carbon Dioxide Research Program during FY 1991 and gives a brief overview of objectives, organization, and accomplishments. The Environmental Sciences Division of the Office of Health and Environmental Research, Office of Energy Research supports a Carbon Dioxide Research Program to determine the scientific linkage between the rise of greenhouse gases in the atmosphere, especially carbon dioxide, and climate and vegetation change. One facet is the Core CO2 Program, a pioneering program that DOE established more than 10 years ago to understand and predict the ways that fossil-fuel burning could affect atmospheric CO2 concentration, global climate, and the Earth's biosphere. Major research areas are: global carbon cycle; climate detection and models of climate change; vegetation research; resource analysis; and, information and integration

  2. Measurement of carbon capture efficiency and stored carbon leakage

    Science.gov (United States)

    Keeling, Ralph F.; Dubey, Manvendra K.

    2013-01-29

    Data representative of a measured carbon dioxide (CO.sub.2) concentration and of a measured oxygen (O.sub.2) concentration at a measurement location can be used to determine whether the measured carbon dioxide concentration at the measurement location is elevated relative to a baseline carbon dioxide concentration due to escape of carbon dioxide from a source associated with a carbon capture and storage process. Optionally, the data can be used to quantify a carbon dioxide concentration increase at the first location that is attributable to escape of carbon dioxide from the source and to calculate a rate of escape of carbon dioxide from the source by executing a model of gas-phase transport using at least the first carbon dioxide concentration increase. Related systems, methods, and articles of manufacture are also described.

  3. Terrestrial vegetation carbon sinks in China, 1981―2000

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Using China's ground observations, e.g., forest inventory, grassland resource, agricultural statistics, climate, and satellite data, we estimate terrestrial vegetation carbon sinks for China's major biomes between 1981 and 2000. The main results are in the following: (1) Forest area and forest biomass carbon (C) stock increased from 116.5×106 ha and 4.3 Pg C (1 Pg C = 1015 g C) in the early 1980s to 142.8×106 ha and 5.9 Pg C in the early 2000s, respectively. Forest biomass carbon density increased form 36.9 Mg C/ha (1 Mg C = 106 g C) to 41.0 Mg C/ha, with an annual carbon sequestration rate of 0.075 Pg C/a. Grassland, shrub, and crop biomass sequestrate carbon at annual rates of 0.007 Pg C/a, 0.014―0.024 Pg C/a, and 0.0125―0.0143 Pg C/a, respectively. (2) The total terrestrial vegetation C sink in China is in a range of 0.096―0.106 Pg C/a between 1981 and 2000, accounting for 14.6%―16.1% of carbon dioxide (CO2) emitted by China's industry in the same period. In addition, soil carbon sink is estimated at 0.04―0.07 Pg C/a. Accordingly, carbon sequestration by China's terrestrial ecosystems (vegetation and soil) offsets 20.8%―26.8% of its industrial CO2 emission for the study period. (3) Considerable uncertainties exist in the present study, especially in the estimation of soil carbon sinks, and need further intensive investigation in the future.

  4. The performance of four granular active carbons; Rendimiento de cuatro carbones activos granulares

    Energy Technology Data Exchange (ETDEWEB)

    Hontangas, P. A.; Morcillo Perez, J. L.

    1999-08-01

    The ability of granular active carbon (GAC) to absorb organic contaminants explains why is widely used in treating water for human consumption. This study used a pilot plant assess the efficiency of two vegetable and two mineral GACs in regard to the elimination of trihalomethanes, cloudiness and oxidisability. The iodine value was used to evaluate the loss of absorptions capacity of the different GACs. (Author) 9 refs.

  5. Carbon nanotube core graphitic shell hybrid fibers.

    Science.gov (United States)

    Hahm, Myung Gwan; Lee, Jae-Hwang; Hart, Amelia H C; Song, Sung Moo; Nam, Jaewook; Jung, Hyun Young; Hashim, Daniel Paul; Li, Bo; Narayanan, Tharangattu N; Park, Chi-Dong; Zhao, Yao; Vajtai, Robert; Kim, Yoong Ahm; Hayashi, Takuya; Ku, Bon-Cheol; Endo, Morinobu; Barrera, Enrique; Jung, Yung Joon; Thomas, Edwin L; Ajayan, Pulickel M

    2013-12-23

    A carbon nanotube yarn core graphitic shell hybrid fiber was fabricated via facile heat treatment of epoxy-based negative photoresist (SU-8) on carbon nanotube yarn. The effective encapsulation of carbon nanotube yarn in carbon fiber and a glassy carbon outer shell determines their physical properties. The higher electrical conductivity (than carbon fiber) of the carbon nanotube yarn overcomes the drawbacks of carbon fiber/glassy carbon, and the better properties (than carbon nanotubes) of the carbon fiber/glassy carbon make up for the lower thermal and mechanical properties of the carbon nanotube yarn via synergistic hybridization without any chemical doping and additional processes. PMID:24224730

  6. Carbon isotopic composition of individual Precambrian microfossils

    Science.gov (United States)

    House, C. H.; Schopf, J. W.; McKeegan, K. D.; Coath, C. D.; Harrison, T. M.; Stetter, K. O.

    2000-01-01

    Ion microprobe measurements of carbon isotope ratios were made in 30 specimens representing six fossil genera of microorganisms petrified in stromatolitic chert from the approximately 850 Ma Bitter Springs Formation, Australia, and the approximately 2100 Ma Gunflint Formation, Canada. The delta 13C(PDB) values from individual microfossils of the Bitter Springs Formation ranged from -21.3 +/- 1.7% to -31.9 +/- 1.2% and the delta 13C(PDB) values from microfossils of the Gunflint Formation ranged from -32.4 +/- 0.7% to -45.4 +/- 1.2%. With the exception of two highly 13C-depleted Gunflint microfossils, the results generally yield values consistent with carbon fixation via either the Calvin cycle or the acetyl-CoA pathway. However, the isotopic results are not consistent with the degree of fractionation expected from either the 3-hydroxypropionate cycle or the reductive tricarboxylic acid cycle, suggesting that the microfossils studied did not use either of these pathways for carbon fixation. The morphologies of the microfossils suggest an affinity to the cyanobacteria, and our carbon isotopic data are consistent with this assignment.

  7. Bioethanol from different Finnish agricultural carbon sources

    Energy Technology Data Exchange (ETDEWEB)

    Kautola, H.; Kymaelaeinen, M.; Tokeensuu, L.; Alatalo, T. (HAMK University of Applied Sciences, Degree Programme in Biotechnology and Food Engineering, Haemeenlinna (Finland)); Caerdenas, R. (Universidad Central del Ecuador, Facultad Ciencias Quimicas, Escuela de Quimica, Av. America. Ciudadela Universitaria, Quito (Ecuador)); Siukola, K.; Naesi, J. (Suomen Biojalostus Oy, Renko (Finland))

    2007-07-01

    Bioethanol in fuel and its domestic production has become a great issue in Finland during the last few years. There has been discussion about what kind of raw materials should be used and are there any local priorities. In the years 2004-2007 local farmers in Haem e , in southern part of Finland, started to find alternative use for sugar beet due to drastic reduction of domestic sugar production in the near future. This was also the start of the experimental studies on bi oethanol production. The aim of the study was to find out how the change of carbon source will effect on bi oethanol yield. The bioethanol production was studied in laboratory scale using carbon sources of saccharose, glucose, sugar beet juice, sugar beet mash and barley hydrolysates pretreated with amylases, (beta-glucanase and xylanase). The yeast used was Saccharomyces sp. The pre experiments were performed in 250 mL flasks to optimize carbon, nitrogen and salts contents in production medium, also comparing different carbon sources and mixtures. The production was then studied in a 30 liter fermenter running for 36 hours. The preliminary studies showed that barley hydrolysate gave the best result 2,4% in bioethanol concentration during the performed fermentations, and saccharose was the best substrate in shake flask fermentations with a 9,6% bioethanol concentration. (orig.)

  8. Carbon isotopic composition of individual Precambrian microfossils.

    Science.gov (United States)

    House, C H; Schopf, J W; McKeegan, K D; Coath, C D; Harrison, T M; Stetter, K O

    2000-08-01

    Ion microprobe measurements of carbon isotope ratios were made in 30 specimens representing six fossil genera of microorganisms petrified in stromatolitic chert from the approximately 850 Ma Bitter Springs Formation, Australia, and the approximately 2100 Ma Gunflint Formation, Canada. The delta 13C(PDB) values from individual microfossils of the Bitter Springs Formation ranged from -21.3 +/- 1.7% to -31.9 +/- 1.2% and the delta 13C(PDB) values from microfossils of the Gunflint Formation ranged from -32.4 +/- 0.7% to -45.4 +/- 1.2%. With the exception of two highly 13C-depleted Gunflint microfossils, the results generally yield values consistent with carbon fixation via either the Calvin cycle or the acetyl-CoA pathway. However, the isotopic results are not consistent with the degree of fractionation expected from either the 3-hydroxypropionate cycle or the reductive tricarboxylic acid cycle, suggesting that the microfossils studied did not use either of these pathways for carbon fixation. The morphologies of the microfossils suggest an affinity to the cyanobacteria, and our carbon isotopic data are consistent with this assignment.

  9. Carbon Nanotubes Synthesis Through Gamma Radiation

    Science.gov (United States)

    Tirado, Pablo; Garcia, Rafael; Montes, Jorge; Melendrez, Rodrigo; Barboza, Marcelino; Contreras, Oscar

    2015-03-01

    Carbon nanotubes show a great potential of applications since there discovery by Iijima in 1991[1] due to their numerous physical-chemical properties such as their high weight to strength relationship, which make them ideal to use in high resistance compound materials, and in many other applications[2] In this work, a novel method for the synthesis of carbon nanotubes is presented, starting from an ultra-thin sheet of graphite synthesized by the chemical vapor decomposition technique (CVD), using ultra high purity methane and hydrogen at 1200°C in a horizontal quartz reactor. For the synthesis of carbon nanotubes, the graphite sheets were exposed to different doses of radiation, with the objective of breaking the graphite bonds and form carbon nanotubes; a Gammacell equipment model 220 Excel was used for the purpose, which counts with a radiation source of cobalt 60, and a current radiation rate of 0.9 Gy/seconds. The time of exposure to radiation was varied in each sample, according to the desired dose of radiation in each case, afterwards the samples were characterized using the Raman spectroscopy and TEM microscopy techniques with the objective of observing the kind of nanotubes formed, their morphology and their number of defects. Results will be shown during the poster session.

  10. Highly stable perovskite solar cells with an all-carbon hole transport layer

    Science.gov (United States)

    Wang, Feijiu; Endo, Masaru; Mouri, Shinichiro; Miyauchi, Yuhei; Ohno, Yutaka; Wakamiya, Atsushi; Murata, Yasujiro; Matsuda, Kazunari

    2016-06-01

    Nano-carbon materials (carbon nanotubes, graphene, and graphene oxide) have potential application for photovoltaics because of their excellent optical and electronic properties. Here, we demonstrate that a single-walled carbon nanotubes/graphene oxide buffer layer greatly improves the photovoltaic performance of organo-lead iodide perovskite solar cells. The carbon nanotubes/graphene oxide buffer layer works as an efficient hole transport/electron blocking layer. The photovoltaic conversion efficiency of 13.3% was achieved in the organo-lead iodide perovskite solar cell due to the complementary properties of carbon nanotubes and graphene oxide. Furthermore, the great improvement of photovoltaic performance stability in the perovskite solar cells using carbon nanotubes/graphene oxide/polymethyl methacrylate was demonstrated in comparison with that using a typical organic hole transport layer of 2,2',7,7'-tetrakis-(N,N-di-4-methoxyphenylamino)-9,9'-spirobifluorene.Nano-carbon materials (carbon nanotubes, graphene, and graphene oxide) have potential application for photovoltaics because of their excellent optical and electronic properties. Here, we demonstrate that a single-walled carbon nanotubes/graphene oxide buffer layer greatly improves the photovoltaic performance of organo-lead iodide perovskite solar cells. The carbon nanotubes/graphene oxide buffer layer works as an efficient hole transport/electron blocking layer. The photovoltaic conversion efficiency of 13.3% was achieved in the organo-lead iodide perovskite solar cell due to the complementary properties of carbon nanotubes and graphene oxide. Furthermore, the great improvement of photovoltaic performance stability in the perovskite solar cells using carbon nanotubes/graphene oxide/polymethyl methacrylate was demonstrated in comparison with that using a typical organic hole transport layer of 2,2',7,7'-tetrakis-(N,N-di-4-methoxyphenylamino)-9,9'-spirobifluorene. Electronic supplementary information (ESI

  11. Studies in sublimation of tungsten single crystal (110) face and the influence of carbon

    Energy Technology Data Exchange (ETDEWEB)

    Dekhtyar, I.Ya.; Kolesnik, V.M.; Patoka, V.I.; Silant' ev, V.I.

    1975-12-01

    Evaporation of the tungsten single crystal (110) face was studied in ultrahigh vacuum (better than 1.10/sup -9/ Torr) using the Langmuir method. The influence of carbon impurities on the evaporation parameters was found out and carbon is shown to increase the sublimation energy by 25 kcal. The data obtained show that the parameters of tungsten evaporation available in literature should be related to carbon-containing materials.

  12. 2.9-1.9 Ga paleoalterations of Archean granitic basement of the Franceville basin (Gabon)

    Science.gov (United States)

    Mouélé, Idalina Moubiya; Dudoignon, Patrick; El Albani, Abderrazak; Meunier, Alain; Boulvais, Philippe; Gauthier-Lafaye, François; Paquette, Jean-Louis; Martin, Hervé; Cuney, Michel

    2014-09-01

    The Archean granitoids in the Kiéné area, Gabon, are overlained by the Paleoproterozoic sediments of the Franceville basin (2.1 Ga). The basin is known for its high-grade uranium deposits among which some have been forming natural nuclear fission reactors. Most of the studies were dedicated to the FA-FB Paleoproterozoic sediments hosting these uranium deposits. Little is known on the Archean basement itself and specifically on the hydrous alteration events it experienced before and after the sediment deposition. The present work is focused on their petrographical, mineralogical and geochemical characterization. Dating the successive alteration events has been attempted on altered monazite crystals. Rocks in different alteration states have been sampled from eight drill cores crosscutting the Archean - Paleoproterozoic unconformity. The Archean granitoids observed in the deepest levels exhibit typical petrographical features of a propylitic alteration while they are intensely illitized up to the unconformity. The propylitic alteration is mainly pervasive but the original texture of the granitoïds is conserved in spite of the formation of new minerals: Mg-chlorite, allanite and epidote forming a typical paragenesis. The illitic alteration is much more invasive near the unconformity. The illitization process leads to the replacement of feldspars and the corrosion of quartz crysals by an illitic matrix while the ferromagnesian minerals are pseudomorphosed by a Fe-chlorite + phengite + hematite assemblage. The final fluid-rock interaction step is marked by fissural deposits of calcite and anhydrite. The δ13C isotopic data show that the fissural carbonates precipitated from diagenetic fluids enriched carbon products deriving from the maturation of organic matter. The U-Pb isotopic analyzes performed on monazite crystals have dated three distinct events: 3.0-2.9 Ga (magmatic), 2.6 Ga (propylitic alteration) and 1.9 Ga (diagenetic illitization). The calculation of

  13. Organic carbon in the sediments of the lower reaches of Periar River

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, K.S.; Venugopal, P.; Sankaranarayanan, V.N.

    Sediments are indicators of the quality of water overlying them and hence, useful in the assessment of environmental pollution. Temporal and spatial variations in sediment characteristics and organic carbon content from 9 stations in the lower...

  14. Terrestrial Carbon Cycle Variability

    Science.gov (United States)

    Baldocchi, Dennis; Ryu, Youngryel; Keenan, Trevor

    2016-01-01

    A growing literature is reporting on how the terrestrial carbon cycle is experiencing year-to-year variability because of climate anomalies and trends caused by global change. As CO 2 concentration records in the atmosphere exceed 50 years and as satellite records reach over 30 years in length, we are becoming better able to address carbon cycle variability and trends. Here we review how variable the carbon cycle is, how large the trends in its gross and net fluxes are, and how well the signal can be separated from noise. We explore mechanisms that explain year-to-year variability and trends by deconstructing the global carbon budget. The CO 2 concentration record is detecting a significant increase in the seasonal amplitude between 1958 and now. Inferential methods provide a variety of explanations for this result, but a conclusive attribution remains elusive. Scientists have reported that this trend is a consequence of the greening of the biosphere, stronger northern latitude photosynthesis, more photosynthesis by semi-arid ecosystems, agriculture and the green revolution, tropical temperature anomalies, or increased winter respiration. At the global scale, variability in the terrestrial carbon cycle can be due to changes in constituent fluxes, gross primary productivity, plant respiration and heterotrophic (microbial) respiration, and losses due to fire, land use change, soil erosion, or harvesting. It remains controversial whether or not there is a significant trend in global primary productivity (due to rising CO 2, temperature, nitrogen deposition, changing land use, and preponderance of wet and dry regions). The degree to which year-to-year variability in temperature and precipitation anomalies affect global primary productivity also remains uncertain. For perspective, interannual variability in global gross primary productivity is relatively small (on the order of 2 Pg-C y -1) with respect to a large and uncertain background (123 +/- 4 Pg-C y -1), and

  15. Carbon fuel particles used in direct carbon conversion fuel cells

    Science.gov (United States)

    Cooper, John F.; Cherepy, Nerine

    2012-10-09

    A system for preparing particulate carbon fuel and using the particulate carbon fuel in a fuel cell. Carbon particles are finely divided. The finely dividing carbon particles are introduced into the fuel cell. A gas containing oxygen is introduced into the fuel cell. The finely divided carbon particles are exposed to carbonate salts, or to molten NaOH or KOH or LiOH or mixtures of NaOH or KOH or LiOH, or to mixed hydroxides, or to alkali and alkaline earth nitrates.

