WorldWideScience

Sample records for carbon 22

  1. Building complex carbon skeletons with ethynyl[2.2]paracyclophanes

    OpenAIRE

    Ina Dix; Lidija Bondarenko; Jones, Peter G; Thomas Oeser; Henning Hopf

    2014-01-01

    Ethynyl[2.2]paracyclophanes are shown to be useful substrates for the preparation of complex, highly unsaturated carbon frameworks. Thus both the pseudo-geminal- 2 and the pseudo-ortho-diethynylcyclophane 4 can be dimerized by Glaser coupling to the respective dimers 9/10 and 11/12. Whereas the former isomer pair could not be separated so far, the latter provided the pure diastereomers after extensive column chromatography/recrystallization. Isomer 11 is chiral and could be separated on a col...

  2. Carbon Nanotubes: Printed Carbon Nanotube Electronics and Sensor Systems (Adv. Mater. 22/2016).

    Science.gov (United States)

    Chen, Kevin; Gao, Wei; Emaminejad, Sam; Kiriya, Daisuke; Ota, Hiroki; Nyein, Hnin Yin Yin; Takei, Kuniharu; Javey, Ali

    2016-06-01

    Printed electronics and sensors enable new applications ranging from low-cost disposable analytical devices to large-area sensor networks. Recent progress in printed carbon nanotube electronics in terms of materials, processing, devices, and applications is discussed on page 4397 by A. Javey and co-workers. The research challenges and opportunities regarding the processing and system-level integration are also discussed for enabling of practical applications. PMID:27273439

  3. Carbon Nanotubes: Printed Carbon Nanotube Electronics and Sensor Systems (Adv. Mater. 22/2016).

    Science.gov (United States)

    Chen, Kevin; Gao, Wei; Emaminejad, Sam; Kiriya, Daisuke; Ota, Hiroki; Nyein, Hnin Yin Yin; Takei, Kuniharu; Javey, Ali

    2016-06-01

    Printed electronics and sensors enable new applications ranging from low-cost disposable analytical devices to large-area sensor networks. Recent progress in printed carbon nanotube electronics in terms of materials, processing, devices, and applications is discussed on page 4397 by A. Javey and co-workers. The research challenges and opportunities regarding the processing and system-level integration are also discussed for enabling of practical applications.

  4. Combined microcalorimetric and IR spectroscopic study on carbon dioxide adsorption in H-MCM-22

    International Nuclear Information System (INIS)

    Highlights: • Adsorption calorimetry and variable temperature IR spectroscopy is used to study adsorption of CO2 in the protonic zeolite H-MCM-22. • By simultaneously recording IR absorbance over a temperature range, temperature and equilibrium pressure, standard adsorption enthalpy and entropy of CO2 was determined. • The results are discussed in the broader context of carbon dioxide capture from the flue gas of fossil fuel fired power stations. - Abstract: The thermodynamics of carbon dioxide adsorption in the protonic zeolite H-MCM-22 (Si:Al = 16:1) was investigated by means of adsorption calorimetry and variable-temperature IR spectroscopy, a technique that affords determination of standard adsorption enthalpy (ΔH0) and entropy (ΔS0) from analysis of a series of IR spectra recorded over a temperature range while simultaneously measuring equilibrium pressure inside a closed IR cell. ΔH0 resulted to be −24.5 (±2) kJ mol−1, while for the entropy change the value of ΔS0 = −115 (±10) J mol−1 K−1 was obtained. The obtained ΔH0 value is compared with those reported in the literature for the adsorption of CO2 on other zeolites, and discussed in the context of carbon dioxide capture and sequestration

  5. Combined microcalorimetric and IR spectroscopic study on carbon dioxide adsorption in H-MCM-22

    Science.gov (United States)

    Arean, C. O.; Delgado, M. R.; Bulánek, R.; Frolich, K.

    2014-10-01

    The thermodynamics of carbon dioxide adsorption in the protonic zeolite H-MCM-22 (Si:Al = 16:1) was investigated by means of adsorption calorimetry and variable-temperature IR spectroscopy, a technique that affords determination of standard adsorption enthalpy (ΔH0) and entropy (ΔS0) from analysis of a series of IR spectra recorded over a temperature range while simultaneously measuring equilibrium pressure inside a closed IR cell. ΔH0 resulted to be -24.5 (±2) kJ mol-1, while for the entropy change the value of ΔS0 = -115 (±10) J mol-1 K-1 was obtained. The obtained ΔH0 value is compared with those reported in the literature for the adsorption of CO2 on other zeolites, and discussed in the context of carbon dioxide capture and sequestration.

  6. Density functional theory study of ultrasmall diameter (2,2) boron nitride, silicon carbide, and carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Fakhrabad, Davoud Vahedi; Shahtahmassebi, Nasser [Nano Research Center, Department of Physics, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of); Movlarooy, Tayebeh [Department of Physics, Shahrood University of Technology, Shahrood (Iran, Islamic Republic of)

    2012-05-15

    We present a first principles calculation on the electronic structure and optical properties of ultrasmall-diameter (2,2) boron nitride, silicon carbide, and carbon nanotubes (BNNT, SiCNT, and CNT) by using full potential linear augmented plane wave (FP-LAPW) and pseudo potential plane wave (PP-PW) methods. The atomic geometries of all considered models are optimized. Calculations of optical spectra are performed under electric fields polarized both parallel and perpendicular with respect to the nanotube (NT) axis. Our results show that the dielectric function is anisotropic and it is revealed that (2,2) SiCNT would be better dielectric material than (2,2) BNNT. We have calculated the first, second and third optical transitions for the considered models. The value of the optical gap for (2,2) BNNT is obtained much larger than that of (2,2) SiCNT and (2,2) CNT. The results show that contrary to the (2,2) CNT being metallic, the (2,2) BNNT, and (2,2) SiCNT are wide indirect gap semiconductors. We also present the energy loss function; in this case the intertube interactions play an important role with respect to the optical spectroscopy. Our results revealed that unlike the dielectric function, the calculated energy loss function show rather weak anisotropy. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Coating curly carbon nanotubes with monocrystalline Zn(BO2)2 and the mechanism of straightening the tubes

    Institute of Scientific and Technical Information of China (English)

    LIU; Jinzhang; YAN; Pengxun; YUE; Guanghui

    2006-01-01

    We overgrew single-crystalline Zn(BO2)2 coatings on carbon nanotubes (CNTs) for the first time. Scanning electron microscopy and transmission electron microscopy analyses revealed that the carbon nanotube-zinc borate composite rods are from tens to hundreds of nm in diameter. It is notable that the original curly tubes were straightened by the monocrystalline coatings. In addition, the crystal nucleation and growth on the surface of CNT were explained. We set a two-dimensional model, which is based on our experimental result, to qualitatively explain the mechanism of straightening the curly tubes by coating them with single-crystals.

  8. Stabilizing of the Transitory Species (TiO2)2 by Encapsulation Into Carbon Nanotubes.

    Science.gov (United States)

    Dargouthi, Sarra; Boughdiri, Salima; Tangour, Bahoueddine

    2015-01-01

    The aim of this paper is studying the encapsulation effect of carbon nanotubes (CNTs ) on the stabilizing process of titanium dioxide molecule dimers (TiO2)2. First, a theoretical study was performed concerning the guest species that are various titanium dioxide dimers. Five structures were treated as following: i) Cis (C) or ii)Trans (T) relatively to a square shaped fragment Ti2O2, iii) a mixed Tetrahedral/Pyramidal (T/P) disposition while two titanium atoms are sharing three oxygen atoms, and finally not bonded dimers in iv) parallel (P) and v) orthogonal (O) positions respectively. Only the (T), (C) and (T/P) isomers may be considered as stable compounds. The structure of the T-dimer is more stable than the Cis one by only 6.5 kcal mol-1. Typically, intra and extracyclic Ti-O bond lengths are 1.84Å and 1.61Å respectively. (T/P) dimer can be described as a metastable structure since its energy is higher than (T) one by 19 kcal mol-1. NBO analysis highlights the participation of dative bonding between oxygen lone pair and vacant titanium 3d orbitals. (P) and (O) structures represent transitory species that transform into the more stable structure which is the T-dimer. The second and principal part of this work concerns the re-optimization of the studied structures placed inside the CNT (12,0). Only (T), (C) and (P) dimers are stabilized by encapsulation through the establishment of strong interactions with the CNT wall. The (T / P) and (O) isomers which are converted into (T) and (P) dimers respectively, are leaving the nanotube while they still interacting with its edge. These favorable results are indicating in one hand the possibly detection of (T) and (C) isomers, and in another hand that the process of polymerization of the TiO2 molecule which is leading to nanostructured materials could be controlled by encapsulation within the CNTs. PMID:26085429

  9. 2012 CHEMISTRY & PHYSICS OF GRAPHITIC CARBON MATERIALS GORDON RESEARCH CONFERENCE, JUNE 17-22, 2012

    Energy Technology Data Exchange (ETDEWEB)

    Fertig, Herbert

    2012-06-22

    This conference will highlight the urgency for research on graphitic carbon materials and gather scientists in physics, chemistry, and engineering to tackle the challenges in this field. The conference will focus on scalable synthesis, characterization, novel physical and electronic properties, structure-properties relationship studies, and new applications of the carbon materials. Contributors

  10. Properties of Lithium-11 and Carbon-22 at leading order in halo effective field theory

    Directory of Open Access Journals (Sweden)

    Acharya Bijaya

    2016-01-01

    Full Text Available We study the 11Li and 22C nuclei at leading order (LO in halo effective field theory (Halo EFT. Using the value of the 22C rms matter radius deduced in Ref. [1] as an input in a LO calculation, we simultaneously constrain the values of the two-neutron (2n separation energy of 22C and the virtual-state energy of the 20C−neutron system (hereafter denoted 21C. The 1−σ uncertainty of the input rms matter radius datum, along with the theory error estimated from the anticipated size of the higher-order terms in the Halo EFT expansion, gives an upper bound of about 100 keV for the 2n separation energy. We also study the electric dipole excitation of 2n halo nuclei to a continuum state of two neutrons and the core at LO in Halo EFT. We first compare our results with the 11Li data from a Coulomb dissociation experiment and obtain good agreement within the theoretical uncertainty of a LO calculation. We then obtain the low-energy spectrum of B(E1 of this transition at several different values of the 2n separation energy of 22C and the virtual-state energy of 21C. Our predictions can be compared to the outcome of an ongoing experiment on the Coulomb dissociation of 22C to obtain tighter constraints on the two- and three-body energies in the 22C system.

  11. Properties of Lithium-11 and Carbon-22 at leading order in halo effective field theory

    Science.gov (United States)

    Acharya, Bijaya; Phillips, Daniel R.

    2016-03-01

    We study the 11Li and 22C nuclei at leading order (LO) in halo effective field theory (Halo EFT). Using the value of the 22C rms matter radius deduced in Ref. [1] as an input in a LO calculation, we simultaneously constrain the values of the two-neutron (2n) separation energy of 22C and the virtual-state energy of the 20C-neutron system (hereafter denoted 21C). The 1-σ uncertainty of the input rms matter radius datum, along with the theory error estimated from the anticipated size of the higher-order terms in the Halo EFT expansion, gives an upper bound of about 100 keV for the 2n separation energy. We also study the electric dipole excitation of 2n halo nuclei to a continuum state of two neutrons and the core at LO in Halo EFT. We first compare our results with the 11Li data from a Coulomb dissociation experiment and obtain good agreement within the theoretical uncertainty of a LO calculation. We then obtain the low-energy spectrum of B(E1) of this transition at several different values of the 2n separation energy of 22C and the virtual-state energy of 21C. Our predictions can be compared to the outcome of an ongoing experiment on the Coulomb dissociation of 22C to obtain tighter constraints on the two- and three-body energies in the 22C system.

  12. Effects of hydroxylated carbon nanotubes on the aggregation of Aβ16-22 peptides: a combined simulation and experimental study.

    Science.gov (United States)

    Xie, Luogang; Lin, Dongdong; Luo, Yin; Li, Huiyu; Yang, Xinju; Wei, Guanghong

    2014-10-21

    The pathogenesis of Alzheimer's disease (AD) is associated with the aggregation of amyloid-β (Aβ) peptides into toxic aggregates with ?-sheet character. In a previous computational study, we showed that pristine single-walled carbon nanotubes (SWCNTs) can inhibit the formation of β-sheet-rich oligomers in the central hydrophobic core fragment of Aβ (Aβ16-22). However, the poor solubility of SWCNTs in water hinders their use in biomedical applications and nanomedicine. Here, we investigate the influence of hydroxylated SWCNT, a water-soluble SWCNT derivative, on the aggregation of Aβ16-22 peptides using all-atom explicit-water replica exchange molecular dynamics simulations. Our results show that hydroxylated SWCNTs can significantly inhibit β-sheet formation and shift the conformations of Aβ16-22 oligomers from ordered β-sheet-rich structures toward disordered coil aggregates. Detailed analyses of the SWCNT-Aβ interaction reveal that the inhibition of β-sheet formation by hydroxylated SWCNTs mainly results from strong electrostatic interactions between the hydroxyl groups of SWCNTs and the positively charged residue K16 of Aβ16-22 and hydrophobic and aromatic stacking interactions between SWCNTs and F19 and F20. In addition, our atomic force microscopy and thioflavin T fluorescence experiments confirm the inhibitory effect of both pristine and hydroxylated SWCNTs on Aβ16-22 fibrillization, in support of our previous and present replica exchange molecular dynamics simulation results. These results demonstrate that hydroxylated SWCNTs efficiently inhibit the aggregation of Aβ16-22; in addition, they offer molecular insight into the inhibition mechanism, thus providing new clues for the design of therapeutic drugs against amyloidosis.

  13. Measurement of the analyzing power for proton-carbon elastic scattering in the CNI region with a 22 GeV/c polarized proton beam

    International Nuclear Information System (INIS)

    We have carried out the experiment BNL-AGS E950 to measure the analyzing power for proton-carbon elastic scattering in the Coulomb-Nuclear Interference (CNI) region with a 22 GeV/c polarized proton beam. Recoil carbons from 300 keV to a few MeV in the CNI region, were detected inside the AGS ring to identify proton-carbon elastic scattering. The preliminary results of the analyzing power measurement are presented

  14. Bis(2,2-dimethyl-2,3-dihydro-1-benzofuran-7-yl carbonate

    Directory of Open Access Journals (Sweden)

    Lin-Tao Yang

    2011-02-01

    Full Text Available The title compound, C21H22O5, crystallizes with three molecules in the asymmetric unit. In one molecule, two methyl groups are disordered over two positions with a site occupation factor of 0.72 (2 for the major occupancy site. The benzene rings make dihedral angles of 35.3 (6, 29.7 (6 and 40.6 (7° in the three molecules.

  15. Properties of Lithium-11 and Carbon-22 at leading order in halo effective field theory

    CERN Document Server

    Acharya, Bijaya

    2015-01-01

    We study the $^{11}\\mathrm{Li}$ and $^{22}\\mathrm{C}$ nuclei at leading order (LO) in halo effective field theory (Halo EFT). Using the value of the $^{22}\\mathrm{C}$ rms matter radius deduced in Ref. [1] as an input in a LO calculation, we simultaneously constrained the values of the two-neutron (2$n$) separation energy of $^{22}\\mathrm{C}$ and the virtual-state energy of the $^{20}\\mathrm{C}-$neutron system (hereafter denoted $^{21}$C). The 1$-\\sigma$ uncertainty of the input rms matter radius datum, along with the theory error estimated from the anticipated size of the higher-order terms in the Halo EFT expansion, gave an upper bound of about 100 keV for the 2$n$ separation energy. We also study the electric dipole excitation of 2$n$ halo nuclei to a continuum state of two neutrons and the core at LO in Halo EFT. We first compare our results with the $^{11}\\mathrm{Li}$ data from a Coulomb dissociation experiment and obtain good agreement within the theoretical uncertainty of a LO calculation. We then obtai...

  16. Redox State of the Deep Ocean During the 2.22-2.1 Ga Carbon Isotope Excursion

    Science.gov (United States)

    Bekker, A.; Shen, Y.; Scott, C.; Kacanda, M.; Lyons, T.; Kenig, F.; Anbar, A.; Rouxel, O.

    2006-05-01

    Response of the redox state of the deep ocean to the rise of atmospheric oxygen, as well as the 2.22-2.1 Ga carbon isotope excursion that followed, is not known. The c. 2.15 Ga Sengoma Argillite Formation (SAF), Botswana, is correlative with the Silverton Formation (SF), South Africa, which contains carbonates with δ °13°C values ranging from +8.3 to +11.3 ‰ PDB. Both units were deposited along the northern margin of the Kaapvaal Craton in an open-marine environment. The SAF consists of two upward- shallowing cycles with organic-rich sulfidic shales deposited in subtidal settings at the base and red beds deposited in coastal and fluvial settings at the top. Sulfur isotope data show a large range from -21.3 to +13.7 ‰ V-CDT with highly negative values confined to the lower part of the cycles and positive values to the upper part of the cycles. The Fe speciation data show similar stratigraphic trends. Carbon isotope values of organic matter are as low as -33.7 ‰ PDB, and if compared with carbonate carbon isotope record of the correlative SF, suggest significant contribution from secondary productivity via either sulfur or methane oxidation. Mo concentrations in these organic-rich shales are just above crustal levels. These data suggest deep ocean euxinic conditions during the carbon isotope excursion. Fe isotope data for sulfides from these shales show an unusually narrow range of Fe isotope values relative to other Archean and Paleoproterozoic sulfides. These data fall within the range of the hydrothermal iron flux, suggesting complete Fe reduction and precipitation as sulfide in the deep ocean. The 2.1-2.0 Ga Ludikovian black shales, Russia, were also deposited in an open marine and euxinic environment but contain much higher Mo levels up to 74 ppm and sulfides with Fe isotope values ranging from those of hydrothermal Fe flux to highly positive values. Higher Mo concentrations in these shales suggest that significant part of the ocean was not a sink for Mo

  17. Biochemical Contributions to Corrosion of Carbon Steel and Alloy 22 in a Continual Flow System

    International Nuclear Information System (INIS)

    Microbiologically influenced corrosion (MIC) may decrease the functional lifetime of nuclear waste packaging materials in the potential geologic repository at Yucca Mountain (YM), Nevada. Biochemical contributions to corrosion of package materials are being determined in reactors containing crushed repository-site rock with the endogenous microbial community, and candidate waste package materials. These systems are being continually supplied with simulated ground water. Periodically, bulk chemistries are analyzed on the system outflow, and surfacial chemistries are assessed on withdrawn material coupons. Both Fe and Mn dissolved from C1020 coupons under conditions that included the presence of YM microorganisms. Insoluble corrosion products remained in a reduced state at the coupon surface, indicating at least a localized anoxic condition; soluble reduced Mn and Fe were also detected in solution, while precipitated and spalled products were oxidized. Alloy 22 surfaces showed a layer of chrome oxide, almost certainly in the Cr(III) oxidation state, on microcosm-exposed coupons, while no soluble chrome was detected in solution. The results of these studies will be compared to identical testing on systems containing sterilized rock to generate, and ultimately predict, microbial contributions to waste package corrosion chemistries

  18. Influence of different carbon sources on exopolysaccharide production by Lactobacillus delbrueckii subsp. bulgaricus (B3, G12 and Streptococcus thermophilus (W22

    Directory of Open Access Journals (Sweden)

    Zehra Nur Yuksekdag

    2008-06-01

    Full Text Available Exopolysaccharides (EPSs production was studied by Lactobacillus delbrueckii subsp. bulgaricus (B3, G12 and Streptococcus thermophilus (W22 in the medium containing various carbon sources (glucose, fructose, sucrose or lactose. For all the strains, glucose was the most efficient carbon source and B3, G12 and W22 strains produced 211, 175 and 120 EPS mg/L respectively. Also, the influence of different concentrations of glucose (5,10,15,20,25,30 g/L on EPS production and growth was studied. The results indicated that EPS production and growth were stimulated by the high glucose concentration (30 g/L.

  19. Hydrodynamic Gene Delivery of Interleukin-22 Protects the Mouse Liver from Concanavalin A-, Carbon Tetrachloride-, and Fas Ligand-Induced Injury via Activation of STAT3

    Institute of Scientific and Technical Information of China (English)

    HongnaPan; FengHong; SvetlanaRadaeva; BinGao

    2004-01-01

    Interleukin-22 (IL-22) is a recently identified T cell-derived cytokine whose biological significance remains obscure. Previously, we have shown that IL-22 plays a protective role in T cell-mediated hepatitis induced by Concanavalin A (Con A), acting as a survival factor for hepatocytes. In the present paper, we demonstrate that hydrodynamic gene delivery of IL-22 cDNA driven either by a liver-specific albumin promoter or a human cytomegalovirus (CMV) promoter results in IL-22 protein expression, STAT3 activation, and expression of several anti-apoptotic proteins, including Bcl-xL, Bcl-2, and Mcl-1 in the liver. Immunohistochemical analysis reveals that IL-22 protein expression is mainly detected in the cytoplasm of hepatocytes. Overexpression of IL-22 by hydrodynamic gene delivery significantly protects against liver injury, necrosis, and apoptosis induced by administration of Con A, carbon tetrachloride (CCl4), or the Fas agonist Jo-2 mAb. Western blot analyses show that overexpression of IL-22 significantly enhances activation of STAT3 and expression of Bcl-xL, Bcl-2, and Mcl-1 proteins in liver injury induced by Con A. In conclusion, hydrodynamic gene delivery of IL-22 protects against liver injury induced by a variety of toxins, suggesting the therapeutic potential of IL-22 in treating human liver disease. Cellular & Molecular Immunology. 2004;1(1):43-49.

  20. Hydrodynamic Gene Delivery of Interleukin-22 Protects the Mouse Liver from Concanavalin A-, Carbon Tetrachloride-, and Fas Ligand-Induced Injury via Activation of STAT3

    Institute of Scientific and Technical Information of China (English)

    Hongna Pan; Feng Hong; Svetlana Radaeva; Bin Gao

    2004-01-01

    Interleukin-22 (IL-22) is a recently identified T cell-derived cytokine whose biological significance remains obscure. Previously, we have shown that IL-22 plays a protective role in T cell-mediated hepatitis induced by Concanavalin A (Con A), acting as a survival factor for hepatocytes. In the present paper, we demonstrate that hydrodynamic gene delivery of IL-22 cDNA driven either by a liver-specific albumin promoter or a human cytomegalovirus (CMV) promoter results in IL-22 protein expression, STAT3 activation, and expression of several anti-apoptotic proteins, including Bcl-xL, Bcl-2, and Mcl-1 in the liver. Immunohistochemical analysis reveals that IL-22 protein expression is mainly detected in the cytoplasm of hepatocytes. Overexpression of IL-22 by hydrodynamic gene delivery significantly protects against liver injury, necrosis, and apoptosis induced by administration of Con A, carbon tetrachloride (CCl4), or the Fas agonist Jo-2 mAb. Western blot analyses show that overexpression of IL-22 significantly enhances activation of STAT3 and expression of Bcl-xL, Bcl-2,and Mcl-1 proteins in liver injury induced by Con A. In conclusion, hydrodynamic gene delivery of IL-22 protects against liver injury induced by a variety of toxins, suggesting the therapeutic potential of IL-22 in treating human liver disease. Cellular & Molecular Immunology. 2004;1(1):43-49.

  1. Kinetics and mechanism studies on scandium calix[6]arene complex initiating ring-opening polymerization of 2,2-dimethyltrimethylene carbonate

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Scandium p-tert-butylcalix[6]arene complex has been synthesized from scandium isopropoxide and p-tert-butylcalix[6]arene and used as a single component initiator for the first time. The polymerization of 2,2-dimethyltrimethylene carbonate (DTC) using this complex can proceed under mild conditions. Poly (2,2-dimethyltrimethylene carbonate) (PolyDTC) with weight-average molecular weight of 33700 and molecular weight distribution of 1.21 can be prepared. Kinetics study indicates that the polymerization rate is first order with respect to both monomer and initiator concentrations, and the apparent activation energy of the polymerization is 22.7 kJ/mol. 1H NMR spectrum of the polymer reveals that the monomer ring opens via acyl-oxygen bond cleavage leading to an active center of Sc-O.

  2. Ring-opening polymerization of 2,2-dimethyltrimethylene carbonate using rare earth aryl oxides substituted by alkyl groups

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Single component rare earth aryl oxides substituted by various alkyl groups [Ln(OAr)3] such as methyl,isopropyl,and tertbutyl have been developed to initiate the ring-opening polymerization of 2,2-dimethyltrimethylene carbonate(DTC).The catalytic activity of rare earth aryl oxides,characteristics of the ring-opening polymerization as well as the polymerization kinetics and mechanism were intensively examined.The experimental results turn out that the catalytic activity of Ln(OAr)3 changes in good concordance with variation of ligands’ structure and number of alkyl groups on benzene ring.The greater the ability of electron-donation of alkyl groups,the greater the catalytic activity.Moreover,the greater the number of substituted alkyls on benzene ring,the greater the catalytic activity.The results show that rare earth tris(2,4,6-tri-tert-butylphenolate)s [Ln(OTTBP)3](Catalyst 1) exhibit rather great activity in all lanthanide aryl oxides.Investigations of the polymerization mechanism by 1H NMR spectroscopy revealed that the DTC monomer inserted into the growing chains with acyloxygen bond cleavage.

  3. Carbon nanotube inhibits the formation of β-sheet-rich oligomers of the Alzheimer's amyloid-β(16-22) peptide.

    Science.gov (United States)

    Li, Huiyu; Luo, Yin; Derreumaux, Philippe; Wei, Guanghong

    2011-11-01

    Alzheimer's disease is associated with the abnormal self-assembly of the amyloid-β (Aβ) peptide into toxic β-rich aggregates. Experimental studies have shown that hydrophobic nanoparticles retard Aβ fibrillation by slowing down the nucleation process; however, the effects of nanoparticles on Aβ oligomeric structures remain elusive. In this study, we investigate the conformations of Aβ(16-22) octamers in the absence and presence of a single-walled carbon nanotube (SWCNT) by performing extensive all-atom replica exchange molecular-dynamics simulations in explicit solvent. Our simulations starting from eight random chains demonstrate that the addition of SWCNT into Aβ(16-22) solution prevents β-sheet formation. Simulation starting from a prefibrillar β-sheet octamer shows that SWCNT destabilizes the β-sheet structure. A detailed analysis of the Aβ(16-22)/SWCNT/water interactions reveals that both the inhibition of β-sheet formation and the destabilization of prefibrillar β-sheets by SWCNT result from the same physical forces: hydrophobic and π-stacking interactions (with the latter playing a more important role). By analyzing the stacking patterns between the Phe aromatic rings and the SWCNT carbon rings, we find that short ring-centroid distances mostly favor parallel orientation, whereas large distances allow all other orientations to be populated. Overall, our computational study provides evidence that SWCNT is likely to inhibit Aβ(16-22) and full-length Aβ fibrillation.

  4. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Knorr Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Sections A20_2003 (22 September-20 October 2003) and A22_2003 (23 October-13 November, 2003)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2008-09-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb carbon-14 system parameters performed during the A20_2003 and A22_2003 cruises, which took place between September 22 and November 13, 2003, aboard research vessel (R/V) Knorr under the auspices of the National Oceanic and Atmospheric Administration (NOAA) and National Science Foundation (NSF). The R/V Knorr departed Woods Hole, Massachusetts, on September 22 for the Repeat Section A20, and ended this line in Port of Spain, Trinidad, on October 20. The Repeat Section A22 started on October 23 in Port of Spain, Trinidad, and finished on November 13, 2003, in Woods Hole, Massachusetts. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and NSF as part of the Climate Variability Program (CLIVAR)/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 88 stations on section A20 and 82 stations on section A22. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), total alkalinity (TALK), dissolved organic carbon (DOC), CFC, carbon-14, hydrographic, and other chemical measurements.

  5. Distributions of C22 C30 even-carbon-number n-alkanes in Ocean Anoxic Event 1 samples from the Basque-Cantabrian Basin

    Science.gov (United States)

    Chaler, R.; Dorronsoro, C.; Grimalt, J. O.; Agirrezabala, L. M.; Fernández-Mendiola, P. A.; García-Mondejar, J.; Gómez-Pérez, I.; López-Horgue, M.

    2005-05-01

    The Ocean Anoxic Event 1 (OAE-1) in central sites of the Basque-Cantabrian Basin exhibits very reducing depositional conditions of sedimentation. These sedimentation events have left a distinct mixture of hydrocarbons that are represented by C22 C30 n-alkanes with a predominance of the even-carbon-number homologues, high relative proportions of squalane and C16 C24 n-alkylcyclopentanes predominated by n-undecyl-, n-tridecyl- and n-pentadecylcyclopentane. Other minor compounds encompass a series of C18 C21 n-alkylcyclohexanes and C18 C24 dimethyl n-alkylcyclohexanes maximized by the even-carbon-number homologues as well as iso- and anteiso-alkanes. This unusual distribution of n-alkanes in this environment provides a new case for comparison with previously reported hypersaline and phosphorite sedimentary deposits where the occurrence of similar n-alkane distributions was reported. In the present case, these major n-alkanes and squalane are indicative of transformation under strong reducing conditions. In contrast, the occurrence of the alkylcyclopentanes, irrespective of the presence of even-carbon-number n-alkanes or squalane, suggests that reductive cyclization of fatty acids is less dependent on strong reducing conditions.

  6. Measurement of analyzing powers of π+ and π- produced on a hydrogen and a carbon target with a 22-GeV/c incident polarized proton beam

    International Nuclear Information System (INIS)

    The analyzing powers of π+ and π- were measured using an incident 22-GeV/c transversely polarized proton beam at the Brookhaven Alternating Gradient Synchrotron. A magnetic spectrometer measured π± inclusive asymmetries on a hydrogen and a carbon target. An elastic polarimeter with a CH2 target measured pp elastic-scattering asymmetries to determine the beam polarization using published data for the pp elastic analyzing power. Using the beam polarization determined from the elastic polarimeter and asymmetries from the inclusive spectrometer, analyzing powers AN for π± were determined in the xF and pT ranges (0.45-0.8) and (0.3-1.2 GeV/c), respectively. The analyzing power results are similar in both sign and character to other measurements at 200 and 11.7 GeV/c, confirming the expectation that high-energy pion inclusive analyzing powers remain large and relatively energy independent. This suggests that pion inclusive polarimetry may be a suitable method for measuring future beam polarizations at BNL RHIC or DESY HERA. Analyzing powers of π+ and π- produced on hydrogen and carbon targets are the same. Various models to explain inclusive analyzing powers are also discussed

  7. Electrochemical and quantum chemical studies of N,N'-bis(4-hydroxybenzaldehyde)-2,2-dimethylpropandiimine Schiff base as corrosion inhibitor for low carbon steel in HCl solution.

    Science.gov (United States)

    Jafari, Hojat; Danaee, Iman; Eskandari, Hadi; Rashvandavei, Mehdi

    2013-01-01

    A synthesized Schiff base N,N'-bis(4-hydroxybenzaldehyde)-2,2-dimethylpropandiimine (p-HBDP) was studied as green inhibitor for the corrosion of low carbon steel in 1 M HCl solution using electrochemical, surface and quantum chemical methods. Results showed that the inhibition occurs through the adsorption of the inhibitor molecules on the metal surface. The inhibition efficiency was found to increase with increasing inhibitor concentration and de-creased with increasing temper-ature, which is due to the fact that the rate of corrosion of steel is higher than the rate of adsorption. Thermodynamic parameters for adsorp-tion and activation processes were determined. Polarization data indicated that this compound act as mixed-type inhibitors and the adsorption isotherm basically obeys the Langmuir adsorption isotherm. The calculations of reactivity indices of p-HBDP such as softness and natural charge distributions together with local reactivity by means of Fukui indices were used to explain the electron transfer mechanism between the p-HBDP molecules and the steel surface.

  8. Electrochemical and quantum chemical studies of N,N'-bis(4-hydroxybenzaldehyde)-2,2-dimethylpropandiimine Schiff base as corrosion inhibitor for low carbon steel in HCl solution.

    Science.gov (United States)

    Jafari, Hojat; Danaee, Iman; Eskandari, Hadi; Rashvandavei, Mehdi

    2013-01-01

    A synthesized Schiff base N,N'-bis(4-hydroxybenzaldehyde)-2,2-dimethylpropandiimine (p-HBDP) was studied as green inhibitor for the corrosion of low carbon steel in 1 M HCl solution using electrochemical, surface and quantum chemical methods. Results showed that the inhibition occurs through the adsorption of the inhibitor molecules on the metal surface. The inhibition efficiency was found to increase with increasing inhibitor concentration and de-creased with increasing temper-ature, which is due to the fact that the rate of corrosion of steel is higher than the rate of adsorption. Thermodynamic parameters for adsorp-tion and activation processes were determined. Polarization data indicated that this compound act as mixed-type inhibitors and the adsorption isotherm basically obeys the Langmuir adsorption isotherm. The calculations of reactivity indices of p-HBDP such as softness and natural charge distributions together with local reactivity by means of Fukui indices were used to explain the electron transfer mechanism between the p-HBDP molecules and the steel surface. PMID:23947700

  9. RING-OPENING POLYMERIZAION OF 2,2-DIMETHYLTRIMETHYLENE CARBONATE INITIATED BY IN SITU GENERATED, TETRAHYDROSALEN STABLIZED YTTRIUM BOROHYDRIDE COMPLEX AND RANDOM COPOLYMERIZATION WITH ε-CAPROLACTONE

    Institute of Scientific and Technical Information of China (English)

    Jing Huang; Jian-fang Yu; Han-jian Yu; Wei-lin Sun; Zhi-quan Shen

    2011-01-01

    The poly(2,2-dimethyltrimethylene carbonate) (PDTC) with one hydroxyl and one formate tenninal fimctions was synthesized by in situ generated, tetrahydrosalen stabilized yttrium borohydride complex. The influences of monomer/initiator molar ratio, temperature and reaction time on polymerization of DTC were investigated. Under the condition: [DTC]/[I] = 500, 55℃, toluene: 0.5 mL, DTC: 0.6 g, PDTC with Mn = 15600 and PDI = 2.15 was obtained.Through 1H-NMR and 13C-NMR analyses, the structure of PDTC was characterized and a coordination-insertion mechanism was proposed. In addition, the random copolymerization of DTC and caprolactone (CL) initiated by rare-earth borohydride compound was studied. The microstructure of PDTC-co-PCL includes four diads: DTC-CL, CL-CL, DTC-DTC and CLDTC, which were determined by the specific signals in 1H-NMR spectra. Based on the typical signals of the formate (δ=8.08) and hydroxyl (δ = 3.34) end groups of PDTC-co-PCL, a mechanism involving DTC monomer inserts before CL during the initiation process was presumed. Furthermore, the thermal properties of amorphous copolymer were characterized by differential scanning calorimetry (DSC). The results support the random structure of PDTC-co-PCL.

  10. Effects of carbon nanomaterials fullerene C60 and fullerol C60(OH)18–22 on gills of fish Cyprinus carpio (Cyprinidae) exposed to ultraviolet radiation

    International Nuclear Information System (INIS)

    In consequence of their growing use and demand, the inevitable environmental presence of nanomaterials (NMs) has raised concerns about their potential deleterious effects to aquatic environments. The carbon NM fullerene (C60), which forms colloidal aggregates in water, and its water-soluble derivative fullerol (C60(OH)18–22), which possesses antioxidant properties, are known to be photo-excited by ultraviolet (UV) or visible light. To investigate their potential hazards to aquatic organisms upon exposure to UV sunlight, this study analyzed (a) the in vitro behavior of fullerene and fullerol against peroxyl radicals (ROO·) under UV-A radiation and (b) the effects of these photo-excited NMs on oxidative stress parameters in functional gills extracted from the fish Cyprinus carpio (Cyprinidae). The variables measured were the total antioxidant capacity, lipid peroxidation (TBARS), the activities of the antioxidant enzymes glutathione reductase (GR) and glutamate cysteine ligase (GCL), and the levels of the non-enzymatic antioxidant glutathione (GSH). The obtained results revealed the following: (1) both NMs behaved in vitro as antioxidants against ROO· in the dark and as pro-oxidants in presence of UV-A, the latter effect being reversed by the addition of sodium azide, which is a singlet oxygen (1O2) quencher; (2) fullerene induced toxicity with or without UV-A incidence, with a significant (p 1O2 generation; and (3) fullerol also decreased GCL activity and GSH formation (p 1O2 formation.

  11. Electron transfer study on graphene modified glassy carbon substrate via electrochemical reduction and the application for tris(2,2'-bipyridyl)ruthenium(II) electrochemiluminescence sensor fabrication.

    Science.gov (United States)

    Xu, Yuanhong; Cao, Mengmei; Liu, Huihui; Zong, Xidan; Kong, Na; Zhang, Jizhen; Liu, Jingquan

    2015-07-01

    In this study, electron transfer behavior of the graphene nanosheets attachment on glassy carbon electrode (GCE) via direct electrochemical reduction of graphene oxide (GO) is investigated for the first time. The graphene modified electrode was achieved by simply dipping the GCE in GO suspension, followed by cyclic voltammetric scanning in the potential window from 0V to -1.5V. Tris(2,2'-bipyridyl)ruthenium(II) [Ru(bpy)3(2+)] was immobilized on the graphene modified electrode and used as the redox probe to evaluate the electron transfer behavior. The electron transfer rate constant (Ks) was calculated to be 61.9±5.8s(-1), which is much faster than that of tiled graphene modified GCE (7.1±0.6s(-1)). The enhanced electron transfer property observed with the GCE modified by reductively deposited graphene is probably due to its standing configuration, which is beneficial to the electron transfer comparing with the tiled one. Because the abundant oxygen-containing groups are mainly located at the edges of GO, which should be much easier for the reduction to start from, the reduced GO should tend to stand on the electrode surface as evidenced by scanning electron microscopy analysis. In addition, due to the favored electron transfer and standing configuration, the Ru(bpy)3(2+) electrochemiluminescence sensor fabricated with standing graphene modified GCE provided much higher and more stable efficiency than that fabricated with tiled graphene.

  12. SYNTHESIS OF 2,2'-DICHLOROHYDRAZOBENZENE FROM ORTHO-NITROCHLOROBENZENE OVER MESOPOROUS CARBON SUPPORTED PLATINUM%介孔碳负载铂催化2,2'-二氯氢化偶氮苯的清洁合成

    Institute of Scientific and Technical Information of China (English)

    李波; 李明时; 鲁墨弘

    2012-01-01

    2,2'-Dichlorohydrazobenzene (DHB) is an important commercial intermediate for the synthesis of 3,3'-dichlorobenzidine (DCB). Selective hydrogenation of o-nitrochlorobenzene to DHB over 3% Pt/MC catalyst in alkaline solution was investigated. Some parameters were studied such as additives, reaction temperature, reaction pressure, sodium hydroxide and so on. The results show that the yield of DHB as high as 95. 7% was obtained at 85 ℃ and 0. 5 Mpa.%2,2'-二氯氢化偶氮苯(DHB)是合成3,3'-二氯联苯胺(DCB)的中间体.以邻硝基氯苯为原料,在碱性环境下以3% Pt/介孔碳(MC)为催化剂,通过加氢偶联的方法合成DHB.实验考察了助剂、温度、压力、NaOH溶液等因素对反应的影响,并根据实验结果确定了较佳的工艺条件.在优化的工艺条件下(反应温度为65℃,压力为0.5 MPa),DHB的收率可达95.7%.

  13. Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C10H22O5 2,5,8,11,14-Pentaoxapentadecane (VMSD1112, LB4865_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C10H22O5 2,5,8,11,14-Pentaoxapentadecane (VMSD1112, LB4865_V)' providing data by calculation of mass density in the single-phase region(s) from low-pressure dilatometric measurements of the molar excess volume at variable mole fraction and constant temperature.

  14. Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C10H22O5 2,5,8,11,14-Pentaoxapentadecane (VMSD1211, LB4862_V)

    Science.gov (United States)

    Cibulka, I.; Fontaine, J.-C.; Sosnkowska-Kehiaian, K.; Kehiaian, H. V.

    This document is part of Subvolume C 'Binary Liquid Systems of Nonelectrolytes III' of Volume 26 'Heats of Mixing, Vapor-Liquid Equilibrium, and Volumetric Properties of Mixtures and Solutions' of Landolt-Börnstein Group IV 'Physical Chemistry'. It contains the Chapter 'Volumetric Properties of the Mixture Dimethyl carbonate C3H6O3 + C10H22O5 2,5,8,11,14-Pentaoxapentadecane (VMSD1211, LB4862_V)' providing data from direct low-pressure dilatometric measurement of molar excess volume at variable mole fraction and constant temperature.

  15. Measurement of analyzing power for proton-carbon elastic scattering in the coulomb-nuclear interference region with a 22-GeV/c polarized proton beam.

    Science.gov (United States)

    Tojo, J; Alekseev, I; Bai, M; Bassalleck, B; Bunce, G; Deshpande, A; Doskow, J; Eilerts, S; Fields, D E; Goto, Y; Huang, H; Hughes, V; Imai, K; Ishihara, M; Kanavets, V; Kurita, K; Kwiatkowski, K; Lewis, B; Lozowski, W; Makdisi, Y; Meyer, H-O; Morozov, B V; Nakamura, M; Przewoski, B; Rinckel, T; Roser, T; Rusek, A; Saito, N; Smith, B; Svirida, D; Syphers, M; Taketani, A; Thomas, T L; Underwood, D; Wolfe, D; Yamamoto, K; Zhu, L

    2002-07-29

    The analyzing power for proton-carbon elastic scattering in the Coulomb-nuclear interference region of momentum transfer, 9.0x10(-3)<-t<4.1x10(-2) (GeV/c)(2), was measured with a 21.7 GeV/c polarized proton beam at the Alternating Gradient Synchrotron of Brookhaven National Laboratory. The ratio of hadronic spin-flip to nonflip amplitude, r(5), was obtained from the analyzing power to be Rer(5)=0.088+/-0.058 and Imr(5)=-0.161+/-0.226. PMID:12144435

  16. Measurement of analyzing power for proton-carbon elastic scattering in the Coulomb-nuclear interference region with a 22-GeV/c polarized proton beam

    International Nuclear Information System (INIS)

    The analyzing power for proton-carbon elastic scattering in the Coulomb-nuclear interference region of momentum transfer, 9.0x10-3-2 (GeV/c)2, was measured with a 21.7 GeV/c polarized proton beam at the Alternating Gradient Synchrotron of Brookhaven National Laboratory. The ratio of hadronic spin-flip to nonflip amplitude, r5, was obtained from the analyzing power to be Rer5=0.088±0.058 and Imr5=-0.161±0.226

  17. Electrogenerated chemiluminescence sensor for the determination of metoclopramide using ordered mesoporous carbon for immobilizing tris(2,2 -bipyridyl)ruthenium

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A novel electrogenerated chemiluminescence(ECL)sensor for the determination of metoclopramide was developed by employing ruthenium complex as an ECL signal producer and an ordered mesoporous carbon(OMC)material as modified material.The ECL sensor was fabricated by adsorption ruthenium complex into a mixture of OMC and Nafion,which showed good electrochemical and ECL behaviors.It was found that the ECL intensity of the sensor fabricated was greatly enhanced in the presence of metoclopramide.Based on this fin...

  18. Structure-reactivity relationships in aluminium alkoxides-catalysed co-polymerisation reactions : aluminium 2,2' methylenebisphenoxide in the synthesis of poly(ether-carbonate)s from cyclohexene oxide and carbon dioxide

    OpenAIRE

    Sypien, Jakub Konrad

    2006-01-01

    Das Design und die Synthese von "Single-Site"-Katalysatoren für die Copolymerisierung von Kohlendioxids und Cyclohexenoxid (CHO), Untersuchungen zu ihrer Struktur-Reaktivitätsbeziehung sowie die Optimierung der Reaktionsparameter waren Hauptaugenmerk dieser Arbeit. Die Liganden für das Katalysator-Design beruhen auf 2,2'-Bisphenol-Derivaten, entweder Methylen- (1-6 basierte Systeme) oder Sulfid-verbrückt (7 basierte Systeme). Die meisten der verwendeten Liganden wurden bereits in der Literatu...

  19. A hydrogen-evolving Ni(P2N2)2 electrocatalyst covalently attached to a glassy carbon electrode: preparation, characterization, and catalysis. comparisons with the homogeneous analogue.

    Science.gov (United States)

    Das, Atanu K; Engelhard, Mark H; Bullock, R Morris; Roberts, John A S

    2014-07-01

    A hydrogen-evolving homogeneous Ni(P2N2)2 electrocatalyst with peripheral ester groups has been covalently attached to a 1,2,3-triazolyllithium-terminated planar glassy carbon electrode surface. Coupling proceeds with both the Ni(0) and the Ni(II) complexes. X-ray photoemission spectra show excellent agreement between the Ni(0) coupling product and its parent complex, and voltammetry of the surface-confined system shows that a single species predominates with a surface density of 1.3 × 10(-10) mol cm(-2), approaching the value estimated for a densely packed monolayer. With the Ni(II) system, both photoemission and voltammetric data show speciation to unidentified products on coupling, and the surface density is 6.7 × 10(-11) mol cm(-2). The surface-confined Ni(0) complex is an electroctalyst for hydrogen evolution, showing the onset of catalytic current at the same potential as the soluble parent complex. Decomposition of the surface-confined species is observed in acidic acetonitrile. This is interpreted to reflect the lability of the Ni(II)-phosphine interaction and the basicity of the free phosphine and bears on concurrent efforts to implement surface-confined Ni(P2N2)2 complexes in electrochemical or photoelectrochemical devices.

  20. Simultaneous determination of hydrazine and phenyl hydrazine using 4′-(4-carboxyphenyl)-2,2′:6′,2″ terpyridine diacetonitrile triphenylphosphine ruthenium(II) tetrafluoroborate complex functionalized multiwalled carbon nanotubes modified electrode

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, Ida, E-mail: idatiwari_2001@rediffmail.com [Department of Chemistry (Center of Advanced Study), Faculty of Science, Banaras Hindu University, Varanasi (India); Gupta, Mandakini; Sinha, Preeti [Department of Chemistry (Center of Advanced Study), Faculty of Science, Banaras Hindu University, Varanasi (India); Banks, Craig E. [Faculty of Science and Engineering, School of Science and the Environment, Division of Chemistry and Environmental Science, Manchester Metropolitan University, Chester Street, Manchester M1 5GD (United Kingdom)

    2014-12-15

    Highlights: • A nanocomposite of ruthenium(II) terpyridine, triphenylphosphine based complex and multiwalled carbon nanotubes have been used first time for simultaneous detection of hydrazine and phenyl hydrazine. • The detection limit reported is lower as compared to other reported works. • The paper also focuses towards effect of ligand variation attached to ruthenium(II) terpyridine based complexes complex for the hydrazine and phenyl hydrazine detection. • Nanocomposite does not involve any biological entity hence high stability. - Abstract: A nanocomposite based on the incorporation of the complex 4′-(4-carboxyphenyl)-2,2′:6′,2″ terpyridine triphenylphosphine diacetonitrile ruthenium(II) tetrafluoroborate with multiwalled carbon nanotubes and ionomer supported upon a glassy carbon electrode substrate is reported and characterized with scanning electron microscopy, transmission electron microscopy and infrared spectroscopy. The electrochemical behavior and stability of the composite electrode was investigated via cyclic voltammetry. The modified electrode exhibits an electro-catalytic activity towards the oxidation of both hydrazine and phenyl hydrazine in 0.1 M phosphate buffer solution (PBS, pH 7.4). The oxidation of hydrazine and phenyl hydrazine occurs at 0.81 V and 0.32 V with limit of detection found to be 3.7 × 10{sup −7} M and 1.15 × 10{sup −7} M and having a linear range from 5 × 10{sup −6} M to 6.5 × 10{sup −3} M, and 5 × 10{sup −6} M to 0.2 × 10{sup −3} M, respectively.

  1. 22 CFR 1422.22 - Inconclusive elections.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Inconclusive elections. 1422.22 Section 1422.22... PROCEEDINGS § 1422.22 Inconclusive elections. (a) An inconclusive election is one in which none of the choices... results of the election, the Regional Director may declare the election a nullity and may order...

  2. 22 CFR 228.22 - Air transportation.

    Science.gov (United States)

    2010-04-01

    ... criteria for determining when U.S. flag air carriers are unavailable. See 48 CFR 47.403-1, or USAID... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Air transportation. 228.22 Section 228.22... for USAID Financing § 228.22 Air transportation. (a) The eligibility of air transportation...

  3. Effects of carbon nanomaterials fullerene C{sub 60} and fullerol C{sub 60}(OH){sub 18-22} on gills of fish Cyprinus carpio (Cyprinidae) exposed to ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Socoowski Britto, Roberta; Longaray Garcia, Marcia; Martins da Rocha, Alessandra [Universidade Federal do Rio Grande - FURG, Instituto de Ciencias Biologicas, Campus Carreiros, Av. Italia km 8 s/n, Rio Grande, RS (Brazil); Programa de Pos Graduacao em Fisiologia Animal Comparada - Fisiologia Animal Comparada, FURG (Brazil); Artigas Flores, Juliana [Universidade Federal do Rio Grande - FURG, Instituto de Ciencias Biologicas, Campus Carreiros, Av. Italia km 8 s/n, Rio Grande, RS (Brazil); Pinheiro, Mauricio V. Brant [Departamento de Fisica, ICEx, Universidade Federal de Minas Gerais, MG (Brazil); Monserrat, Jose Maria [Universidade Federal do Rio Grande - FURG, Instituto de Ciencias Biologicas, Campus Carreiros, Av. Italia km 8 s/n, Rio Grande, RS (Brazil); Programa de Pos Graduacao em Fisiologia Animal Comparada - Fisiologia Animal Comparada, FURG (Brazil); Ribas Ferreira, Josencler L., E-mail: josenclerf@gmail.com [Universidade Federal do Rio Grande - FURG, Instituto de Ciencias Biologicas, Campus Carreiros, Av. Italia km 8 s/n, Rio Grande, RS (Brazil); Programa de Pos Graduacao em Fisiologia Animal Comparada - Fisiologia Animal Comparada, FURG (Brazil)

    2012-06-15

    In consequence of their growing use and demand, the inevitable environmental presence of nanomaterials (NMs) has raised concerns about their potential deleterious effects to aquatic environments. The carbon NM fullerene (C{sub 60}), which forms colloidal aggregates in water, and its water-soluble derivative fullerol (C{sub 60}(OH){sub 18-22}), which possesses antioxidant properties, are known to be photo-excited by ultraviolet (UV) or visible light. To investigate their potential hazards to aquatic organisms upon exposure to UV sunlight, this study analyzed (a) the in vitro behavior of fullerene and fullerol against peroxyl radicals (ROO{center_dot}) under UV-A radiation and (b) the effects of these photo-excited NMs on oxidative stress parameters in functional gills extracted from the fish Cyprinus carpio (Cyprinidae). The variables measured were the total antioxidant capacity, lipid peroxidation (TBARS), the activities of the antioxidant enzymes glutathione reductase (GR) and glutamate cysteine ligase (GCL), and the levels of the non-enzymatic antioxidant glutathione (GSH). The obtained results revealed the following: (1) both NMs behaved in vitro as antioxidants against ROO{center_dot} in the dark and as pro-oxidants in presence of UV-A, the latter effect being reversed by the addition of sodium azide, which is a singlet oxygen ({sup 1}O{sub 2}) quencher; (2) fullerene induced toxicity with or without UV-A incidence, with a significant (p < 0.05) increase in lipid peroxidation (with greater damage under illumination), a decrease in GCL activity, and the depletion of GSH stocks (under illumination), all of which were attributed to {sup 1}O{sub 2} generation; and (3) fullerol also decreased GCL activity and GSH formation (p < 0.05) but without lipid damage. The overall results show that fullerene can be toxic with or without light incidence, whereas UV radiation seems to play a key role in the environmental toxicity of carbon NMs through {sup 1}O{sub 2} formation.

  4. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Meteor Cruise 22/5 in the South Atlantic Ocean (WOCE Section A10, December 1992-January 1993)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, A.

    1998-12-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) and total alkalinity (TALK) at hydrographic stations, as well as the underway partial pressure of CO{sub 2} (pCO{sub 2}) during the R/V Meteor Cruise 22/5 in the South Atlantic Ocean (Section A10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Rio de Janeiro on December 27, 1992, and ended after 36 days at sea in Capetown, South Africa, on January 31, 1993. Measurements made along WOCE Section A10 included pressure, temperature, and salinity [measured by conductivity, temperature, and depth (CTD) sensor], bottle salinity, bottle oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-1 1 , CFC-12), TCO{sub 2}, TALK, and underway pCO{sub 2}. The TCO{sub 2} was measured by using two Single-Operator Multiparameter Metabolic Analyzers (SOMMAs) for extracting CO{sub 2} from seawater samples that were coupled to a coulometer for detection of the extracted CO{sub 2}. The overall precision and accuracy of the analyses was {+-} 1.9 {micro}mol/kg. Samples collected for TALK were measured by potentiometric titration; precision was {+-}2.0 {micro}mol/kg. Underway pCO{sub 2} was measured by infrared photometry with a precision of {+-} 2.0 {micro}atm. The work aboard the R/V Meteor was supported by the U.S. Department of Energy under contract DE-AC02-76CHOO016, and the Bundesministerium fir Forschung und Technologies through grants 03F0545A and MPG 099/1.

  5. Main: MYCATRD22 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MYCATRD22 S000174 29-Sep-1999 (last modified) kehi Binding site for MYC (rd22BP1) i...n Arabidopsis (A.t.) dehydration-resposive gene, rd22; MYC binding site in rd22 gene of Arabidopsis thaliana; ABA-induction; Loca...ted at ca. -200 of rd22 gene; Also MYB at ca. -141 of rd22 gene; See also S000175 (MYBA...TRD22); Dehydration; Water stress; ABA; MYC; myc; leaf; shoot; Arabidopsis thaliana CACATG ...

  6. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORINGS in the North Atlantic Ocean from 2005-10-22 to 2007-10-01 (NODC Accession 0100065)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100065 includes chemical, physical and time series data collected from MOORINGS in the North Atlantic Ocean from 2005-10-22 to 2007-10-01. These...

  7. The Carbon Emission Game

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    When Chinese President Hu Jintao attended the UN climate summit on September22,he made a solemn commitment that China will cut its per GDP unit carbon emission to a significant amount in 2020 compared with that of 2005.

  8. 22q11-deletionssyndrom

    DEFF Research Database (Denmark)

    Olesen, Charlotte; Agergaard, Peter; Boers, Maria;

    2010-01-01

    22q11 deletion syndrome (formerly named CATCH22, DiGeorge, Velo-Cardio-Facial, Caylor, Kinouchi and Shprintzen syndrome) occurs in approximately 1/2000 to 4000 children. The genetic lesion is remarkably uniform, occurring mainly as 3 or 1.5 MB deletions in the 22q11.2 region. However, the clinical...