  16. Synthesis of carbon nanofibers on impregnated powdered activated carbon as cheap substrate

    Directory of Open Access Journals (Sweden)

    A.A. Mamun

    2016-07-01

    Full Text Available The catalysis and characterization of carbon nanofibers (CNFs composite are reported in this work. Carbon nanofibers were produced on oil palm shell powdered activated carbon (PAC, which was impregnated with nickel. Chemical Vapor Deposition (CVD of C2H2 was used in the presence of hydrogen at ∼650 °C. The flow rates of carbon source and hydrogen were fixed. The CNFs formed directly on the surface of the impregnated PAC. Variable weight percentages (1%, 3%, 5%, 7% and 9% of the catalyst salt (Ni+2 were used for the impregnation. However, the best catalysis was observed on the substrate with 3% Ni+2. The product displayed a relatively high surface area, essentially constituted by the external surface. New functional groups also appeared compared to those in the PAC. Field Emission Scanning Microscopy (FESEM, Transmission Electron Microscopy (TEM, Fourier Transform Infrared (FTIR, BET surface area analysis and energy dispersive X-ray (EDX were used for the characterization of the new carbon nano product, which was produced through a clean novel process.

  17. Asphalt-derived high surface area activated porous carbons for carbon dioxide capture.

    Science.gov (United States)

    Jalilov, Almaz S; Ruan, Gedeng; Hwang, Chih-Chau; Schipper, Desmond E; Tour, Josiah J; Li, Yilun; Fei, Huilong; Samuel, Errol L G; Tour, James M

    2015-01-21

    Research activity toward the development of new sorbents for carbon dioxide (CO2) capture have been increasing quickly. Despite the variety of existing materials with high surface areas and high CO2 uptake performances, the cost of the materials remains a dominant factor in slowing their industrial applications. Here we report preparation and CO2 uptake performance of microporous carbon materials synthesized from asphalt, a very inexpensive carbon source. Carbonization of asphalt with potassium hydroxide (KOH) at high temperatures (>600 °C) yields porous carbon materials (A-PC) with high surface areas of up to 2780 m(2) g(-1) and high CO2 uptake performance of 21 mmol g(-1) or 93 wt % at 30 bar and 25 °C. Furthermore, nitrogen doping and reduction with hydrogen yields active N-doped materials (A-NPC and A-rNPC) containing up to 9.3% nitrogen, making them nucleophilic porous carbons with further increase in the Brunauer-Emmett-Teller (BET) surface areas up to 2860 m(2) g(-1) for A-NPC and CO2 uptake to 26 mmol g(-1) or 114 wt % at 30 bar and 25 °C for A-rNPC. This is the highest reported CO2 uptake among the family of the activated porous carbonaceous materials. Thus, the porous carbon materials from asphalt have excellent properties for reversibly capturing CO2 at the well-head during the extraction of natural gas, a naturally occurring high pressure source of CO2. Through a pressure swing sorption process, when the asphalt-derived material is returned to 1 bar, the CO2 is released, thereby rendering a reversible capture medium that is highly efficient yet very inexpensive. PMID:25531980

  18. Asphalt-derived high surface area activated porous carbons for carbon dioxide capture.

    Science.gov (United States)

    Jalilov, Almaz S; Ruan, Gedeng; Hwang, Chih-Chau; Schipper, Desmond E; Tour, Josiah J; Li, Yilun; Fei, Huilong; Samuel, Errol L G; Tour, James M

    2015-01-21

    Research activity toward the development of new sorbents for carbon dioxide (CO2) capture have been increasing quickly. Despite the variety of existing materials with high surface areas and high CO2 uptake performances, the cost of the materials remains a dominant factor in slowing their industrial applications. Here we report preparation and CO2 uptake performance of microporous carbon materials synthesized from asphalt, a very inexpensive carbon source. Carbonization of asphalt with potassium hydroxide (KOH) at high temperatures (>600 °C) yields porous carbon materials (A-PC) with high surface areas of up to 2780 m(2) g(-1) and high CO2 uptake performance of 21 mmol g(-1) or 93 wt % at 30 bar and 25 °C. Furthermore, nitrogen doping and reduction with hydrogen yields active N-doped materials (A-NPC and A-rNPC) containing up to 9.3% nitrogen, making them nucleophilic porous carbons with further increase in the Brunauer-Emmett-Teller (BET) surface areas up to 2860 m(2) g(-1) for A-NPC and CO2 uptake to 26 mmol g(-1) or 114 wt % at 30 bar and 25 °C for A-rNPC. This is the highest reported CO2 uptake among the family of the activated porous carbonaceous materials. Thus, the porous carbon materials from asphalt have excellent properties for reversibly capturing CO2 at the well-head during the extraction of natural gas, a naturally occurring high pressure source of CO2. Through a pressure swing sorption process, when the asphalt-derived material is returned to 1 bar, the CO2 is released, thereby rendering a reversible capture medium that is highly efficient yet very inexpensive.

  19. 9th International ISAAC Congress

    CERN Document Server

    Ruzhansky, Michael

    2015-01-01

    This book is a collection of papers from the 9th International ISAAC Congress held in 2013 in Kraków, Poland. The papers are devoted to recent results in mathematics, focused on analysis and a wide range of its applications. These include up-to-date findings of  the following topics: - Differential Equations: Complex and Functional Analytic Methods - Nonlinear PDE - Qualitative Properties of Evolution Models - Differential and Difference Equations - Toeplitz Operators - Wavelet Theory - Topological and Geometrical Methods of Analysis - Queueing Theory and Performance Evaluation of Computer Networks - Clifford and Quaternion Analysis - Fixed Point Theory - M-Frame Constructions - Spaces of Differentiable Functions of Several Real Variables Generalized Functions - Analytic Methods in Complex Geometry - Topological and Geometrical Methods of Analysis - Integral Transforms and Reproducing Kernels - Didactical Approaches to Mathematical Thinking Their wide applications in biomathematics, mechanics, queueing mode...

  20. Flexible Carbon Aerogels

    Directory of Open Access Journals (Sweden)

    Marina Schwan

    2016-09-01

    Full Text Available Carbon aerogels are highly porous materials with a large inner surface area. Due to their high electrical conductivity they are excellent electrode materials in supercapacitors. Their brittleness, however, imposes certain limitations in terms of applicability. In that context, novel carbon aerogels with varying degree of flexibility have been developed. These highly porous, light aerogels are characterized by a high surface area and possess pore structures in the micrometer range, allowing for a reversible deformation of the aerogel network. A high ratio of pore size to particle size was found to be crucial for high flexibility. For dynamic microstructural analysis, compression tests were performed in-situ within a scanning electron microscope allowing us to directly visualize the microstructural flexibility of an aerogel. The flexible carbon aerogels were found to withstand between 15% and 30% of uniaxial compression in a reversible fashion. These findings might stimulate further research and new application fields directed towards flexible supercapacitors and batteries.

  1. Securing tropical forest carbon

    DEFF Research Database (Denmark)

    Scharlemann, Jörn P. W.; Kapos, Valerie; Campbell, Alison;

    2010-01-01

    Forest loss and degradation in the tropics contribute 6-17% of all greenhouse gas emissions. Protected areas cover 217.2 million ha (19.6%) of the world's humid tropical forests and contain c. 70.3 petagrams of carbon (Pg C) in biomass and soil to 1 m depth. Between 2000 and 2005, we estimate...... that 1.75 million ha of forest were lost from protected areas in humid tropical forests, causing the emission of 0.25-0.33 Pg C. Protected areas lost about half as much carbon as the same area of unprotected forest. We estimate that the reduction of these carbon emissions from ongoing deforestation......, although certainly not sufficient, component of an overall strategy for reducing emissions from deforestation and forest degradation (REDD)...

  2. Pyrolyzed carbon film diodes.

    Science.gov (United States)

    Morton, Kirstin C; Tokuhisa, Hideo; Baker, Lane A

    2013-11-13

    We have previously reported pyrolyzed parylene C (PPC) as a conductive carbon electrode material for use with micropipets, atomic force microscopy probes, and planar electrodes. Advantages of carbon electrode fabrication from PPC include conformal coating of high-aspect ratio micro/nanoscale features and the benefits afforded by chemical vapor deposition of carbon polymers. In this work, we demonstrate chemical surface doping of PPC through the use of previously reported methods. Chemically treated PPC films are characterized by multiple spectroscopic and electronic measurements. Pyrolyzed parylene C and doped PPC are used to construct diodes that are examined as both p-n heterojunction and Schottky barrier diodes. Half-wave rectification is achieved with PPC diodes and demonstrates the applicability of PPC as a conductive and semiconductive material in device fabrication. PMID:24090451

  3. The global carbon budget 1959–2011

    Directory of Open Access Journals (Sweden)

    C. Le Quéré

    2013-05-01

    Full Text Available Accurate assessments of anthropogenic carbon dioxide (CO2 emissions and their redistribution among the atmosphere, ocean, and terrestrial biosphere is important to better understand the global carbon cycle, support the climate policy process, and project future climate change. Present-day analysis requires the combination of a range of data, algorithms, statistics and model estimates and their interpretation by a broad scientific community. Here we describe datasets and a methodology developed by the global carbon cycle science community to quantify all major components of the global carbon budget, including their uncertainties. We discuss changes compared to previous estimates, consistency within and among components, and methodology and data limitations. CO2 emissions from fossil fuel combustion and cement production (EFF are based on energy statistics, while emissions from Land-Use Change (ELUC, including deforestation, are based on combined evidence from land cover change data, fire activity in regions undergoing deforestation, and models. The global atmospheric CO2 concentration is measured directly and its rate of growth (GATM is computed from the concentration. The mean ocean CO2 sink (SOCEAN is based on observations from the 1990s, while the annual anomalies and trends are estimated with ocean models. Finally, the global residual terrestrial CO2 sink (SLAND is estimated by the difference of the other terms. For the last decade available (2002–2011, EFF was 8.3 ± 0.4 PgC yr−1, ELUC 1.0 ± 0.5 PgC yr−1, GATM 4.3 ± 0.1PgC yr−1, SOCEAN 2.5 ± 0.5 PgC yr−1, and SLAND 2.6 ± 0.8 PgC yr−1. For year 2011 alone, EFF was 9.5 ± 0.5 PgC yr−1, 3.0 percent above 2010, reflecting a continued trend in these emissions; ELUC was 0.9 ± 0.5 PgC yr−1, approximately constant throughout the decade; GATM was 3.6 ± 0.2 PgC yr−1, SOCEAN was 2.7 ± 0.5 PgC yr−1, and SLAND was 4.1 ± 0.9 PgC yr−1. GATM was low in 2011

  4. Environmental Protection Implementation Plan, November 9, 1991--November 9, 1992

    International Nuclear Information System (INIS)

    DOE Order 5400.1, ''General Environmental Protection Program,'' established environmental protection program requirements, authorities, and responsibilities to assure that the Department of Energy (DOE) operations are in compliance with applicable federal, state, and local environmental protection laws and regulations, executive orders, and internal department policies. Chapter 3 of DOE Order 5400.1 required that each field organization prepare a plan for implementing the requirements of this order by no later than November 9, 1989, and update the plan annually. Therefore, the Department of Energy/Field Office, Nevada (DOE/NV) has prepared this second annual update of its Environmental Protection Implementation Plan (EPIP). The Order and corresponding guidances also require estimated budgetary resources necessary for implementation of the Order be identified in the Environmental Protection Implementation Plan. To satisfy this requirement, the estimated costs to effectuate necessary changes in existing programs or processes and to institute new programs or processes for compliance with the Order are provided in the following sections of this plan. The DOE/NV Assistant Manager for Operations (AMO), in consultation with other organizations responsible for line management of plan implementation, is responsible for annual plan revisions. 7 figs

  5. NANOTR9: 9th Nanoscience and Nanotechnology Conference

    Science.gov (United States)

    2014-11-01

    The conference series NanoTR is the major conference on nanoscience and nanotechnology in Turkey. It brings together leading scientists and engineers in nanotechnology to exchange information on their latest research progress. An exhibition of the companies working in the related field is also organized as a part of the event. With intensive international participation, NanoTR conference series has spread outside the national border and has become an international event in this field. Among international contributions, a wide interest from the countries around Turkey should be emphasized. 9th in the series was organized by Atatürk University in Erzurum-Turkey on June 24-28, 2013 with more than 900 scientists, researchers, private sector representatives from around the world. Conference program included 6 plenary speakers, 35 invited speakers (18 of them were from outside the country), 116 oral presentations, and 340 poster presentations. In addition to 6 plenary sessions, 17 oral and 4 poster sessions created very lively discussion forums covering a vast range of current and emerging sciences from nano-materials, nanoscience, nanofabrication, nano-engineering, nano-electronics, nano-biotechnology, to ethical and social issues of nanoscience and nanotechnology. Also, panel discussions about industrial applications, tutorial sessions have been organized for students, new-comers and company employees.

  6. 21 CFR 1401.9 - Appeals.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Appeals. 1401.9 Section 1401.9 Food and Drugs OFFICE OF NATIONAL DRUG CONTROL POLICY PUBLIC AVAILABILITY OF INFORMATION § 1401.9 Appeals. An appeal to the ONDCP must explain in writing the legal and factual basis for the appeal. It must be received...

  7. 17 CFR 9.22 - Appeal brief.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Appeal brief. 9.22 Section 9... Appeals § 9.22 Appeal brief. (a) Time to file. Any person who has filed a notice of appeal in accordance with the provisions of § 9.20 must perfect the appeal by filing an appeal brief with the...

  8. 17 CFR 9.7 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 9.7 Section 9.7... DISCIPLINARY, ACCESS DENIAL OR OTHER ADVERSE ACTIONS General Provisions § 9.7 Settlement. At any time before... accordance with § 9.20, the parties may file a stipulation for dismissal based on a settlement...

  9. 10 CFR 9.105 - Commission procedures.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Commission procedures. 9.105 Section 9.105 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Government in the Sunshine Act Regulations § 9.105 Commission procedures. (a) Action under § 9.104 shall be taken only when a majority of the entire membership of...

  10. 29 CFR 4010.9 - Financial information.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Financial information. 4010.9 Section 4010.9 Labor... DISCLOSURE REQUIREMENTS ANNUAL FINANCIAL AND ACTUARIAL INFORMATION REPORTING § 4010.9 Financial information... with the instructions on PBGC's Web site, http://www.pbgc.gov, the following financial information...

  11. Horizontal carbon nanotube alignment.

    Science.gov (United States)

    Cole, Matthew T; Cientanni, Vito; Milne, William I

    2016-09-21

    The production of horizontally aligned carbon nanotubes offers a rapid means of realizing a myriad of self-assembled near-atom-scale technologies - from novel photonic crystals to nanoscale transistors. The ability to reproducibly align anisotropic nanostructures has huge technological value. Here we review the present state-of-the-art in horizontal carbon nanotube alignment. For both in and ex situ approaches, we quantitatively assess the reported linear packing densities alongside the degree of alignment possible for each of these core methodologies. PMID:27546174

  12. Nanotube composite carbon fibers

    Science.gov (United States)

    Andrews, R.; Jacques, D.; Rao, A. M.; Rantell, T.; Derbyshire, F.; Chen, Y.; Chen, J.; Haddon, R. C.

    1999-08-01

    Single walled carbon nanotubes (SWNTs) were dispersed in isotropic petroleum pitch matrices to form nanotube composite carbon fibers with enhanced mechanical and electrical properties. We find that the tensile strength, modulus, and electrical conductivity of a pitch composite fiber with 5 wt % loading of purified SWNTs are enhanced by ˜90%, ˜150%, and 340% respectively, as compared to the corresponding values in unmodified isotropic pitch fibers. These results serve to highlight the potential that exits for developing a spectrum of material properties through the selection of the matrix, nanotube dispersion, alignment, and interfacial bonding.

  13. Carbon Nanotube Solar Cells

    OpenAIRE

    Klinger, Colin; Patel, Yogeshwari; Postma, Henk W. Ch.

    2012-01-01

    We present proof-of-concept all-carbon solar cells. They are made of a photoactive side of predominantly semiconducting nanotubes for photoconversion and a counter electrode made of a natural mixture of carbon nanotubes or graphite, connected by a liquid electrolyte through a redox reaction. The cells do not require rare source materials such as In or Pt, nor high-grade semiconductor processing equipment, do not rely on dye for photoconversion and therefore do not bleach, and are easy to fabr...

  14. Carbon cycle makeover

    DEFF Research Database (Denmark)

    Canfield, Donald Eugene; Kump, Lee R.

    2013-01-01

    remaining in sediments after respiration leave a residual of oxygen in the atmosphere. The source of oxygen to the atmosphere represented by organic matter burial is balanced by oxygen sinks associated with rock weathering and chemical reaction with volcanic gases. This is the long-term carbon and oxygen...... geochemical cycle. But Earth is an old planet, and oxygen levels have changed through time (2). On page 540 of this issue, Schrag et al. (3) challenge the most commonly used geochemical approach to assess long-term changes in the coupled oxygen and carbon cycles....

  15. Pitch carbon microsphere composite

    Science.gov (United States)

    Price, H. L.; Nelson, J. B.

    1977-01-01

    Petroleum pitch carbon microspheres were prepared by flash heating emulsified pitch and carbonizing the resulting microspheres in an inert atmosphere. Microsphere composites were obtained from a mixture of microspheres and tetraester precursor pyrrone powder. Scanning electron micrographs of the composite showed that it was an aggregate of microspheres bonded together by the pyrrone at the sphere contact points, with voids in and among the microspheres. Physical, thermal, and sorption properties of the composite are described. Composite applications could include use as a honeycomb filler in elevated-temperature load-bearing sandwich boards or in patient-treatment tables for radiation treatment of tumors.