  9. Removal mechanism of 2,2′,4,4′-Tetrabromodiphenylether by carbon nanotubes supported bimetallic composites in water%碳纳米管负载双金属复合材料对水中2,2′,4,4′-四溴联苯醚的去除机制

    Institute of Scientific and Technical Information of China (English)

    刘总堂; 谷成刚; 叶茂; 程吟文; 生弘杰; 卞永荣; 蒋新

    2015-01-01

    Nickel lanthanum/carbon nanotubes (Ni-La/CNTs) and nickel cobalt/carbon nanotubes (Ni-Co/CNTs) composites were prepared by impregnation method. The structure and composition of the Ni-La/CNTs and Ni-Co/CNTs were characterized by TEM and XRD. The removal mechanism of 2,2′,4,4′-tetrabromodiphenylether (BDE-47) by Ni-La/CNTs and Ni-Co/CNTs in water solution were also investigated. The results of TEM images indicated that the Ni-La or Ni-Co bimetallic nanoparticles were loaded onto the composites surfaces successfully with an average diameter in the range of (20~30) nm. The XRD results illustrated that the bimetallic nanoparticles were mainly Ni-La or Ni-Co oxides without demonstrable zero valent nickel, lanthanum and cobalt. Ni-La/CNTs and Ni-Co/CNTs had good removal performance for BDE-47 in water solution. When the initial concentration of BDE-47 increased to 1.0 mg·L-1, the removal rates decreased and the adsorption capacities increased. The possible reason was that the active sites of Ni-La/CNTs and Ni-Co/CNTs were limited and the sorption processes needed more time to reach equilibrium at higher initial BDE-47 concentration. The removal processes of BDE-47 onto Ni-La/CNTs and Ni-Co/CNTs could be fitted by the pseudo-second order kinetic model perfectly, the adsorption rate order waskCNTs > kNi-La/CNTs> kNi-Co/CNTs. Predominant adsorption and weak degradation were coexisted in the removal process of BDE-47 by Ni-La/CNTs and Ni-Co/CNTs while there was only adsorption onto CNTs. In addition, the Ni-La/CNTs and Ni-Co/CNTs composites had good regeneration performance and the removal rates were still more than 80 % after four regeneration cycles.%采用浸渍法制备了碳纳米管负载镍镧(Ni-La)/镍钴(Ni-Co)双金属复合材料Ni-La/CNTs和Ni-Co/CNTs,采用投射电子显微镜(TEM)和X射线粉末衍射仪(XRD)对样品的结构特征和组成进行了表征。并通过吸附实验探讨了Ni-La/CNTs和Ni-Co/CNTs对水中2,2′,4,4

  10. 22 CFR 518.22 - Payment.

    Science.gov (United States)

    2010-04-01

    ... OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management § 518.22 Payment. (a) Payment methods shall minimize the time elapsing between... and disbursement by the recipient, and (ii) Financial management systems that meet the standards...

  11. Carbon dioxide effects research and assessment program. Proceedings of the International Meeting on Stable Isotopes in Tree-Ring Research, New Paltz, New York, May 22-25, 1979

    Energy Technology Data Exchange (ETDEWEB)

    Jacoby, G [ed.

    1980-12-01

    Information about the past and present concentrations of CO/sub 2/ in the atmosphere and variations in climate can be obtained from measurements of stable isotopes in tree rings; specifically carbon-13, oxygen-18 and deuterium. The analysis of these stable isotopes in tree rings is a relatively new and rapidly developing field. This proceedings volume contains most of the papers presented at the meeting. The first paper gives an overview of the status of carbon-13 research. Papers relating to carbon-13 are in section I and grouped separately from the contributions on carbon-14. Although the meeting was primarily concerned with stable isotopes, all carbon isotopic analysis may be helpful in understanding the carbon-13 record in tree rings. The papers on hydrogen and oxygen isotope studies are in sections II and III respectively. The remaining sections contain papers that consider more than one isotope at a time, general topics related to isotopes, atmospheric changes and tree growth, and methods of isotopic analysis.

  12. Reference: ABREATRD22 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABREATRD22 Iwasaki T, Yamaguchi-Shinozaki K,Shinozaki K Identification of a cis-regulatory re...gion of a gene in Arabidopsis thaliana whose induction by dehydration is mediated by abscisic acid and require

  13. 28 CFR 22.22 - Revelation of identifiable data.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Revelation of identifiable data. 22.22 Section 22.22 Judicial Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND... subject, be expected to totally conceal subject identity....

  14. 22 CFR 40.22 - Multiple criminal convictions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Multiple criminal convictions. 40.22 Section 40.22 Foreign Relations DEPARTMENT OF STATE VISAS REGULATIONS PERTAINING TO BOTH NONIMMIGRANTS AND IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Criminal and Related Grounds-Conviction of Certain Crimes § 40.22 Multiple...

  15. Marginalia no. 22

    OpenAIRE

    Library, Merrill-Cazier

    2007-01-01

    Issue Number 22: Spring 2007 A MESSAGE FROM THE Director- Linda Wolcott on our mission and strategic planning. SECURING OUR FUTURE- Information on USU’s new campaign, “Honoring Tradition, Securing the Future” INSPIRED BY THE MASTERS: PRESERVATION LIBRARIAN ALSO A FINE ARTIST-The talented Mr. Noel A. Carmack LATINO VOICES PROJECT-Patrick Williams describes the latest oral history project by Special Collections & Archives MERRILL-CAZIER LIBRARY STRATEGIC PLAN-The mission; the vis...

  16. VLT/UVES observations of extremely strong intervening damped Lyman-alpha systems: Molecular hydrogen and excited carbon, oxygen and silicon at log N(HI)=22.4

    CERN Document Server

    Noterdaeme, P; Rahmani, H; Petitjean, P; Pâris, I; Ledoux, C; Gupta, N; López, S

    2015-01-01

    We present a detailed analysis of three extremely strong intervening DLAs (log N(HI)>=21.7) observed towards quasars with VLT/UVES. We measure overall metallicities of [Zn/H]~-1.2, -1.3 and -0.7 at respectively zabs=2.34 towards SDSS J2140-0321 (log N(HI) = 22.4+/-0.1), zabs=3.35 towards SDSS J1456+1609 (log N(HI) = 21.7+/-0.1) and zabs=2.25 towards SDSS J0154+1935 (log N(HI) = 21.75+/-0.15). We detect H2 towards J2140-0321 (log N(H2) = 20.13+/-0.07) and J1456+1609 (log N(H2) = 17.10+/-0.09) and argue for a tentative detection towards J0154+1935. Absorption from the excited fine-structure levels of OI, CI and SiII are detected in the system towards J2140-0321, that has the largest HI column density detected so far in an intervening DLA. This is the first detection of OI fine-structure lines in a QSO-DLA, that also provides us a rare possibility to study the chemical abundances of less abundant atoms like Co and Ge. Simple single phase photo-ionisation models fail to reproduce all the observed quantities. Inst...

  17. Carbon Carbon Composites: An Overview .

    OpenAIRE

    G. Rohini Devi; K. Rama Rao

    1993-01-01

    Carbon carbon composites are a new class of engineering materials that are ceramic in nature but exhibit brittle to pseudoplastic behaviour. Carbon-carbon is a unique all-carbon composite with carbon fibre embeded in carbon matrix and is known as an inverse composite. Due to their excellent thermo-structural properties, carbon-carbon composites are used in specialised application like re-entry nose-tips, leading edges, rocket nozzles, and aircraft brake discs apart from several indust...

  18. DNA hybridization biosensor using chitosan-carbon nanotubes composite film as an immobilization platform and [Cu(bpy)(MBZ){sub 2}(H{sub 2}O)] (bpy = 2,2'-bipyridine, MBZ = p-methylbenzoate) as a novel redox indicator

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qingxiang, E-mail: axiang236@126.co [Department of Chemistry and Environment Science, Zhangzhou Normal University, Zhangzhou 363000 (China) and Fujian Province University Key Laboratory of Analytical Science, Zhangzhou Normal University, Zhangzhou 363000 (China); Shi Juanlan; Ni Jiancong; Gao Fei; Gao Feng [Department of Chemistry and Environment Science, Zhangzhou Normal University, Zhangzhou 363000 (China); Weng Wen [Department of Chemistry and Environment Science, Zhangzhou Normal University, Zhangzhou 363000 (China); Fujian Province University Key Laboratory of Analytical Science, Zhangzhou Normal University, Zhangzhou 363000 (China); Jiao Kui, E-mail: kjiao@qust.edu.c [College of Chemistry and Molecular Engineering, Qingdao University and Science and Technology, Qingdao 266042 (China)

    2011-04-15

    Research highlights: Chitosan-carbon nanotubes composite was used as a platform for DNA immobilization. Discrimination of a synthetic copper complex to ds- and ss-DNA was obtained. Hybridization detection was performed using the copper complex as an indicator. Good specificity and high sensitivity were achieved on the constructed DNA biosensor. - Abstract: In this paper, a new DNA hybridization detection strategy was developed based on the immobilization of capture probe DNA on a chitosan (CS)-carbon nanotubes (CNTs) composite modified glassy carbon electrode (CS-CNTs/GCE) and the use of a copper complex, [Cu(bpy)(MBZ){sub 2}(H{sub 2}O)] (bpy = 2,2'-bipyridine, MBZ = p-methylbenzoate), as a new redox hybridization indicator. The electrochemical characterization experiments showed that the nanocomposite film of CS-CNTs could effectively immobilize the capture probe DNA and greatly improve the electron-transfer reactions of the electroactive molecules. Electrochemical and fluorescent spectroscopic analysis revealed that the polypyridyl copper complex of [Cu(bpy)(MBZ){sub 2}(H{sub 2}O)] bound to DNA via a typical intercalation mode. Surface studies further showed that the copper complex can discriminate between double-stranded and single-stranded DNA that immobilized on the surface of CS-CNTs/GCE. When being utilized as a redox indicator for the detection of hybridization for short DNA species related to phosphinothricin acetyltransferase (PAT), the indicator showed good specificity for recognizing the complementary, three-base mismatched and non-complementary DNA. Under the optimized conditions, the oxidation peak currents of the copper complex enhanced linearly with increases in the concentration of the complementary sequence in the range from 5.0 x 10{sup -10} to 1.0 x 10{sup -8} M. A detection limit of 5.0 x 10{sup -10} M was also obtained based on the constructed DNA biosensor.

  19. Carbon Carbon Composites: An Overview .

    Directory of Open Access Journals (Sweden)

    G. Rohini Devi

    1993-10-01

    Full Text Available Carbon carbon composites are a new class of engineering materials that are ceramic in nature but exhibit brittle to pseudoplastic behaviour. Carbon-carbon is a unique all-carbon composite with carbon fibre embeded in carbon matrix and is known as an inverse composite. Due to their excellent thermo-structural properties, carbon-carbon composites are used in specialised application like re-entry nose-tips, leading edges, rocket nozzles, and aircraft brake discs apart from several industrial and biomedical applications. The multidirectional carbon-carbon product technology is versatile and offers design flexibility. This paper describes the multidirectional preform and carbon-carbon process technology and research and development activities within the country. Carbon-carbon product experience at DRDL has also been discussed. Development of carbon-carbon brake discs process technology using the liquid impregnation process is described. Further the test results on material characterisation, thermal, mechanical and tribological properties are presented.

  20. 22 CFR 22.3 - Remittances in the United States.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Remittances in the United States. 22.3 Section...-DEPARTMENT OF STATE AND FOREIGN SERVICE § 22.3 Remittances in the United States. (a) Type of remittance. Remittances shall be in the form of: (1) Check or bank draft drawn on a bank in the United States; (2)...

  1. 22 CFR 42.22 - Returning resident aliens.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Returning resident aliens. 42.22 Section 42.22... Returning resident aliens. (a) Requirements for returning resident status. An alien shall be classifiable as... presented that: (1) The alien had the status of an alien lawfully admitted for permanent residence at...

  2. 22 CFR 212.22 - Protection of personal privacy.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Protection of personal privacy. 212.22 Section... Information for Public Inspection and Copying § 212.22 Protection of personal privacy. To the extent required to prevent a clearly unwarranted invasion of personal privacy, USAID may delete identifying...

  3. Dissolved inorganic carbon, total alkalinity, pH, fugacity of carbon dioxide, and other variables from surface observations using Niskin bottle, flow through pump and other instruments from NOAA Ship Ronald H. Brown in the Gulf of Mexico and East Coast of the United States during the second Gulf of Mexico and East Coast Carbon (GOMECC-2) Cruise from 2012-07-22 to 2012-08-13 (NODC Accession 0117971)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains ocean acidification related data from the the second Gulf of Mexico and East Coast Carbon (GOMECC-2) Cruise on board NOAA Ship Ronald...

  4. Carbon isotope anomalies in carbonates of the Karelian series

    Science.gov (United States)

    Iudovich, Ia. E.; Makarikhin, V. V.; Medvedev, P. V.; Sukhanov, N. V.

    1990-07-01

    Results are presented on carbon isotope distributions in carbonates of the Karelian complex. A highly anomalous isotopic composition was found in carbonate rocks aged from 2.6 to 1.9 b.y. In the stromatolitic carbonates of the Onega water table, delta-(C-13) reaches a value of +18 percent, while the shungite layer of the Zaonega horizon is characterized by a wide dispersion (from +7.9 to -11.8 percent). These data are in good agreement with the known geochemical boundary (about 2.2 b.y. ago) in the history of the earth.

  5. Adsorption over polyacrylonitrile based carbon monoliths

    Science.gov (United States)

    Nandi, Mahasweta; Dutta, Arghya; Patra, Astam Kumar; Bhaumik, Asim; Uyama, Hiroshi

    2013-02-01

    Highly porous activated carbon monoliths have been prepared from mesoporous polyacrylonitrile (PAN) monolith as the carbon precursor. The mesoporous PAN monoliths are fabricated by a unique and facile template-free method which on carbonization gives N-doped activated carbon monoliths. The carbonization is achieved via two step thermal process which includes pretreatment in air leading to cyclization and subsequent aromatization of the PAN moieties followed by carbonization in a mixture of argon and carbon dioxide to give a layered carbon framework. Nitrogen sorption experiments carried over these carbon monoliths revealed high surface area (ca. 2500 m2g-1) for these materials with precise micropore size distribution. The activated carbons show extraordinarily high CO2 capture capacity and the uptake up to 3 bar has been found to be as high as 22.5 and 10.6 mmol/g at 273 K and 298 K, respectively.

  6. 22 CFR 22.1 - Schedule of fees.

    Science.gov (United States)

    2010-04-01

    ... site (22 CFR 51.56(b)) (not applicable abroad) 60 4. Exemptions: The following applicants are exempted... require a passport in connection with their duties aboard an American flag vessel (22 U.S.C. 214) No fee... significant time and/or expenses incurred) No fee. (b) Overseeing the appraisal, sale, and final...

  7. Accelerated carbonation of brucite in mine tailings for carbon sequestration.

    Science.gov (United States)

    Harrison, Anna L; Power, Ian M; Dipple, Gregory M

    2013-01-01

    Atmospheric CO(2) is sequestered within ultramafic mine tailings via carbonation of Mg-bearing minerals. The rate of carbon sequestration at some mine sites appears to be limited by the rate of CO(2) supply. If carbonation of bulk tailings were accelerated, large mines may have the capacity to sequester millions of tonnes of CO(2) annually, offsetting mine emissions. The effect of supplying elevated partial pressures of CO(2) (pCO(2)) at 1 atm total pressure, on the carbonation rate of brucite [Mg(OH)(2)], a tailings mineral, was investigated experimentally with conditions emulating those at Mount Keith Nickel Mine (MKM), Western Australia. Brucite was carbonated to form nesquehonite [MgCO(3) · 3H(2)O] at a rate that increased linearly with pCO(2). Geochemical modeling indicated that HCO(3)(-) promoted dissolution accelerated brucite carbonation. Isotopic and aqueous chemistry data indicated that equilibrium between CO(2) in the gas and aqueous phases was not attained during carbonation, yet nesquehonite precipitation occurred at equilibrium. This implies CO(2) uptake into solution remains rate-limiting for brucite carbonation at elevated pCO(2), providing potential for further acceleration. Accelerated brucite carbonation at MKM offers the potential to offset annual mine emissions by ~22-57%. Recognition of mechanisms for brucite carbonation will guide ongoing work to accelerate Mg-silicate carbonation in tailings. PMID:22770473

  8. The mass of $^{22}$Mg

    CERN Document Server

    Mukherjee, M; Beck, D; Blaum, K; Bollen, G; Carrel, F; Delahaye, P; Dilling, J; George, S; Guenaut, C; Herfurth, F; Herlert, Alexander; Kluge, H J; Köster, U; Lunney, M D; Schwarz, S; Schweikhard, L; Yazidjian, C

    2004-01-01

    Mass measurements with a relative precision of better than $1.5 \\times 10^{-8}$ were performed on $^{22}$Mg and its reaction partners $^{21}$Na and $^{22}$Na with the ISOLTRAP Penning trap mass spectrometer at CERN, yielding the mass excesses $D(^{22}$Mg) = -399.92(27) keV, $D(^{21}$Na) = -2184.71(21) keV, and $D(^{22}$Na) = -5181.56(16) keV. The importance of these results is twofold. First, a comparative half-life ($Ft$ value)has been obtained for the superallowed $\\beta$-decay of $^{22}$Mg to further test the conserved-vector-current hypothesis. Second, the resonance energy for the $^{21}$Na proton capture reaction has been independently determined, allowing direct comparisons of observable $\\gamma$-radiation in nova explosions with the yield expected from models.

  9. 40 CFR 52.22 - Enforceable commitments for further actions addressing the pollutant greenhouse gases (GHGs).

    Science.gov (United States)

    2010-07-01

    ... actions addressing the pollutant greenhouse gases (GHGs). 52.22 Section 52.22 Protection of Environment... greenhouse gases (GHGs). (a) Definitions. (1) Greenhouse Gases (GHGs) means the air pollutant as defined in § 86.1818-12(a) of this chapter as the aggregate group of six greenhouse gases: Carbon dioxide,...

  10. Heat transfer coeffcient for boiling carbon dioxide

    DEFF Research Database (Denmark)

    Knudsen, Hans Jørgen Høgaard; Jensen, Per Henrik

    1997-01-01

    Heat transfer coefficient and pressure drop for boiling carbon dioxide (R744) flowing in a horizontal pipe has been measured. The pipe is heated by condensing R22 outside the pipe. The heat input is supplied by an electrical heater wich evaporates the R22. With the heat flux assumed constant over...

  11. 22 CFR 62.22 - Trainees and interns.

    Science.gov (United States)

    2010-04-01

    ...) Education, Social Sciences, Library Science, Counseling and Social Services; (vi) Health Related Occupations; (vii) Hospitality and Tourism; (viii) Information Media and Communications; (iv) Management, Business... eligibility requirements set forth in Subpart A of 22 CFR Part 62 and satisfying the Department that they...

  12. High capacity carbon dioxide sorbent

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, Steven Dean; Alptekin, Gokhan; Jayaraman, Ambalavanan

    2015-09-01

    The present invention provides a sorbent for the removal of carbon dioxide from gas streams, comprising: a CO.sub.2 capacity of at least 9 weight percent when measured at 22.degree. C. and 1 atmosphere; an H.sub.2O capacity of at most 15 weight percent when measured at 25.degree. C. and 1 atmosphere; and an isosteric heat of adsorption of from 5 to 8.5 kilocalories per mole of CO.sub.2. The invention also provides a carbon sorbent in a powder, a granular or a pellet form for the removal of carbon dioxide from gas streams, comprising: a carbon content of at least 90 weight percent; a nitrogen content of at least 1 weight percent; an oxygen content of at most 3 weight percent; a BET surface area from 50 to 2600 m.sup.2/g; and a DFT micropore volume from 0.04 to 0.8 cc/g.

  13. 32 CFR 2700.22 - Classification guides.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Classification guides. 2700.22 Section 2700.22... SECURITY INFORMATION REGULATIONS Derivative Classification § 2700.22 Classification guides. OMSN shall issue classification guides pursuant to section 2-2 of E.O. 12065. These guides, which shall be used...

  14. 27 CFR 22.45 - Organizational documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Organizational documents. 22.45 Section 22.45 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Permit, Form 5150.22 § 22.45 Organizational documents. The supporting information required by §...

  15. Zirconium sulfate interaction with sodium carbonate in solution

    International Nuclear Information System (INIS)

    Zirconium sulfate interaction with sodium carbonate is studied in aqueous solution. By pH-metry and infrared spectroscopy it is stated that depending on the carbonate concentration Zr(OH)2x(CO3)22-, ZrOH(CO3)33- and Zr(CO3)44- compounds can be formed in sulfatocarbonate solutions. pH range in which soluble carbonate complexes exist also depends on the concentration of sodium carbonate. Calculated is the fourth stability constant

  16. Porous carbons

    Indian Academy of Sciences (India)

    Satish M Manocha

    2003-02-01

    Carbon in dense as well as porous solid form is used in a variety of applications. Activated porous carbons are made through pyrolysis and activation of carbonaceous natural as well as synthetic precursors. Pyrolysed woods replicate the structure of original wood but as such possess very low surface areas and poor adsorption capacities. On activation, these exhibit increased adsorption volumes of 0.5–0.8 cm3 /gm and surface areas of 700–1800 m2 /gm depending on activation conditions, whether physical or chemical. Former carbons possess mixed pore size distribution while chemically activated carbons predominantly possess micropores. Thus, these carbons can be used for adsorption of wide distributions of molecules from gas to liquid. The molecular adsorption within the pores is due to single layer or multilayer molecule deposition at the pore walls and hence results in different types of adsorption isotherm. On the other hand, activated carbon fibres with controlled microporous structure and surface area in the range of 2500 m2 /gm can be developed by controlled pyrolysis and physical activation of amorphous carbon fibres. Active carbon fibres with unmatchable pore structure and surface characteristics are present and futuristic porous materials for a number of applications from pollution control to energy storage.

  17. Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from the AURORA AUSTRALIS in the Indian Ocean from 2008-03-22 to 2008-04-17 (NODC Accession 0109900)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0109900 includes biological, chemical, discrete sample, physical and profile data collected from AURORA AUSTRALIS in the Indian Ocean from 2008-03-22...

  18. Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, Coulometer for DIC measurement and other instruments from the Hokusei Maru in the North Pacific Ocean from 1998-06-22 to 1998-07-06 (NODC Accession 0112238)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0112238 includes chemical, discrete sample, physical and profile data collected from Hokusei Maru in the North Pacific Ocean from 1998-06-22 to...

  19. Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using CTD, Coulometer for DIC measurement and other instruments from the SHUMPU MARU in the Philippine Sea from 1998-04-22 to 1998-04-30 (NODC Accession 0112302)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0112302 includes biological, chemical, discrete sample, physical and profile data collected from SHUMPU MARU in the Philippine Sea from 1998-04-22 to...

  20. Dissolved inorganic carbon, pH, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from ROGER REVELLE in the Bay of Bengal and Indian Ocean from 2007-03-22 to 2007-05-01 (NODC Accession 0110791)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0110791 includes discrete sample and profile data collected from ROGER REVELLE in the Bay of Bengal and Indian Ocean from 2007-03-22 to 2007-05-01....

  1. Interaction cross section study of the two-neutron halo nucleus 22C

    Science.gov (United States)

    Togano, Y.; Nakamura, T.; Kondo, Y.; Tostevin, J. A.; Saito, A. T.; Gibelin, J.; Orr, N. A.; Achouri, N. L.; Aumann, T.; Baba, H.; Delaunay, F.; Doornenbal, P.; Fukuda, N.; Hwang, J. W.; Inabe, N.; Isobe, T.; Kameda, D.; Kanno, D.; Kim, S.; Kobayashi, N.; Kobayashi, T.; Kubo, T.; Leblond, S.; Lee, J.; Marqués, F. M.; Minakata, R.; Motobayashi, T.; Murai, D.; Murakami, T.; Muto, K.; Nakashima, T.; Nakatsuka, N.; Navin, A.; Nishi, S.; Ogoshi, S.; Otsu, H.; Sato, H.; Satou, Y.; Shimizu, Y.; Suzuki, H.; Takahashi, K.; Takeda, H.; Takeuchi, S.; Tanaka, R.; Tuff, A. G.; Vandebrouck, M.; Yoneda, K.

    2016-10-01

    The interaction cross sections (σI) of the very neutron-rich carbon isotopes 19C, 20C and 22C have been measured on a carbon target at 307, 280, and 235 MeV/nucleon, respectively. A σI of 1.280 ± 0.023 b was obtained for 22C, significantly larger than for 19,20C, supporting the halo character of 22C. A 22C root-mean-squared matter radius of 3.44 ± 0.08 fm was deduced using a four-body Glauber reaction model. This value is smaller than an earlier estimate (of 5.4 ± 0.9 fm) derived from a σI measurement on a hydrogen target at 40 MeV/nucleon. These new, higher-precision σI data provide stronger constraints for assessing the consistency of theories describing weakly bound nuclei.

  2. Developmental expression of otoconin-22 in the bullfrog endolymphatic sac and inner ear.

    Science.gov (United States)

    Yaoi, Yuichi; Onda, Tomoaki; Hidaka, Yoshie; Yajima, Shinya; Suzuki, Masakazu; Tanaka, Shigeyasu

    2004-05-01

    In amphibians, calcium carbonate crystals are present in the endolymphatic sac and the inner ear. The formation of these crystals is considered to be facilitated by a protein called otoconin-22. We examined the spatial and temporal expression of otoconin-22 during the development of the bullfrog (Rana catesbeiana) using RT-PCR, in situ hybridization (ISH), and immunofluorescence techniques. By RT-PCR, otoconin-22 mRNA was first detected in embryos at Shumway stage 20, and this expression pattern continues in late stages. The first otoconin-22 mRNA-positive reaction was detected in stage 22 embryos in the placode of the endolymphatic sac. Otoconin-22 protein was observed in the epithelial cells of the endolymphatic sac at stage 24. On the other hand, a whole-mount ISH technique showed the first expression of otoconin-22 mRNA in the inner ear, in addition to the endolymphatic sac, at the mid-phase of Shumway stage 25. We discuss the role of otoconin-22 in the formation of calcium carbonate crystals in the endolymphatic sac and inner ear. PMID:15100243

  3. Politisk danning etter 22. juli

    Directory of Open Access Journals (Sweden)

    Lars Løvlie

    2011-01-01

    Full Text Available Political education after july 22. This article makes the case fordeliberation as a major end-in-view for a political education in the general sense. The immediate backdrop is the neofascist ideology of Anders Behring Breivik and his ilk, an ideology that may partly explain the motive behind the devastation of government buildings in Oslo and the following mass shooting at Utøya on July 22. My intention here will, however, be limited to the question: what is basic to the idea of deliberation? My answer is twofold: deliberation is a reasonable method for arriving at a possible and temporary agreement on questions of truth and morality; and it is based on some – usually tacit – mutual presuppositions. These two aspects together make deliberation educative and part of an education for deliberative democracy. Without deliberation as a method we are unable to get at what John Dewey used to call “warranted assertibility”. Without deliberation as embedded in joint assumptions we would be unable to distinguish between method as wayward gibberish and as reasonable conversation. On pain of being presumptuous I invite the reader to this short educative stroll!

  4. Calcium Carbonate

    Science.gov (United States)

    ... before being swallowed; do not swallow them whole. Drink a full glass of water after taking either the regular or chewable tablets or capsules. Some liquid forms of calcium carbonate must be shaken well before use.Do not ...

  5. Carbon Stars

    Indian Academy of Sciences (India)

    T. Lloyd Evans

    2010-12-01

    In this paper, the present state of knowledge of the carbon stars is discussed. Particular attention is given to issues of classification, evolution, variability, populations in our own and other galaxies, and circumstellar material.

  6. Performance assessment of carbonation process integrated with coal fired power plant to reduce CO2 (carbon dioxide) emissions

    International Nuclear Information System (INIS)

    This paper presents a novel approach to recover energy from mineral carbonation process, one of the CCS (carbon capture and storage) technologies, to reduce its additional energy demand and reports the feasibility of integrating a carbonation process with an existing power plant for reducing CO2 (carbon dioxide) emission. A thermodynamic mass and energy flow model of the carbonation process is developed using Matlab/Simulink software for a range of carbonation temperatures using two naturally available feedstocks, namely serpentine and olivine. The CO2 emissions are reduced if a carbonation system is implemented in the power plant, though the power generation efficiency and net power output are reduced too due to the large amount of extra energy required for the grinding of feedstock and the compression of CO2. The existing power plant efficiency was found to be 36.1%. If a carbonation system is incorporated, the plant efficiency reduces to 22% and 24% using serpentine and olivine feedstocks respectively. However, a significant amount of heat energy can be recovered from exothermic reaction of carbonation and carbonated products. The power plant efficiency can be increased to 35% and 34% again, respectively, when energy from carbonation reaction and carbonated products can be recovered appropriately. - Highlights: • Mineral carbonation technology is one of the carbon capture and storage technologies. • Exothermic heat energy can be recovered from mineral carbonation process. • Mineral carbonation process is energy self-sufficient. • Thermodynamic mass and energy balance model is developed for mineral carbonation

  7. 13 CFR 307.22 - Variances.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Variances. 307.22 Section 307.22 Business Credit and Assistance ECONOMIC DEVELOPMENT ADMINISTRATION, DEPARTMENT OF COMMERCE ECONOMIC... Federal, State and local law....

  8. 47 CFR 22.99 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... channel bandwidth or the bandwidths of two or more contiguous channels. Auxiliary test transmitter. A.... See §§ 22.911(c) and 22.912. Facsimile service. Transmission of still images from one place to...

  9. 22nd International Meshing Roundtable

    CERN Document Server

    Staten, Matthew

    2014-01-01

    This volume contains the articles presented at the 22nd International Meshing Roundtable (IMR) organized, in part, by Sandia National Laboratories and was held on Oct 13-16, 2013 in Orlando, Florida, USA.  The first IMR was held in 1992, and the conference series has been held annually since.  Each year the IMR brings together researchers, developers, and application experts in a variety of disciplines, from all over the world, to present and discuss ideas on mesh generation and related topics.  The technical papers in this volume present theoretical and novel ideas and algorithms with practical potential, as well as technical applications in science and engineering, geometric modeling, computer graphics and visualization.

  10. 16 CFR 460.22 - Tax claims.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Tax claims. 460.22 Section 460.22 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES LABELING AND ADVERTISING OF HOME INSULATION § 460.22 Tax claims. Do not say or imply that your product qualifies for a tax benefit unless it is true....

  11. 12 CFR 1282.22 - Housing plans.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Housing plans. 1282.22 Section 1282.22 Banks and Banking FEDERAL HOUSING FINANCE AGENCY HOUSING GOALS AND MISSION ENTERPRISE HOUSING GOALS AND MISSION Housing Goals § 1282.22 Housing plans. (a) If the Director determines, under § 1282.21, that...

  12. 24 CFR 81.22 - Housing plans.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Housing plans. 81.22 Section 81.22 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development THE... LOAN MORTGAGE CORPORATION (FREDDIE MAC) Housing Goals § 81.22 Housing plans. (a) If the...

  13. 28 CFR 26.22 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Requirements. 26.22 Section 26.22 Judicial Administration DEPARTMENT OF JUSTICE DEATH SENTENCES PROCEDURES Certification Process for State Capital Counsel Systems § 26.22 Requirements. A state meets the requirements for certification under 28...

  14. 7 CFR 632.22 - Contracts.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Contracts. 632.22 Section 632.22 Agriculture... AGRICULTURE LONG TERM CONTRACTING RURAL ABANDONED MINE PROGRAM Participation § 632.22 Contracts. (a) Cost-sharing contracts. A land user who has an approved reclamation plan may enter into a contract with NRCS...

  15. 44 CFR 62.22 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Judicial review. 62.22 Section 62.22 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ADJUSTMENT OF CLAIMS Claims Adjustment, Claims Appeals, and Judicial Review § 62.22 Judicial review. (a)...

  16. 31 CFR 3.22 - Legal review.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Legal review. 3.22 Section 3.22 Money and Finance: Treasury Office of the Secretary of the Treasury CLAIMS REGULATIONS AND INDEMNIFICATION OF DEPARTMENT OF TREASURY EMPLOYEES Claims Under the Small Claims Act § 3.22 Legal review....

  17. 7 CFR 22.201 - Coordination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Coordination. 22.201 Section 22.201 Agriculture Office of the Secretary of Agriculture RURAL DEVELOPMENT COORDINATION Roles and Responsibilities of Federal Government § 22.201 Coordination. The following identifies types and levels of coordination: (a)...

  18. 49 CFR 218.22 - Utility employee.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Utility employee. 218.22 Section 218.22..., DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Blue Signal Protection of Workers § 218.22 Utility employee. (a) A utility employee shall be subject to the Hours of Service Act, and the requirements...

  19. 40 CFR 230.22 - Water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water. 230.22 Section 230.22... Chemical Characteristics of the Aquatic Ecosystem § 230.22 Water. (a) Water is the part of the aquatic... the liquid phase and is contained by the substrate. Water forms part of a dynamic aquatic...

  20. 28 CFR 802.22 - Fees.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Fees. 802.22 Section 802.22 Judicial... Privacy Act § 802.22 Fees. The Agency shall charge fees under the Privacy Act for duplication of records only. These fees shall be at the same rate the Agency charges for duplication fees under the Freedom...

  1. 32 CFR 518.22 - Reports control.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Reports control. 518.22 Section 518.22 National... RELATIONS THE FREEDOM OF INFORMATION ACT PROGRAM Reports § 518.22 Reports control. (a) General. (1) The... requirement outlined is assigned Report Control Symbol DD-DA&M(A)1365, FOIA Report to Congress. (b)...

  2. 32 CFR 22.320 - Special competitions.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Special competitions. 22.320 Section 22.320... REGULATIONS DoD GRANTS AND AGREEMENTS-AWARD AND ADMINISTRATION Competition § 22.320 Special competitions. Some... competed specifically among institutions of higher education. All such special competitions shall...

  3. 30 CFR 725.22 - Financial management.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Financial management. 725.22 Section 725.22... PROGRAM REGULATIONS REIMBURSEMENTS TO STATES § 725.22 Financial management. (a) The agency shall account for grant funds in accordance with the requirements of Office of Management and Budget Circular...

  4. 7 CFR 1218.22 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1218.22 Section 1218.22 Agriculture... INFORMATION ORDER Blueberry Promotion, Research, and Information Order Definitions § 1218.22 United States. United States means collectively the 50 states, the District of Columbia, the Commonwealth of Puerto...

  5. 22 CFR 40.41 - Public charge.

    Science.gov (United States)

    2010-04-01

    ... Consular Services (22 CFR 22.1). (c) Joint Sponsors. Submission of one or more additional affidavits of... subscribed to before a notary public by the employer or an authorized employee or agent of the employer. The... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public charge. 40.41 Section 40.41...

  6. 7 CFR 1221.22 - Production.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Production. 1221.22 Section 1221.22 Agriculture... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Definitions § 1221.22 Production. Production, as used in § 1221.100, means: (a) for the purpose of establishing the initial Board in...

  7. 7 CFR 983.22 - Pistachios.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Pistachios. 983.22 Section 983.22 Agriculture... and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE PISTACHIOS GROWN IN CALIFORNIA, ARIZONA, AND NEW MEXICO Definitions § 983.22 Pistachios. Pistachios means the nuts of the pistachio...

  8. 49 CFR 22.69 - Claim process.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Claim process. 22.69 Section 22.69 Transportation Office of the Secretary of Transportation SHORT-TERM LENDING PROGRAM (STLP) Loan Administration § 22.69 Claim process. After reasonable efforts have been exhausted to collect on a delinquent debt,...

  9. 30 CFR 282.22 - Delineation Plan.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Delineation Plan. 282.22 Section 282.22 Mineral... § 282.22 Delineation Plan. All exploration activities shall be conducted in accordance with a Delineation Plan submitted by the lessee and approved by the Director. The Delineation Plan shall describe...

  10. 49 CFR 230.22 - Accident reports.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Accident reports. 230.22 Section 230.22... Requirements § 230.22 Accident reports. In the case of an accident due to failure, from any cause, of a steam... persons, the railroad on whose line the accident occurred shall immediately make a telephone report of...

  11. 50 CFR 22.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... as determined by the continuing absence of any adult, egg, or dependent young at the nest for at... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Definitions. 22.3 Section 22.3 Wildlife... (CONTINUED) EAGLE PERMITS Introduction § 22.3 Definitions. In addition to the definitions contained in...

  12. 7 CFR 1205.22 - State.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1205.22 Section 1205.22 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Procedures for Conduct of Sign-up Period Definitions § 1205.22 State. The term State means each of the...

  13. 48 CFR 22.1302 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Policy. 22.1302 Section 22... APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Equal Opportunity for Veterans 22.1302 Policy. (a... a fiscal year to enter into a contract for the procurement of personal property and...

  14. 25 CFR 141.22 - Subleasing prohibited.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Subleasing prohibited. 141.22 Section 141.22 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.22 Subleasing prohibited. No...

  15. 25 CFR 286.22 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Reports. 286.22 Section 286.22 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ECONOMIC ENTERPRISES INDIAN BUSINESS DEVELOPMENT PROGRAM § 286.22... of the Indian Business Development Program at all times....

  16. 47 CFR 22.357 - Emission types.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Emission types. 22.357 Section 22.357... Operational and Technical Requirements Technical Requirements § 22.357 Emission types. Any authorized station in the Public Mobile Services may transmit emissions of any type(s) that comply with the...

  17. 47 CFR 22.1015 - Repeater operation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Repeater operation. 22.1015 Section 22.1015... Offshore Radiotelephone Service § 22.1015 Repeater operation. Offshore central stations may be used as repeater stations provided that the licensee is able to maintain control of the station, and in...

  18. 45 CFR 602.22 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... CFR part 31. Contract Cost Principles and Procedures, or uniform cost accounting standards that comply... 45 Public Welfare 3 2010-10-01 2010-10-01 false Allowable costs. 602.22 Section 602.22 Public... Requirements § 602.22 Allowable costs. (a) Limitation on use of funds. Grant funds may be used only for:...

  19. 45 CFR 1174.22 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... than a hospital and an organization named in OBM Circular A-122 as not subject to that circular 48 CFR... 45 Public Welfare 3 2010-10-01 2010-10-01 false Allowable costs. 1174.22 Section 1174.22 Public....22 Allowable costs. (a) Limitation on use of funds. Grant funds may be used only for: (1)...

  20. 45 CFR 1183.22 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... than a hospital and an organization named in OBM Circular A-122 as not subject to that circular 48 CFR... 45 Public Welfare 3 2010-10-01 2010-10-01 false Allowable costs. 1183.22 Section 1183.22 Public....22 Allowable costs. (a) Limitation on use of funds. Grant funds may be used only for: (1)...

  1. 12 CFR 228.22 - Lending test.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Lending test. 228.22 Section 228.22 Banks and... REINVESTMENT (REGULATION BB) Standards for Assessing Performance § 228.22 Lending test. (a) Scope of test. (1) The lending test evaluates a bank's record of helping to meet the credit needs of its assessment...

  2. 32 CFR 22.415 - Standards.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Standards. 22.415 Section 22.415 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT REGULATIONS DoD... Procedures § 22.415 Standards. To be qualified, a potential recipient must: (a) Have the...

  3. 28 CFR 104.22 - Advance Benefits.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Advance Benefits. 104.22 Section 104.22... Filing for Compensation; Application for Advance Benefits § 104.22 Advance Benefits. (a) Advance Benefits. Eligible Claimants may apply for immediate “Advance Benefits” in a fixed amount as follows: (1) $50,000...

  4. 49 CFR 22.19 - Credit criteria.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Credit criteria. 22.19 Section 22.19... STLP Loans § 22.19 Credit criteria. An applicant for a STLP loan must be creditworthy and demonstrate... debts. The Participating Lender and DOT OSDBU shall consider: (a) Character, reputation, and...

  5. 29 CFR 22.34 - Evidence.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Evidence. 22.34 Section 22.34 Labor Office of the Secretary of Labor PROGRAM FRAUD CIVIL REMEDIES ACT OF 1986 § 22.34 Evidence. (a) The ALJ shall determine the... unfair prejudice, confusion of the issues, or by considerations of undue delay or needless...

  6. 49 CFR 1.22 - Structure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Structure. 1.22 Section 1.22 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.22 Structure. (a) Secretary and Deputy Secretary. The Secretary and Deputy Secretary...

  7. 28 CFR 551.22 - Pregnancy.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Pregnancy. 551.22 Section 551.22 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT MISCELLANEOUS Birth Control, Pregnancy, Child Placement, and Abortion § 551.22 Pregnancy. (a) The Warden shall ensure that each...

  8. 43 CFR 22.6 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Policy. 22.6 Section 22.6 Public Lands... Interior Employees § 22.6 Policy. (a) The Department of the Interior may indemnify a Department employee..., judgment, or other monetary award which is rendered against such employee, provided that the conduct...

  9. 40 CFR 61.22 - Standard.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard. 61.22 Section 61.22... EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standards for Radon Emissions From Underground Uranium Mines § 61.22 Standard. Emissions of radon-222 to the ambient air from an...

  10. 50 CFR 697.22 - Exempted fishing.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Exempted fishing. 697.22 Section 697.22... § 697.22 Exempted fishing. The Regional Administrator or Director may exempt any person or vessel from the requirements of this part for the conduct of exempted fishing beneficial to the management of...

  11. 22 CFR 226.91 - Marking.

    Science.gov (United States)

    2010-04-01

    ... forth at 22 CFR 226.61 and 226.62. (j) USAID Principal Officers, defined for purposes of this provision... waiver after the date of completion as defined in 22 CFR 226.2 but before closeout as defined in 22 CFR... Government. (2) The recipient shall provide the Cognizant Technical Officer (CTO) or other USAID...

  12. 30 CFR 281.22 - Lease form.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease form. 281.22 Section 281.22 Mineral... OIL, GAS, AND SULPHUR IN THE OUTER CONTINENTAL SHELF Leasing Procedures § 281.22 Lease form. The OCS mineral leases shall be issued on the lease form prescribed by the Secretary in the leasing notice....

  13. 28 CFR 51.22 - Premature submissions.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Premature submissions. 51.22 Section 51.22 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROCEDURES FOR THE ADMINISTRATION OF... § 51.22 Premature submissions. The Attorney General will not consider on the merits: (a) Any...

  14. 7 CFR 923.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... committee, together with nominations for the initial alternate members for each position, may be submitted... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 923.22 Section 923.22 Agriculture... COUNTIES IN WASHINGTON Order Regulating Handling Administrative Body § 923.22 Nomination. (a)...

  15. 7 CFR 920.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... Administrative Body § 920.22 Nomination. (a) Except as provided in paragraph (b) of this section, the committee... recommended by the committee and approved by the Secretary. (c) Only growers may participate in the nomination... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 920.22 Section 920.22...

  16. 7 CFR 925.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... event nominations for initial members and alternate members of the committee are not filed pursuant to... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 925.22 Section 925.22 Agriculture... SOUTHEASTERN CALIFORNIA Administrative Body § 925.22 Nomination. (a) Initial members. Nominations for each...

  17. 7 CFR 922.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... IN WASHINGTON Order Regulating Handling Administrative Body § 922.22 Nomination. (a) Initial members. Nominations for each of the eight initial grower members and four initial handler members of the committee... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 922.22 Section 922.22...

  18. 4 CFR 2.2 - References.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false References. 2.2 Section 2.2 Accounts GOVERNMENT ACCOUNTABILITY OFFICE PERSONNEL SYSTEM PURPOSE AND GENERAL PROVISION § 2.2 References. (a) Subchapters III and IV of Chapter 7 of Title 31 U.S.C. (b) Title 5, United States Code....

  19. 10 CFR 75.22 - Accounting records.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Accounting records. 75.22 Section 75.22 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) SAFEGUARDS ON NUCLEAR MATERIAL-IMPLEMENTATION OF US/IAEA AGREEMENT Material Accounting and Control for Facilities § 75.22 Accounting records. (a) The accounting records required by §...

  20. 50 CFR 401.22 - Civil rights.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Civil rights. 401.22 Section 401.22..., DEVELOPMENT AND ENHANCEMENT § 401.22 Civil rights. Each application for Federal assistance, grant-in-aid award... Assisted Programs of the Civil Rights Act of 1964 and with the Secretary's regulations...

  1. 30 CFR 735.22 - Audit.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Audit. 735.22 Section 735.22 Mineral Resources... ENFORCEMENT § 735.22 Audit. The agency shall arrange for an independent audit no less frequently than once..., Attachment P. The audits will be performed in accordance with the “Standards for Audit of...

  2. Preparation and characterization of carbon nanotube-hybridized carbon fiber to reinforce epoxy composite

    International Nuclear Information System (INIS)

    Highlights: → CNTs were uniformly grown onto the carbon fibers. → No obvious mechanical properties of carbon fiber were observed after CNT growth. → The IFSS of multiscale epoxy composite was measured by single fiber pull-out tests. → Observing fractography of composite, the fracture modes of CNTs were discussed. -- Abstract: The multiscale carbon nanotube-hybridized carbon fiber was prepared by a newly developed aerosol-assisted chemical vapour deposition. Scanning electron microscopy and transmission electron microscope were carried out to characterize this multiscale material. Compared with the original carbon fibers, the fabrication of this hybrid fiber resulted in an almost threefold increase of BET surface area to reach 2.22 m2/g. Meanwhile, there was a slight degradation of fiber tensile strength within 10%, while the fiber modulus was not significantly affected. The interfacial shearing strength of a carbon fiber-reinforced polymer composite with carbon nanotube-hybridized carbon fiber and an epoxy matrix was determined from the single fiber pull-out tests of microdroplet composite. Due to an efficient increase of load transfer at the fiber/matrix interfaces, the interracial shear strength of composite reinforced by carbon nanotube-hybridized carbon fiber is almost 94% higher than that of one reinforced by the original carbon fiber. Based on the fractured morphologies of the composites, the interfacial reinforcing mechanisms were discussed through proposing different types of carbon nanotube fracture modes along with fiber pulling out from epoxy composites.

  3. Stable carbon isotope biogeochemistry of lakes along a trophic gradient

    NARCIS (Netherlands)

    de Kluijver, A.; Schoon, P.L.; Downing, J.A.; Schouten, S.; Middelburg, J.J.

    2014-01-01

    The stable carbon (C) isotope variability of dissolved inorganic and organic C (DIC and DOC), particulate organic carbon (POC), glucose and polar-lipid derived fatty acids (PLFAs) was studied in a survey of 22 North American oligotrophic to eutrophic lakes. The d13C of different PLFAs were used as p

  4. 77 FR 67337 - Certain Activated Carbon From the People's Republic of China; 2010-2011; Final Results of...

    Science.gov (United States)

    2012-11-09

    ... of Antidumping Duty Order: Certain Activated Carbon from the People's Republic of China, 72 FR 20988... Administrative Review, 75 FR 70208, 70210 (November 17, 2010). \\22\\ In Activated Carbon AR3, the Department found..., 76 FR 67142, 67145 n.25 (October 31, 2011) (``Activated Carbon AR3''). \\23\\ In Activated Carbon......

  5. Molecular cloning of otoconin-22 complementary deoxyribonucleic acid in the bullfrog endolymphatic sac: effect of calcitonin on otoconin-22 messenger ribonucleic acid levels.

    Science.gov (United States)

    Yaoi, Yuichi; Suzuki, Masakazu; Tomura, Hideaki; Sasayama, Yuichi; Kikuyama, Sakae; Tanaka, Shigeyasu

    2003-08-01

    Anuran amphibians have a special organ called the endolymphatic sac (ELS), containing many calcium carbonate crystals, which is believed to have a calcium storage function. The major protein of aragonitic otoconia, otoconin-22, which is considered to be involved in the formation of calcium carbonate crystals, has been purified from the saccule of the Xenopus inner ear. In this study, we cloned a cDNA encoding otoconin-22 from the cDNA library constructed for the paravertebral lime sac (PVLS) of the bullfrog, Rana catesbeiana, and sequenced it. The bullfrog otoconin-22 encoded a protein consisting of 147 amino acids, including a signal peptide of 20 amino acids. The protein had cysteine residues identical in a number and position to those conserved among the secretory phospholipase A(2) family. The mRNA of bullfrog otoconin-22 was expressed in the ELS, including the PVLS and inner ear. This study also revealed the presence of calcitonin receptor-like protein in the ELS, with the putative seven-transmembrane domains of the G protein-coupled receptors. The ultimobranchialectomy induced a prominent decrease in the otoconin-22 mRNA levels of the bullfrog PVLS. Supplementation of the ultimobranchialectomized bullfrogs with synthetic salmon calcitonin elicited a significant increase in the mRNA levels of the sac. These findings suggest that calcitonin secreted from the ultimobranchial gland, regulates expression of bullfrog otoconin-22 mRNA via calcitonin receptor-like protein on the ELS, thereby stimulating the formation of calcium carbonate crystals in the lumen of the ELS. PMID:12865304

  6. Volume-based thermodynamics: estimations for 2:2 salts.

    Science.gov (United States)

    Jenkins, H Donald Brooke; Glasser, Leslie

    2006-02-20

    The lattice energy of an ionic crystal, U(POT), can be expressed as a linear function of the inverse cube root of its formula unit volume (i.e., Vm(-1/3)); thus, U(POT) approximately 2I(alpha/Vm(1/3) + beta), where alpha and beta are fitted constants and I is the readily calculated ionic strength factor of the lattice. The standard entropy, S, is a linear function of Vm itself: S approximately kVm + c, with fitted constants k and c. The constants alpha and beta have previously been evaluated for salts with charge ratios of 1:1, 1:2, and 2:1 and for the general case q:p, while values of k and c applicable to ionic solids generally have earlier been reported. In this paper, we obtain alpha and beta, k and c, specifically for 2:2 salts (by studying the ionic oxides, sulfates, and carbonates), finding that U(POT)[MX 2:2]/(kJ mol(-1)) approximately 8(119/Vm(1/3) + 60) and S degree [MX 2:2]/(J K(-1) mol(-1)) approximately 1382V(m) + 16. PMID:16471990

  7. Controllable fabrication of carbon aerogels

    Institute of Scientific and Technical Information of China (English)

    FENG Ya'ning; MIAO Lei; TANEMURA Sakae; TANEMURA Masaki; SUZUKI Kenzi

    2006-01-01

    Nano-pore carbon aerogels were prepared by the sol-gel polymerization of resorcinol (1,3-dihydroxybenzene)(C6H4(OH)2) with formaldehyde (HCHO) in a slightly basic aqueous solution, followed by super-critical drying under liquid carbon dioxide as super-critical media and carbonization at 700 ℃ under N2 gas atmosphere. The key of the work is to fabricate carbon aerogels with controllable nano-pore structure, which means extremely high surface area and sharp pore size distribution. Aiming to investigate the effects of preparation conditions on the gelation process, the bulk density, and the physical and chemical structure of the resultant carbon aerogels, the molar ratio of R/C (resorcinol to catalyst) and the amount of distilled water were varied, consequently two different sets of samples, with series of R/C ratio and RF/W (Resorcinol-Formaldehyde to water, or the content of reactant) ratio, were prepared. The result of N2 adsorption/desorption experiment at 77 K shows that the pore sizes decreasing from 11.4 down tO2.2 nm with the increasing of the molar ratio of R/C from 100 to 400, and/or, the pore sizes decreasing from 3.8 down to 1.6 nm with the increasing of reactant content from 0.4 to 0.6.

  8. Fabrication of Implanted $^{22}$Na Targets

    CERN Multimedia

    2002-01-01

    A knowledge of the $^{22}$Na(p,$\\gamma$)$^{23}$ Mg reaction rate is of significant astrophysical interest. In order to complete previous studies of this reaction, radioactive $^{22}$Na targets of high purity are required. We ask for support to fabricate these targets via the implantation technique at ISOLDE GPS (off—line mode) using $^{22}$Na nuclides in an Al matrix produced in Nov. 1990 at the PSI (Zürich). The $^{22}$Na nuclides are released and ionized in a surface ionisation source, mass-analyzed at ISOLDE GPS, and implanted in a Ni-Ta backing and a C—foil in a special implantation setup.

  9. Determination the Hydrogen Stored in Carbon Nanotubes by NO Titration Method

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A novel method was established to determine the H2-storage capacity in carbon nanotubes. According to 2NO+2H2 (or 4H) = N2+2H2O reaction, the H2-storage capacity in carbon nanotubes could be calculated. The H2-storage capacity in carbon nanotubes is at least 2.89 wt%.

  10. Structure of a dinuclear cadmium complex with 2,2'-bi-pyridine, monodentate nitrate and 3-carb-oxy-6-methyl-pyridine-2-carboxyl-ate ligands: intra-molecular carbon-yl(lone pair)⋯π(ring) and nitrate(π)⋯π(ring) inter-actions.

    Science.gov (United States)

    Granifo, Juan; Suarez, Sebastián; Baggio, Ricardo

    2015-08-01

    The centrosymmetric dinuclear complex bis-(μ-3-carb-oxy-6-methyl-pyridine-2-carboxyl-ato)-κ(3) N,O (2):O (2);κ(3) O (2):N,O (2)-bis-[(2,2'-bi-pyridine-κ(2) N,N')(nitrato-κO)cadmium] methanol monosolvate, [Cd2(C8H6NO4)2(NO3)2(C10H8N2)2]·CH3OH, was isolated as colourless crystals from the reaction of Cd(NO3)2·4H2O, 6-methyl-pyridine-2,3-di-carb-oxy-lic acid (mepydcH2) and 2,2'-bi-pyridine in methanol. The asymmetric unit consists of a Cd(II) cation bound to a μ-κ(3) N,O (2):O (2)-mepydcH(-) anion, an N,N'-bidentate 2,2'-bi-pyridine group and an O-mono-dentate nitrate anion, and is completed with a methanol solvent mol-ecule at half-occupancy. The Cd complex unit is linked to its centrosymmetric image through a bridging mepydcH(-) carboxyl-ate O atom to complete the dinuclear complex mol-ecule. Despite a significant variation in the coordination angles, indicating a considerable departure from octa-hedral coordination geometry about the Cd(II) atom, the Cd-O and Cd-N distances in this complex are surprisingly similar. The crystal structure consists of O-H⋯O hydrogen-bonded chains parallel to a, further bound by C-H⋯O contacts along b to form planar two-dimensional arrays parallel to (001). The juxtaposed planes form inter-stitial columnar voids that are filled by the methanol solvent mol-ecules. These in turn inter-act with the complex mol-ecules to further stabilize the structure. A search in the literature showed that complexes with the mepydcH(-) ligand are rare and complexes reported previously with this ligand do not adopt the μ-κ(3) coordination mode found in the title compound. PMID:26396748

  11. Biodegradation of Chlorpyrifos by Pseudomonas Resinovarans Strain AST2.2 Isolated from Enriched Cultures.

    Directory of Open Access Journals (Sweden)

    Anish Sharma*,

    2016-04-01

    Full Text Available A bacterial strain AST2.2 with chlorpyrifos degrading ability was isolated by enrichment technique from apple orchard soil with previous history of chlorpyrifos use. Based on the morphological, biochemical tests and 16S rRNA sequence analysis, AST2.2 strain was identified as Pseudomonas resinovarans. The strain AST2.2 utilized chlorpyrifos as the sole source of carbon and energy. This strain exhibited growth upto 400mg/l concentration of chlorpyrifos and exhibited high extracellular organophosphorus hydrolase (OPH activity. Gas chromatography-flame ionization detector (GC-FID studies revealed that Pseudomonas resinovarans AST2.2 degraded 43.90 % of chlorpyrifos (400 mg/l within 96 hrs. Intermediates of chlorpyrifos degradation were identified using GC-MS. This strain have potential to degrade chlorpyrifos and thus can be used for bioremediation and ecological restoration of sites contaminated with chlorpyrifos.