  16. Ferrous ion oxidation by Thiobacillus ferrooxidans immobilized on activated carbon

    Institute of Scientific and Technical Information of China (English)

    ZHOU Ji-kui; QIN Wen-qing; NIU Yin-jian; LI Hua-xia

    2006-01-01

    The immobilization of Thiobacillus ferrooxidans on the activated carbon particles as support matrix was investigated. Cycling batch operation results in the complete oxidation of ferrous iron in 8 d when the modified 9 K medium is set to flow through the mini-bioreactor at a rate of 0.104 L/h at 25 ℃. The oxidation rate of ferrous iron with immobilized T. ferrooxidans is 9.38 g/(L·h). The results show that the immobilization of T. ferrooxidans on activated carbon can improve the rate of oxidation of ferrous iron. The SEM images show that a build-up of cells of T. ferrooxidans and iron precipitates is formed on the surface of activated carbon particles.

  17. Templateless Infrared Heating Process for Fabricating Carbon Nitride Nanorods with Efficient Photocatalytic H2 Evolution.

    Science.gov (United States)

    Li, Hui-Jun; Qian, Dong-Jin; Chen, Meng

    2015-11-18

    The bottom-up fabrication of carbon nitride nanorods is realized through the direct infrared heating of dicyandiamide. The approach requires no templates or extra organics. The controlled infrared heating has a major influence on the morphology of the obtained carbon nitrides. The precursors assemble into carbon nitride nanorods at low power levels, and they grow into nanoplates at high power levels. The formation mechanism of the carbon nitride nanorods is proposed to be a kinetically driven process, and the photocatalytic activity of the carbon nitride nanorods prepared at 50% power for hydrogen evolution is about 2.9 times that of carbon nitride nanoplates at 100% power. Structural, optical, and electronic analysis demonstrates that the enhancement is primarily attributed to the elimination of structural defects and the improved charge-carrier separation in highly condensed and oriented carbon nitride nanorods.

  18. Hydrological restoration of Indonesian peatlands to mitigate carbon dioxide emissions

    NARCIS (Netherlands)

    Wösten, H.; Jaenicke, J.; Budiman, A.; Siegert, F.

    2010-01-01

    Delta Session DS 9: The lowland deltas of Indonesia. Hydrological restoration of Indonesian peatlands to mitigate carbon dioxide emissions, Henk Wösten (2010). Presented at the international conference Deltas in Times of Climate Change, 29 September - 1 October, Rotterdam, the Netherlands.

  19. XPS of nitrogen-containing functional groups on activated carbon

    NARCIS (Netherlands)

    Jansen, R.J.J.; Bekkum, van H.

    1995-01-01

    XPS is used to study the binding energy of the Cls, Nls and Ols photoelectrons of surface groups on several nitrogen-containing activated carbons. Specific binding energies are assigned to amide (399.9 eV). lactam and imidc (399.7 eV). pyridine (398.7 eV), pyrrole (400.7 eV), alkylamine. secondary a

  20. Remnant evolution after a carbon-oxygen white dwarf merger

    NARCIS (Netherlands)

    S.C. Yoon; P. Podsiadlowski; S. Rosswog

    2007-01-01

    We systematically explore the evolution of the merger of two carbon-oxygen (CO) white dwarfs. The dynamical evolution of a 0.9Msolar + 0.6Msolar CO white dwarf merger is followed by a 3D smoothed particle hydrodynamics (SPH) simulation. The calculation uses a state-of-the-art e

  1. Carbon Smackdown: Visualizing Clean Energy (LBNL Summer Lecture Series)

    Energy Technology Data Exchange (ETDEWEB)

    Meza, Juan [LBNL, Computational Research Division

    2010-08-09

    The final Carbon Smackdown match took place Aug. 9, 2010. Juan Meza of the Computational Research Division revealed how scientists use computer visualizations to accelerate climate research and discuss the development of next-generation clean energy technologies such as wind turbines and solar cells.

  2. Organic carbon stocks in the soils of Brazil

    NARCIS (Netherlands)

    Batjes, N.H.

    2005-01-01

    Soil organic carbon stocks to 1 m for Brazil, calculated using an updated Soil and Terrain (SOTER) database and simulation of phenoforms, are 65.9-67.5 Pg C, of which 65% is in the Amazonian region of Brazil. Other researchers have obtained similar gross results, despite very different spatial patte

  3. Removing lead in drinking water with activated carbon

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, R.M.; Kuennen, R.W. (Amway Corp., Ada, MI (United States))

    1994-02-01

    A point-of-use (POU) granular activated carbon (GAC) fixed bed adsorber (FBA) was evaluated for reduction of soluble and insoluble lead from drinking water. Some of the factors which affect lead removal by GAC were evaluated, such as carbon type, solution pH, and a limited amount of work on competitive interactions. The design criteria for lead reduction by a POU device are also addressed. Minicolumns were used to evaluate the capacity of carbon for lead under a variety of conditions. The importance of surface chemistry of the carbon and the relationship with the pH of the water for lead reduction was demonstrated. Results indicate that a properly designed POU-GAC-FBA can reduce lead in drinking water to below the EPA action level of 15 ppb while being tested under a variety of conditions as specified under the National Sanitation Foundation (NSF) International Standard 53 test protocol. 37 refs., 9 figs., 1 tab.

  4. CARBON DIOXIDE CAPTURE FROM FLUE GAS USING DRY REGENERABLE SORBENTS

    Energy Technology Data Exchange (ETDEWEB)

    David A. Green; Brian S. Turk; Raghubir P. Gupta; Alejandro Lopez-Ortiz; Douglas P. Harrison; Ya Liang

    2001-05-01

    Electrobalance studies of calcination and carbonation of sodium bicarbonate materials were conducted at Louisiana State University. Calcination in an inert atmosphere was rapid and complete at 120 C. Carbonation was temperature dependent, and both the initial rate and the extent of reaction were found to decrease as temperature was increased between 60 and 80 C. A fluidization test apparatus was constructed at RTI and two sodium bicarbonate materials were fluidized in dry nitrogen at 22 C. The bed was completely fluidized at between 9 and 11 in. of water pressure drop. Kinetic rate expression derivations and thermodynamic calculations were conducted at RTI. Based on literature data, a simple reaction rate expression, which is zero order in carbon dioxide and water, was found to provide the best fit against reciprocal temperature. Simulations based on process thermodynamics suggested that approximately 26 percent of the carbon dioxide in flue gas could be recovered using waste heat available at 240 C.

  5. CARBON DIOXIDE CAPTURE FROM FLUE GAS USING DRY REGENERABLE SORBENTS

    International Nuclear Information System (INIS)

    Electrobalance studies of calcination and carbonation of sodium bicarbonate materials were conducted at Louisiana State University. Calcination in an inert atmosphere was rapid and complete at 120 C. Carbonation was temperature dependent, and both the initial rate and the extent of reaction were found to decrease as temperature was increased between 60 and 80 C. A fluidization test apparatus was constructed at RTI and two sodium bicarbonate materials were fluidized in dry nitrogen at 22 C. The bed was completely fluidized at between 9 and 11 in. of water pressure drop. Kinetic rate expression derivations and thermodynamic calculations were conducted at RTI. Based on literature data, a simple reaction rate expression, which is zero order in carbon dioxide and water, was found to provide the best fit against reciprocal temperature. Simulations based on process thermodynamics suggested that approximately 26 percent of the carbon dioxide in flue gas could be recovered using waste heat available at 240 C

  6. Quantitative Estimation of the Climatic Effects of Carbon Transferred by International Trade.

    Science.gov (United States)

    Wei, Ting; Dong, Wenjie; Moore, John; Yan, Qing; Song, Yi; Yang, Zhiyong; Yuan, Wenping; Chou, Jieming; Cui, Xuefeng; Yan, Xiaodong; Wei, Zhigang; Guo, Yan; Yang, Shili; Tian, Di; Lin, Pengfei; Yang, Song; Wen, Zhiping; Lin, Hui; Chen, Min; Feng, Guolin; Jiang, Yundi; Zhu, Xian; Chen, Juan; Wei, Xin; Shi, Wen; Zhang, Zhiguo; Dong, Juan; Li, Yexin; Chen, Deliang

    2016-01-01

    Carbon transfer via international trade affects the spatial pattern of global carbon emissions by redistributing emissions related to production of goods and services. It has potential impacts on attribution of the responsibility of various countries for climate change and formulation of carbon-reduction policies. However, the effect of carbon transfer on climate change has not been quantified. Here, we present a quantitative estimate of climatic impacts of carbon transfer based on a simple CO2 Impulse Response Function and three Earth System Models. The results suggest that carbon transfer leads to a migration of CO2 by 0.1-3.9 ppm or 3-9% of the rise in the global atmospheric concentrations from developed countries to developing countries during 1990-2005 and potentially reduces the effectiveness of the Kyoto Protocol by up to 5.3%. However, the induced atmospheric CO2 concentration and climate changes (e.g., in temperature, ocean heat content, and sea-ice) are very small and lie within observed interannual variability. Given continuous growth of transferred carbon emissions and their proportion in global total carbon emissions, the climatic effect of traded carbon is likely to become more significant in the future, highlighting the need to consider carbon transfer in future climate negotiations. PMID:27329411

  7. Quantitative Estimation of the Climatic Effects of Carbon Transferred by International Trade

    Science.gov (United States)

    Wei, Ting; Dong, Wenjie; Moore, John; Yan, Qing; Song, Yi; Yang, Zhiyong; Yuan, Wenping; Chou, Jieming; Cui, Xuefeng; Yan, Xiaodong; Wei, Zhigang; Guo, Yan; Yang, Shili; Tian, Di; Lin, Pengfei; Yang, Song; Wen, Zhiping; Lin, Hui; Chen, Min; Feng, Guolin; Jiang, Yundi; Zhu, Xian; Chen, Juan; Wei, Xin; Shi, Wen; Zhang, Zhiguo; Dong, Juan; Li, Yexin; Chen, Deliang

    2016-01-01

    Carbon transfer via international trade affects the spatial pattern of global carbon emissions by redistributing emissions related to production of goods and services. It has potential impacts on attribution of the responsibility of various countries for climate change and formulation of carbon-reduction policies. However, the effect of carbon transfer on climate change has not been quantified. Here, we present a quantitative estimate of climatic impacts of carbon transfer based on a simple CO2 Impulse Response Function and three Earth System Models. The results suggest that carbon transfer leads to a migration of CO2 by 0.1–3.9 ppm or 3–9% of the rise in the global atmospheric concentrations from developed countries to developing countries during 1990–2005 and potentially reduces the effectiveness of the Kyoto Protocol by up to 5.3%. However, the induced atmospheric CO2 concentration and climate changes (e.g., in temperature, ocean heat content, and sea-ice) are very small and lie within observed interannual variability. Given continuous growth of transferred carbon emissions and their proportion in global total carbon emissions, the climatic effect of traded carbon is likely to become more significant in the future, highlighting the need to consider carbon transfer in future climate negotiations. PMID:27329411

  8. Quantitative Estimation of the Climatic Effects of Carbon Transferred by International Trade

    Science.gov (United States)

    Wei, Ting; Dong, Wenjie; Moore, John; Yan, Qing; Song, Yi; Yang, Zhiyong; Yuan, Wenping; Chou, Jieming; Cui, Xuefeng; Yan, Xiaodong; Wei, Zhigang; Guo, Yan; Yang, Shili; Tian, Di; Lin, Pengfei; Yang, Song; Wen, Zhiping; Lin, Hui; Chen, Min; Feng, Guolin; Jiang, Yundi; Zhu, Xian; Chen, Juan; Wei, Xin; Shi, Wen; Zhang, Zhiguo; Dong, Juan; Li, Yexin; Chen, Deliang

    2016-06-01

    Carbon transfer via international trade affects the spatial pattern of global carbon emissions by redistributing emissions related to production of goods and services. It has potential impacts on attribution of the responsibility of various countries for climate change and formulation of carbon-reduction policies. However, the effect of carbon transfer on climate change has not been quantified. Here, we present a quantitative estimate of climatic impacts of carbon transfer based on a simple CO2 Impulse Response Function and three Earth System Models. The results suggest that carbon transfer leads to a migration of CO2 by 0.1–3.9 ppm or 3–9% of the rise in the global atmospheric concentrations from developed countries to developing countries during 1990–2005 and potentially reduces the effectiveness of the Kyoto Protocol by up to 5.3%. However, the induced atmospheric CO2 concentration and climate changes (e.g., in temperature, ocean heat content, and sea-ice) are very small and lie within observed interannual variability. Given continuous growth of transferred carbon emissions and their proportion in global total carbon emissions, the climatic effect of traded carbon is likely to become more significant in the future, highlighting the need to consider carbon transfer in future climate negotiations.

  9. [Carbon emissions and low-carbon regulation countermeasures of land use change in the city and town concentrated area of central Liaoning Province, China].

    Science.gov (United States)

    Xi, Feng-ming; Liang, Wen-juan; Niu, Ming-fen; Wang, Jiao-yue

    2016-02-01

    Carbon emissions due to land use change have an important impact on global climate change. Adjustment of regional land use patterns has a great scientific significance to adaptation to a changing climate. Based on carbon emission/absorption parameters suitable for Liaoning Province, this paper estimated the carbon emission of land use change in the city and town concentrated area of central Liaoning Province. The results showed that the carbon emission and absorption were separately 308.51 Tg C and 11.64 Tg C from 1997 to 2010. It meant 3.8% of carbon emission. was offset by carbon absorption. Among the 296.87 Tg C net carbon emission of land use change, carbon emission of remaining land use type was 182.24 Tg C, accounting for 61.4% of the net carbon emission, while the carbon emission of land use transformation was 114.63 Tg C, occupying the rest 38.6% of net carbon emission. Through quantifying the mapping relationship between land use change and carbon emission, it was shown that during 1997-2004 the contributions of remaining construction land (40.9%) and cropland transform ation to construction land (40.6%) to carbon emission were larger, but the greater contributions to carbon absorption came from cropland transformation to forest land (38.6%) and remaining forest land (37.5%). During 2004-2010, the land use types for carbon emission and absorption were the same to the period of 1997-2004, but the contribution of remaining construction land to carbon emission increased to 80.6%, and the contribution of remaining forest land to carbon absorption increased to 71.7%. Based on the carbon emission intensity in different land use types, we put forward the low-carbon regulation countermeasures of land use in two aspects. In carbon emission reduction, we should strict control land transformation to construction land, increase the energy efficiency of construction land, and avoid excessive development of forest land and water. In carbon sink increase, we should

  10. [Carbon emissions and low-carbon regulation countermeasures of land use change in the city and town concentrated area of central Liaoning Province, China].

    Science.gov (United States)

    Xi, Feng-ming; Liang, Wen-juan; Niu, Ming-fen; Wang, Jiao-yue

    2016-02-01

    Carbon emissions due to land use change have an important impact on global climate change. Adjustment of regional land use patterns has a great scientific significance to adaptation to a changing climate. Based on carbon emission/absorption parameters suitable for Liaoning Province, this paper estimated the carbon emission of land use change in the city and town concentrated area of central Liaoning Province. The results showed that the carbon emission and absorption were separately 308.51 Tg C and 11.64 Tg C from 1997 to 2010. It meant 3.8% of carbon emission. was offset by carbon absorption. Among the 296.87 Tg C net carbon emission of land use change, carbon emission of remaining land use type was 182.24 Tg C, accounting for 61.4% of the net carbon emission, while the carbon emission of land use transformation was 114.63 Tg C, occupying the rest 38.6% of net carbon emission. Through quantifying the mapping relationship between land use change and carbon emission, it was shown that during 1997-2004 the contributions of remaining construction land (40.9%) and cropland transform ation to construction land (40.6%) to carbon emission were larger, but the greater contributions to carbon absorption came from cropland transformation to forest land (38.6%) and remaining forest land (37.5%). During 2004-2010, the land use types for carbon emission and absorption were the same to the period of 1997-2004, but the contribution of remaining construction land to carbon emission increased to 80.6%, and the contribution of remaining forest land to carbon absorption increased to 71.7%. Based on the carbon emission intensity in different land use types, we put forward the low-carbon regulation countermeasures of land use in two aspects. In carbon emission reduction, we should strict control land transformation to construction land, increase the energy efficiency of construction land, and avoid excessive development of forest land and water. In carbon sink increase, we should

  11. Method for production of carbon nanofiber mat or carbon paper

    Energy Technology Data Exchange (ETDEWEB)

    Naskar, Amit K.

    2015-08-04

    Method for the preparation of a non-woven mat or paper made of carbon fibers, the method comprising carbonizing a non-woven mat or paper preform (precursor) comprised of a plurality of bonded sulfonated polyolefin fibers to produce said non-woven mat or paper made of carbon fibers. The preforms and resulting non-woven mat or paper made of carbon fiber, as well as articles and devices containing them, and methods for their use, are also described.

  12. Voltammetric oxidation and determination of cinnarizine at glassy carbon electrode modified with multi-walled carbon nanotubes.