  12. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose...

  13. 24 CFR 3500.22 - Severability.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Severability. 3500.22 Section 3500.22 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND...

  14. 7 CFR 2902.22 - Fertilizers.

    Science.gov (United States)

    2010-01-01

    ... Procurement Guideline, 40 CFR 247.15. EPA provides recovered materials content recommendations for fertilizers... 7 Agriculture 15 2010-01-01 2010-01-01 false Fertilizers. 2902.22 Section 2902.22 Agriculture... Fertilizers. (a) Definition. Products formulated or processed to provide nutrients for plant growth...

  15. 22 CFR 126.5 - Canadian exemptions.

    Science.gov (United States)

    2010-04-01

    ..., the permanent and temporary export to Canada without a license of defense articles and related technical data identified in 22 CFR 121.1. The above exemption is subject to the following limitations... in 22 CFR 121.1 continuing to require a license are: (1) All classified articles, technical data...

  16. 32 CFR 2001.22 - Derivative classification.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Derivative classification. 2001.22 Section 2001... Identification and Markings § 2001.22 Derivative classification. (a) General. Information classified derivatively on the basis of source documents or classification guides shall bear all markings prescribed...

  17. 22 CFR 9a.4 - Classification.

    Science.gov (United States)

    2010-04-01

    ... State shall follow the standards in E.O. 11652 and the provisions of 22 CFR 9.5 through 9.8. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification. 9a.4 Section 9a.4 Foreign... ENERGY PROGRAMS; RELATED MATERIAL § 9a.4 Classification. (a) Section 1 of E.O. 11932, August 4,...

  18. 22 CFR 9.6 - Derivative classification.

    Science.gov (United States)

    2010-04-01

    ... CFR 2001.22. (c) Department of State Classification Guide. The Department of State Classification... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Derivative classification. 9.6 Section 9.6... classification. (a) Definition. Derivative classification is the incorporating, paraphrasing, restating...

  19. 7 CFR 955.22 - Nominations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Nominations. 955.22 Section 955.22 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... may be specified by the Secretary. (3) The Secretary may, upon recommendation of the committee,...

  20. 22 CFR 504.14 - Fees.

    Science.gov (United States)

    2010-04-01

    ... charged by the BBG in its Freedom of Information Act regulations at 22 CFR Part 503. (c) Witness fees... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 504.14 Section 504.14 Foreign Relations... OFFICIAL INFORMATION IN LEGAL PROCEEDINGS Schedule of Fees § 504.14 Fees. (a) Generally. The...

  1. 48 CFR 22.103-1 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definition. 22.103-1... PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Basic Labor Policies 22.103-1 Definition... does not exceed the norm for the area, as determined by local custom, tradition, or law; and (2)...

  2. 28 CFR 22.27 - Notification.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Notification. 22.27 Section 22.27 Judicial Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL... of subject, be expected to totally conceal subject identity, an individual shall be so advised....

  3. 17 CFR 9.22 - Appeal brief.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Appeal brief. 9.22 Section 9... Appeals § 9.22 Appeal brief. (a) Time to file. Any person who has filed a notice of appeal in accordance with the provisions of § 9.20 must perfect the appeal by filing an appeal brief with the...

  4. 34 CFR 80.22 - Allowable costs.

    Science.gov (United States)

    2010-07-01

    ... CFR part 31. Contract Cost Principles and Procedures, or uniform cost accounting standards that comply... 34 Education 1 2010-07-01 2010-07-01 false Allowable costs. 80.22 Section 80.22 Education Office... Allowable costs. (a) Limitation on use of funds. Grant funds may be used only for: (1) The allowable...

  5. 45 CFR 1157.22 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... named in OBM Circular A-122 as not subject to that circular 48 CFR part 31. Contract Cost Principles and... 45 Public Welfare 3 2010-10-01 2010-10-01 false Allowable costs. 1157.22 Section 1157.22 Public... Allowable costs. (a) Limitation on use of funds. Grant funds may be used only for: (1) The allowable...

  6. 24 CFR 85.22 - Allowable costs.

    Science.gov (United States)

    2010-04-01

    ... Circular A-122 as not subject to that circular 48 CFR part 31. Contract Cost Principles and Procedures, or... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Allowable costs. 85.22 Section 85... TRIBAL GOVERNMENTS Post-Award Requirements Financial Administration § 85.22 Allowable costs....

  7. 28 CFR 22.20 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Applicability. 22.20 Section 22.20 Judicial Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL... public. (c) The regulations do not apply to information gained regarding future criminal conduct....

  8. 40 CFR 123.22 - Program description.

    Science.gov (United States)

    2010-07-01

    ... employees. The State need not submit complete job descriptions for every employee carrying out the State... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Program description. 123.22 Section... PROGRAM REQUIREMENTS State Program Submissions § 123.22 Program description. Any State that seeks...

  9. 33 CFR 2.22 - Territorial sea.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Territorial sea. 2.22 Section 2... Jurisdictional Terms § 2.22 Territorial sea. (a) With respect to the United States, the following apply— (1) Territorial sea means the waters, 12 nautical miles wide, adjacent to the coast of the United States...

  10. 15 CFR 265.22 - Bicycle traffic.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Bicycle traffic. 265.22 Section 265.22... STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE REGULATIONS GOVERNING TRAFFIC AND CONDUCT REGULATIONS GOVERNING TRAFFIC AND CONDUCT ON THE GROUNDS OF THE NATIONAL INSTITUTE OF STANDARDS &...

  11. 40 CFR 194.22 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements § 194.22 Quality assurance. (a)(1) As soon as practicable after April 9, 1996, the... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Quality assurance. 194.22 Section...

  12. 48 CFR 22.202 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract clause. 22.202 Section 22.202 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... employment of convict labor; (b) The supplies or services are to be purchased from Federal Prison...

  13. 22 CFR 23.3 - Refunds.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Refunds. 23.3 Section 23.3 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.3 Refunds. (a) Rectifications and readjustments. See § 22.6 of this chapter for outline of circumstances under which fees which have...

  14. 7 CFR 1730.22 - Borrower analysis.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Borrower analysis. 1730.22 Section 1730.22... Borrower analysis. (a) Each borrower shall periodically analyze and document its security, operations and... any, the borrower's written analysis would also include a review of the operator's performance...

  15. 34 CFR 101.22 - Amici curiae.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Amici curiae. 101.22 Section 101.22 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION... completed their initial examination of a witness, any amicus curiae may request the presiding officer...

  16. 7 CFR 915.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... committee; or the committee may conduct nominations in Districts 1 and 2 by mail in a manner recommended by the committee and approved by the Secretary. Such nominations shall be submitted to the Secretary by... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 915.22 Section 915.22...

  17. 7 CFR 929.22 - Nomination.

    Science.gov (United States)

    2010-01-01

    ... nominations for membership on the committee are made, such cooperative or growers affiliated therewith shall... such nominations shall be by such means as are recommended by the committee and approved by the... 7 Agriculture 8 2010-01-01 2010-01-01 false Nomination. 929.22 Section 929.22...

  18. 22 CFR 127.10 - Civil penalty.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil penalty. 127.10 Section 127.10 Foreign... Civil penalty. (a) The Assistant Secretary of State for Political-Military Affairs is authorized to impose a civil penalty in an amount not to exceed that authorized by 22 U.S.C. 2778, 2779a and 2780...

  19. 36 CFR 1275.22 - Security.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Security. 1275.22 Section... THE NIXON ADMINISTRATION Preservation and Protection § 1275.22 Security. The Archivist is responsible for providing adequate security for the Presidential historical materials....

  20. 7 CFR 993.22 - Consumer package.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Consumer package. 993.22 Section 993.22 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... weight of mixed dried fruit in the lot consists of standard processed prunes or standard prunes....

  1. 22 CFR 41.107 - Visa fees.

    Science.gov (United States)

    2010-04-01

    ... charitable organization under the provisions of section 501(c)(3) of the Internal Revenue Code (26 U.S.C. 501... recognition to charitable institutions, that it establishes that it is recognized as a charitable institution... by the Secretary and set forth in 22 CFR 22.1 to be sufficient only to cover the cost...

  2. 7 CFR 774.22 - Loan closing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Loan closing. 774.22 Section 774.22 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... interest in the bankruptcy claim, and protect the Government's interest, in accordance with...

  3. 48 CFR 22.804-2 - Construction.

    Science.gov (United States)

    2010-10-01

    ... applicable to covered geographical areas or projects and (2) applicable requirements of 41 CFR 60-1 and 60-4... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Construction. 22.804-2... Construction. (a) Construction contractors that hold a nonexempt (see 22.807) Government construction...

  4. Gene : CBRC-TNIG-22-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available -22 25% MERPSAPWLPPLVGEERPHDSVVTDIGGCELSGPQLRRRRFMSSSSGLDASGPRLRCHRCRVWEPSAPRLCRHRRLGTSQAALWLRRHRRSPLPSSRAGA...RLRRQRCRIWSHSALSSVVVATVVVVRTRCKRASASLSPLSGLEPSGPQLRRHRHRRWSQVALGSVVIVVPAAVVGAGAKRPSAPSSSLLSSSSGLDASGPRLRCHRR...RPFGSVLVVVPAAVVAAGAKRPSAPSSLLLSSSSGLDASGPRLRRHRRRRWSQAALGSVVTVVWAGAKRPFGSVLVVVPAA

  5. Synthesis of 2-(2-Aminopyrimidine)-2,2-difluoroethanols as Potential Bioisosters of Salicylidene Acylhydrazides

    OpenAIRE

    Dahlgren, Markus K.; Öberg, Christopher T; Wallin, Erika A.; Pär G. Janson; Mikael Elofsson

    2010-01-01

    Salicylidene acylhydrazides are inhibitors of type III secretion in several Gram-negative pathogens. To further develop the salicylidene acylhydrazides, scaffold hopping was applied to replace the core fragment of the compounds. The novel 2-(2-amino-pyrimidine)-2,2-difluoroethanol scaffold was identified as a possible analog to the salicylidene acylhydrazide core structure. The synthesis of a library of 2-(2-amino-pyrimidine)-2,2-difluoro-ethanols is described in this paper.

  6. Synthesis of 2-(2-Aminopyrimidine-2,2-difluoroethanols as Potential Bioisosters of Salicylidene Acylhydrazides

    Directory of Open Access Journals (Sweden)

    Markus K. Dahlgren

    2010-06-01

    Full Text Available Salicylidene acylhydrazides are inhibitors of type III secretion in several Gram-negative pathogens. To further develop the salicylidene acylhydrazides, scaffold hopping was applied to replace the core fragment of the compounds. The novel 2-(2-amino-pyrimidine-2,2-difluoroethanol scaffold was identified as a possible analog to the salicylidene acylhydrazide core structure. The synthesis of a library of 2-(2-amino-pyrimidine-2,2-difluoro-ethanols is described in this paper.

  7. Synthesis of 2-(2-aminopyrimidine)-2,2-difluoroethanols as potential bioisosters of salicylidene acylhydrazides.

    Science.gov (United States)

    Dahlgren, Markus K; Oberg, Christopher T; Wallin, Erika A; Janson, Pär G; Elofsson, Mikael

    2010-06-01

    Salicylidene acylhydrazides are inhibitors of type III secretion in several gram-negative pathogens. To further develop the salicylidene acylhydrazides, scaffold hopping was applied to replace the core fragment of the compounds. The novel 2-(2-amino-pyrimidine)-2,2-difluoroethanol scaffold was identified as a possible analog to the salicylidene acylhydrazide core structure. The synthesis of a library of 2-(2-amino-pyrimidine)-2,2-difluoro-ethanols is described in this paper. PMID:20657451

  8. Condensed Matter Theories - Volume 22

    Science.gov (United States)

    Reinholz, Heidi; Röpke, Gerd; de Llano, Manuel

    2007-09-01

    pt. A. Fermi liquids. Pressure comparison between the spherical cellular model and the Thomas-Fermi model / G.A. Baker, Jr. Pair excitations and vertex corrections in Fermi fluids and the dynamic structure function of two-dimension 3He / H.M. Böhm, H. Godfrin, E. Krotscheck, H.J. Lauter, M. Meschke and M. Panholzer. Condensation of helium in wedges / E.S. Hernádez ... [et al.]. Non-Fermi liquid behavior from the Fermi-liquid approach / V.A. Khodel ... [et al.]. Theory of third sound and stability of thin 3He-4He superfluid films / E. Krotscheck and M.D. Miller. Pairing in asymmetrical Fermi systems / K.F. Quader and R. Liao. Ground-state properties of small 3He drops from quantum Monte Carlo simulations / E. Sola, J. Casulleras and J. Boronat. Ground-state energy and compressibility of a disordered two-dimensional electron gas / Tanatar ... [et al.]. Quasiexcitons in photoluminescence of incompressible quantum liquids / A. Wójs, A.G ladysiewicz and J.J. Quinn -- pt. B. Bose liquids. Quantum Boltzmann liquids / K.A. Gernoth, M L. Ristig and T. Lindenau. Condensate fraction in the dynamic structure function of Bose fluids / M. Saarela, F. Mazzanti and V. Apaja -- pt. C. Strongly-correlated electronic systems. Electron gas in high-field nanoscopic transport: metallic carbon nanotubes / F. Green and D. Neilson. Evolution and destruction of the Kondo effect in a capacitively coupled double dot system / D.E. Logan and M.R. Galpin. The method of increments-a wavefunction-based Ab-Initio correlation method for solids / B. Paulus. Fractionally charged excitations on frustrated lattices / E. Runge, F. Pollmann and P. Fulde. 5f Electrons in actinides: dual nature and photoemission spectra / G. Zwicknagl -- pt. D. Magnetism. Magnetism in disordered two-dimensional Kondo-Necklace / W. Brenig. On the de Haas-can Alphen oscillation in 2D / S. Fujita and D.L. Morabito. Dynamics in one-dimensional spin systems-density matrix reformalization group study / S. Nishimoto and M

  9. Research on the Method of Recoverying Microtopography of Epeiric Carbonate Platform in Depositional Stage:A case study from the layer A of Jia 22 Member in Moxi Gas Field , Sichuan Basin%陆表海碳酸盐岩台地沉积期微地貌恢复方法研究——以四川盆地磨溪气田嘉二2亚段A层为例

    Institute of Scientific and Technical Information of China (English)

    谭秀成; 聂勇; 刘宏; 周彦; 李凌; 赵路子; 张本健; 冯钰

    2011-01-01

    ;③intargranular solution extremely develops;④the freshwater cements in early stage and cement unconformity exist;⑤lens-diagenesis reservoir of atmospheric genesis positively associates with the grainstone gross-thickness. Based on this, the paper then takes the view that microtopography prominence can be inverted by the reservoir study of the grain shoal. Followed by that principle,it also suggestes that the concrete study procedure can be like this:the isochronous geologic body to be chosen as the main body of grainstone deposition, the confirmation of reservoir genesis and exposured time, the topography recovering during depositional stage and the application of achievement verification.Sichuan Basin was characterized by developing epeiric carbonate platform during the period of Jialingjiang in early Triassic. The basin was also hit by an fierce transgression in the period of early Jia 22, which made the salinity of the seawater normal on the whole. Moxi gas field locates in the south of genfie-oblique tectonic zone of the palaeohigh in the central of the basin, where the tectonic body is about 280 km2, and the exploration wells penetrating the Jia 2 member sum up to 42( data by 2005 ) ,of which the total cored wells of Jia 2 member sum up to 16 ,besides, the distribution is relatively uniform. Hence, the gas field was used in the case study, where the result indicates that highland mainly develop in the well areas of eastern side of Mo 24-Mo 205, southern side of Mo 206, the rim of Mo 207, Mo 151-Mo 36, Mo 208 and its southern part, Mo 48 ,Northern part of Mo 202(7 in all),which distribute in the direction of southwest-northeast, swales mainly develop in Mo 12-Mo 201, Mo 005-2-Mo 150, southern part of Mo 22 and eastern part of Mo 206. There is thick deposition of underwater-gypsum ( dark-gray and massive gypsum, no exposed marks found) developing in the well areas of Mo 005-2-Mo 150, Mo 207 ,which has come into being by the shoal development around the micro-highland , resulting in

  10. Preparation of composite electroheat carbon film

    Institute of Scientific and Technical Information of China (English)

    XIA Jin-tong; TU Chuan-jun; LI Yan; HU Li-min; DENG Jiu-hua

    2005-01-01

    A kind of conductive and heating unit, which can reach a high surface electroheat temperature at a low voltage, was developed in view of the traditional electroheat coating which has a low surface electroheat temperature and an insufficient heat resistance of its binder. The coating molded electroheat carbon film(CMECF) was prepared by carbonizing the coating which was prepared by adding modified resin into flake graphite and carbon fiber, coating molded onto the surface of the heat resisting matrix after dried, while the hot pressing molded electroheat thick carbon film(HPMETCF) was prepared by carbonizing the bodies whose powders were hot pressing molded directly.The surface and inner microstructure of the carbon film was characterized and analyzed by SEM and DSC/TG, while electroheat property was tested by voltage-current volume resistivity tester and electrical parameter tester. The results show that, close-packed carbon network configuration is formed within the composite electroheat carbon film film after anti-oxidizable treatment reaches a higher surface electroheat temperature than that of the existing electroheat coatings at a low voltage, and has excellent electroheat property, high thermal efficiency as well as stable physicochemical property. It is found that, at room temperature(19± 2 ℃) and 22 V for 5 min, the surface electroheat temperature of the self-produced CMECF (mfiller/mresin = 1. 8/1) reaches 112 ℃ while HPMETCF (mfiller/mresin = 3. 6/1) reaches 265 ℃.

  11. Carbon classified?

    DEFF Research Database (Denmark)

    Lippert, Ingmar

    2012-01-01

    . Using an actor- network theory (ANT) framework, the aim is to investigate the actors who bring together the elements needed to classify their carbon emission sources and unpack the heterogeneous relations drawn on. Based on an ethnographic study of corporate agents of ecological modernisation over...... a period of 13 months, this paper provides an exploration of three cases of enacting classification. Drawing on ANT, we problematise the silencing of a range of possible modalities of consumption facts and point to the ontological ethics involved in such performances. In a context of global warming...

  12. Microdeletion 22q11 and oesophageal atresia

    Science.gov (United States)

    Digilio, M. C.; Marino, B.; Bagolan, P.; Giannotti, A.; Dallapiccola, B.

    1999-01-01

    Oesophageal atresia (OA) is a congenital defect associated with additional malformations in 30-70% of the cases. In particular, OA is a component of the VACTERL association. Since some major features of the VACTERL association, including conotruncal heart defect, radial aplasia, and anal atresia, have been found in patients with microdeletion 22q11.2 (del(22q11.2)), we have screened for del(22q11.2) by fluorescent in situ hybridisation (FISH) in 15 syndromic patients with OA. Del(22q11.2) was detected in one of them, presenting with OA, tetralogy of Fallot, anal atresia, neonatal hypocalcaemia, and subtle facial anomalies resembling those of velocardiofacial syndrome. The occurrence of del(22q11.2) in our series of patients with OA is low (1/15), but this chromosomal anomaly should be included among causative factors of malformation complexes with OA. In addition, clinical variability of del(22q11.2) syndrome is further corroborated with inclusion of OA in the list of the findings associated with the deletion.


Keywords: microdeletion 22q11; oesophageal atresia; VACTERL association; velocardiofacial syndrome PMID:10051013

  13. Carbon Nanomembranes.

    Science.gov (United States)

    Turchanin, Andrey; Gölzhäuser, Armin

    2016-08-01

    Carbon nanomembranes (CNMs) are synthetic 2D carbon sheets with tailored physical or chemical properties. These depend on the structure, molecular composition, and surroundings on either side. Due to their molecular thickness, they can be regarded as "interfaces without bulk" separating regions of different gaseous, liquid, or solid components and controlling the materials exchange between them. Here, a universal scheme for the fabrication of 1 nm-thick, mechanically stable, functional CNMs is presented. CNMs can be further modified, for example perforated by ion bombardment or chemically functionalized by the binding of other molecules onto the surfaces. The underlying physical and chemical mechanisms are described, and examples are presented for the engineering of complex surface architectures, e.g., nanopatterns of proteins, fluorescent dyes, or polymer brushes. A simple transfer procedure allows CNMs to be placed on various support structures, which makes them available for diverse applications: supports for electron and X-ray microscopy, nanolithography, nanosieves, Janus nanomembranes, polymer carpets, complex layered structures, functionalization of graphene, novel nanoelectronic and nanomechanical devices. To close, the potential of CNMs in filtration and sensorics is discussed. Based on tests for the separation of gas molecules, it is argued that ballistic membranes may play a prominent role in future efforts of materials separation. PMID:27281234

  14. Trading forest carbon

    Science.gov (United States)

    The nature of carbon in forests is discussed from the perspective of carbon trading. Carbon inventories, specifically in the area of land use and forestry are reviewed for the Pacific Northwest. Carbon turnover in forests is discussed as it relates to carbon sequestration. Scient...

  15. 22 CFR 99.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... the Convention on Protection of Children and Co-operation in Respect of Intercountry Adoption done at The Hague on May 29, 1993. (b) Such other terms as are defined in 22 CFR 96.2 shall have the...

  16. 48 CFR 22.901 - Policy.

    Science.gov (United States)

    2010-10-01

    ... APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Nondiscrimination Because of Age 22.901 Policy. Executive... employees, or the terms, conditions, or privileges of their employment, discriminate against persons...

  17. 40 CFR 191.22 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Ground-Water Protection § 191.22 Definitions... determined by use of the method specified in 40 CFR part 136. Underground source of drinking water means...

  18. 7 CFR 1219.22 - Promotion.

    Science.gov (United States)

    2010-01-01

    ... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION, RESEARCH, AND INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.22 Promotion. Promotion means any action to advance the image, desirability, or marketability of Hass...

  19. Strasti po 22 sentjabrja / Eldar Efendijev

    Index Scriptorium Estoniae

    Efendijev, Eldar, 1954-

    2005-01-01

    Isamaaliidu algatatud pühade ja tähtpäevade seaduse muutmise eelnõust 1944. a. 22. septembril tegutsenud Otto Tiefi valitsuse mälestuse jäädvustamiseks. Keskerakonna seisukohta tutvustab Ain Seppik

  20. Hurricane Rita Poster (September 22, 2005)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Hurricane Rita poster. Multi-spectral image from NOAA-16 shows Hurricane Rita as a category-4 hurricane in the Gulf of Mexico on September 22, 2005. Poster size is...

  1. Conformally reducible 2+2 spacetimes

    Energy Technology Data Exchange (ETDEWEB)

    Carot, Jaume [Departament de Fisica, Universitat de les Illes Balears, Cra. Valldemossa km 7.5, E-07071 Palma de Mallorca (Spain); Tupper, Brian O J [Department of Mathematics and Statistics, University of New Brunswick, Fredericton, NB E3B 5A3 (Canada)

    2002-08-07

    Spacetimes which are conformal to 2+2 reducible spacetimes are considered. We classify them according to their conformal algebra, giving in each case explicit expressions for the metric and conformal Killing vectors, and providing physically meaningful examples.

  2. Conformally reducible 2+2 spacetimes

    CERN Document Server

    Carot, J

    2002-01-01

    Spacetimes which are conformal to 2+2 reducible spacetimes are considered. We classify them according to their conformal algebra, giving in each case explicit expressions for the metric and conformal Killing vectors, and providing physically meaningful examples.

  3. 22 CFR 1101.11 - Fees.

    Science.gov (United States)

    2010-04-01

    ... statute (for example, 22 CFR part 1102—Freedom of Information Act.) (d) Remittances shall be in the form... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 1101.11 Section 1101.11 Foreign Relations... § 1101.11 Fees. (a) Under the Act, fees can only be charged for the cost of copying records. No fees...

  4. Deletion 22q13.3 syndrome

    OpenAIRE

    Phelan Mary C

    2008-01-01

    Abstract The deletion 22q13.3 syndrome (deletion 22q13 syndrome or Phelan-McDermid syndrome) is a chromosome microdeletion syndrome characterized by neonatal hypotonia, global developmental delay, normal to accelerated growth, absent to severely delayed speech, and minor dysmorphic features. The deletion occurs with equal frequency in males and females and has been reported in mosaic and non-mosaic forms. Due to lack of clinical recognition and often insufficient laboratory testing, the syndr...

  5. The bare uranyl(2+) ion, UO22+

    International Nuclear Information System (INIS)

    Ion-molecule reactions between U2+ and oxygen donors or charge-stripping collisions between singly charged UO22 ions and O2 collision partners generate uranyl(2+) ions in the gas phase. These do not readily dissociate into singly charged fragments. The standard enthalpy of formation for UO22+ is estimated to be 371±60 kcal mol-1, in accord with the results of ab initio calculations. (orig.)

  6. Ectrodactyly and 7q22.1

    Energy Technology Data Exchange (ETDEWEB)

    Rivera, H. [Salisbury District Hospital, Odstock (United Kingdom)

    1994-10-15

    This succinct `Letter to the Editor` was written in response to a report on a family exhibiting both a t(2;7)(q21.2;q22.1) and split hand/foot anomaly by Genuardi et al. [1993]. Pertinent sections of the article are discussed, with disagreement taken with a lack of mention to work conducted in 1991 by Rivera et al. in assigning the crucial locus to band 7q22 near to the proximal interface. 3 refs.

  7. Power Systems Development Facility Gasification Test Campaign TC22

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services

    2008-11-01

    In support of technology development to utilize coal for efficient, affordable, and environmentally clean power generation, the Power Systems Development Facility (PSDF), located in Wilsonville, Alabama, routinely demonstrates gasification technologies using various types of coals. The PSDF is an engineering scale demonstration of key features of advanced coal-fired power systems, including a KBR Transport Gasifier, a hot gas particulate control device, advanced syngas cleanup systems, and high-pressure solids handling systems. This report summarizes the results of TC22, the first test campaign using a high moisture lignite from Mississippi as the feedstock in the modified Transport Gasifier configuration. TC22 was conducted from March 24 to April 17, 2007. The gasification process was operated for 543 hours, increasing the total gasification operation at the PSDF to over 10,000 hours. The PSDF gasification process was operated in air-blown mode with a total of about 1,080 tons of coal. Coal feeder operation was challenging due to the high as-received moisture content of the lignite, but adjustments to the feeder operating parameters reduced the frequency of coal feeder trips. Gasifier operation was stable, and carbon conversions as high as 98.9 percent were demonstrated. Operation of the PCD and other support equipment such as the recycle gas compressor and ash removal systems operated reliably.

  8. Estimation of Carbon Stocks in Coffee Plantation in East Java

    Directory of Open Access Journals (Sweden)

    Aris Wibawa

    2010-05-01

    Full Text Available Global warming is closely related with the amount of carbon stored in an ecosystem. A research to determine the amount of carbon stock in the coffee farms has been conducted in Sumberbaru and Silo Sub-districts in Jember district, Kaliwining Experimental Station (ES in Jember district, Sumberasin ES in Malang district and Andungsari ES in Bondowoso district. Carbon stock was measured using the method of Rapid Carbon Stock’s Assessment (RaCSA developed by ICRAF. Measurements were made on the observation plots of 200 m2, with 3 replications. Results of measurement of carbon stock on coffee plantations showed that the increased carbon stock was proportional with the age of plants. Carbon stock in coffee plantation depends on the shade tree system. In the monoculture coffee leucaena used as shade trees, the carbon stock was lower then in multistrata system (agroforestry used several kinds of shade trees. Carbon stock on coffee plant in the estate more than smallholder. The average of carbon stock on Robusta coffee at the age of 30 years amounted to 29.38 Mg ha-1, it is greater than the carbon deposit on Arabica coffee that is 22.02 Mg ha-1.Key words: Carbon stock, coffee plantation, Arabica, Robusta, smallholder, agroforestri

  9. Carbon Farming as a Carbon Negative Technology

    Science.gov (United States)

    Anderson, C.; Laird, D.; Hayes, D. J.