    Science.gov (United States)

    Hegde, Rajesh N; Hosamani, Ragunatharaddi R; Nandibewoor, Sharanappa T

    2009-09-01

    The voltammetric oxidation of cinnarizine was investigated. In pH 2.5 Britton-Robinson buffer, cinnarizine shows an irreversible oxidation peak at about 1.20 V at a multi-walled carbon nanotube (MWCNT)-modified glassy carbon electrode. The cyclic voltammetric results indicate that MWCNT-modified glassy carbon electrode can remarkably enhance electrocatalytic activity towards the oxidation of cinnarizine. The electrocatalytic behavior was further exploited as a sensitive detection scheme for the cinnarizine determination by differential-pulse voltammetry. Under optimized conditions, the concentration range and detection limit are 9.0x10(-8) to 6.0x10(-6) M and 2.58x10(-9) M, respectively for cinnarizine. The proposed method was successfully applied to cinnarizine determination in pharmaceutical samples. The analytical performance of this sensor has been evaluated for the detection of analyte in urine as a real sample. PMID:19446444

  13. Catalytic graphitization of carbon/carbon composites by lanthanum oxide

    Institute of Scientific and Technical Information of China (English)

    ZHANG Can; LU Guimin; SUN Ze; YU Jianguo

    2012-01-01

    Graphitized carbon/carbon composites were prepared by the process of catalytic graphitization with the rare-earth catalyst,lanthanum oxide (La2O3),in order to increase the degree of graphitization and reduce the electrical resistivity.The modified coal tar pitch and coal-based needle coke were used as carbon source,and a small amount of La2O3 was added to catalyze the graphitization of the disordered carbon materials.The effects of La2O3 catalyst on the graphitization degree and microstructure oftbe carbon/carbon composites were investigated by X-ray diffraction,scanning electron microscopy,and Raman spectroscopy.The results showed that La2O3 promoted the formation of more perfect and larger crystallites,and improved the electrical/mechanical properties of carbon/carbon composites.Carbon/carbon composites with a lower electrical resistivity (7.0 μΩ·m) could be prepared when adding 5 wt.% La2O3 powder with heating treatment at 2800 ℃.The catalytic effect of La2O3 for the graphitization of carbon/carbon composites was analyzed.

  14. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Memos Regarding Some of the Hazards Associated with Engine-Driven Generators, 2004-2014 January 07, 2016 Non- ... Investigations Associated with Non-Fire Carbon Monoxide from Engine-Driven Generators and Other Engine-Driven Tools, 2004– ...

  15. Carbon Monoxide Poisoning

    OpenAIRE

    Wray, Alisa

    2016-01-01

    Audience: This oral boards case is appropriate for all emergency medicine learners (residents, interns, and medical students). Introduction: Carbon monoxide (CO) is a colorless and odorless gas that typically results from combustion. It binds hemoglobin, dissociating oxygen, causing headache, weakness, confusion and possible seizure or coma. Pulse oxygen levels may be falsely elevated. Practitioners should maintain a high in...

  16. Closing carbon cycles

    NARCIS (Netherlands)

    Patel, Martin

    2001-01-01

    Fossil fuels are used as raw materials for the manufacture of synthetic organic materials, e.g. plastics, fibres, synthetic rubber, paints, solvents, fertilisers, surfactants, lubricants and bitumen. Since fossil carbon is embodied in these products they may be particularly relevant to climate ch

  17. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Flickr SlideShare All Pages & Documents Recalls & News Releases Home Recalls CPSC Recall API Recall Lawsuits Recalls by ... CO Poster Contest Toy Recall Statistics Pool Safely Home / Safety Education / Safety Education Centers En Español Carbon ...

  18. Carbon nanotube solar cells.

    Directory of Open Access Journals (Sweden)

    Colin Klinger

    Full Text Available We present proof-of-concept all-carbon solar cells. They are made of a photoactive side of predominantly semiconducting nanotubes for photoconversion and a counter electrode made of a natural mixture of carbon nanotubes or graphite, connected by a liquid electrolyte through a redox reaction. The cells do not require rare source materials such as In or Pt, nor high-grade semiconductor processing equipment, do not rely on dye for photoconversion and therefore do not bleach, and are easy to fabricate using a spray-paint technique. We observe that cells with a lower concentration of carbon nanotubes on the active semiconducting electrode perform better than cells with a higher concentration of nanotubes. This effect is contrary to the expectation that a larger number of nanotubes would lead to more photoconversion and therefore more power generation. We attribute this to the presence of metallic nanotubes that provide a short for photo-excited electrons, bypassing the load. We demonstrate optimization strategies that improve cell efficiency by orders of magnitude. Once it is possible to make semiconducting-only carbon nanotube films, that may provide the greatest efficiency improvement.

  19. Skallerup Klit's carbon footprint

    DEFF Research Database (Denmark)

    Zacho, Kristina Overgaard; Ørnstrup, Niels Holm; Zimmermann, Tine Marquard;

    by offsetting and without making actual emission reductions. Therefore the purpose of this study is to present recommendations on how Skallerup Klit can build up their business strategy using Carbon Footprint (CFP) as a tool. The CPF is calculated and assessed by using financial data in an Input-output LCA...

  20. Polyimide/carbon Nanocomposites

    Science.gov (United States)

    Harris, Frank W.

    2003-01-01

    The goal of this product is to design and characterize well-defined conductive nanocomposite materials. The materials will be composed of a polymer matrix composed of rigid-backbone polyimides, and will be filled with modified or unmodified multi-walled carbon nanotubes (MWNTs). The ultimate design of this project is to create composite materials with optical clarity and a high conductivity.

  1. City Carbon Footprint Networks

    Directory of Open Access Journals (Sweden)

    Guangwu Chen

    2016-07-01

    Full Text Available Progressive cities worldwide have demonstrated political leadership by initiating meaningful strategies and actions to tackle climate change. However, the lack of knowledge concerning embodied greenhouse gas (GHG emissions of cities has hampered effective mitigation. We analyse trans-boundary GHG emission transfers between five Australian cities and their trading partners, with embodied emission flows broken down into major economic sectors. We examine intercity carbon footprint (CF networks and disclose a hierarchy of responsibility for emissions between cities and regions. Allocations of emissions to households, businesses and government and the carbon efficiency of expenditure have been analysed to inform mitigation policies. Our findings indicate that final demand in the five largest cities in Australia accounts for more than half of the nation’s CF. City households are responsible for about two thirds of the cities’ CFs; the rest can be attributed to government and business consumption and investment. The city network flows highlight that over half of emissions embodied in imports (EEI to the five cities occur overseas. However, a hierarchy of GHG emissions reveals that overseas regions also outsource emissions to Australian cities such as Perth. We finally discuss the implications of our findings on carbon neutrality, low-carbon city concepts and strategies and allocation of subnational GHG responsibility.

  2. Bioenergy, the Carbon Cycle, and Carbon Policy

    Science.gov (United States)

    Kammen, D. M.

    2003-12-01

    The evolving energy and land-use policies across North America and Africa provide critical case studies in the relationship between regional development, the management of natural resources, and the carbon cycle. Over 50 EJ of the roughly 430 EJ total global anthropogenic energy budget is currently utilized in the form of direct biomass combustion. In North America 3 - 4 percent of total energy is derived from biomass, largely in combined heat and power (CHP) combustion applications. By contrast Africa, which is a major consumer of 'traditional' forms of biomass, uses far more total bioenergy products, but largely in smaller batches, with quantities of 0.5 - 2 tons/capita at the household level. Several African nations rely on biomass for well over 90 percent of household energy, and in some nations major portions of the industrial energy supply is also derived from biomass. In much of sub-Saharan Africa the direct combustion of biomass in rural areas is exceeded by the conversion of wood to charcoal for transport to the cities for household use there. There are major health, and environmental repercussions of these energy flows. The African, as well as Latin American and Asian charcoal trade has a noticeable signature on the global greenhouse gas cycles. In North America, and notably Scandinavia and India as well, biomass energy and emerging conversion technologies are being actively researched, and provide tremendous opportunities for the evolution of a sustainable, locally based, energy economy for many nations. This talk will examine aspects of these current energy and carbon flows, and the potential that gassification and new silvicultural practices hold for clean energy systems in the 21st century. North America and Africa will be examined in particular as both sources of innovation in this field, and areas with specific promise for application of these energy technologies and biomass/land use practices to further energy and global climate management.

  3. 9.1.Diabetes mellitus

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930241 The relationship between GLUT/Bg1Ⅱ,Xba Ⅰ RFLP and Chinese non—insulin—de-pendent diabetes mellitus.SUN Duoqi (孙多奇),et al.Dept Endocrinol,6th People’sHosp,Shanghai,200233.Chin J Endocrinol &Metabol 1993;9(1):5—7.Digestion of human genomic DNA with re-striction enzyme Bgl Ⅱ,Xba Ⅰ revealed a twoallele polymorphism with a human HepG 2 glu-cose transporter probe.Bands of 7.8 Kb (B1 al-lele),6.2 Kb (B2 allele) and 6.3 Kb (X1allele),6.0 Kb (X2 allele) were observed.Thegenotype frequencies were investigated in twogroups of Shanghai Chinese and San FranciscoChinese and their subgroups.The frequencies ofBIBI,B1B2 and B2B2 were 82%,17%,1% re-spectively among 92 Shanghai Chinese controls,and 78%,21%,1% respectively among 156

  4. Soil carbon dynamics inferred from carbon isotope compositions of soil organic matter and soil respiration

    International Nuclear Information System (INIS)

    To better understand 14C cycling in terrestrial ecosystems, 14C abundances were evaluated for fractionated soil organic matter (SOM) and soil respiration in an urban forest. In 2001 soil profile, Δ 14C values of litter and bulk SOM increased rapidly from litter surface (62.7 per mille) to uppermost mineral soil layer (244.9 per mille), and then decreased sharply to 6 cm depth of mineral soil (125.0 per mille). Carbon enriched in 14C by atmospheric nuclear weapons testing had penetrated to at least 16 cm depth of mineral soil. The average Δ 14C in atmospheric CO2 was 58.8 per mille in August 2001, suggesting recent carbon input to the topmost litter layer. Although a similar depth distribution was observed for Δ 14C values of residual SOM after acid hydrolysis, the Δ 14C values were slightly lower than those in bulk SOM. This indicates input of 'bomb' C into this organic fraction and higher 14C abundance in acid-soluble SOM. The most of CO2 may be derived from the microbial decomposition of the acid-soluble, or labile, SOM. Therefore, the labile SOM may become most influential pool for soil carbon cycling. In contrast, carbon in base-insoluble SOM remained considerably low in 14C abundance at all depths, suggesting no or little incorporation of 'bomb' C to this fraction. Values of Δ 14C in soil respiration ranged from 91.9 to 146.4 per mille in August 2001, showing a significant contribution from decomposition of SOM fixed over past 2-40 years. These results indicate that the use of bulk SOM as a representative of soil carbon pool would lead to severe misunderstand of the soil C dynamics on decadal and shorter time scales. (author)

  5. Carbon nanotube macroelectronics

    Science.gov (United States)

    Zhang, Jialu

    In this dissertation, I discuss the application of carbon nanotubes in macroelectronis. Due to the extraordinary electrical properties such as high intrinsic carrier mobility and current-carrying capacity, single wall carbon nanotubes are very desirable for thin-film transistor (TFT) applications such as flat panel display, transparent electronics, as well as flexible and stretchable electronics. Compared with other popular channel material for TFTs, namely amorphous silicon, polycrystalline silicon and organic materials, nanotube thin-films have the advantages of low-temperature processing compatibility, transparency, and flexibility, as well as high device performance. In order to demonstrate scalable, practical carbon nanotube macroelectroncis, I have developed a platform to fabricate high-density, uniform separated nanotube based thin-film transistors. In addition, many other essential analysis as well as technology components, such as nanotube film density control, purity and diameter dependent semiconducting nanotube electrical performance study, air-stable n-type transistor fabrication, and CMOS integration platform have also been demonstrated. On the basis of the above achievement, I have further demonstrated various kinds of applications including AMOLED display electronics, PMOS and CMOS logic circuits, flexible and transparent electronics. The dissertation is structured as follows. First, chapter 1 gives a brief introduction to the electronic properties of carbon nanotubes, which serves as the background knowledge for the following chapters. In chapter 2, I will present our approach of fabricating wafer-scale uniform semiconducting carbon nanotube thin-film transistors and demonstrate their application in display electronics and logic circuits. Following that, more detailed information about carbon nanotube thin-film transistor based active matrix organic light-emitting diode (AMOLED) displays is discussed in chapter 3. And in chapter 4, a technology to

  6. Epoxy based photoresist/carbon nanoparticle composites

    DEFF Research Database (Denmark)

    Lillemose, Michael; Gammelgaard, Lauge; Richter, Jacob;

    2008-01-01

    We have fabricated composites of SU-8 polymer and three different types of carbon nanoparticles (NPs) using ultrasonic mixing. Structures of composite thin films have been patterned on a characterization chip with standard UV photolithography. Using a four-point bending probe, a well defined stress...... is applied to the composite thin film and we have demonstrated that the composites are piezoresistive. Stable gauge factors of 5-9 have been measured, but we have also observed piezoresistive responses with gauge factors as high as 50. As SU-8 is much softer than silicon and the gauge factor of the composite...

  7. Fabrication, structure, and electron emission of single carbon nanotubes

    Science.gov (United States)

    Zhao, Gongpu

    Carbon nanotubes possess many excellent field emission properties. An obstacle to these applications is that there is no simple and reproducible method to prepare a single carbon nanotube field emitter. In this dissertation, individual carbon nanotube field emitters have been fabricated in a two-step process involving (a) producing micron-size carbon fibers which contain single carbon nanotubes at their cores and (b) exposing the nanotubes by fracturing the fiber with mechanical forces and mounting the fiber to a copper ribbon with a groove. This fabrication method has the potential to be the production method for single carbon nanotube field emission point electron sources. The cold field emission properties of single carbon nanotubes have been studied. These carbon nanotubes exhibit large field enhancement factors of 1.1x107 m-1 and low turn-on fields of 1.1 V/mum. An empirical model has been developed to calculate the field enhancement factor of an open end nanotube attached on a carbon fiber. The lifetime measurements show that a single carbon nanotube can continuously emit electrons over 100 hours without significant current drops. The emission stability measurements show that the maximum current drift is 3.6%. It is also shown experimentally that a carbon nanotube has a high reduced brightness 2.9x 108 ASr-1m-2 V-1, which is two orders of magnitude higher than those of the thermionic electron sources. The thermal field emission properties of a single carbon nanotube have been systemically studied. It is found that there is a gap between the intermediate region and the field emission region which is not covered by either the Fowler-Nordheim theory or the Murphy-Good theory. We have developed an analytical equation that describes the thermal field emission behavior of a single carbon nanotube within the gap. The experimental results agree well with the theoretical predictions. We also studied the effect of Cs doping on the field emission properties and

  8. Carbon sinks in temperate forests

    NARCIS (Netherlands)

    Martin, P.H.; Nabuurs, G.J.; Aubinet, M.; Karjalainen, T.; Vine, E.L.; Kinsman, J.; Heath, L.S.

    2001-01-01

    In addition to being scientifically exciting, commercially important, and environmentally essential, temperate forests have also become a key diplomatic item in international climate negotiations as potential sinks for carbon. This review presents the methods used to estimate carbon sequestration, i

  9. Carbon Monoxide (CO) Poisoning Prevention

    Science.gov (United States)

    ... What's this? Submit Button Past Emails CDC Features Carbon Monoxide (CO) Poisoning Prevention Language: English Español (Spanish) ... tornadoes), using alternative sources of power can cause carbon monoxide (CO) to build up in a home ...

  10. Dewatering Peat With Activated Carbon

    Science.gov (United States)

    Rohatgi, N. K.

    1984-01-01

    Proposed process produces enough gas and carbon to sustain itself. In proposed process peat slurry is dewatered to approximately 40 percent moisture content by mixing slurry with activated carbon and filtering with solid/liquid separation techniques.

  11. ROE Carbon Storage - Percent Change

    Data.gov (United States)

    U.S. Environmental Protection Agency — This polygon dataset depicts the percentage change in the amount of carbon stored in forests in counties across the United States, based on the difference in carbon...

  12. Boron nitride converted carbon fiber

    Energy Technology Data Exchange (ETDEWEB)

    Rousseas, Michael; Mickelson, William; Zettl, Alexander K.

    2016-04-05

    This disclosure provides systems, methods, and apparatus related to boron nitride converted carbon fiber. In one aspect, a method may include the operations of providing boron oxide and carbon fiber, heating the boron oxide to melt the boron oxide and heating the carbon fiber, mixing a nitrogen-containing gas with boron oxide vapor from molten boron oxide, and converting at least a portion of the carbon fiber to boron nitride.

  13. Templated Growth of Carbon Nanotubes

    Science.gov (United States)

    Siochik Emilie J. (Inventor)

    2007-01-01

    A method of growing carbon nanotubes uses a synthesized mesoporous si lica template with approximately cylindrical pores being formed there in. The surfaces of the pores are coated with a carbon nanotube precu rsor, and the template with the surfaces of the pores so-coated is th en heated until the carbon nanotube precursor in each pore is convert ed to a carbon nanotube.

  14. Carbon balance in Mediterranean ecosystems

    OpenAIRE

    Correia, Alexandra Cristina Pires

    2013-01-01

    Forests play an important role in climate change mitigation as they sequester and store carbon dioxide (CO2) from the atmosphere. The aim of this thesis was to investigate forest carbon balance in its main compartments: tress, understory and soils. We present methods to estimate carbon stock in biomass of stone pine stands in south Portugal. Allometric models, as well as conversion and expansion factors were presented allowing the quantification of stand carbon stocks irrespect...

  15. Fabrication of carbon/SiO2 composites from the hydrothermal carbonization process of polysaccharide and their adsorption performance.