    2015-12-01

    Carbon farms have a pivotal role in national and international efforts to mitigate and adapt to climate change. A carbon farm in its broadest sense is one that reduces greenhouse gas (GHG) emissions or captures and holds carbon in vegetation and soils. Their capacity to remove carbon from the air and store it safely and permanently, while providing additional human and ecosystem benefits, means they could contribute significantly to national efforts to stabilize or reduce GHGs. We examine carbon farms in the context of corn and soybean production agriculture. We illustrate, using Iowa data but with relevance across United States corn and soybean production, the potential for carbon farms to reduce human GHG emissions and sequester carbon permanently at a rate that has meaningful impact on global greenhouse gas concentration. Carbon has been viewed as a next generation cash crop in Iowa for over a decade. The carbon farm perspective, however, goes beyond carbon as cash crop to make carbon the center of an entire farm enterprise. The transformation is possible through slight adjustment crop practices mixed with advances in technology to sequester carbon through biochar. We examine carbon balance of Iowa agriculture given only the combination of slight reduction in fertilizer and sequestration by biochar. We find the following. Iowa carbon farms could turn Iowa agriculture into a carbon sink. The estimated range of GHG reduction by statewide implementation of carbon farms is 19.46 to 90.27 MMt CO2-equivalent (CO2-e), while the current agricultural CO2-e emission estimate is 35.38 MMt CO2-e. Iowa carbon farm GHG reduction would exceed Iowa GHG reduction by wind energy (8.7 MMt CO2-e) and could exceed combined reductions from wind energy and corn grain ethanol (10.7 MMt CO2-e; 19.4 MMt CO2-e combined). In fact, Iowa carbon farms alone could exceed GHG reduction from national corn grain ethanol production (39.6 MMt CO2-e). A carbon price accessible to agricultural

  10. Net Ecosystem Carbon Flux

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Net Ecosystem Carbon Flux is defined as the year-over-year change in Total Ecosystem Carbon Stock, or the net rate of carbon exchange between an ecosystem and the...

  11. Carbon Monoxide (CO)

    Science.gov (United States)

    ... IAQ) » Carbon Monoxide's Impact on Indoor Air Quality Carbon Monoxide's Impact on Indoor Air Quality On this ... length of exposure. Top of Page Sources of Carbon Monoxide Sources of CO include: unvented kerosene and ...

  12. Carbon Monoxide Poisoning

    Science.gov (United States)

    ... Recommend on Facebook Tweet Share Compartir What is Carbon Monoxide? Carbon monoxide, or “CO,” is an odorless, colorless gas that can kill you. Carbon monoxide detector Where is CO found? CO is ...

  13. Magnetoresistance of Multiwalled Carbon Nanotube Yarns

    Institute of Scientific and Technical Information of China (English)

    SHENG Lei-Mei; GAO Wei; CAO Shi-Xun; ZHANG Jin-Cang

    2008-01-01

    We measure zero-field resistivity and magnetoresistance of multiwalled carbon nanotube yarns (CNTYs). The CNTYs are drawn from superaligned multiwalled carbon nanotube arrays synthesized by the low-pressure chemical vapour deposition method. The zero-field resistivity shows a logarithmic decrease from 2 K to 300 K. In the presence of a magnetic field applied perpendicular to the yarn axis, a pronounced negative magnetoresistance is observed. A magnetoresistance ratio of 22% is obtained. These behaviours can be explained by the weak localization effect.

  14. Protective Effects of Dimethyl—4,4‘—Dinmethoxy—5,6,5’,6‘—Dimethylene Dioxybiphenyl—2,2’—Dicarboxylate on Damages of Isolated Rat Hepatocytes Induced by Carbon Tetrachloride and D—galactosam

    Institute of Scientific and Technical Information of China (English)

    FUTIEBO; LIUGENGTAO

    1992-01-01

    The rotective effect of biphenyl dimethyl dicarboxylate(DDB)on chemically induced damages was studied in isolated suspended rat hepatocytes.The experimental results showed that DDB(200μg/106cells) efficiently protected the hepatocytes against carbon tetrachloride(CCl4 10mmol·L-1)and D-galactosamine(1mmol·L1)induce damages.Membranal lipid peroxidation(malondialdehyde,MDA formation(and glutamic pyruvic transaminase(GPT) release from the hepatocytes were markedly decreased.The damage of the cell surfaces of the hepatocytes were also reduced as seen under a scanning electrom microscope(SEM). Pretreatment with DDB(300mg·kg-1)orally ameliorated the reduction of liver glycogen and blood glucose caused by ip injection of D-galactosamine(800mg·kg-1)in mice.When normal rats were given DDB 300mg·kg-1 once daily for 10d,the free ribosomal protein and RNA in the liver increased significantly.These results indicate that DDB is of beneficial effects on both damaged and normal hepatocytes.

  15. Global deforestation: contribution to atmospheric carbon dioxide.

    Science.gov (United States)

    Woodwell, G M; Hobbie, J E; Houghton, R A; Melillo, J M; Moore, B; Peterson, B J; Shaver, G R

    1983-12-01

    A study of effects of terrestrial biota on the amount of carbon dioxide in the atmosphere suggests that the global net release of carbon due to forest clearing between 1860 and 1980 was between 135 x 10(15) and 228 x 10(15) grams. Between 1.8 x 10(15) and 4.7 x 10(15) grams of carbon were released in 1980, of which nearly 80 percent was due to deforestation, principally in the tropics. The annual release of carbon from the biota and soils exceeded the release from fossil fuels until about 1960. Because the biotic release has been and remains much larger than is commonly assumed, the airborne fraction, usually considered to be about 50 percent of the release from fossil fuels, was probably between 22 and 43 percent of the total carbon released in 1980. The increase in carbon dioxide in the atmosphere is thought by some to be increasing the storage of carbon in the earth's remaining forests sufficiently to offset the release from deforestation. The interpretation of the evidence presented here suggests no such effect; deforestation appears to be the dominant biotic effect on atmospheric carbon dioxide. If deforestation increases in proportion to population, the biotic release of carbon will reach 9 x 10(15) grams per year before forests are exhausted early in the next century. The possibilities for limiting the accumulation of carbon dioxide in the atmosphere through reduction in use of fossil fuels and through management of forests may be greater than is commonly assumed. PMID:17747369

  16. Solution structure of human sorting nexin 22.

    Science.gov (United States)

    Song, Jikui; Zhao, Kate Qin; Newman, Carrie L Loushin; Vinarov, Dmitriy A; Markley, John L

    2007-05-01

    The sorting nexins (SNXs) constitute a large group of PX domain-containing proteins that play critical roles in protein trafficking. We report here the solution structure of human sorting nexin 22 (SNX22). Although SNX22 has <30% sequence identity with any PX domain protein of known structure, it was found to contain the alpha/beta fold and compact structural core characteristic of PX domains. Analysis of the backbone dynamics of SNX22 by NMR relaxation measurements revealed that the two walls of the ligand binding cleft undergo internal motions: on the picosecond timescale for the beta1/beta2 loop and on the micro- to millisecond timescale for the loop between the polyproline motif and helix alpha2. Regions of the SNX22 structure that differ from those of other PX domains include the loop connecting strands beta1 and beta2 and the loop connecting helices alpha1 and alpha2, which appear to be more mobile than corresponding loops in other known structures. The interaction of dibutanoyl-phosphatidylinositol-3-phosphate (dibutanoyl-PtdIns(3)P) with SNX22 was investigated by an NMR titration experiment, which identified the binding site in a basic cleft and indicated that ligand binding leads only to a local structural rearrangement as has been found with other PX domains. Because motions in the loops are damped out when dibutanoyl-PtdIns(3)P binds, entropic effects could contribute to the lower affinity of SNX22 for this ligand compared to other PX domains. PMID:17400918

  17. Asymmetry in inclusive π±, p production at 22 GeV, BNL E925

    International Nuclear Information System (INIS)

    Preliminary results from Experiment E925 on inclusive pion asymmetries from a 22 GeV/c polarized proton beam on a carbon target show significant asymmetries for π± production similar to those observed earlier at the ZGS and Fermilab with beams of 12 and 200 GeV respectively. This experiment demonstrates the viability of using the analyzing power in inclusive pion production for high energy beam polarimetry at RHIC. Inclusive proton asymmetries are consistent with zero

  18. Integral Ring Carbon-Carbon Piston

    Science.gov (United States)

    Northam, G. Burton (Inventor)

    1999-01-01

    An improved structure for a reciprocating internal combustion engine or compressor piston fabricate from carbon-carbon composite materials is disclosed. An integral ring carbon-carbon composite piston, disclosed herein, reduces the need for piston rings and for small clearances by providing a small flexible, integral component around the piston that allows for variation in clearance due to manufacturing tolerances, distortion due to pressure and thermal loads, and variations in thermal expansion differences between the piston and cylinder liner.

  19. Carbon dioxide sequestration by mineral carbonation

    OpenAIRE

    Huijgen, W.J.J.

    2007-01-01

    The increasing atmospheric carbon dioxide (CO2) concentration, mainly caused by fossil fuel combustion, has lead to concerns about global warming. A possible technology that can contribute to the reduction of carbon dioxide emissions is CO2 sequestration by mineral carbonation. The basic concept behind mineral CO2 sequestration is the mimicking of natural weathering processes in which calcium or magnesium containing minerals react with gaseous CO2 and form solid calcium or magnesium carbonate...

  20. Reaction rates for the s-process neutron source 22Ne+{\\alpha}

    CERN Document Server

    Longland, Richard; Karakas, Amanda I

    2012-01-01

    The 22Ne({\\alpha},n)25Mg reaction is an important source of neutrons for the s-process. In massive stars responsible for the weak component of the s-process, 22Ne({\\alpha},n)25Mg is the dominant source of neutrons, both during core helium burning and in shell carbon burning. For the main s-process component produced in Asymptotic Giant Branch (AGB) stars, the 13C({\\alpha},n)16O reaction is the dominant source of neutrons operating during the interpulse period, with the 22Ne+{\\alpha} source affecting mainly the s-process branchings during a thermal pulse. Rate uncertainties in the competing 22Ne({\\alpha},n)25Mg and 22Ne({\\alpha},{\\gamma})26Mg reactions result in large variations of s-process nucleosynthesis. Here, we present up-to-date and statistically rigorous 22Ne+{\\alpha} reaction rates using recent experimental results and Monte Carlo sampling. Our new rates are used in post-processing nucleosynthesis calculations both for massive stars and AGB stars. We demonstrate that the nucleosynthesis uncertainties ...

  1. Carbon Residence Times in Pedogenic Carbonate Pools

    Science.gov (United States)

    Monger, H.; Feng, Y.; Karnjanapiboonwang, A.

    2013-12-01

    Soil carbonate is a huge pool of terrestrial carbon that contains at least 930 to 940 Pg C and has influx rates on the order of 1 to 12 g CaCO3/m2/yr. Such large mass to flux ratios yield long mean residence times for carbon (e.g., 85,000 years)--assuming steady state. Like other global carbon pools, the soil carbonate pool has smaller sub-pools with higher influx rates and shorter mean residence times. For example, pedogenic carbonate in coppice dunes known to have formed since 1858 and carbonate formed on lithic artifacts in soils at archaeology sites suggests mean residence times can be as short as 120 years--again assuming steady state. Harder to assess are efflux rates as CO2 emissions or bicarbonate leaching. Some Bowen-ratio studies have nevertheless found evidence for CO2 emissions resulting from carbonate dissolution, and other studies have found evidence for bicarbonate leaching based on dissolution pipes through calcic horizons using soil morphology studies. Since an understanding of mean residence times are prerequisite for a better understanding of soil carbonate in the global carbon cycle, especially in a scenario of an expanding Aridosphere, more influx and efflux measurements are needed to evaluate the possibility of carbon sequestration by soil carbonate in hyperarid, arid, semiarid, or subhumid soils.

  2. Carbon dioxide sequestration by mineral carbonation

    NARCIS (Netherlands)

    Huijgen, W.J.J.

    2007-01-01

    The increasing atmospheric carbon dioxide (CO2) concentration, mainly caused by fossil fuel combustion, has lead to concerns about global warming. A possible technology that can contribute to the reduction of carbon dioxide emissions is CO2 sequestration by mineral carbonation. The basic concept beh

  3. Carbon Footprint of Beef Cattle

    Directory of Open Access Journals (Sweden)

    Jim Dyer

    2012-12-01

    Full Text Available The carbon footprint of beef cattle is presented for Canada, The United States, The European Union, Australia and Brazil. The values ranged between 8 and 22 kg CO2e per kg of live weight (LW depending on the type of farming system, the location, the year, the type of management practices, the allocation, as well as the boundaries of the study. Substantial reductions have been observed for most of these countries in the last thirty years. For instance, in Canada the mean carbon footprint of beef cattle at the exit gate of the farm decreased from 18.2 kg CO2e per kg LW in 1981 to 9.5 kg CO2e per kg LW in 2006 mainly because of improved genetics, better diets, and more sustainable land management practices. Cattle production results in products other than meat, such as hides, offal and products for rendering plants; hence the environmental burden must be distributed between these useful products. In order to do this, the cattle carbon footprint needs to be reported in kg of CO2e per kg of product. For example, in Canada in 2006, on a mass basis, the carbon footprint of cattle by-products at the exit gate of the slaughterhouse was 12.9 kg CO2e per kg of product. Based on an economic allocation, the carbon footprints of meat (primal cuts, hide, offal and fat, bones and other products for rendering were 19.6, 12.3, 7 and 2 kg CO2e per kg of product, respectively.

  4. 27 CFR 22.20 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ... in TTB Order 1135.22, Delegation of the Administrator's Authorities in 27 CFR Part 22, Distribution... Administrator. 22.20 Section 22.20 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Provisions Authorities § 22.20 Delegations of the Administrator. The regulatory authorities of...

  5. Erythrocyte 22Na+ influx in hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Shalev, O.; Eaton, J.W.; Ben-Ishay, D.

    1984-01-01

    We assessed 22Na+ uptake by erythrocytes (RBC) from 38 individuals with essential hypertension and 37 healthy controls. All subjects were male, white, non-obese and with normal renal function, obviating sex, race, hormonal, ponderal and renal factors known to influence RBC Na+ handling. The mean +/- sem 22Na+ uptake of the patients was 284 +/- 16 mumole/liter RBC/hour while that of normal controls was 249 +/- 11 mumole/liter RBC/hour; although the difference reached borderline significance, individual values showed considerable overlap. Consequently, in our population, RBC 22Na+ uptake is not a reliable marker for essential hypertension. We believe that previous studies should be reassessed with regard to patients' characteristics and future studies employ rigorous criteria in selection of subjects.

  6. SU(2|2) supersymmetric mechanics

    CERN Document Server

    Ivanov, Evgeny; Sidorov, Stepan

    2016-01-01

    We introduce a new kind of non-relativistic ${\\cal N}{=}\\,8$ supersymmetric mechanics, associated with worldline realizations of the supergroup $SU(2|2)$ treated as a deformation of flat ${\\cal N}{=}\\,8$, $d{=}1$ supersymmetry. Various worldline $SU(2|2)$ superspaces are constructed as coset manifolds of this supergroup, and the corresponding superfield techniques are developed. For the off-shell $SU(2|2)$ multiplets $({\\bf 3,8,5})$, $({\\bf 4,8,4})$ and $({\\bf 5,8,3})$, we construct and analyze the most general superfield and component actions. Common features are mass oscillator-type terms proportional to the deformation parameter and a trigonometric realization of the superconformal group $OSp(4^*|4)$ in the conformal cases. For the simplest $({\\bf 5, 8, 3})$ model the quantization is performed.

  7. From carbon nanotubes to carbon atomic chains

    Science.gov (United States)

    Casillas García, Gilberto; Zhang, Weijia; José-Yacamán, Miguel

    2010-10-01

    Carbyne is a linear allotrope of carbon. It is formed by a linear arrangement of carbon atoms with sp-hybridization. We present a reliable and reproducible experiment to obtain these carbon atomic chains using few-layer-graphene (FLG) sheets and a HRTEM. First the FLG sheets were synthesized from worm-like exfoliated graphite and then drop-casted on a lacey-carbon copper grid. Once in the TEM, two holes are opened near each other in a FLG sheet by focusing the electron beam into a small spot. Due to the radiation, the carbon atoms rearrange themselves between the two holes and form carbon fibers. The beam is concentrated on the carbon fibers in order excite the atoms and induce a tension until multi wall carbon nanotube (MWCNT) is formed. As the radiation continues the MWCNT breaks down until there is only a single wall carbon nanotube (SWCNT). Then, when the SWCNT breaks, an atomic carbon chain is formed, lasts for several seconds under the radiation and finally breaks. This demonstrates the stability of this carbon structure.

  8. Organisasjonstenkningen i 22.juli-kommisjonens rapport

    OpenAIRE

    Røgenes, Kristine Nordbø

    2013-01-01

    Sammendrag Denne studien omhandler organisasjonstenkningen i 22.juli-kommisjonens rapport. Fredag 22.juli 2011 ble Norge rammet av den verste terrorhandlingen på norsk jord i fredstid. Ufattelige tragedier utspant seg og viktige samfunnsorganisasjoner som politiet, helsevesenet, brannvesenet og regjeringen ble satt på en kraftig prøve. For å gi befolkningen de svar de hadde krav på, nedsatte regjeringen en uavhengig kommisjon. Kommisjonen fikk ett år på seg til å finne svarene og legge ...

  9. Characterization Well R-22 Geochemistry Report

    Energy Technology Data Exchange (ETDEWEB)

    Patrick Longmire

    2002-09-01

    This report provides analytical results for groundwater collected during four characterization-sampling rounds conducted at well R-22 from March 2001 through March 2002. Characterization well R-22 was sampled from March 6 through 13, 2001; June 19 through 26, 2001; November 30 through December 10, 2001; and February 27 through March 7, 2002. The goal of the characterization efforts was to assess the hydrochemistry and to determine whether or not contaminants are present in the regional aquifer in the vicinity of the well. A geochemical evaluation of the analytical results for the well is also presented in this report.

  10. Global Carbon Budget 2015

    Science.gov (United States)

    Le Quéré, C.; Moriarty, R.; Andrew, R. M.; Canadell, J. G.; Sitch, S.; Korsbakken, J. I.; Friedlingstein, P.; Peters, G. P.; Andres, R. J.; Boden, T. A.; Houghton, R. A.; House, J. I.; Keeling, R. F.; Tans, P.; Arneth, A.; Bakker, D. C. E.; Barbero, L.; Bopp, L.; Chang, J.; Chevallier, F.; Chini, L. P.; Ciais, P.; Fader, M.; Feely, R. A.; Gkritzalis, T.; Harris, I.; Hauck, J.; Ilyina, T.; Jain, A. K.; Kato, E.; Kitidis, V.; Klein Goldewijk, K.; Koven, C.; Landschützer, P.; Lauvset, S. K.; Lefèvre, N.; Lenton, A.; Lima, I. D.; Metzl, N.; Millero, F.; Munro, D. R.; Murata, A.; Nabel, J. E. M. S.; Nakaoka, S.; Nojiri, Y.; O'Brien, K.; Olsen, A.; Ono, T.; Pérez, F. F.; Pfeil, B.; Pierrot, D.; Poulter, B.; Rehder, G.; Rödenbeck, C.; Saito, S.; Schuster, U.; Schwinger, J.; Séférian, R.; Steinhoff, T.; Stocker, B. D.; Sutton, A. J.; Takahashi, T.; Tilbrook, B.; van der Laan-Luijkx, I. T.; van der Werf, G. R.; van Heuven, S.; Vandemark, D.; Viovy, N.; Wiltshire, A.; Zaehle, S.; Zeng, N.

    2015-12-01

    carbon budget. For the last decade available (2005-2014), EFF was 9.0 ± 0.5 GtC yr-1, ELUC was 0.9 ± 0.5 GtC yr-1, GATM was 4.4 ± 0.1 GtC yr-1, SOCEAN was 2.6 ± 0.5 GtC yr-1, and SLAND was 3.0 ± 0.8 GtC yr-1. For the year 2014 alone, EFF grew to 9.8 ± 0.5 GtC yr-1, 0.6 % above 2013, continuing the growth trend in these emissions, albeit at a slower rate compared to the average growth of 2.2 % yr-1 that took place during 2005-2014. Also, for 2014, ELUC was 1.1 ± 0.5 GtC yr-1, GATM was 3.9 ± 0.2 GtC yr-1, SOCEAN was 2.9 ± 0.5 GtC yr-1, and SLAND was 4.1 ± 0.9 GtC yr-1. GATM was lower in 2014 compared to the past decade (2005-2014), reflecting a larger SLAND for that year. The global atmospheric CO2 concentration reached 397.15 ± 0.10 ppm averaged over 2014. For 2015, preliminary data indicate that the growth in EFF will be near or slightly below zero, with a projection of -0.6 [range of -1.6 to +0.5] %, based on national emissions projections for China and the USA, and projections of gross domestic product corrected for recent changes in the carbon intensity of the global economy for the rest of the world. From this projection of EFF and assumed constant ELUC for 2015, cumulative emissions of CO2 will reach about 555 ± 55 GtC (2035 ± 205 GtCO2) for 1870-2015, about 75 % from EFF and 25 % from ELUC. This living data update documents changes in the methods and data sets used in this new carbon budget compared with previous publications of this data set (Le Quéré et al., 2015, 2014, 2013). All observations presented here can be downloaded from the Carbon Dioxide Information Analysis Center (doi:10.3334/CDIAC/GCP_2015).

  11. Global carbon budget 2014

    Science.gov (United States)

    Le Quéré, C.; Moriarty, R.; Andrew, R. M.; Peters, G. P.; Ciais, P.; Friedlingstein, P.; Jones, S. D.; Sitch, S.; Tans, P.; Arneth, A.; Boden, T. A.; Bopp, L.; Bozec, Y.; Canadell, J. G.; Chini, L. P.; Chevallier, F.; Cosca, C. E.; Harris, I.; Hoppema, M.; Houghton, R. A.; House, J. I.; Jain, A. K.; Johannessen, T.; Kato, E.; Keeling, R. F.; Kitidis, V.; Klein Goldewijk, K.; Koven, C.; Landa, C. S.; Landschützer, P.; Lenton, A.; Lima, I. D.; Marland, G.; Mathis, J. T.; Metzl, N.; Nojiri, Y.; Olsen, A.; Ono, T.; Peng, S.; Peters, W.; Pfeil, B.; Poulter, B.; Raupach, M. R.; Regnier, P.; Rödenbeck, C.; Saito, S.; Salisbury, J. E.; Schuster, U.; Schwinger, J.; Séférian, R.; Segschneider, J.; Steinhoff, T.; Stocker, B. D.; Sutton, A. J.; Takahashi, T.; Tilbrook, B.; van der Werf, G. R.; Viovy, N.; Wang, Y.-P.; Wanninkhof, R.; Wiltshire, A.; Zeng, N.

    2015-05-01

    component of the global carbon budget. For the last decade available (2004-2013), EFF was 8.9 ± 0.4 GtC yr-1, ELUC 0.9 ± 0.5 GtC yr-1, GATM 4.3 ± 0.1 GtC yr-1, SOCEAN 2.6 ± 0.5 GtC yr-1, and SLAND 2.9 ± 0.8 GtC yr-1. For year 2013 alone, EFF grew to 9.9 ± 0.5 GtC yr-1, 2.3% above 2012, continuing the growth trend in these emissions, ELUC was 0.9 ± 0.5 GtC yr-1, GATM was 5.4 ± 0.2 GtC yr-1, SOCEAN was 2.9 ± 0.5 GtC yr-1, and SLAND was 2.5 ± 0.9 GtC yr-1. GATM was high in 2013, reflecting a steady increase in EFF and smaller and opposite changes between SOCEAN and SLAND compared to the past decade (2004-2013). The global atmospheric CO2 concentration reached 395.31 ± 0.10 ppm averaged over 2013. We estimate that EFF will increase by 2.5% (1.3-3.5%) to 10.1 ± 0.6 GtC in 2014 (37.0 ± 2.2 GtCO2 yr-1), 65% above emissions in 1990, based on projections of world gross domestic product and recent changes in the carbon intensity of the global economy. From this projection of EFF and assumed constant ELUC for 2014, cumulative emissions of CO2 will reach about 545 ± 55 GtC (2000 ± 200 GtCO2) for 1870-2014, about 75% from EFF and 25% from ELUC. This paper documents changes in the methods and data sets used in this new carbon budget compared with previous publications of this living data set (Le Quéré et al., 2013, 2014). All observations presented here can be downloaded from the Carbon Dioxide Information Analysis Center (doi:10.3334/CDIAC/GCP_2014).

  12. Two-Dimensional Crystallization of P22 Virus-Like Particles.

    Science.gov (United States)

    Yoshimura, Hideyuki; Edwards, Ethan; Uchida, Masaki; McCoy, Kimberly; Roychoudhury, Raj; Schwarz, Benjamin; Patterson, Dustin; Douglas, Trevor

    2016-07-01

    Virus-like particles (VLPs) are well established platforms for constructing functional biomimetic materials. The VLP from the bacteriophage P22 can be used as a nanocontainer to sequester active enzymes, at high concentration, within its cavity through a process of directed self-assembly. Construction of ordered 2D assemblies of these catalytic VLPs can be envisioned as a functional membrane. To achieve this, it is important to establish methods to fabricate densely packed monolayers of VLPs. Highly ordered assemblies of P22 can also be utilized as a two-dimensional (2D) crystal for electron crystallography to get precise structural information on the VLP. Here we report 2D crystallization of different P22 morphologies: P22 procapsid (PC), enzyme encapsulated PC (β-glycosidase and enhanced green fluorescent protein), empty shell (PC without scaffold proteins, ES), the expanded form of P22 (EX), and enzyme encapsulated EX (NADH oxidase). The 2D crystals of P22 VLPs were formed on a positively charged lipid monolayer at the water-air interface with a subphase containing 1% trehalose. A P22 solution, injected underneath the lipid monolayer, floated to the surface because of the density difference between the subphase and protein solution. The lipid monolayer, with adsorbed P22, was transferred to a holey carbon grid and was examined by electron microscopy. 2D crystals were obtained from a subphase containing 100 mM NaCl, 10 mM MES (pH 5.0), and 1% trehalose. The diffraction spots from the transferred film extended to the sixth order in negatively stained samples and the 10th order in cryo-electron microscopy samples. PMID:27125277

  13. Evolution of white dwarf stars with high-metallicity progenitors: the role of 22Ne diffusion

    CERN Document Server

    Althaus, Leandro G; Renedo, Isabel; Isern, Jordi; Córsico, Alejandro H; Rohrmann, Rene D

    2010-01-01

    Motivated by the strong discrepancy between the main sequence turn-off age and the white dwarf cooling age in the metal-rich open cluster NGC 6791, we compute a grid of white dwarf evolutionary sequences that incorporates for the first time the energy released by the processes of 22Ne sedimentation and of carbon/oxygen phase separation upon crystallization. The grid covers the mass range from 0.52 to 1.0 Msun, and it is appropriate for the study of white dwarfs in metal-rich clusters. The evolutionary calculations are based on a detailed and self-consistent treatment of the energy released from these two processes, as well as on the employment of realistic carbon/oxygen profiles, of relevance for an accurate evaluation of the energy released by carbon/oxygen phase separation. We find that 22Ne sedimentation strongly delays the cooling rate of white dwarfs stemming from progenitors with high metallicities at moderate luminosities, whilst carbon/oxygen phase separation adds considerable delays at low luminositi...

  14. Systematic structure of the neutron drip-line {sup 22}C nucleus

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, Atef [Fundamental and Applied Sciences Department, Universiti Teknologi Petronas, Bandar Seri Iskandar, 31750 Tronoh, Perak, Malaysia and Department of Physics, Al-Azhar University, 71524 Assiut (Egypt); Cheong, Lee Yen; Yahya, Noorhana [Fundamental and Applied Sciences Department, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Tammam, M. [Department of Physics, Al-Azhar University, 71524 Assiut (Egypt)

    2014-10-24

    In the present work we systematically discuss the nuclear structure of the the heaviest particle-bound carbon isotope, {sup 22}C. The ground state wave function of the carbon isotope is calculated using the {sup 20}C core plus two-valence neutron based on a phenomenological mean-field MF potential. We apply the deduced wave function to provide the nuclear matter density which is necessary in the calculations of the total reaction cross section. Calculations show that there is a reasonable good description of the experimental binding energy BE and root-mean square RMS radius. The exotic structure and configuration of the ground state carbon isotope is explained and a consistent explanation on the two-neutron halo (Borromean) nucleus is given.

  15. Carbon nanotube composite materials

    Energy Technology Data Exchange (ETDEWEB)

    O' Bryan, Gregory; Skinner, Jack L; Vance, Andrew; Yang, Elaine Lai; Zifer, Thomas

    2015-03-24

    A material consisting essentially of a vinyl thermoplastic polymer, un-functionalized carbon nanotubes and hydroxylated carbon nanotubes dissolved in a solvent. Un-functionalized carbon nanotube concentrations up to 30 wt % and hydroxylated carbon nanotube concentrations up to 40 wt % can be used with even small concentrations of each (less than 2 wt %) useful in producing enhanced conductivity properties of formed thin films.

  16. Mutagenicity of carbon nanomaterials

    DEFF Research Database (Denmark)

    Wallin, Håkan; Jacobsen, Nicklas Raun; White, Paul A;

    2011-01-01

    Carbon nanomaterials such carbon nanotubes, graphene and fullerenes are some the most promising nanomaterials. Although carbon nanomaterials have been reported to possess genotoxic potential, it is imperitive to analyse the data on the genotoxicity of carbon nanomaterials in vivo and in vitro...

  17. 27 CFR 22.22 - Alternate methods or procedures; and emergency variations from requirements.

    Science.gov (United States)

    2010-04-01

    ... OF TAX-FREE ALCOHOL Administrative Provisions Authorities § 22.22 Alternate methods or procedures... to the revenue; (iii) It is not contrary to law; and (iv) It will not cause an increase in cost to... are conditioned upon compliance with the conditions and limitations set forth in the approval....

  18. Electroanalysis with carbon paste electrodes

    CERN Document Server

    Svancara, Ivan; Walcarius, Alain; Vytras, Karel

    2011-01-01

    Introduction to Electrochemistry and Electroanalysis with Carbon Paste-Based ElectrodesHistorical Survey and GlossaryField in Publication Activities and LiteratureCarbon Pastes and Carbon Paste ElectrodesCarbon Paste as the Binary MixtureClassification of Carbon Pastes and Carbon Paste ElectrodesConstruction of Carbon Paste HoldersCarbon Paste as the Electrode MaterialPhysicochemical Properties of Carbon PastesElectrochemical Characteristics of Carbon PastesTesting of Unmodified CPEsIntera

  19. Mesoporous carbon materials

    Science.gov (United States)

    Dai, Sheng; Fulvio, Pasquale Fernando; Mayes, Richard T.; Wang, Xiqing; Sun, Xiao-Guang; Guo, Bingkun

    2014-09-09

    A conductive mesoporous carbon composite comprising conductive carbon nanoparticles contained within a mesoporous carbon matrix, wherein the conductive mesoporous carbon composite possesses at least a portion of mesopores having a pore size of at least 10 nm and up to 50 nm, and wherein the mesopores are either within the mesoporous carbon matrix, or are spacings delineated by surfaces of said conductive carbon nanoparticles when said conductive carbon nanoparticles are fused with each other, or both. Methods for producing the above-described composite, devices incorporating them (e.g., lithium batteries), and methods of using them, are also described.

  20. Pyrolyzed thin film carbon

    Science.gov (United States)

    Tai, Yu-Chong (Inventor); Liger, Matthieu (Inventor); Harder, Theodore (Inventor); Konishi, Satoshi (Inventor); Miserendino, Scott (Inventor)

    2010-01-01

    A method of making carbon thin films comprises depositing a catalyst on a substrate, depositing a hydrocarbon in contact with the catalyst and pyrolyzing the hydrocarbon. A method of controlling a carbon thin film density comprises etching a cavity into a substrate, depositing a hydrocarbon into the cavity, and pyrolyzing the hydrocarbon while in the cavity to form a carbon thin film. Controlling a carbon thin film density is achieved by changing the volume of the cavity. Methods of making carbon containing patterned structures are also provided. Carbon thin films and carbon containing patterned structures can be used in NEMS, MEMS, liquid chromatography, and sensor devices.

  1. 22 CFR 208.1010 - Suspending official.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspending official. 208.1010 Section 208.1010 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Definitions § 208.1010 Suspending official. (a) Suspending official means an agency official...

  2. 22 CFR 51.41 - Documentary evidence.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Documentary evidence. 51.41 Section 51.41 Foreign Relations DEPARTMENT OF STATE NATIONALITY AND PASSPORTS PASSPORTS Evidence of U.S. Citizenship or Nationality § 51.41 Documentary evidence. The applicant must provide documentary evidence that he or she is...

  3. 22 CFR 1502.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Introduction. 1502.1 Section 1502.1 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION AVAILABILITY OF RECORDS § 1502.1 Introduction. (a) It is the policy... Administration and Finance (A&F) shall be responsible for the Foundation's compliance with the...

  4. 22 CFR 133.605 - Award.

    Science.gov (United States)

    2010-04-01

    ... Governmentwide rule 22 CFR Part 135 that implements OMB Circular A-102 (for availability, see 5 CFR 1310.3) and... Relations DEPARTMENT OF STATE MISCELLANEOUS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL... or cooperative agreement, in the form of money or property in lieu of money. (2) A block grant or...

  5. 22 CFR 98.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... function. (c) Such other terms as are defined in 22 CFR 96.2 shall have the meaning given to them therein. ... Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES INTERCOUNTRY ADOPTION-CONVENTION RECORD... Children and Co-operation in Respect of Intercountry Adoption, done at The Hague on May 29, 1993....

  6. 22 CFR 35.34 - Evidence.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Evidence. 35.34 Section 35.34 Foreign Relations DEPARTMENT OF STATE CLAIMS AND STOLEN PROPERTY PROGRAM FRAUD CIVIL REMEDIES § 35.34 Evidence. (a) The ALJ shall determine the admissibility of evidence. (b) Except as provided herein, the ALJ shall not be...

  7. 22 CFR 18.16 - Evidence.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Evidence. 18.16 Section 18.16 Foreign Relations... Enforcement Proceedings § 18.16 Evidence. The rules of evidence prevailing in courts of law and equity are not controlling in hearings under this part. However, the hearing examiner shall exclude evidence which...

  8. 22 CFR 518.34 - Equipment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Equipment. 518.34 Section 518.34 Foreign... Property Standards § 518.34 Equipment. (a) Title to equipment acquired by a recipient with Federal funds... equipment acquired with Federal funds to provide services to non-Federal outside organizations for a...

  9. 22 CFR 135.32 - Equipment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Equipment. 135.32 Section 135.32 Foreign... Equipment. (a) Title. Subject to the obligations and conditions set forth in this section, title to equipment acquired under a grant or subgrant will vest upon acquisition in the grantee or...

  10. 22 CFR 142.45 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 142.45 Section 142.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 142.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall...

  11. 22 CFR 146.405 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 146.405 Section 146.405 Foreign... Activities Prohibited § 146.405 Housing. (a) Generally. A recipient shall not, on the basis of sex, apply... benefits related to housing, except as provided in this section (including housing provided only to...

  12. 22 CFR 217.45 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall...

  13. 48 CFR 22.402 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... repair of a public building or public work); (iii) Employees of railroads operating under collective... Construction 22.402 Applicability. (a) Contracts for construction work. (1) The requirements of this subpart... commercial supplier or materialman; (ii) Contracts requiring construction work that is so closely related...

  14. 22 CFR 171.6 - Archival records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Archival records. 171.6 Section 171.6 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC General Policy and Procedures § 171.6 Archival records. The Department ordinarily transfers records to...

  15. 22 CFR 226.43 - Competition.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Competition. 226.43 Section 226.43 Foreign... ORGANIZATIONS Post-award Requirements Procurement Standards § 226.43 Competition. All procurement transactions shall be conducted in a manner to provide, to the maximum extent practical, open and free...

  16. 22 CFR 145.43 - Competition.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Competition. 145.43 Section 145.43 Foreign... Competition. All procurement transactions shall be conducted in a manner to provide, to the maximum extent practical, open and free competition. The recipient shall be alert to organizational conflicts of...

  17. 22 CFR 518.43 - Competition.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Competition. 518.43 Section 518.43 Foreign... Procurement Standards § 518.43 Competition. All procurement transactions shall be conducted in a manner to provide, to the maximum extent practical, open and free competition. The recipient shall be alert...

  18. 22 CFR 309.16 - Review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Review. 309.16 Section 309.16 Foreign Relations PEACE CORPS DEBT COLLECTION Salary Offset § 309.16 Review. (a) Request for outside hearing. Except as... hearing or a review of the documentary evidence is requested. If an oral hearing is desired, the...

  19. 22 CFR 911.7 - Review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Review. 911.7 Section 911.7 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD IMPLEMENTATION DISPUTES § 911.7 Review. Resolution of disputes under this section shall not be subject to judicial review....

  20. 22 CFR 42.11 - Classification symbols.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification symbols. 42.11 Section 42.11... NATIONALITY ACT, AS AMENDED Classification and Foreign State Chargeability § 42.11 Classification symbols. A... visa symbol to show the classification of the alien. Immigrants Symbol Class Section of law...

  1. 22 CFR 9.8 - Classification challenges.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification challenges. 9.8 Section 9.8 Foreign Relations DEPARTMENT OF STATE GENERAL SECURITY INFORMATION REGULATIONS § 9.8 Classification... classification status is improper are expected and encouraged to challenge the classification status of...

  2. 22 CFR 41.12 - Classification symbols.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification symbols. 41.12 Section 41.12... AND NATIONALITY ACT, AS AMENDED Classification of Nonimmigrants § 41.12 Classification symbols. A visa... appropriate visa symbol to show the classification of the alien. The symbol shall be inserted in the...

  3. 22 CFR 9.4 - Original classification.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Original classification. 9.4 Section 9.4... classification. (a) Definition. Original classification is the initial determination that certain information... classification. (b) Classification levels. (1) Top Secret shall be applied to information the...

  4. 22 CFR 17.3 - Fault.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Fault. 17.3 Section 17.3 Foreign Relations DEPARTMENT OF STATE PERSONNEL OVERPAYMENTS FROM THE FOREIGN SERVICE RETIREMENT AND DISABILITY FUND UNDER THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM (FSRDS) AND THE FOREIGN SERVICE PENSION SYSTEM...

  5. 22 CFR 17.1 - General.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General. 17.1 Section 17.1 Foreign Relations DEPARTMENT OF STATE PERSONNEL OVERPAYMENTS FROM THE FOREIGN SERVICE RETIREMENT AND DISABILITY FUND UNDER THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM (FSRDS) AND THE FOREIGN SERVICE PENSION SYSTEM...

  6. 22 CFR 120.17 - Export.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Export. 120.17 Section 120.17 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.17 Export. (a) Export means: (1) Sending or taking a defense article out of the United States in any manner, except...

  7. 22 CFR 20.2 - Funding.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Funding. 20.2 Section 20.2 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.2 Funding. Benefits under this part are paid from the Fund maintained by the Secretary of the Treasury pursuant to section 802 of the...

  8. 22 CFR 120.9 - Defense service.

    Science.gov (United States)

    2010-04-01

    ... Defense service. (a) Defense service means: (1) The furnishing of assistance (including training) to foreign persons, whether in the United States or abroad in the design, development, engineering... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Defense service. 120.9 Section 120.9...

  9. 22 CFR 226.48 - Contract provisions.

    Science.gov (United States)

    2010-04-01

    ... authority as acceptable sureties pursuant to 31 CFR part 223, “Surety Companies Doing Business with the... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Contract provisions. 226.48 Section 226.48 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADMINISTRATION OF ASSISTANCE AWARDS TO U.S....

  10. 22 CFR 1002.7 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 1002.7 Section 1002.7 Foreign Relations INTER-AMERICAN FOUNDATION AVAILABILITY OF RECORDS § 1002.7 Fees. Except as otherwise specifically provided by the Foundation, a fee will be levied for all searches for, or copies of, records. These...

  11. 22 CFR 521.25 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 521.25 Section 521.25 Foreign Relations BROADCASTING BOARD OF GOVERNORS IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 521.25 Fees. The party requesting a subpoena shall pay the cost of the fee and mileage of any witness subpoenaed in the amounts...

  12. 22 CFR 1502.7 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 1502.7 Section 1502.7 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION AVAILABILITY OF RECORDS § 1502.7 Fees. (a) When charged. Fees shall be... information primarily benefits the general public. Fees shall also not be charged where they would amount,...

  13. 22 CFR 505.11 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 505.11 Section 505.11 Foreign Relations BROADCASTING BOARD OF GOVERNORS PRIVACY ACT REGULATION § 505.11 Fees. (a) The first copy of any Agency record about you will be provided free of charge. A fee of $0.15 per page will be charged for any...

  14. 22 CFR 1411.10 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 1411.10 Section 1411.10 Foreign Relations... AVAILABILITY OF OFFICIAL INFORMATION § 1411.10 Fees. Persons requesting records from the Board, the General Counsel or the Panel shall be subject to a charge of fees for the direct cost of document search...

  15. 22 CFR 707.23 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 707.23 Section 707.23 Foreign Relations... INFORMATION IN RECORDS OF THE CORPORATION Notification; Access to Records; Amendment; Fees § 707.23 Fees. The fees to be charged by the Corporation for making copies of any records provided to any individual...

  16. 22 CFR 303.13 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 303.13 Section 303.13 Foreign Relations PEACE CORPS PROCEDURES FOR DISCLOSURE OF INFORMATION UNDER THE FREEDOM OF INFORMATION ACT § 303.13 Fees... business, such as informational or recruiting brochures, no fees will be charged. (b) For each a...

  17. 22 CFR 308.18 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 308.18 Section 308.18 Foreign Relations PEACE CORPS IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 308.18 Fees. No fees shall be charged for search time or for any other time expended by the agency to produce a record. Copies of records may be...

  18. 22 CFR 1507.8 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Fees. 1507.8 Section 1507.8 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION § 1507.8 Fees. Fees to be charged... as true copies, attestation under the seal of the Foundation, etc.), the question of charging...

  19. 22 CFR 135.25 - Program income.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Program income. 135.25 Section 135.25 Foreign... income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees for services performed, from the use or rental of real or personal...

  20. 22 CFR 226.24 - Program income.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Program income. 226.24 Section 226.24 Foreign... ORGANIZATIONS Post-award Requirements Financial and Program Management § 226.24 Program income. (a) Recipients shall apply the standards set forth in this section to account for program income related to...

  1. 22 CFR 226.82 - Program income.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Program income. 226.82 Section 226.82 Foreign... ORGANIZATIONS Additional Provisions For Awards to Commercial Organizations § 226.82 Program income. The additional costs alternative described in § 226.24(b)(1) may not be applied to program income earned by...

  2. 22 CFR 229.510 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 229.510 Section 229.510 Foreign... in Education Programs or Activities Prohibited § 229.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and...

  3. 22 CFR 146.310 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 146.310 Section 146.310 Foreign... Recruitment Prohibited § 146.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 146.300 through 146.310 apply shall not discriminate on the basis of sex in the recruitment and...

  4. 22 CFR 229.310 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 229.310 Section 229.310 Foreign... and Recruitment Prohibited § 229.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 229.300 through 229.310 apply shall not discriminate on the basis of sex in the recruitment...

  5. 22 CFR 146.510 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 146.510 Section 146.510 Foreign... Education Programs or Activities Prohibited § 146.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of...

  6. 47 CFR 22.353 - Blanketing interference.

    Science.gov (United States)

    2010-10-01

    ... Operational and Technical Requirements Technical Requirements § 22.353 Blanketing interference. Licensees of...: ER17NO94.007 where d is the radial distance to the boundary, in kilometers p is the radial effective radiated power, in kilowatts The maximum effective radiated power in the pertinent direction,...

  7. 22 CFR 67.3 - Management.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Management. 67.3 Section 67.3 Foreign Relations....3 Management. (a) NED's operations and staff are managed by a President selected by the Board of... Office of the President provides policy direction and is responsible for day-to-day management of...

  8. 22 CFR 146.540 - Advertising.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Advertising. 146.540 Section 146.540 Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR... Education Programs or Activities Prohibited § 146.540 Advertising. A recipient shall not in any...

  9. 22 CFR 229.540 - Advertising.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Advertising. 229.540 Section 229.540 Foreign... in Education Programs or Activities Prohibited § 229.540 Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation, specification, or discrimination based...

  10. 22 CFR 120.13 - United States.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false United States. 120.13 Section 120.13 Foreign... United States. United States, when used in the geographical sense, includes the several states, the Commonwealth of Puerto Rico, the insular possessions of the United States, the District of Columbia,...

  11. 22 CFR 171.13 - Business information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Business information. 171.13 Section 171.13 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Freedom of Information Act Provisions § 171.13 Business information. (a) Business...

  12. 22 CFR 126.13 - Required information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Required information. 126.13 Section 126.13... PROVISIONS § 126.13 Required information. (a) All applications for licenses (DSP-5, DSP-61, DSP-73, and DSP... are multiple consignors, consignees or freight forwarders, and all the required information cannot...

  13. 22 CFR 61.9 - General information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General information. 61.9 Section 61.9 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES WORLD-WIDE FREE FLOW OF AUDIO-VISUAL MATERIALS § 61.9 General information. General information and application forms may be obtained by writing to...

  14. 22 CFR 96.31 - Corporate structure.

    Science.gov (United States)

    2010-04-01

    ... Approval Licensing and Corporate Governance § 96.31 Corporate structure. (a) The agency qualifies for... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Corporate structure. 96.31 Section 96.31 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES ACCREDITATION OF AGENCIES AND APPROVAL...

  15. 22 CFR 216.3 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procedures. 216.3 Section 216.3 Foreign..., before a final decision is made to provide A.I.D. funding for the action. (2) Threshold decision. (i) The... procurement or use, or both, of pesticides for research or limited field evaluation purposes by or under...

  16. 22 CFR 231.16 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 231.16 Section 231.16 Foreign... EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS § 231.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws...

  17. 22 CFR 204.43 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 204.43 Section 204.43 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS Administration § 204.43 Governing law. This Guaranty shall be governed by and construed in accordance with the laws...

  18. 22 CFR 221.43 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 221.43 Section 221.43 Foreign... Administration § 221.43 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States of America governing contracts and commercial transactions of the...

  19. 22 CFR 230.16 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 230.16 Section 230.16 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States...

  20. 22 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 215.2 Section 215.2 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF 1974 § 215.2... citizen of the United States or an alien lawfully admitted for permanent residence; (e) Maintain...

  1. 22 CFR 308.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 308.3 Section 308.3 Foreign Relations PEACE CORPS IMPLEMENTATION OF THE PRIVACY ACT OF 1974 § 308.3 Definitions. (a) Record means any... residence. (f) The term maintain includes the maintenance, collection, use or dissemination of any...

  2. 22 CFR 1507.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 1507.3 Section 1507.3 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION § 1507.3 Definitions. (a... permanent residence. (f) The term maintain includes the maintenance, collection, use or dissemination of...

  3. 22 CFR 1003.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 1003.2 Section 1003.2 Foreign Relations INTER-AMERICAN FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION IN IAF RECORDS § 1003.2... for permanent residence. (c) The term maintain includes maintain, collect, use, or disseminate....

  4. 22 CFR 62.29 - Government visitors.

    Science.gov (United States)

    2010-04-01

    ..., to be paid to the government visitor. (f) Issuance of Form DS-2019. The Form DS-2019 shall be issued... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Government visitors. 62.29 Section 62.29... Program Provisions § 62.29 Government visitors. (a) Purpose. The government visitor category is for...

  5. 22 CFR 210.650 - Grant.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grant. 210.650 Section 210.650 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE... authorized by a law of the United States, rather than to acquire property or services for the...

  6. 22 CFR 133.650 - Grant.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grant. 133.650 Section 133.650 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL... authorized by a law of the United States, rather than to acquire property or services for the...

  7. 9 CFR 145.22 - Participation.

    Science.gov (United States)

    2010-01-01

    ... LIVESTOCK IMPROVEMENT NATIONAL POULTRY IMPROVEMENT PLAN FOR BREEDING POULTRY Special Provisions for Multiplier Egg-Type Chicken Breeding Flocks and Products § 145.22 Participation. Participating flocks of multiplier egg type chickens, and the eggs and chicks produced from them, shall comply with the...

  8. 9 CFR 146.22 - Participation.

    Science.gov (United States)

    2010-01-01

    ... LIVESTOCK IMPROVEMENT NATIONAL POULTRY IMPROVEMENT PLAN FOR COMMERCIAL POULTRY Special Provisions for Commercial Table-Egg Layer Flocks § 146.22 Participation. (a) Participating commercial table-egg layer flocks... of subpart B of this part. (b) Commercial table-egg laying premises with fewer than 75,000 birds...

  9. 48 CFR 22.807 - Exemptions.

    Science.gov (United States)

    2010-10-01

    ... APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Equal Employment Opportunity 22.807 Exemptions. (a) Under..., however, discriminate among Indians on the basis of religion, sex, or tribal affiliation, and the use of... the Secretary of Labor, and applicable clauses in the contract. (5) Facilities not connected...

  10. 22 CFR 1502.10 - Judicial review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Judicial review. 1502.10 Section 1502.10 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION AVAILABILITY OF RECORDS § 1502.10 Judicial review. On complaint, the district court of the United States in the district in which the complainant resides, or has...

  11. 22 CFR 1507.9 - Judicial review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Judicial review. 1507.9 Section 1507.9 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION § 1507.9 Judicial review. Any person may file a complaint against the Foundation in the appropriate U.S. district court,...

  12. 22 CFR 1006.1015 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... covered under the Federal Acquisition Regulation (48 CFR chapter 1) for a temporary period, pending... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Suspension. 1006.1015 Section 1006.1015 Foreign Relations INTER-AMERICAN FOUNDATION GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT)...

  13. 22 CFR 312.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... Regulation for procurement contracts (48 CFR part 9, subpart 9.4) and the common rule, Government-wide... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Suspension. 312.670 Section 312.670 Foreign... § 312.670 Suspension. Suspension means an action taken by a Federal agency that immediately prohibits...

  14. 22 CFR 210.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ..., in accordance with the Federal Acquisition Regulation for procurement contracts (48 CFR part 9... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension. 210.670 Section 210.670 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.670 Suspension. Suspension means an action taken by a Federal...

  15. 22 CFR 1008.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... Acquisition Regulation for procurement contracts (48 CFR part 9, subpart 9.4) and the common rule, Government... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Suspension. 1008.670 Section 1008.670 Foreign... ASSISTANCE) Definitions § 1008.670 Suspension. Suspension means an action taken by a Federal agency...

  16. 22 CFR 1508.1015 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... transactions covered under the Federal Acquisition Regulation (48 CFR chapter 1) for a temporary period... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Suspension. 1508.1015 Section 1508.1015 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION GOVERNMENTWIDE DEBARMENT AND SUSPENSION...

  17. 22 CFR 127.8 - Interim suspension.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Interim suspension. 127.8 Section 127.8 Foreign... Interim suspension. (a) The Managing Director of the Directorate of Defense Trade Controls or the Director of the Office of Defense Trade Controls Compliance is authorized to order the interim suspension...

  18. 22 CFR 133.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... Acquisition Regulation for procurement contracts (48 CFR part 9, subpart 9.4) and the common rule, Government... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension. 133.670 Section 133.670 Foreign... ASSISTANCE) Definitions § 133.670 Suspension. Suspension means an action taken by a Federal agency...

  19. 22 CFR 208.1015 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... transactions covered under the Federal Acquisition Regulation (48 CFR chapter 1) for a temporary period... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension. 208.1015 Section 208.1015 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION...

  20. 22 CFR 34.20 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... Suspension. The suspension of collection action shall be made in accordance with the standards set forth in the FCCS, 31 CFR 903.1-903.2 ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension. 34.20 Section 34.20...

  1. 22 CFR 1509.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... Acquisition Regulation for procurement contracts (48 CFR part 9, subpart 9.4) and the common rule, Government... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Suspension. 1509.670 Section 1509.670 Foreign... ASSISTANCE) Definitions § 1509.670 Suspension. Suspension means an action taken by a Federal agency...

  2. 22 CFR 41.71 - Transit aliens.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Transit aliens. 41.71 Section 41.71 Foreign... NATIONALITY ACT, AS AMENDED Transit Aliens § 41.71 Transit aliens. (a) Transit aliens—general. An alien is classifiable as a nonimmigrant transit alien under INA 101(a) (15) (C) if the consular officer is...

  3. 22 CFR 228.34 - Joint ventures.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Joint ventures. 228.34 Section 228.34 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR COMMODITIES AND... Financing § 228.34 Joint ventures. A joint venture or unincorporated association is eligible only if each...

  4. 22 CFR 518.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Financial reporting. 518.52 Section 518.52... Requirements Reports and Records § 518.52 Financial reporting. (a) The following forms or such other forms as... awarding agency requires accrual information and the recipient's accounting records are not normally...

  5. 19 CFR 177.22 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) ADMINISTRATIVE RULINGS Government Procurement; Country-of-Origin Determinations § 177.22 Definitions. (a) Country of origin. For the purpose of this subpart, an article is a product of a country or... or principal of law relating to the country of origin, without applying it to a particular set...

  6. 22 CFR 228.40 - Local procurement.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Local procurement. 228.40 Section 228.40... COMMODITIES AND SERVICES FINANCED BY USAID Conditions Governing Source and Nationality of Local Procurement Transactions for USAID Financing § 228.40 Local procurement. Local procurement in the cooperating...

  7. 22 CFR 145.46 - Procurement records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procurement records. 145.46 Section 145.46... EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Procurement Standards § 145.46 Procurement records. Procurement records and files for purchases in excess of the small...

  8. 22 CFR 226.46 - Procurement records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procurement records. 226.46 Section 226.46...-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Procurement Standards § 226.46 Procurement records. Procurement records and files for purchases in excess of the small purchase threshold shall include...

  9. 22 CFR 204.41 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 204.41 Section 204.41 Foreign... § 204.41 Arbitration. Any controversy or claim between A.I.D. and the Lender or any Assignee arising out of this Guaranty shall be settled by arbitration to be held in Washington, DC in accordance with...

  10. 22 CFR 221.41 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 221.41 Section 221.41 Foreign... Administration § 221.41 Arbitration. Any controversy or claim between A.I.D. and any noteholder arising out of this Guarantee shall be settled by arbitration to be held in Washington, DC in accordance with the...