    Science.gov (United States)

    Li, Yinhui; Li, Kunyu; Su, Min; Ren, Yanmei; Li, Ying; Chen, Jianxin; Li, Liang

    2016-11-20

    In this work, carbon/SiO2 composites, using amylose and tetraethyl orthosilicate (TEOS) as raw materials, were successfully prepared by a facial hydrothermal carbonization process. The carbon/SiO2 composites were characterized by X-ray diffraction (XRD), scanning electron microscope (SEM), Energy Dispersive Spectroscopy (EDS), transmission electron microscope (TEM), N2 adsorption and Thermogravimetric (TG) analysis. The composites, which were made up of amorphous SiO2 and amorphous carbon, were found to have hierarchical porous structures. The mass ratios of amylose and SiO2 and the hydrothermal carbonization time had significant effects on the morphology of the composites, which had three shapes including monodispersed spheres, porous pieces and the nano-fibers combined with nano-spheres structures. The adsorption performance of the composites was studied using Pb(2+) as simulated contaminants from water. When the mass ratio of amylose and SiO2 was 9/1, the hydrothermal time was 30h and the hydrothermal temperature was 180°C, the adsorption capacity of the composites achieved to 52mg/g. Experimental data show that adsorption kinetics of the carbon/SiO2 composites can be fitted well by the Elovich model, while the isothermal data can be perfectly described by the Langmuir adsorption model and Freundlich adsorption model. The maximum adsorption capacity of the carbon/SiO2 composites is 56.18mgg(-1).

  16. Toward uniform and ultrathin carbon layer coating on lithium iron phosphate using liquid carbon dioxide for enhanced electrochemical performance

    Science.gov (United States)

    Hong, Seung-Ah; Kim, Dong Hyun; Chung, Kyung Yoon; Chang, Wonyoung; Yoo, Jibeom; Kim, Jaehoon

    2014-09-01

    In this communication, uniform and ultrathin carbon coating on LiFePO4 (LFP) particles are performed using liquid carbon dioxide (l-CO2)-based free-meniscus coating. The uniform and conformal coverage of the carbon layer on LFP with a thickness of 3.3 nm, and a uniform distribution of carbon on the entire surface of the LFP particle are confirmed. The carbon-coated LFP (C-LFP) with a carbon content of 1.9 wt.% obtained using l-CO2-based coating exhibits a discharge capacity of 169 mAh g-1 at 0.1 C and 71 mAh g-1 at 30 C, while much lower discharge capacity of 146 mAh g-1 at 0.1 C and 17 mAh g-1 at 30 C is observed when C-LFP with an optimized carbon content of 6.0 wt.% is prepared using conventional aqueous-based coating.

  17. Fabrication of carbon/SiO2 composites from the hydrothermal carbonization process of polysaccharide and their adsorption performance.

    Science.gov (United States)

    Li, Yinhui; Li, Kunyu; Su, Min; Ren, Yanmei; Li, Ying; Chen, Jianxin; Li, Liang

    2016-11-20

    In this work, carbon/SiO2 composites, using amylose and tetraethyl orthosilicate (TEOS) as raw materials, were successfully prepared by a facial hydrothermal carbonization process. The carbon/SiO2 composites were characterized by X-ray diffraction (XRD), scanning electron microscope (SEM), Energy Dispersive Spectroscopy (EDS), transmission electron microscope (TEM), N2 adsorption and Thermogravimetric (TG) analysis. The composites, which were made up of amorphous SiO2 and amorphous carbon, were found to have hierarchical porous structures. The mass ratios of amylose and SiO2 and the hydrothermal carbonization time had significant effects on the morphology of the composites, which had three shapes including monodispersed spheres, porous pieces and the nano-fibers combined with nano-spheres structures. The adsorption performance of the composites was studied using Pb(2+) as simulated contaminants from water. When the mass ratio of amylose and SiO2 was 9/1, the hydrothermal time was 30h and the hydrothermal temperature was 180°C, the adsorption capacity of the composites achieved to 52mg/g. Experimental data show that adsorption kinetics of the carbon/SiO2 composites can be fitted well by the Elovich model, while the isothermal data can be perfectly described by the Langmuir adsorption model and Freundlich adsorption model. The maximum adsorption capacity of the carbon/SiO2 composites is 56.18mgg(-1). PMID:27561502

  18. Arabidopsis ECERIFERUM9 involvement in cuticle formation and maintenance of plant water status

    KAUST Repository

    Lu, Shiyou

    2012-05-25

    Mutation of the ECERIFERUM9 (CER9) gene in Arabidopsis (Arabidopsis thaliana) causes elevated amounts of 18-carbon-length cutin monomers and a dramatic shift in the cuticular wax profile (especially on leaves) toward the very-long-chain free fatty acids tetracosanoic acid (C24) and hexacosanoic acid (C26). Relative to the wild type, cer9 mutants exhibit elevated cuticle membrane thickness over epidermal cells and cuticular ledges with increased occlusion of the stomatal pore. The cuticular phenotypes of cer9 are associated with delayed onset of wilting in plants experiencing water deficit, lower transpiration rates, and improved water use efficiency measured as carbon isotope discrimination. The CER9 protein thus encodes a novel determinant of plant drought tolerance-associated traits, one whose deficiency elevates cutin synthesis, redistributes wax composition, and suppresses transpiration. Map-based cloning identified CER9, and sequence analysis predicted that it encodes an E3 ubiquitin ligase homologous to yeast Doa10 (previously shown to target endoplasmic reticulum proteins for proteasomal degradation). To further elucidate CER9 function, the impact of CER9 deficiency on interactions with other genes was examined using double mutant and transcriptome analyses. For both wax and cutin, cer9 showed mostly additive effects with cer6, long-chain acyl-CoA synthetase1 (lacs1), and lacs2 and revealed its role in early steps of both wax and cutin synthetic pathways. Transcriptome analysis revealed that the cer9 mutation affected diverse cellular processes, with primary impact on genes associated with diverse stress responses. The discovery of CER9 lays new groundwork for developing novel cuticle-based strategies for improving the drought tolerance and water use efficiency of crop plants. © 2012 American Society of Plant Biologists. All Rights Reserved.

  19. 9%Cr heat resistant steels: Alloy design, microstructure evolution and creep response at 650 deg. C

    International Nuclear Information System (INIS)

    Highlights: → 9Cr alloys with varying Ti and C contents were designed, produced and crept at 650 deg. C. → Sub-grain and precipitate distribution and evolution investigated by STEM-HAADF. → Correlations between microstructure evolution and mechanical properties were studied. → Coarsening of sub-grain size was larger for Ti-containing 9Cr alloys. → 9Cr alloy with low C and no Ti showed the highest creep strength of all studied alloys. - Abstract: In this work 9%Cr alloys were designed supported by computational thermodynamic methods. Two sets of alloys were produced: 9%Cr alloys with 0.1%C and 0.05%C and 9%Cr alloys containing ∼0.03% Ti with 0.1%C and 0.05%C (always wt%). Microstructure investigations showed good agreement with the predicted phases of the thermodynamic modeling. The volume fraction of precipitated M23C6 carbides is directly related to the carbon content of the alloys. For Ti-containing alloys the precipitation of nano-sized Ti-rich MX carbonitrides was observed. The microstructure evolution (sub-grain and particle size) during creep at 650 deg. C/100 MPa was investigated by STEM-HAADF. The sub-grain size evolution and the coarsening of precipitates (MX carbonitrides, M23C6 and Laves phase) were more pronounced for Ti-containing alloys. 9Cr alloys without Ti and with low carbon content presented the highest creep strength of all investigated alloys.

  20. Apparatus for producing carbon-coated nanoparticles and carbon nanospheres

    Science.gov (United States)

    Perry, W. Lee; Weigle, John C.; Phillips, Jonathan

    2015-10-20

    An apparatus for producing carbon-coated nano- or micron-scale particles comprising a container for entraining particles in an aerosol gas, providing an inlet for carbon-containing gas, providing an inlet for plasma gas, a proximate torch for mixing the aerosol gas, the carbon-containing gas, and the plasma gas, bombarding the mixed gases with microwaves, and providing a collection device for gathering the resulting carbon-coated nano- or micron-scale particles. Also disclosed is a method and apparatus for making hollow carbon nano- or micro-scale spheres.

  1. Designing carbon markets, Part II: Carbon markets in space

    International Nuclear Information System (INIS)

    This paper analyses the design of carbon markets in space (i.e., geographically). It is part of a twin set of papers that, starting from first principles, ask what an optimal global carbon market would look like by around 2030. Our focus is on firm-level cap-and-trade systems, although much of what we say would also apply to government-level trading and carbon offset schemes. We examine the 'first principles' of spatial design to maximise flexibility and to minimise costs, including key design issues in linking national and regional carbon markets together to create a global carbon market.

  2. Green Carbon : The role of natural forests in carbon storage

    OpenAIRE

    Keith, Heather; Lindenmayer, David B; Mackey, Brendan; Berry, Sandra L.

    2008-01-01

    The colour of carbon matters. Green carbon is the carbon stored in the plants and soil of natural ecosystems and is a vital part of the global carbon cycle. This report is the first in a series that examines the role of natural forests in the storage of carbon, the impacts of human land use activities, and the implications for climate change policy nationally and internationally. REDD (“reducing emissions from deforestation and degradation”) is now part of the agenda for the “Bali Action Plan...

  3. Wool Research Makes Carbon Headway

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    A collective of woolgrowers, scientists and carbon specialists the Wool Carbon Alliance (WCA) has reviewed the latest research role in the natural carbon cycle, from woolgrowing properties around the globe known as on wool's to homes around the globe .

  4. Carbon dioxide as a carbon source in organic transformation: carbon-carbon bond forming reactions by transition-metal catalysts.

    OpenAIRE

    Tsuji, Yasushi; Fujihara, Tetsuaki

    2012-01-01

    Recent carbon-carbon bond forming reactions of carbon dioxide with alkenes, alkynes, dienes, aryl zinc compounds, aryl boronic esters, aryl halides, and arenes having acidic C-H bonds are reviewed in which transition-metal catalysts play an important role.

  5. Carbon nanotube junctions and devices

    NARCIS (Netherlands)

    Postma, H.W.Ch.

    2001-01-01

    In this thesis Postma presents transport experiments performed on individual single-wall carbon nanotubes. Carbon nanotubes are molecules entirely made of carbon atoms. The electronic properties are determined by the exact symmetry of the nanotube lattice, resulting in either metallic or semiconduct

  6. Guideposts for Low Carbon Finance

    International Nuclear Information System (INIS)

    The author proposes four guideposts for efficient low carbon finance: remove subsidies for high-carbon technologies, improve the cost-effectiveness of low-carbon subsidies, encourage private sector innovation and maintain transparent public policy tools that support cost-benefit accounting

  7. CARBON IN FORESTS: QUALITY MATTERS

    Science.gov (United States)

    The nature of carbon in forests is discussed from the perspective of carbon sequestration and global climate change. Carbon inventories, specifically in the area of land use and forestry are reviewed for the Pacific Northwest. Areas vulnerable to climate change with respect to ca...

  8. Carbon Sequestration in Agricultural Soils

    OpenAIRE

    World Bank

    2009-01-01

    The purpose of this report is to improve the knowledge base for facilitating investments in land management technologies that sequester soil organic carbon. While there are many studies on soil carbon sequestration, there is no single unifying volume that synthesizes knowledge on the impact of different land management practices on soil carbon sequestration rates across the world. A meta-a...

  9. Low Carbon Development of Hainan

    Science.gov (United States)

    Yi, Feng; Kun, Zhang

    With the construction of Hainan international tourism island rising to a national strategy level, the green growth pattern based on low carbon objectives will become a significant part in the development of Hainan's economy. In this paper, low carbon electric power system and differentiation service will be discussed, and some opinions were brought up to have a good impact on Hainan's low carbon development.

  10. Synthesis of colchicine and isocolchicine labelled with carbon-11 or carbon-13

    Energy Technology Data Exchange (ETDEWEB)

    Kothari, P.J.; Finn, R.D.; Larson, S.M. [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)

    1995-06-01

    The syntheses of isotopically labelled (-)-10-[{sup 11}C/{sup 13}C]-colchicine and (-)-9-[{sup 11}C/{sup 13}C]-isocolchicine have been achieved from the reaction of (-)desmethylcolchicine with [{sup 11}C/{sup 13}C]-iodomethane. The radiolabelled compounds, (-)-10-[{sup 11}C]-colchicine ({sup 11}C-n-colchicine) and (-)-9-[{sup 11}C]-isocolchicine ({sup 11}C-i-colchicine), were isolated by reversed phase HPLC. The total synthesis time was approximately 60 minutes for both radiolabelled compounds with an average specific activity of 240 mCi/{mu}mol calculated to EOB. Utilizing a similar synthetic strategy, we also reported the synthesis of milligram quantities of the carbon-13 enriched compounds and the magnetic resonance signal assignment for (-)-9-[{sup 13}C] isocolchicine. (Author).

  11. Accelerated carbonation of brucite in mine tailings for carbon sequestration.

    Science.gov (United States)

    Harrison, Anna L; Power, Ian M; Dipple, Gregory M

    2013-01-01

    Atmospheric CO(2) is sequestered within ultramafic mine tailings via carbonation of Mg-bearing minerals. The rate of carbon sequestration at some mine sites appears to be limited by the rate of CO(2) supply. If carbonation of bulk tailings were accelerated, large mines may have the capacity to sequester millions of tonnes of CO(2) annually, offsetting mine emissions. The effect of supplying elevated partial pressures of CO(2) (pCO(2)) at 1 atm total pressure, on the carbonation rate of brucite [Mg(OH)(2)], a tailings mineral, was investigated experimentally with conditions emulating those at Mount Keith Nickel Mine (MKM), Western Australia. Brucite was carbonated to form nesquehonite [MgCO(3) · 3H(2)O] at a rate that increased linearly with pCO(2). Geochemical modeling indicated that HCO(3)(-) promoted dissolution accelerated brucite carbonation. Isotopic and aqueous chemistry data indicated that equilibrium between CO(2) in the gas and aqueous phases was not attained during carbonation, yet nesquehonite precipitation occurred at equilibrium. This implies CO(2) uptake into solution remains rate-limiting for brucite carbonation at elevated pCO(2), providing potential for further acceleration. Accelerated brucite carbonation at MKM offers the potential to offset annual mine emissions by ~22-57%. Recognition of mechanisms for brucite carbonation will guide ongoing work to accelerate Mg-silicate carbonation in tailings. PMID:22770473

  12. Carbon dioxide conversion over carbon-based nanocatalysts.

    Science.gov (United States)

    Khavarian, Mehrnoush; Chai, Siang-Piao; Mohamed, Abdul Rahman

    2013-07-01

    The utilization of carbon dioxide for the production of valuable chemicals via catalysts is one of the efficient ways to mitigate the greenhouse gases in the atmosphere. It is known that the carbon dioxide conversion and product yields are still low even if the reaction is operated at high pressure and temperature. The carbon dioxide utilization and conversion provides many challenges in exploring new concepts and opportunities for development of unique catalysts for the purpose of activating the carbon dioxide molecules. In this paper, the role of carbon-based nanocatalysts in the hydrogenation of carbon dioxide and direct synthesis of dimethyl carbonate from carbon dioxide and methanol are reviewed. The current catalytic results obtained with different carbon-based nanocatalysts systems are presented and how these materials contribute to the carbon dioxide conversion is explained. In addition, different strategies and preparation methods of nanometallic catalysts on various carbon supports are described to optimize the dispersion of metal nanoparticles and catalytic activity. PMID:23901504

  13. Erosion of soil organic carbon: implications for carbon sequestration

    Science.gov (United States)

    Van Oost, Kristof; Van Hemelryck, Hendrik; Harden, Jennifer W.

    2009-01-01

    Agricultural activities have substantially increased rates of soil erosion and deposition, and these processes have a significant impact on carbon (C) mineralization and burial. Here, we present a synthesis of erosion effects on carbon dynamics and discuss the implications of soil erosion for carbon sequestration strategies. We demonstrate that for a range of data-based parameters from the literature, soil erosion results in increased C storage onto land, an effect that is heterogeneous on the landscape and is variable on various timescales. We argue that the magnitude of the erosion term and soil carbon residence time, both strongly influenced by soil management, largely control the strength of the erosion-induced sink. In order to evaluate fully the effects of soil management strategies that promote carbon sequestration, a full carbon account must be made that considers the impact of erosion-enhanced disequilibrium between carbon inputs and decomposition, including effects on net primary productivity and decomposition rates.

  14. Carbon dynamics of Oregon and Northern California forests and potential land-based carbon storage.

    Science.gov (United States)

    Hudiburg, Tara; Law, Beverly; Turner, David P; Campbell, John; Donato, Dan; Duane, Maureen

    2009-01-01

    Net uptake of carbon from the atmosphere (net ecosystem production, NEP) is dependent on climate, disturbance history, management practices, forest age, and forest type. To improve understanding of the influence of these factors on forest carbon stocks and flux in the western United States, federal inventory data and supplemental field measurements at additional plots were used to estimate several important components of the carbon balance in forests in Oregon and Northern California during the 1990s. Species- and ecoregion-specific allometric equations were used to estimate live and dead biomass stores, net primary productivity (NPP), and mortality. In the semiarid East Cascades and mesic Coast Range, mean total biomass was 8 and 24 kg C/m2, and mean NPP was 0.30 and 0.78 kg C.m(-2).yr(-1), respectively. Maximum NPP and dead biomass stores were most influenced by climate, whereas maximum live biomass stores and mortality were most influenced by forest type. Within ecoregions, mean live and dead biomass were usually higher on public lands, primarily because of the younger age class distribution on private lands. Decrease in NPP with age was not general across ecoregions, with no marked decline in old stands (>200 years old) in some ecoregions. In the absence of stand-replacing disturbance, total landscape carbon stocks could theoretically increase from 3.2 +/- 0.34 Pg C to 5.9 +/- 1.34 Pg C (a 46% increase) if forests were managed for maximum carbon storage. Although the theoretical limit is probably unattainable, given the timber-based economy and fire regimes in some ecoregions, there is still potential to significantly increase the land-based carbon storage by increasing rotation age and reducing harvest rates. PMID:19323181

  15. Production of High Purity Multi-Walled Carbon Nanotubes from Catalytic Decomposition of Methane

    Institute of Scientific and Technical Information of China (English)

    Kong Bee Hong; Aidawati Azlin Binti Ismail; Mohamed Ezzaham Bin Mohd Mahayuddin; Abdul Rahman Mohamed; Sharif Hussein Sharif Zein

    2006-01-01

    Acid-based purification process of multi-walled carbon nanotubes (MWNTs) produced via catalytic decomposition of methane with NiO/TiO2 as a catalyst is described. By combining the oxidation in air and the acid refluxes, the impurities, such as amorphous carbon, carbon nanoparticles, and the NiO/TiO2 catalyst, are eliminated. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) images confirm the removal of the impurities. The percentage of the carbon nanotubes purity was analyzed using thermal gravimetric analysis (TGA). Using this process, 99.9 wt% purity of MWNTs was obtained.

  16. Main: 1AW9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW9 トウモロコシ Corn Zea mays L. Glutathione Transferase Iii Name=Gst3a; Zea Mays Molec...LVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHASYLLYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTVAAIPLPPPPSSSA corn_1AW9.jpg ...

  17. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  18. Springtime carbon emission episodes at the Gosan background site revealed by total carbon, stable carbon isotopic composition, and thermal characteristics of carbonaceous particles

    Science.gov (United States)

    Jung, J.; Kawamura, K.

    2011-11-01

    In order to investigate the emission of carbonaceous aerosols at the Gosan background super-site (33.17° N, 126.10° E) in East Asia, total suspended particles (TSP) were collected during spring of 2007 and 2008 and analyzed for particulate organic carbon, elemental carbon, total carbon (TC), total nitrogen (TN), and stable carbon isotopic composition (δ13C) of TC. The stable carbon isotopic composition of TC (δ13CTC) was found to be lowest during pollen emission episodes (range: -26.2‰ to -23.5‰, avg. -25.2 ± 0.9‰), approaching those of the airborne pollen (-28.0‰) collected at the Gosan site. Based on a carbon isotope mass balance equation, we found that ~42% of TC in the TSP samples during the pollen episodes was attributed to airborne pollen from Japanese cedar trees planted around tangerine farms in Jeju Island. A negative correlation between the citric acid-carbon/TC ratios and δ13CTC was obtained during the pollen episodes. These results suggest that citric acid emitted from tangerine fruit may be adsorbed on the airborne pollen and then transported to the Gosan site. Thermal evolution patterns of organic carbon during the pollen episodes were characterized by high OC evolution in the OC2 temperature step (450 °C). Since thermal evolution patterns of organic aerosols are highly influenced by their molecular weight, they can be used as additional information on the formation of secondary organic aerosols and the effect of aging of organic aerosols during the long-range atmospheric transport and sources of organic aerosols.

  19. Springtime carbon emission episodes at the Gosan background site revealed by total carbon, stable carbon isotopic composition, and thermal characteristics of carbonaceous particles

    Directory of Open Access Journals (Sweden)

    J. Jung

    2011-11-01

    Full Text Available In order to investigate the emission of carbonaceous aerosols at the Gosan background super-site (33.17° N, 126.10° E in East Asia, total suspended particles (TSP were collected during spring of 2007 and 2008 and analyzed for particulate organic carbon, elemental carbon, total carbon (TC, total nitrogen (TN, and stable carbon isotopic composition (δ13C of TC. The stable carbon isotopic composition of TC (δ13CTC was found to be lowest during pollen emission episodes (range: −26.2‰ to −23.5‰, avg. −25.2 ± 0.9‰, approaching those of the airborne pollen (−28.0‰ collected at the Gosan site. Based on a carbon isotope mass balance equation, we found that ~42% of TC in the TSP samples during the pollen episodes was attributed to airborne pollen from Japanese cedar trees planted around tangerine farms in Jeju Island. A negative correlation between the citric acid-carbon/TC ratios and δ13CTC was obtained during the pollen episodes. These results suggest that citric acid emitted from tangerine fruit may be adsorbed on the airborne pollen and then transported to the Gosan site. Thermal evolution patterns of organic carbon during the pollen episodes were characterized by high OC evolution in the OC2 temperature step (450 °C. Since thermal evolution patterns of organic aerosols are highly influenced by their molecular weight, they can be used as additional information on the formation of secondary organic aerosols and the effect of aging of organic aerosols during the long-range atmospheric transport and sources of organic aerosols.

  20. Organic Carbon Isotope Geochemistry of the Neoproterozoic Doushantuo Formation, South China

    Institute of Scientific and Technical Information of China (English)

    GUO Qingjun; LIU Congqiang; Harald STRAUSS; Tatiana GOLDBERG; ZHU Maoyan; PI Daohui; WANG Jian

    2006-01-01

    The Neoproterozoic Doushantuo Formation on the Yangtze Platform, South China,documents a sedimentary succession with different sedimentary facies from carbonate platform to slope and to deep sea basin, and hosts one of the world-class phosphorite deposits. In these strata,exquisitely preserved fossils have been discovered: the Weng'an biota. This study presents carbon isotope geochemistry which is associated paired carbonate and organic matter from the Weng'an section of a carbonate platform (shelf of the Yangtze Platform, Guizhou Province) from the Songtao section and Nanming section of a transition belt (slope of the Yangtze Platform, Guizhou Province) and from the Yanwutan section (basin area of the Yangtze Platform, Hunan Province). Environmental variations and bio-events on the Yangtze Platform during the Late Neoproterozoic and their causal relationship are discussed. Negative carbon isotope values for carbonate and organic carbon (mean δ13Corg = -35.0%) from the uppermost Nantuo Formation are followed by an overall increase in δ13C up-section. Carbon isotope values vary between -9.9% and 3.6% for carbonate and between -35.6% and -21.5% for organic carbon, respectively. Heavier δ13Ccarb values suggest an increase in organic carbon burial, possibly related to increasing productivity (such as the Weng'an biota). The δ13C values of the sediments from the Doushantuo Formation decreased from the platform via the slope to basin,reflecting a reduced environment with minor dissolved inorganic carbon possibly due to a lower primary productivity. It is deduced that the classical upwelling process, the stratification structure and the hydrothermal eruption are principally important mechanisms to interpret the carbon isotopic compositions of the sediments from the Doushantuo Formation.

  1. Carbon dioxide dangers demonstration model

    Science.gov (United States)

    Venezky, Dina; Wessells, Stephen

    2010-01-01

    Carbon dioxide is a dangerous volcanic gas. When carbon dioxide seeps from the ground, it normally mixes with the air and dissipates rapidly. However, because carbon dioxide gas is heavier than air, it can collect in snowbanks, depressions, and poorly ventilated enclosures posing a potential danger to people and other living things. In this experiment we show how carbon dioxide gas displaces oxygen as it collects in low-lying areas. When carbon dioxide, created by mixing vinegar and baking soda, is added to a bowl with candles of different heights, the flames are extinguished as if by magic.

  2. V18P9C2. A complex phosphide carbide

    International Nuclear Information System (INIS)

    V18P9C2 crystallizes in the orthorhombic space group Pmma with the lattice parameters a = 17.044(3), b = 3.2219(7), and c = 13.030(2) Aa, Z = 2. The crystal structure is composed of 19 symmetry-independent atoms. The crystal structure is considered as a network formed by the transition metal atoms exhibiting cubic, trigonal prismatic, and octahedral voids centered by V, P, and C atoms, respectively. Vice versa, the V and P atoms form a three-dimensional network. The two CV6 octahedra are edge- and corner-connected to chains running parallel to [010]. The five unique P atoms are trigonal prismatically coordinated by V atoms with one to three faces capped again by a V atom. The V atoms have mainly cubic environments formed solely by V or by V and P atoms. V18P9C2 exhibits some structural relations to other compounds of the ternary system V-P-C as well as to other intermetallic phases. Despite the low carbon content, V18P9C2 is considered as a ternary compound rather than an interstitially stabilized (binary) phosphide in view of its special structural features.

  3. Create a Consortium and Develop Premium Carbon Products from Coal

    Energy Technology Data Exchange (ETDEWEB)

    Frank Rusinko; John Andresen; Jennifer E. Hill; Harold H. Schobert; Bruce G. Miller

    2006-01-01

    The objective of these projects was to investigate alternative technologies for non-fuel uses of coal. Special emphasis was placed on developing premium carbon products from coal-derived feedstocks. A total of 14 projects, which are the 2003 Research Projects, are reported herein. These projects were categorized into three overall objectives. They are: (1) To explore new applications for the use of anthracite in order to improve its marketability; (2) To effectively minimize environmental damage caused by mercury emissions, CO{sub 2} emissions, and coal impounds; and (3) To continue to increase our understanding of coal properties and establish coal usage in non-fuel industries. Research was completed in laboratories throughout the United States. Most research was performed on a bench-scale level with the intent of scaling up if preliminary tests proved successful. These projects resulted in many potential applications for coal-derived feedstocks. These include: (1) Use of anthracite as a sorbent to capture CO{sub 2} emissions; (2) Use of anthracite-based carbon as a catalyst; (3) Use of processed anthracite in carbon electrodes and carbon black; (4) Use of raw coal refuse for producing activated carbon; (5) Reusable PACs to recycle captured mercury; (6) Use of combustion and gasification chars to capture mercury from coal-fired power plants; (7) Development of a synthetic coal tar enamel; (8) Use of alternative binder pitches in aluminum anodes; (9) Use of Solvent Extracted Carbon Ore (SECO) to fuel a carbon fuel cell; (10) Production of a low cost coal-derived turbostratic carbon powder for structural applications; (11) Production of high-value carbon fibers and foams via the co-processing of a low-cost coal extract pitch with well-dispersed carbon nanotubes; (12) Use of carbon from fly ash as metallurgical carbon; (13) Production of bulk carbon fiber for concrete reinforcement; and (14) Characterizing coal solvent extraction processes. Although some of the

  4. A New Carbonate Chemistry in the Earth's Lower Mantle

    Science.gov (United States)

    Boulard, E.; Gloter, A.; Corgne, A.; Antonangeli, D.; Auzende, A.; Perrillat, J.; Guyot, F. J.; Fiquet, G.

    2010-12-01

    The global geochemical carbon cycle involves exchange between the Earth’s mantle and the surface. Carbon (C) is recycled into the mantle via subduction and released to the atmosphere via volcanic outgassing. Carbonates are the main C-bearing minerals that are transported deep in the Earth’s mantle via subduction of the oceanic lithosphere [1]. The way C is recycled and its contribution to the lower mantle reservoir is however largely unknown [ e.g 2, 3]. In this respect, it is important to assess if carbonates can be preserved in the deep mantle, or if decarbonatation, melting or reduction play a role in the deep carbon cycle. To clarify the fate of carbonates in the deep mantle, we carried out high-pressure and high-temperature experiments up to 105 GPa and 2850 K. Natural Fe-Mg carbonates or oxide mixtures of (Mg,Fe)O + CO2 were loaded into laser heated diamond anvil cells. In situ characterizations were done by X-ray Diffraction (XRD) using synchrotron radiation at the high-pressure beamline ID27 of the European Synchrotron Radiation Facility. A focused ion beam technique was then used to prepare the recovered samples for electron energy loss spectroscopy in a dedicated scanning transmission electron microscope (EELS-STEM) and scanning transmission X-ray microscopy (STXM). In situ XRD clearly shows the transformation of the initial carbonate phase into a new Mg-Fe high pressure carbonate phase at lower mantle conditions. We also provide direct evidence for recombination of CO2 with (Mg,Fe)O to form this new carbonate structure. In addition, subsequent EELS-STEM and STXM spectroscopies carried out on recovered samples yields C K-edge and stoechiometry characteristic to this new carbonate structure. This new high pressure phase concentrates a large amount of Fe(III), as a result of redox reactions within the siderite-rich carbonate. The oxidation of iron is balanced by partial reduction of carbon into CO groups and/or diamond. These reactions may provide an

  5. Carbon Nanotube Biosensors

    Directory of Open Access Journals (Sweden)

    Carmen-Mihaela eTilmaciu

    2015-10-01

    Full Text Available Nanomaterials possess unique features which make them particularly attractive for biosensing applications. In particular Carbon Nanotubes (CNTs can serve as scaffolds for immobilization of biomolecules at their surface, and combine several exceptional physical, chemical, electrical and optical characteristics properties which make them one of the best suited materials for the transduction of signals associated with the recognition of analytes, metabolites or disease biomarkers. Here we provide a comprehensive review on these carbon nanostructures, in which we will describe their structural and physical properties, discuss functionalization and cellular uptake, biocompatibility and toxicity issues. We further review historical developments in the field of biosensors, and describe the different types of biosensors which have been developed over time, with specific focus on CNT-conjugates engineered for biosensing applications, and in particular detection of cancer biomarkers.

  6. Carbon Fiber Composites

    Science.gov (United States)

    1997-01-01

    HyComp(R), Inc. development a line of high temperature carbon fiber composite products to solve wear problems in the harsh environment of steel and aluminum mills. WearComp(R), self-lubricating composite wear liners and bushings, combines carbon graphite fibers with a polyimide binder. The binder, in conjunction with the fibers, provides the slippery surface, one that demands no lubrication, yet wears at a very slow rate. WearComp(R) typically lasts six to ten times longer than aluminum bronze. Unlike bronze, WearComp polishes the same surface and imparts a self-lube film for years of service. It is designed for continuous operation at temperatures of 550 degrees Fahrenheit and can operate under high compressive loads.

  7. Growing carbon nanotubes

    Directory of Open Access Journals (Sweden)

    Yoshinori Ando

    2004-10-01

    Full Text Available The discovery of ‘fullerenes’ added a new dimension to the knowledge of carbon science1; and the subsequent discovery of ‘carbon nanotubes’ (CNTs, the elongated fullerene added a new dimension to the knowledge of technology2;. Today, ‘nanotechnology’ is a hot topic attracting scientists, industrialists, journalists, governments, and even the general public. Nanotechnology is the creation of functional materials, devices, and systems through control of matter on the nanometer scale and the exploitation of novel phenomena and properties of matter (physical, chemical, biological, electrical, etc. at that length scale. CNTs are supposed to be a key component of nanotechnology. Almost every week a new potential application of CNTs is identified, stimulating scientists to peep into this tiny tube with ever increasing curiosity.

  8. Carbon materials for supercapacitors

    Science.gov (United States)

    Gao, Yang

    As an important energy storage device, electrochemical supercapacitors or ultracapacitors fill the gap between conventional dielectric capacitors and batteries in terms of specific energy and power. Although supercapacitors have been used in electric vehicles, digital communication instruments, and pulsed lasers, further improvement of supercapacitor performance is highly needed to enhance the energy density without significantly losing the power density. Additionally, the conventional supercapacitors use rigid packages and liquid electrolytes, which limit applications in transparent and flexible electronics. To address these challenges, the research efforts in this dissertation mainly focused on: 1) improvement of the energy density of carbon nanoonions by chemical activation; 2) laser-assisted activation of carbon nanotubes for improved energy density; 3) fabrication of flexible solid-state supercapacitors based on nanocarbon and manganese dioxide (MnO2) hybrid electrodes; and 4) investigation of the electrochemical performance of graphene as transparent and flexible supercapacitor electrodes.

  9. Applications of Carbon Nanotubes

    Science.gov (United States)

    Ajayan, Pulickel M.; Zhou, Otto Z.

    Carbon nanotubes have attracted the fancy of many scientists worldwide. The small dimensions, strength and the remarkable physical properties of these structures make them a very unique material with a whole range of promising applications. In this review we describe some of the important materials science applications of carbon nanotubes. Specifically we discuss the electronic and electrochemical applications of nanotubes, nanotubes as mechanical reinforcements in high performance composites, nanotube-based field emitters, and their use as nanoprobes in metrology and biological and chemical investigations, and as templates for the creation of other nanostructures. Electronic properties and device applications of nanotubes are treated elsewhere in the book. The challenges that ensue in realizing some of these applications are also discussed from the point of view of manufacturing, processing, and cost considerations.

  10. Carbon neutron star atmospheres

    CERN Document Server

    Suleimanov, V F; Pavlov, G G; Werner, K

    2013-01-01

    The accuracy of measuring the basic parameters of neutron stars is limited in particular by uncertainties in chemical composition of their atmospheres. For example, atmospheres of thermally - emitting neutron stars in supernova remnants might have exotic chemical compositions, and for one of them, the neutron star in CasA, a pure carbon atmosphere has recently been suggested by Ho & Heinke (2009). To test such a composition for other similar sources, a publicly available detailed grid of carbon model atmosphere spectra is needed. We have computed such a grid using the standard LTE approximation and assuming that the magnetic field does not exceed 10^8 G. The opacities and pressure ionization effects are calculated using the Opacity Project approach. We describe the properties of our models and investigate the impact of the adopted assumptions and approximations on the emergent spectra.

  11. Carbon Lorenz Curves

    Energy Technology Data Exchange (ETDEWEB)

    Groot, L. [Utrecht University, Utrecht School of Economics, Janskerkhof 12, 3512 BL Utrecht (Netherlands)

    2008-11-15

    The purpose of this paper is twofold. First, it exhibits that standard tools in the measurement of income inequality, such as the Lorenz curve and the Gini-index, can successfully be applied to the issues of inequality measurement of carbon emissions and the equity of abatement policies across countries. These tools allow policy-makers and the general public to grasp at a single glance the impact of conventional distribution rules such as equal caps or grandfathering, or more sophisticated ones, on the distribution of greenhouse gas emissions. Second, using the Samuelson rule for the optimal provision of a public good, the Pareto-optimal distribution of carbon emissions is compared with the distribution that follows if countries follow Nash-Cournot abatement strategies. It is shown that the Pareto-optimal distribution under the Samuelson rule can be approximated by the equal cap division, represented by the diagonal in the Lorenz curve diagram.

  12. Carbon reduction potentials of China's industrial parks: A case study of Suzhou Industry Park

    International Nuclear Information System (INIS)

    Industrial parks are the economic engines for many China regions, but they also consume a great deal of energy and emit greenhouse gases. However, few empirical studies have examined these special communities. We selected SIP (Suzhou Industrial Park) as a case study. Carbon emissions from SIP were accounted from the consumption perspective to analyze their characteristics. Results showed total carbon emissions grew 85.2% from 2005 to 2010, and carbon intensity (carbon emissions per unit of GDP (gross domestic product)) decreased by 9%. Scenario analysis was then used to depict emissions trajectories under three different pathways. The total carbon emissions and per capita carbon emissions for SIP will undoubtedly increase in the near future under a business-as-usual scenario, improved-policy scenario, and low-carbon scenario; the carbon intensity will decrease by 38% under low-carbon scenario, but it will still be difficult to reach the national mitigation target. In addition, geographic-boundary-based accounting methodology was applied for comparison analysis, carbon emissions show a large gap of 42.4–65.1% from 2005 to 2010, due to failure to account for cross-boundary emissions from imported electricity. Therefore, comprehensive analysis from a consumption perspective is necessary to provide a fair and comprehensive tool for China's local decision-makers to evaluate carbon mitigation potentials. - Highlights: ► Carbon reduction potentials of industrial parks, which are important communities in China, were analyzed. ► Comprehensive carbon emission inventories were developed for a China's industrial park. ► Policies were recommended for industrial parks to achieve low-carbon development target. ► Consumption-based emission inventory is necessary for local government to evaluate carbon reduction potentials

  13. Digital carbonate rock physics

    Science.gov (United States)

    Saenger, Erik H.; Vialle, Stephanie; Lebedev, Maxim; Uribe, David; Osorno, Maria; Duda, Mandy; Steeb, Holger

    2016-08-01

    Modern estimation of rock properties combines imaging with advanced numerical simulations, an approach known as digital rock physics (DRP). In this paper we suggest a specific segmentation procedure of X-ray micro-computed tomography data with two different resolutions in the µm range for two sets of carbonate rock samples. These carbonates were already characterized in detail in a previous laboratory study which we complement with nanoindentation experiments (for local elastic properties). In a first step a non-local mean filter is applied to the raw image data. We then apply different thresholds to identify pores and solid phases. Because of a non-neglectable amount of unresolved microporosity (micritic phase) we also define intermediate threshold values for distinct phases. Based on this segmentation we determine porosity-dependent values for effective P- and S-wave velocities as well as for the intrinsic permeability. For effective velocities we confirm an observed two-phase trend reported in another study using a different carbonate data set. As an upscaling approach we use this two-phase trend as an effective medium approach to estimate the porosity-dependent elastic properties of the micritic phase for the low-resolution images. The porosity measured in the laboratory is then used to predict the effective rock properties from the observed trends for a comparison with experimental data. The two-phase trend can be regarded as an upper bound for elastic properties; the use of the two-phase trend for low-resolution images led to a good estimate for a lower bound of effective elastic properties. Anisotropy is observed for some of the considered subvolumes, but seems to be insignificant for the analysed rocks at the DRP scale. Because of the complexity of carbonates we suggest using DRP as a complementary tool for rock characterization in addition to classical experimental methods.

  14. Carbon nanotube network varactor

    Science.gov (United States)

    Generalov, A. A.; Anoshkin, I. V.; Erdmanis, M.; Lioubtchenko, D. V.; Ovchinnikov, V.; Nasibulin, A. G.; Räisänen, A. V.

    2015-01-01

    Microelectromechanical system (MEMS) varactors based on a freestanding layer of single-walled carbon nanotube (SWCNT) films were designed, fabricated and tested. The freestanding SWCNT film was employed as a movable upper patch in the parallel plate capacitor of the MEMS. The measurements of the SWCNT varactors show very high tunability, nearly 100%, of the capacitance with a low actuation voltage of 10 V. The functionality of the varactor is improved by implementing a flexible nanocellulose aerogel filling.

  15. CARBON DIOXIDE FIXATION.

    Energy Technology Data Exchange (ETDEWEB)

    FUJITA,E.

    2000-01-12

    Solar carbon dioxide fixation offers the possibility of a renewable source of chemicals and fuels in the future. Its realization rests on future advances in the efficiency of solar energy collection and development of suitable catalysts for CO{sub 2} conversion. Recent achievements in the efficiency of solar energy conversion and in catalysis suggest that this approach holds a great deal of promise for contributing to future needs for fuels and chemicals.

  16. Accounting for carbon

    OpenAIRE

    Lovell, Heather; Sales de Aguiar, Thereza; Bebbington, Jan; Larrinaga-Gonzalez, Carlos; International Emissions Trading Association

    2010-01-01

    ACCA working in partnership with IETA This report reveals how large emitters in the European Emissions Trading Scheme (EU ETS) are accounting for emission allowances. The diversity of emission-allowance accounting practices being used in Europe shows carbon financial accounting to be in its formative stages - rules and practices are still unsettled. With this report, ACCA, in partnership with IETA, is opening up the debate to a wider international audience. Publisher PDF

  17. Improving Carbon Fixation Pathways

    OpenAIRE

    Ducat, Daniel C.; Silver, Pamela A

    2012-01-01

    A recent resurgence in basic and applied research on photosynthesis has been driven in part by recognition that fulfilling future food and energy requirements will necessitate improvements in crop carbon-fixation efficiencies. Photosynthesis in traditional terrestrial crops is being reexamined in light of molecular strategies employed by photosynthetic microbes to enhance the activity of the Calvin cycle. Synthetic biology is well-situated to provide original approaches for compartmentalizing...

  18. Amorphous carbon for photovoltaics

    Science.gov (United States)

    Risplendi, Francesca; Grossman, Jeffrey C.

    2015-03-01

    All-carbon solar cells have attracted attention as candidates for innovative photovoltaic devices. Carbon-based materials such as graphene, carbon nanotubes (CNT) and amorphous carbon (aC) have the potential to present physical properties comparable to those of silicon-based materials with advantages such as low cost and higher thermal stability.In particular a-C structures are promising systems in which both sp2 and sp3 hybridization coordination are present in different proportions depending on the specific density, providing the possibility of tuning their optoelectronic properties and achieving comparable sunlight absorption to aSi. In this work we employ density functional theory to design suitable device architectures, such as bulk heterojunctions (BHJ) or pn junctions, consisting of a-C as the active layer material.Regarding BHJ, we study interfaces between aC and C nanostructures (such as CNT and fullerene) to relate their optoelectronic properties to the stoichiometry of aC. We demonstrate that the energy alignment between the a-C mobility edges and the occupied and unoccupied states of the CNT or C60 can be widely tuned by varying the aC density to obtain a type II interface.To employ aC in pn junctions we analyze the p- and n-type doping of a-C focusingon an evaluation of the Fermi level and work function dependence on doping.Our results highlight promising features of aC as the active layer material of thin-film solar cells.

  19. 25 CFR 575.9 - Final assessment.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Final assessment. 575.9 Section 575.9 Indians NATIONAL... § 575.9 Final assessment. (a) If the respondent fails to request a hearing as provided in part 577 of this chapter, the proposed civil fine assessment shall become a final order of the Commission....

  20. 40 CFR 1508.9 - Environmental assessment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Environmental assessment. 1508.9 Section 1508.9 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY TERMINOLOGY AND INDEX § 1508.9 Environmental assessment. Environmental assessment: (a) Means a concise public document for which a...

  1. 39 CFR 955.9 - Hearing election.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Hearing election. 955.9 Section 955.9 Postal... CONTRACT APPEALS § 955.9 Hearing election. As directed by Board order, each party shall inform the Board... elected, the election should state where and when the electing party desires the hearing to be...

  2. 37 CFR 501.9 - Patent protection.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent protection. 501.9 Section 501.9 Patents, Trademarks, and Copyrights UNDER SECRETARY FOR TECHNOLOGY, DEPARTMENT OF COMMERCE UNIFORM PATENT POLICY FOR RIGHTS IN INVENTIONS MADE BY GOVERNMENT EMPLOYEES § 501.9 Patent protection....

  3. 27 CFR 9.83 - Lake Erie.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Lake Erie. 9.83 Section 9... TREASURY LIQUORS AMERICAN VITICULTURAL AREAS Approved American Viticultural Areas § 9.83 Lake Erie. (a) Name. The name of the viticultural area described in this section is “Lake Erie.” (b) Approved...

  4. 27 CFR 9.99 - Clear Lake.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Clear Lake. 9.99 Section 9... TREASURY LIQUORS AMERICAN VITICULTURAL AREAS Approved American Viticultural Areas § 9.99 Clear Lake. (a) Name. The name of the viticultural area described in this section is “Clear Lake.” (b) Approved...

  5. 7 CFR 956.9 - Container.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Container. 956.9 Section 956.9 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and... OF SOUTHEAST WASHINGTON AND NORTHEAST OREGON Definitions § 956.9 Container. Container means a...

  6. 36 CFR 327.9 - Sanitation.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Sanitation. 327.9 Section 327.9 Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY RULES AND... § 327.9 Sanitation. (a) Garbage, trash, rubbish, litter, gray water, or any other waste material...

  7. 49 CFR 260.9 - Loan terms.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Loan terms. 260.9 Section 260.9 Transportation... FINANCING PROGRAM Overview § 260.9 Loan terms. The maximum repayment period for direct loans and guaranteed... equal to the rate on Treasury securities of a similar term. In general, the financial...

  8. 8 CFR 244.9 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Evidence. 244.9 Section 244.9 Aliens and... OF DESIGNATED STATES § 244.9 Evidence. (a) Documentation. Applicants shall submit all documentation... affidavit or other credible evidence may be submitted. (1) Evidence of identity and nationality....

  9. 43 CFR 402.9 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Contracts. 402.9 Section 402.9 Public... SALE OF LANDS IN FEDERAL RECLAMATION PROJECTS Public Lands § 402.9 Contracts. A contract in form... the United States by the Commissioner. A copy of the contract shall be furnished to the...

  10. 20 CFR 322.9 - Subsidiary remuneration.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Subsidiary remuneration. 322.9 Section 322.9... REMUNERATION § 322.9 Subsidiary remuneration. (a) Definition.The term “subsidiary remuneration” means remuneration not in excess of an average of $15 per day for the period with respect to which it is payable...

  11. 48 CFR 9.206-3 - Competition.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Competition. 9.206-3... CONTRACTOR QUALIFICATIONS Qualifications Requirements 9.206-3 Competition. (a) Presolicitation. If a... solicitation to ascertain whether the number of sources is adequate for competition. (See 9.204(a) for...

  12. 22 CFR 9.8 - Classification challenges.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification challenges. 9.8 Section 9.8 Foreign Relations DEPARTMENT OF STATE GENERAL SECURITY INFORMATION REGULATIONS § 9.8 Classification... classification status is improper are expected and encouraged to challenge the classification status of...

  13. 7 CFR 281.9 - Funding.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Funding. 281.9 Section 281.9 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... RESERVATIONS § 281.9 Funding. (a) Agency of State government. From the funds available to carry out...

  14. 44 CFR 150.9 - Funding.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Funding. 150.9 Section 150.9 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY FIRE PREVENTION AND CONTROL PUBLIC SAFETY AWARDS TO PUBLIC SAFETY OFFICERS § 150.9 Funding....

  15. 25 CFR 515.9 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Fees. 515.9 Section 515.9 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR GENERAL PROVISIONS PRIVACY ACT PROCEDURES § 515.9 Fees. The Commission... Commission may charge a fee sufficient to cover the cost of duplication....

  16. 10 CFR 9.85 - Fees.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Fees. 9.85 Section 9.85 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Privacy Act Regulations Fees § 9.85 Fees. Fees shall not be charged for search or... available for review, although fees may be charged for additional copies. Fees established under 31...

  17. 45 CFR 503.9 - Fees.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Fees. 503.9 Section 503.9 Public Welfare... Regulations § 503.9 Fees. Fees to be charged, if any, to any individual for making copies of that individual's... or because those services are required by some other law, the question of charging fees for...

  18. 41 CFR 51-9.304 - Fees.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Fees. 51-9.304 Section 51-9.304 Public Contracts and Property Management Other Provisions Relating to Public Contracts... Access to Records § 51-9.304 Fees....

  19. 40 CFR 1602.9 - Fees.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Fees. 1602.9 Section 1602.9 Protection... INDIVIDUAL RECORDS UNDER THE PRIVACY ACT OF 1974 § 1602.9 Fees. The CSB will charge fees for duplication of records under the Privacy Act in the same way in which it charges duplication fees under the FOIA...

  20. 23 CFR 751.9 - Effective control.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Effective control. 751.9 Section 751.9 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RIGHT-OF-WAY AND ENVIRONMENT JUNKYARD CONTROL AND ACQUISITION § 751.9 Effective control. (a) In order to provide effective control of junkyards located within...

  1. 38 CFR 9.12 - Reinsurance formula.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Reinsurance formula. 9.12 Section 9.12 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SERVICEMEMBERS' GROUP LIFE INSURANCE AND VETERANS' GROUP LIFE INSURANCE § 9.12 Reinsurance formula. The allocation...

  2. 12 CFR 704.9 - Liquidity management.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Liquidity management. 704.9 Section 704.9 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS CORPORATE CREDIT UNIONS § 704.9 Liquidity management. (a) General. In the management of liquidity, a corporate...

  3. 15 CFR 4.9 - Business Information.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Business Information. 4.9 Section 4.9 Commerce and Foreign Trade Office of the Secretary of Commerce DISCLOSURE OF GOVERNMENT INFORMATION Freedom of Information Act § 4.9 Business Information. (a) In general. Business information obtained by...

  4. 7 CFR 6.9 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Information. 6.9 Section 6.9 Agriculture Office of the Secretary of Agriculture IMPORT QUOTAS AND FEES General Provisions § 6.9 Information. Persons desiring information from the Department of Agriculture regarding section 22 or section 8(a), or any action...

  5. 22 CFR 61.9 - General information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General information. 61.9 Section 61.9 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES WORLD-WIDE FREE FLOW OF AUDIO-VISUAL MATERIALS § 61.9 General information. General information and application forms may be obtained by writing to...

  6. 16 CFR 0.9 - Organization structure.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Organization structure. 0.9 Section 0.9 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE ORGANIZATION § 0.9 Organization structure. The Federal Trade Commission comprises the following principal...

  7. 44 CFR 9.4 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 9.4 Section 9.4... GENERAL FLOODPLAIN MANAGEMENT AND PROTECTION OF WETLANDS § 9.4 Definitions. The following definitions... Management Agency (FEMA). Agency Assistance means grants for projects or planning activities, loans, and...

  8. 45 CFR 12a.9 - Application process.

    Science.gov (United States)

    2010-10-01

    ... the requirements of 45 CFR 12.9. (7) Historic preservation. Where applicable, the applicant must..., as specified in 45 CFR part 12. (c) Scope of evaluations. Due to the short time frame imposed for... 45 Public Welfare 1 2010-10-01 2010-10-01 false Application process. 12a.9 Section 12a.9...

  9. 24 CFR 9.131 - Direct threat.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Direct threat. 9.131 Section 9.131... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT § 9.131 Direct threat. (a) This part does not require the agency..., privileges, advantages and accommodations of that agency when that individual poses a direct threat to...

  10. 7 CFR 1206.9 - Importer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Importer. 1206.9 Section 1206.9 Agriculture... INFORMATION Mango Promotion, Research, and Information Order Definitions § 1206.9 Importer. Importer means any... United States for sale in the United States, and who is listed as the importer of record for such mangos....

  11. 7 CFR 1218.9 - Importer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Importer. 1218.9 Section 1218.9 Agriculture... INFORMATION ORDER Blueberry Promotion, Research, and Information Order Definitions § 1218.9 Importer. Importer... importer of record for such blueberries....

  12. 22 CFR 1507.9 - Judicial review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Judicial review. 1507.9 Section 1507.9 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION § 1507.9 Judicial review. Any person may file a complaint against the Foundation in the appropriate U.S. district court,...

  13. 46 CFR 386.9 - Gambling.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Gambling. 386.9 Section 386.9 Shipping MARITIME... THE UNITED STATES MERCHANT MARINE ACADEMY § 386.9 Gambling. Unless permitted by Executive or... the operation of gambling devices, or the conduct of a lottery or a pool, or the selling or...

  14. 48 CFR 9.407 - Suspension.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Suspension. 9.407 Section 9.407 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Debarment, Suspension, and Ineligibility 9.407 Suspension....

  15. 46 CFR 9.10 - Waiting time.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Waiting time. 9.10 Section 9.10 Shipping COAST GUARD... § 9.10 Waiting time. The same construction should be given the act when charging for waiting time as... for duty the waiting time amounts to at least one hour....

  16. 49 CFR 79.9 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Design. 79.9 Section 79.9 Transportation Office of the Secretary of Transportation MEDALS OF HONOR § 79.9 Design. The Department is authorized to adopt and revise the existing designs for the award, rosette, and ribbon provided for by statute....

  17. 15 CFR 746.9 - Syria.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Syria. 746.9 Section 746.9 Commerce... CONTROLS § 746.9 Syria. General Order No. 2, Supplement No. 1 to part 736 of the EAR, sets forth special controls for exports and reexports to Syria....

  18. 12 CFR 931.9 - Transition provision.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Transition provision. 931.9 Section 931.9 Banks and Banking FEDERAL HOUSING FINANCE BOARD FEDERAL HOME LOAN BANK RISK MANAGEMENT AND CAPITAL STANDARDS FEDERAL HOME LOAN BANK CAPITAL STOCK § 931.9 Transition provision. (a) In general. Each Bank shall...

  19. 32 CFR 505.9 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Reporting requirements. 505.9 Section 505.9 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY AID OF CIVIL AUTHORITIES AND PUBLIC RELATIONS ARMY PRIVACY ACT PROGRAM § 505.9 Reporting requirements. The Department of the Army...

  20. 45 CFR 32.9 - Financial hardship.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Financial hardship. 32.9 Section 32.9 Public... § 32.9 Financial hardship. (a) A debtor whose wages are subject to a withholding order may, at any time... as disability, divorce, or catastrophic illness which result in financial hardship. (b) A...

  1. 26 CFR 9.2 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false 9.2 Section 9.2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE TAX REDUCTION ACT OF 1975 § 9.2...

  2. 48 CFR 9.305 - Risk.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Risk. 9.305 Section 9.305... QUALIFICATIONS First Article Testing and Approval 9.305 Risk. Before first article approval, the acquisition of materials or components, or commencement of production, is normally at the sole risk of the contractor....

  3. 40 CFR 257.9 - Wetlands.

    Science.gov (United States)

    2010-07-01

    .... (b) For purposes of this section, wetlands means those areas that are defined in 40 CFR 232.2(r). ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Wetlands. 257.9 Section 257.9... Location Restrictions § 257.9 Wetlands. (a) Owners or operators of new units and lateral expansions...

  4. 42 CFR 9.11 - Animal transport.

    Science.gov (United States)

    2010-10-01

    ... CHIMPANZEES HELD IN THE FEDERALLY SUPPORTED SANCTUARY SYSTEM § 9.11 Animal transport. The transportation of chimpanzees by surface or air must be in accordance with the requirements set forth in the Animal Welfare Act... 42 Public Health 1 2010-10-01 2010-10-01 false Animal transport. 9.11 Section 9.11 Public...

  5. 46 CFR 9.8 - Broken periods.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Broken periods. 9.8 Section 9.8 Shipping COAST GUARD... § 9.8 Broken periods. In computing extra compensation where the services rendered are in broken periods and less than 2 hours intervene between such broken periods the time served should be...

  6. 7 CFR 633.9 - Conservation plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Conservation plan. 633.9 Section 633.9 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE LONG TERM CONTRACTING WATER BANK PROGRAM § 633.9 Conservation plan. (a) The program...

  7. 7 CFR 631.9 - Conservation plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Conservation plan. 631.9 Section 631.9 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE LONG TERM CONTRACTING GREAT PLAINS CONSERVATION PROGRAM General Provisions § 631.9...

  8. 48 CFR 9.104 - Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Standards. 9.104 Section 9.104 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Responsible Prospective Contractors 9.104 Standards....

  9. 49 CFR 179.100-9 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.100-9 Section 179.100-9... Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.100-9 Welding. (a) All..., appendix W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall...

  10. 49 CFR 179.300-9 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.300-9 Section 179.300-9... Specifications for Multi-Unit Tank Car Tanks (Classes DOT-106A and 110AW) § 179.300-9 Welding. (a) Longitudinal... fusion welded on class DOT-110A tanks. Welding procedures, welders and fabricators must be approved...

  11. 30 CFR 74.9 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... CFR part 51. Persons may obtain a copy from the International Organization for Standardization at the... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 74.9 Section 74.9 Mineral... DUST SAMPLING DEVICES Requirements for Continuous Personal Dust Monitors § 74.9 Quality assurance....

  12. 32 CFR 766.9 - Insurance requirements.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Insurance requirements. 766.9 Section 766.9... DEPARTMENT OF THE NAVY AVIATION FACILITIES BY CIVIL AIRCRAFT § 766.9 Insurance requirements. (a) Control of insurance. The Commander, Naval Facilities Engineering Command, or his designee, shall be responsible...

  13. 42 CFR 70.9 - Vaccination clinics.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Vaccination clinics. 70.9 Section 70.9 Public... INTERSTATE QUARANTINE § 70.9 Vaccination clinics. (a) The Director may establish vaccination clinics, through contract or otherwise, authorized to administer vaccines and/or other prophylaxis. (b) A vaccination...

  14. 12 CFR 9.15 - Fiduciary compensation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Fiduciary compensation. 9.15 Section 9.15 Banks... BANKS Regulations § 9.15 Fiduciary compensation. (a) Compensation of bank. If the amount of a national bank's compensation for acting in a fiduciary capacity is not set or governed by applicable law,...

  15. 17 CFR 171.9 - Service.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Service. 171.9 Section 171.9... ACTIONS General Provisions § 171.9 Service. (a) General requirements. Unless otherwise provided, all... service. Service may be made by personal delivery (effective upon receipt), mail (effective upon...

  16. 29 CFR 401.9 - Labor organization.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Labor organization. 401.9 Section 401.9 Labor Regulations... MEANING OF TERMS USED IN THIS SUBCHAPTER § 401.9 Labor organization. Labor organization means a labor organization engaged in an industry affecting commerce and includes any organization of any kind, any...

  17. 7 CFR 780.9 - Mediation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Mediation. 780.9 Section 780.9 Agriculture Regulations... PROGRAMS APPEAL REGULATIONS § 780.9 Mediation. (a) Any request for mediation must be submitted after... once: (1) If resolution of an adverse decision is not achieved in mediation, a participant may...

  18. 49 CFR 218.9 - Civil penalty.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 218.9 Section 218.9 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES General § 218.9 Civil penalty. Any person (an entity of any type... requirement of this part or causes the violation of any such requirement is subject to a civil penalty of...

  19. 49 CFR 235.9 - Civil penalty.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 235.9 Section 235.9 Transportation... SIGNAL SYSTEM OR RELIEF FROM THE REQUIREMENTS OF PART 236 § 235.9 Civil penalty. Any person (an entity of... violates any requirement of this part or causes the violation of any such requirement is subject to a...

  20. 24 CFR 9.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Communications. 9.160 Section 9.160... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT § 9.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants, participants, personnel of other...

  1. 12 CFR 352.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Communications. 352.9 Section 352.9 Banks and... NONDISCRIMINATION ON THE BASIS OF DISABILITY § 352.9 Communications. (a) The FDIC shall take appropriate steps to ensure effective communication with participants in FDIC programs, activities and EIT. (1) The FDIC...

  2. 10 CFR 171.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Communications. 171.9 Section 171.9 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) ANNUAL FEES FOR REACTOR LICENSES AND FUEL CYCLE LICENSES AND MATERIALS... APPROVALS AND GOVERNMENT AGENCIES LICENSED BY THE NRC § 171.9 Communications. All communications...

  3. 10 CFR 95.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Communications. 95.9 Section 95.9 Energy NUCLEAR... INFORMATION AND RESTRICTED DATA General Provisions § 95.9 Communications. Except where otherwise specified, all communications and reports concerning the regulations in this part should be submitted as...

  4. 32 CFR 518.9 - Reading room.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Reading room. 518.9 Section 518.9 National... RELATIONS THE FREEDOM OF INFORMATION ACT PROGRAM FOIA Reading Rooms § 518.9 Reading room. (a) Reading room... the records described, DA may elect to place other records in their reading room, and also make...

  5. 45 CFR 1388.9 - Peer review.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Peer review. 1388.9 Section 1388.9 Public Welfare... PROGRAM THE UNIVERSITY AFFILIATED PROGRAMS § 1388.9 Peer review. (a) The purpose of the peer review... D, Section 152 of the Act, must be evaluated through the peer review process. (c) Panels must...

  6. 27 CFR 9.172 - West Elks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false West Elks. 9.172 Section 9... TREASURY LIQUORS AMERICAN VITICULTURAL AREAS Approved American Viticultural Areas § 9.172 West Elks. (a) Name. The name of the viticultural area described in this section is “West Elks.” (b) Approved...

  7. 45 CFR 1610.9 - Accounting.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Accounting. 1610.9 Section 1610.9 Public Welfare Regulations Relating to Public Welfare (Continued) LEGAL SERVICES CORPORATION USE OF NON-LSC FUNDS, TRANSFERS OF LSC FUNDS, PROGRAM INTEGRITY § 1610.9 Accounting. Funds received by a recipient from a...

  8. 46 CFR 160.171-9 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.171-9 Section 160.171-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-9 Construction. (a) General....

  9. 46 CFR 160.176-9 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.176-9 Section 160.176-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-9 Construction. (a)...

  10. 46 CFR 160.174-9 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.174-9 Section 160.174-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Thermal Protective Aids § 160.174-9 Construction. (a)...

  11. 45 CFR 9.4 - Criteria.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Criteria. 9.4 Section 9.4 Public Welfare... SCIENTISTS, ENGINEERS, AND STUDENTS § 9.4 Criteria. (a) The official permitting use of Department facilities must determine that it would be consistent with the programs of his activity to participate....

  12. 45 CFR 9.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Purpose. 9.1 Section 9.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION USE OF HHS RESEARCH FACILITIES BY ACADEMIC SCIENTISTS, ENGINEERS, AND STUDENTS § 9.1 Purpose. To enhance the availability of DHHS scientific research and study facilities to academic...

  13. Nongovernmental valorization of carbon dioxide

    International Nuclear Information System (INIS)

    Carbon dioxide (CO2) is considered the largest contributor to the greenhouse gas effect. Most attempts to manage the flow of CO2 or carbon into our environment involve reducing net emissions or sequestering the gas into long-lived sinks. Using CO2 as a chemical feedstock has a long history, but using it on scales that might impact the net emissions of CO2 into the atmosphere has not generally been considered seriously. There is also a growing interest in employing our natural biomes of carbon such as trees, vegetation, and soils as storage media. Some amelioration of the net carbon emissions into the atmosphere could be achieved by concomitant large withdrawals of carbon. This report surveys the potential and limitations in employing carbon as a resource for organic chemicals, fuels, inorganic materials, and in using the biome to manage carbon. The outlook for each of these opportunities is also described

  14. A Better Carbon Footprint Label

    DEFF Research Database (Denmark)

    Thøgersen, John; Nielsen, Kristian S.

    2016-01-01

    Based on insights from behavioral economics, it is suggested to extend carbon footprint labeling with information about relative performance, using the well-known “traffic light” color scheme to communicate relative performance. To test this proposition, the impact of a carbon footprint label......, participants saw the original Carbon Trust label and in the other condition they saw the same label, but with traffic light colors added to communicate the product's relative performance in terms of carbon footprint. All included attributes were found to have a significant impact on consumer choices...... to indicate relative carbon footprint significantly increases carbon label effectiveness. Hence, a carbon footprint label is more effective if it uses traffic light colors to communicate the product's relative performance....

  15. Increasing the Tensile Property of Unidirectional Carbon/Carbon Composites by Grafting Carbon Nanotubes onto Carbon Fibers by Electrophoretic Deposition

    Institute of Scientific and Technical Information of China (English)

    Qiang Song; Kezhi Li; Hejun Li; Qiangang Fu

    2013-01-01

    Although in-situ growing carbon nanotubes (CNTs) on carbon fibers could greatly increase the matrix-dominated mechanical properties of carbon/carbon composites (C/Cs),it always decreased the tensile strength of carbon fibers.In this work,CNTs were introduced into unidirectional carbon fiber (CF) preforms by electrophoretic deposition (EPD) and they were used to reinforce C/Cs.Effects of the content of CNTs introduced by EPD on tensile property of unidirectional C/Cs were investigated.Results demonstrated that EPD could be used as a simple and efficient method to fabricate carbon nanotube reinforced C/Cs (CNT-C/Cs) with excellent tensile strength,which pays a meaningful way to maximize the global performance of CNT-C/Cs.

  16. Edge effects in finite elongated carbon nanotubes

    CERN Document Server

    Hod, O; Scuseria, G E; Hod, Oded; Peralta, Juan E.; Scuseria, Gustavo E.

    2006-01-01

    The importance of finite-size effects for the electronic structure of long zigzag and armchair carbon nanotubes is studied. We analyze the electronic structure of capped (6,6), (8,0), and (9,0) single walled carbon nanotubes as a function of their length up to 60 nm, using a divide and conquer density functional theory approach. For the metallic nanotubes studied, most of the physical features appearing in the density of states of an infinite carbon nanotube are recovered at a length of 40 nm. The (8,0) semi-conducting nanotube studied exhibits pronounced edge effects within the energy gap that scale as the inverse of the length of the nanotube. As a result, the energy gap reduces from the value of ~1 eV calculated for the periodic system to a value of ~0.25 eV calculated for a capped 62 nm long CNT. These edge effects are expected to become negligible only at tube lengths exceeding 6 micrometers. Our results indicate that careful tailoring of the nature of the system and its capping units should be applied w...

  17. Active carbons from low temperature conversion chars

    International Nuclear Information System (INIS)

    Hulls obtained from the fruits of five tropical biomass have been subjected to low temperature conversion process and their chars activated by partial physical gasification to produce active carbons. The biomass are T. catappa, B. nitida, L leucophylla, D. regia and O. martiana. The bulk densities of the samples ranged from 0.32 g.cm3 to 0.52 g.cm3. Out of the samples T. catappa recorded the highest cellulose content (41.9 g.100g-1), while O. martiana contained the highest lignin content (40.7 g.100g-1). The ash of the samples were low (0.5 - 4.4%). The percentage of char obtained after conversion were high (33.7% - 38.6%). Active carbons obtained from T. catappa, D. regia and O. martiana, recorded high methylene blue numbers and iodine values. They also displayed good micro- and mesostructural characteristics. Micropore volume (Vmicro) was between 0.33cm3.g-1 - 0.40cm3.g-1, while the mesopore volume(Vmeso) was between 0.05 cm3.g-1 - 0.07 cm3.g-1. The BET specific surface exceeds 1000 m2.g-1. All these values compared favourably with high grade commercial active carbons. (author)

  18. Effect of carbon nanotubes upon emissions from cutting and sanding carbon fiber-epoxy composites

    International Nuclear Information System (INIS)

    Carbon nanotubes (CNTs) are being incorporated into structural composites to enhance material strength. During fabrication or repair activities, machining nanocomposites may release CNTs into the workplace air. An experimental study was conducted to evaluate the emissions generated by cutting and sanding on three types of epoxy-composite panels: Panel A containing graphite fibers, Panel B containing graphite fibers and carbon-based mat, and Panel C containing graphite fibers, carbon-based mat, and multi-walled CNTs. Aerosol sampling was conducted with direct-reading instruments, and filter samples were collected for measuring elemental carbon (EC) and fiber concentrations. Our study results showed that cutting Panel C with a band saw did not generate detectable emissions of fibers inspected by transmission electron microscopy but did increase the particle mass, number, and EC emission concentrations by 20–80 % compared to Panels A and B. Sanding operation performed on two Panel C resulted in fiber emission rates of 1.9 × 108 and 2.8 × 106 fibers per second (f/s), while no free aerosol fibers were detected from sanding Panels A and B containing no CNTs. These free CNT fibers may be a health concern. However, the analysis of particle and EC concentrations from these same samples cannot clearly indicate the presence of CNTs, because extraneous aerosol generation from machining the composite epoxy material increased the mass concentrations of the EC

  19. Effect of carbon nanotubes upon emissions from cutting and sanding carbon fiber-epoxy composites

    Energy Technology Data Exchange (ETDEWEB)

    Heitbrink, William A. [LMK OSH Consulting LLC (United States); Lo, Li-Ming, E-mail: LLo@cdc.gov [Centers for Disease Control and Prevention (CDC), Division of Applied Research and Technology, National Institute for Occupational Safety and Health (NIOSH) (United States)

    2015-08-15

    Carbon nanotubes (CNTs) are being incorporated into structural composites to enhance material strength. During fabrication or repair activities, machining nanocomposites may release CNTs into the workplace air. An experimental study was conducted to evaluate the emissions generated by cutting and sanding on three types of epoxy-composite panels: Panel A containing graphite fibers, Panel B containing graphite fibers and carbon-based mat, and Panel C containing graphite fibers, carbon-based mat, and multi-walled CNTs. Aerosol sampling was conducted with direct-reading instruments, and filter samples were collected for measuring elemental carbon (EC) and fiber concentrations. Our study results showed that cutting Panel C with a band saw did not generate detectable emissions of fibers inspected by transmission electron microscopy but did increase the particle mass, number, and EC emission concentrations by 20–80 % compared to Panels A and B. Sanding operation performed on two Panel C resulted in fiber emission rates of 1.9 × 10{sup 8} and 2.8 × 10{sup 6} fibers per second (f/s), while no free aerosol fibers were detected from sanding Panels A and B containing no CNTs. These free CNT fibers may be a health concern. However, the analysis of particle and EC concentrations from these same samples cannot clearly indicate the presence of CNTs, because extraneous aerosol generation from machining the composite epoxy material increased the mass concentrations of the EC.

  20. Carbon felt supported carbon nanotubes catalysts composite electrode for vanadium redox flow battery application

    Science.gov (United States)

    Wei, Guanjie; Jia, Chuankun; Liu, Jianguo; Yan, Chuanwei

    2012-12-01

    A modified electrode for vanadium redox flow battery (VRFB) has been developed in this paper. The electrode is based on a traditional carbon felt (CF) grafted with the short-carboxylic multi-walled carbon nanotubes (MWCNTs). The microstructure and electrochemical property of the modified electrode as well as the performance of the VRFB single cell with it have been characterized. The results show that the MWCNTs are evenly dispersed and adhere to the surface of carbon fibres in the CF. The electrochemical activities of the modified CF electrode have been improved dramatically and the reversibility of the VO2+/VO2+ and V3+/V2+ redox couples increased greatly. The VRFB single cell with the modified CF exhibits higher coulombic efficiency (93.9%) and energy efficiency (82.0%) than that with the pristine CF. The SEM analysis shows that the MWCNTs still cohere with carbon fibres after charge and discharge test, indicating the stability of the MWCNTs in flowing electrolyte. Therefore, the composite electrode presents considerable potential for the commercial application of CF in VRFB.