  11. 22 CFR 230.14 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 230.14 Section 230.14 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.14 Arbitration. Any... arbitration to be held in Washington, DC in accordance with the then prevailing rules of the...

  12. 22 CFR 231.14 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 231.14 Section 231.14 Foreign... § 231.14 Arbitration. Any controversy or claim between USAID and any noteholder arising out of this Guarantee shall be settled by arbitration to be held in Washington, DC in accordance with the...

  13. 22 CFR 207.01 - Policy.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Policy. 207.01 Section 207.01 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT INDEMNIFICATION OF EMPLOYEES § 207.01 Policy. (a) A.I.D. may... employees) for any verdict, judgment or other monetary award which is rendered against any such...

  14. 22 CFR 21.1 - Policy.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Policy. 21.1 Section 21.1 Foreign Relations DEPARTMENT OF STATE PERSONNEL INDEMNIFICATION OF EMPLOYEES § 21.1 Policy. (a) The Department of State may indemnify an employee for any verdict, judgment, or other monetary award which is rendered against...

  15. 22 CFR 95.3 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procedures. 95.3 Section 95.3 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES IMPLEMENTATION OF TORTURE CONVENTION IN EXTRADITION CASES § 95... torture are made or the issue is otherwise brought to the Department's attention, appropriate policy...

  16. 22 CFR 1008.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Individual. 1008.655 Section 1008.655 Foreign Relations INTER-AMERICAN FOUNDATION GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1008.655 Individual. Individual means a natural person....

  17. 22 CFR 312.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Individual. 312.655 Section 312.655 Foreign Relations PEACE CORPS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 312.655 Individual. Individual means a natural person....

  18. 22 CFR 1509.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Individual. 1509.655 Section 1509.655 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1509.655 Individual. Individual means a natural person....

  19. 22 CFR 133.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Individual. 133.655 Section 133.655 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 133.655 Individual. Individual means a natural person....

  20. 22 CFR 210.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Individual. 210.655 Section 210.655 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 210.655 Individual. Individual means a natural person....

  1. 22 CFR 40.65 - Smugglers.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Smugglers. 40.65 Section 40.65 Foreign Relations DEPARTMENT OF STATE VISAS REGULATIONS PERTAINING TO BOTH NONIMMIGRANTS AND IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Illegal Entrants and Immigration Violators § 40.65 Smugglers....

  2. 22 CFR 40.64 - Stowaways.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Stowaways. 40.64 Section 40.64 Foreign Relations DEPARTMENT OF STATE VISAS REGULATIONS PERTAINING TO BOTH NONIMMIGRANTS AND IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Illegal Entrants and Immigration Violators § 40.64 Stowaways....

  3. 22 CFR 40.69 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false 40.69 Section 40.69 Foreign Relations DEPARTMENT OF STATE VISAS REGULATIONS PERTAINING TO BOTH NONIMMIGRANTS AND IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Illegal Entrants and Immigration Violators § 40.69...

  4. 22 CFR 8.12 - Financial records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial records. 8.12 Section 8.12 Foreign Relations DEPARTMENT OF STATE GENERAL ADVISORY COMMITTEE MANAGEMENT § 8.12 Financial records. Accurate records will be kept by the responsible committee office of all operating and salary costs of a...

  5. 22 CFR 226.31 - Insurance coverage.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Insurance coverage. 226.31 Section 226.31...-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Property Standards § 226.31 Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for real property and equipment...

  6. 22 CFR 518.31 - Insurance coverage.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Insurance coverage. 518.31 Section 518.31... Requirements Property Standards § 518.31 Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for real property and equipment acquired with Federal funds as provided...

  7. 22 CFR 145.31 - Insurance coverage.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Insurance coverage. 145.31 Section 145.31 Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER... Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for...

  8. 22 CFR 62.14 - Insurance.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Insurance. 62.14 Section 62.14 Foreign... § 62.14 Insurance. (a) Sponsors shall require each exchange visitor to have insurance in effect which... amount of $10,000; and (4) A deductible not to exceed $500 per accident or illness. (b) An...

  9. 22 CFR 512.28 - Assessment.

    Science.gov (United States)

    2010-04-01

    ... the Federal Claims Collection Standards (4 CFR part 103) relating to the compromise of claims or if... be suspended under § 104.2(c)(1) of the Federal Claims Collection Standards (4 CFR part 104). ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Assessment. 512.28 Section 512.28...

  10. 22 CFR 171.31 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 171.31 Section 171.31 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Privacy Act Provisions § 171.31 Definitions. As used in this subpart, the following definitions...

  11. 22 CFR 62.73 - Academic training.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Academic training. 62.73 Section 62.73 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES EXCHANGE VISITOR PROGRAM Student and Exchange Visitor Information System (SEVIS) § 62.73 Academic training. (a) Students meeting the definition...

  12. 22 CFR 63.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 63.1 Section 63.1 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES PAYMENTS TO AND ON BEHALF OF PARTICIPANTS IN THE INTERNATIONAL EDUCATIONAL AND CULTURAL EXCHANGE PROGRAM § 63.1 Definitions. For the purpose...

  13. 22 CFR 231.02 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 231.02 Section 231.02 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...

  14. 22 CFR 92.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 92.1 Section 92.1 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES NOTARIAL AND RELATED SERVICES Introduction § 92.1 Definitions. (a) In the United States the term notary or notary public means a public officer qualified...

  15. 22 CFR 61.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 61.2 Section 61.2 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES WORLD-WIDE FREE FLOW OF AUDIO-VISUAL MATERIALS § 61.2 Definitions. Department—means the Department of State. Applicant— means: (1) The United...

  16. 22 CFR 64.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 64.2 Section 64.2 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES PARTICIPATION BY FEDERAL EMPLOYEES IN CULTURAL EXCHANGE PROGRAMS OF FOREIGN COUNTRIES § 64.2 Definitions. For the purpose of this part: (a)...

  17. 22 CFR 46.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 46.1 Section 46.1 Foreign Relations DEPARTMENT OF STATE VISAS CONTROL OF ALIENS DEPARTING FROM THE UNITED STATES § 46.1 Definitions... public ferry, passenger vessel sailing coastwise on a fixed schedule, excursion vessel, or...

  18. 22 CFR 171.20 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 171.20 Section 171.20 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Executive Order 12958 Provisions § 171.20 Definitions. As used in this subpart, the following...

  19. 22 CFR 120.11 - Public domain.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public domain. 120.11 Section 120.11 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.11 Public domain. (a) Public domain means information which is published and which is generally...

  20. 22 CFR 62.74 - Student employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Student employment. 62.74 Section 62.74 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES EXCHANGE VISITOR PROGRAM Student and Exchange Visitor Information System (SEVIS) § 62.74 Student employment. (a) Students meeting the definition...

  1. 22 CFR 1203.735-101 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Purpose. 1203.735-101 Section 1203.735-101 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND... maintenance of these standards. To accord with these concepts the regulations in this part prescribe...

  2. 22 CFR 401.10 - General rule.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true General rule. 401.10 Section 401.10 Foreign Relations INTERNATIONAL JOINT COMMISSION, UNITED STATES AND CANADA RULES OF PROCEDURE General § 401.10... to carry out the true intent and meaning of the Treaty....

  3. 22 CFR 901.11 - Agency.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Agency. 901.11 Section 901.11 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD GENERAL Meanings of Terms As Used in This Chapter § 901.11 Agency. Agency means the Department of State, the Agency for International Development, the U.S. Information...

  4. 22 CFR 1500.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...: Board or Board of Directors means the collegial body that conducts the business of the African Development Foundation as specified in title V, section 507 of the International Security and Development Cooperation Act of 1980, Pub. L. 96-533 (22 U.S.C. 290 h-5). Meeting means the deliberations of a quorum...

  5. 45 CFR 2543.22 - Payment.

    Science.gov (United States)

    2010-10-01

    ... AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management § 2543.22 Payment. (a) Payment methods shall minimize the time... and disbursement by the recipient, and (2) Financial management systems that meet the standards...

  6. 40 CFR 30.22 - Payment.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management § 30.22 Payment. (a... time elapsing between the transfer of funds and disbursement by the recipient; and financial...

  7. 45 CFR 74.22 - Payment.

    Science.gov (United States)

    2010-10-01

    ... AND SUBAWARDS TO INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, OTHER NONPROFIT ORGANIZATIONS, AND COMMERCIAL ORGANIZATIONS Post-Award Requirements Financial and Program Management § 74.22 Payment. (a) Unless... transfer of funds and disbursement by the recipient; and (ii) Financial management systems that meet...

  8. 20 CFR 435.22 - Payment.

    Science.gov (United States)

    2010-04-01

    ... INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, OTHER NON-PROFIT ORGANIZATIONS, AND COMMERCIAL ORGANIZATIONS Post-Award Requirements Financial and Program Management § 435.22 Payment. (a) Introduction. Payment methods..., and (ii) Financial management systems that meet the standards for fund control and accountability...

  9. 22 CFR 145.24 - Program income.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Program income. 145.24 Section 145.24 Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management §...

  10. 28 CFR 70.22 - Payment.

    Science.gov (United States)

    2010-07-01

    ... (INCLUDING SUBAWARDS) WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management § 70.22 Payment. (a) Payment methods must... transfer of funds and disbursement by the recipient, and financial management systems that meet...

  11. 38 CFR 49.22 - Payment.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Financial and Program Management § 49.22 Payment. (a... elapsing between the transfer of funds and disbursement by the recipient, and financial management...

  12. 15 CFR 14.22 - Payment.

    Science.gov (United States)

    2010-01-01

    ... AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, OTHER NON-PROFIT, AND COMMERCIAL ORGANIZATIONS Post-Award Requirements Financial and Program Management § 14.22 Payment. (a) Payment methods... transfer of funds and disbursement by the recipient, and financial management systems that meet...

  13. 22 CFR 135.34 - Copyrights.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Copyrights. 135.34 Section 135.34 Foreign... Copyrights. The Federal awarding agency reserves a royalty-free, nonexclusive, and irrevocable license to...) The copyright in any work developed under a grant, subgrant, or contract under a grant or...

  14. 22 CFR 226.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial reporting. 226.52 Section 226.52...-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Reports and Records § 226.52 Financial reporting. USAID requires recipients to use the Standard Form 425 or Standard Form 425a, Federal Financial Report, or...

  15. 22 CFR 145.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial reporting. 145.52 Section 145.52....52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are..., in obtaining this information, shall comply with report clearance requirements of 5 CFR part 1320....

  16. 22 CFR 135.41 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial reporting. 135.41 Section 135.41... Enforcement § 135.41 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of...) Submitting financial reports to Federal agencies, or (ii) Requesting advances or reimbursements when...

  17. 22 CFR 228.55 - Delivery services.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR... that delaying shipment would increase costs or significantly delay receipt of the cargo; (4) Eligible... waiver. Other free world air carriers may be used only as provided in § 228.22....

  18. 28 CFR 68.22 - Depositions.

    Science.gov (United States)

    2010-07-01

    ... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR IMMIGRATION-RELATED EMPLOYMENT PRACTICES, AND DOCUMENT FRAUD § 68.22 Depositions. (a) Notice. Any party... taken elsewhere, unless otherwise permitted by the Administrative Law Judge or agreed to by the...

  19. 22 CFR 143.11 - Standards.

    Science.gov (United States)

    2010-04-01

    ... out in part 90 (primarily subpart B) of 45 CFR. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 143.11 Section 143.11 Foreign... RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination § 143.11 Standards....

  20. 22 CFR 218.11 - Standards.

    Science.gov (United States)

    2010-04-01

    ... prohibited are set out in part 90 (primarily subpart B) of 45 CFR. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 218.11 Section 218.11 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination §...

  1. 22 CFR 908.2 - Attorney fees.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Attorney fees. 908.2 Section 908.2 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD REMEDIES § 908.2 Attorney fees. (a) If the Board finds that a... authority to direct the Agency to pay reasonable attorney fees to the same extent and in the same manner...

  2. 22 CFR 96.30 - State licensing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State licensing. 96.30 Section 96.30 Foreign... Licensing and Corporate Governance § 96.30 State licensing. (a) The agency or person is properly licensed or... person follows applicable State licensing and regulatory requirements in all jurisdictions in which...

  3. 22 CFR 707.31 - Public information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Public information. 707.31 Section 707.31 Foreign Relations OVERSEAS PRIVATE INVESTMENT CORPORATION ADMINISTRATIVE PROVISIONS ACCESS TO AND SAFEGUARDING OF PERSONAL INFORMATION IN RECORDS OF THE CORPORATION Exceptions § 707.31 Public...

  4. 22 CFR 212.21 - Public records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public records. 212.21 Section 212.21 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Availability of Information for Public Inspection and Copying § 212.21 Public records. In accordance with this subpart, USAID makes the...

  5. 22 CFR 216.8 - Public hearings.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public hearings. 216.8 Section 216.8 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.8 Public hearings. (a) In most instances AID will be able to gain the benefit of public participation in the impact statement...

  6. 22 CFR 214.34 - Public participation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public participation. 214.34 Section 214.34... Committees § 214.34 Public participation. (a) Each advisory committee meeting is to be open to the public except where: (1) The Director, OMB, has determined that public notice of a meeting would be...

  7. 22 CFR 8.14 - Public inquiries.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public inquiries. 8.14 Section 8.14 Foreign Relations DEPARTMENT OF STATE GENERAL ADVISORY COMMITTEE MANAGEMENT § 8.14 Public inquiries. Public inquiries concerning the implementation of the Federal Advisory Committee Act and the management of...

  8. 22 CFR 120.24 - Port Directors.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Port Directors. 120.24 Section 120.24 Foreign... Port Directors. Port Directors of U.S. Customs and Border Protection means the U.S. Customs and Border Protection Port Directors at the U.S. Customs and Border Protection Ports of Entry (other than the port...

  9. 22 CFR 228.21 - Ocean transportation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Ocean transportation. 228.21 Section 228.21... for USAID Financing § 228.21 Ocean transportation. (a) The Cargo Preference Act of 1954, Section 901(b... transportation services is determined by the flag registry of the vessel. (1) When the authorized source...

  10. 22 CFR 192.31 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.31 Section 192.31 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF VICTIMS OF TERRORISM COMPENSATION Medical Benefits for Captive Situations § 192.31 Applicable benefits. A person eligible for benefits under this...

  11. 22 CFR 20.5 - Survivor benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 20.5 Section 20.5 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.5 Survivor benefits. (a) Type of benefits. A former spouse who meets the eligibility requirements of § 20.3 is entitled...

  12. 22 CFR 229.525 - Fringe benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Fringe benefits. 229.525 Section 229.525... Employment in Education Programs or Activities Prohibited § 229.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical,...

  13. 22 CFR 146.525 - Fringe benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Fringe benefits. 146.525 Section 146.525... Employment in Education Programs or Activities Prohibited § 146.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical,...

  14. 22 CFR 20.4 - Retirement benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Retirement benefits. 20.4 Section 20.4 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.4 Retirement benefits. (a) Type of benefits. (1) A former spouse who meets the qualification requirements of § 20.3 is entitled...

  15. 22 CFR 192.21 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.21 Section 192.21... Soldiers' and Sailors' Civil Relief Act to Captive Situations § 192.21 Applicable benefits. (a) Eligible persons are entitled to the benefits provided by the Soldiers' and Sailors' Civil Relief Act of 1940 (50...

  16. 22 CFR 191.21 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.21 Section 191.21 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF HOSTAGE RELIEF ASSISTANCE Medical Benefits § 191.21 Applicable benefits. A person eligible for benefits under this part shall be eligible for authorized...

  17. 22 CFR 191.11 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.11 Section 191.11...' and Sailors' Civil Relief Act § 191.11 Applicable benefits. (a) Eligible persons are entitled to the benefits provided by the Soldiers' and Sailors' Civil Relief Act of 1940 (50 U.S.C. App. 501, et...

  18. 22 CFR 19.11 - Survivor benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 19.11 Section 19.11 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.11 Survivor benefits....

  19. 22 CFR 192.11 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.11 Section 192.11 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF VICTIMS OF TERRORISM COMPENSATION Payment of Salary and Other Benefits for Captive Situations § 192.11 Applicable benefits. (a) Captives are entitled...

  20. Event 22 February 2012: The Impact Agenda

    OpenAIRE

    Blog Admin, Impact of Social Sciences,

    2012-01-01

    The Impact Agenda – an ESRC-funded seminar series – will host speakers at Seminar 5: New Frontiers of Impact on Wednesday, 22nd February 2012 from 9.00am until 5.00pm at Manchester Business School West.

  1. Consumption of HCFC-22 Increases Steadily

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Chlorodifluoromethane (HCFC-22) is an important fluorine chemical product. It can be directly used as refrigerant in household air-conditioners and refrigerators and also as chemical raw material to produce fluorine-containing polymer monomer tetrafluoroethylene (TFE) to extend the fluorine chemical industrial chain.

  2. 22 CFR 224.34 - Evidence.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Evidence. 224.34 Section 224.34 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224... probative value is substantially outweighed by the danger of unfair prejudice, confusion of the issues,...

  3. 22 CFR 521.34 - Evidence.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Evidence. 521.34 Section 521.34 Foreign Relations BROADCASTING BOARD OF GOVERNORS IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 521.34... substantially outweighed by the danger of unfair prejudice, confusion of the issues, or by consideration...

  4. 22 CFR 142.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 142.3 Section 142.3 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 142.3 Definitions. As used in this... conditions as orthopedic, visual, speech, and hearing impairments, cerebral palsy, epilepsy,...

  5. 22 CFR 203.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... information may be accessed in the daily course of conducting business. (e) International Private Voluntary... Voluntary Organization (LPVO) means a non-U.S. based PVO that meets the definition of an International... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 203.2 Section 203.2...

  6. 22 CFR 216.6 - Environmental assessments.

    Science.gov (United States)

    2010-04-01

    ... avoided should the proposed action be implemented; the relationship between short-term uses of the... significance; possible conflicts between the proposed action and land use plans, policies and controls for the... shall be governed by 22 CFR part 9. Those portions of an Environmental Assessment which are...

  7. 22 CFR 146.515 - Compensation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compensation. 146.515 Section 146.515 Foreign... Education Programs or Activities Prohibited § 146.515 Compensation. A recipient shall not make or enforce... compensation; (b) Results in the payment of wages to employees of one sex at a rate less than that paid...

  8. 22 CFR 96.34 - Compensation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compensation. 96.34 Section 96.34 Foreign... Financial and Risk Management § 96.34 Compensation. (a) The agency or person does not compensate any... for compensation within the intercountry adoption community in that country, to the extent that...

  9. 22 CFR 229.515 - Compensation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compensation. 229.515 Section 229.515 Foreign... in Education Programs or Activities Prohibited § 229.515 Compensation. A recipient shall not make or... compensation; (b) Results in the payment of wages to employees of one sex at a rate less than that paid...

  10. 22 CFR 208.985 - Person.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Person. 208.985 Section 208.985 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Definitions § 208.985 Person. Person means any individual, corporation, partnership, association, unit...

  11. 27 CFR 10.22 - Employee associations.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS COMMERCIAL BRIBERY Commercial Bribery § 10.22 Employee associations. Gifts... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Employee associations. 10... employee associations are considered the same as bonuses, premiums, compensation, or other things of...

  12. 27 CFR 22.162 - Inventories.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Inventories. 22.162... Inventories. Each permittee shall take a physical inventory of the tax-free and recovered alcohol in its possession semi-annually for the periods ending June 30 and December 31 of each year; or other...

  13. 22 CFR 901.14 - Service.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Service. 901.14 Section 901.14 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD GENERAL Meanings of Terms As Used in This Chapter § 901.14 Service. Service means the Foreign Service of the United States....

  14. Reference: ABRE2HVA22 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABRE2HVA22 Shen Q, Ho TH Functional dissection of an abscisic acid(ABA)-inducible gene re...veals two independent ABA-responsive complexes each containing a G-box and a novel cis-acting element. Plant Cell 7:295-307 (1995) PubMed: 7734964; ...

  15. 22 CFR 228.51 - Commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Commodities. 228.51 Section 228.51 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR COMMODITIES AND SERVICES FINANCED BY USAID Waivers § 228.51 Commodities. (a) Waiver criteria. Any waiver must be based...

  16. 22 CFR 1300.2 - Organization.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Organization. 1300.2 Section 1300.2 Foreign Relations MILLENNIUM CHALLENGE CORPORATION ORGANIZATION AND FUNCTIONS OF THE MILLENNIUM CHALLENGE CORPORATION § 1300.2 Organization. (a) MCC's Board consists of: (1) The Secretary of State, the Secretary...

  17. 22 CFR 135.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 135.3 Section 135.3 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE...) school district, special district, intrastate district, council of governments (whether or...

  18. 22 CFR 218.33 - Mediation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mediation. 218.33 Section 218.33 Foreign... § 218.33 Mediation. (a) Referral of complaints for mediation. The agency will refer to the Federal Mediation and Conciliation Service all complaints that: (1) fall within the jurisdiction of...

  19. 22 CFR 143.33 - Mediation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mediation. 143.33 Section 143.33 Foreign... Mediation. (a) Referral of complaints for mediation. The agency will refer to the Federal Mediation and... participate in the mediation process to the extent necessary to reach an agreement or make an...

  20. 22 CFR 1508.920 - Civil judgment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Civil judgment. 1508.920 Section 1508.920...) Definitions § 1508.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability...

  1. 22 CFR 208.920 - Civil judgment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil judgment. 208.920 Section 208.920 Foreign...) Definitions § 208.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability...

  2. 22 CFR 1006.920 - Civil judgment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Civil judgment. 1006.920 Section 1006.920...) Definitions § 1006.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability...

  3. A note on Lysias 1.22

    OpenAIRE

    Edwards, Michael J.

    2005-01-01

    Solución de la notoria crux de Lys. 1.22, donde la mayoría de editores desde Reiske ha propuesto la existencia de una laguna. Propongo que la lectura preservada μεγλοις es una corrupción del original μν λλοις.

  4. 22 CFR 144.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 144.160 Section 144.160 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE UNITED STATES DEPARTMENT OF STATE § 144.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants,...

  5. 22 CFR 1600.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 1600.160 Section 1600.160 Foreign Relations JAPAN-UNITED STATES FRIENDSHIP COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... § 1600.160 Communications. (a) The agency shall take appropriate steps to ensure effective...

  6. 22 CFR 219.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign... DEVELOPMENT § 219.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants, participants, personnel of other Federal entities, and members of the public....

  7. 22 CFR 1005.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 1005.160 Section 1005.160... PROGRAMS OR ACTIVITIES CONDUCTED BY THE INTER-AMERICAN FOUNDATION § 1005.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants, participants,...

  8. 22 CFR 530.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 530.160 Section 530.160 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.160 Communications. (a) The Board shall take appropriate steps to ensure effective communication with applicants,...

  9. 22 CFR 1510.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 1510.160 Section 1510.160... IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE AFRICAN DEVELOPMENT FOUNDATION § 1510.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with...

  10. 22 CFR 1103.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 1103.160 Section 1103.160 Foreign Relations INTERNATIONAL BOUNDARY AND WATER COMMISSION, UNITED STATES AND MEXICO, UNITED STATES... Communications. (a) The agency shall take appropriate steps to ensure effective communication with...

  11. 22 CFR 1701.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 1701.160 Section 1701.160 Foreign Relations UNITED STATES INSTITUTE OF PEACE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF... Communications. (a) The agency shall take appropriate steps to ensure effective communication with...

  12. 22 CFR 711.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Communications. 711.160 Section 711.160 Foreign... CORPORATION § 711.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants, participants, personnel of other Federal entities, and members of the public....

  13. 22 CFR 135.21 - Payment.

    Science.gov (United States)

    2010-04-01

    ... CFR part 205. (c) Advances. Grantees and subgrantees shall be paid in advance, provided they maintain... reimburse the grantee for its actual cash disbursements. The working capital advance method of payment shall... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment. 135.21 Section 135.21...

  14. 32 CFR 32.22 - Payment.

    Science.gov (United States)

    2010-07-01

    ... ORGANIZATIONS Post-Award Requirements Financial and Program Management § 32.22 Payment. (a) Payment methods... issuance or redemption of checks, warrants, or payment by other means by the recipients. Payment methods of... CFR part 206), interest should be remitted to the HHS Payment Management System through an...

  15. 22 CFR 225.114 - Cooperative research.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Cooperative research. 225.114 Section 225.114... research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects, each institution is responsible...

  16. 22 CFR 8.7 - Security.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Security. 8.7 Section 8.7 Foreign Relations DEPARTMENT OF STATE GENERAL ADVISORY COMMITTEE MANAGEMENT § 8.7 Security. (a) All officers and members of a committee must have a security clearance for the subject matter level of security at which the...

  17. 22 CFR 120.4 - Commodity jurisdiction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Commodity jurisdiction. 120.4 Section 120.4 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS... and media. The fit of the item is its ability to physically interface or interconnect with or...

  18. 22 CFR 35.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 35.2 Section 35.2 Foreign Relations DEPARTMENT OF STATE CLAIMS AND STOLEN PROPERTY PROGRAM FRAUD CIVIL REMEDIES § 35.2 Definitions. (a) ALJ means an Administrative Law Judge in the authority appointed pursuant to 5 U.S.C. 3105 or...

  19. 22 CFR 209.6 - Compliance information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 209.6 Section 209.6... § 209.6 Compliance information. (a) Cooperation and assistance. The Administrator shall to the fullest... and accurate compliance reports at such times, and in such form and containing such information,...

  20. Expression of human PTPN22 alleles

    DEFF Research Database (Denmark)

    Nielsen, C; Barington, T; Husby, S;

    2007-01-01

    Considering the female predominance in most of the autoimmune disorders that associate with the PTPN22 Trp620 variant and the complexity by which this variant influences immunologic tolerance, the objective of this study was to ascertain if the allele-specific expression of the disease-associated...... variant Udgivelsesdato: 2007-Mar...

  1. 22 CFR 33.8 - Claim procedures.

    Science.gov (United States)

    2010-04-01

    ... must be supported by documentary evidence. Foreign language documents must be accompanied by an... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Claim procedures. 33.8 Section 33.8 Foreign..., including: (i) The date and cost of acquisition supported by invoices or other acceptable proof of...

  2. 22 CFR 228.32 - Nonprofit organizations.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Nonprofit organizations. 228.32 Section 228.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR... USAID Financing § 228.32 Nonprofit organizations. (a) Nonprofit organizations, such as...

  3. 22 CFR 1503.2 - Description.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Description. 1503.2 Section 1503.2 Foreign Relations AFRICAN DEVELOPMENT FOUNDATION OFFICIAL SEAL § 1503.2 Description. The official seal of the African Development Foundation is described as follows: (a) Forming an outer circle is a ring of type...

  4. 22 CFR 521.21 - Discovery.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Discovery. 521.21 Section 521.21 Foreign Relations BROADCASTING BOARD OF GOVERNORS IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 521.21 Discovery. (a) The following types of discovery are authorized: (1) Requests for production of documents...

  5. 15 CFR 996.22 - Certification.

    Science.gov (United States)

    2010-01-01

    ... products; and conveys no automatic, direct or indirect NOAA endorsement of any product or service. (c... NOAA HYDROGRAPHIC PRODUCTS AND SERVICES Certification of a Hydrographic Product and Decertification. § 996.22 Certification. (a) A hydrographic product that has passed the compliance tests...

  6. 22 CFR 142.17 - New construction.

    Science.gov (United States)

    2010-04-01

    ... Uniform Federal Accessibility Standards (USAF) (appendix A to 41 CFR subpart 101-19.6) shall be deemed to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 142.17 Section 142.17 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 142.17 New construction. (a) Design...

  7. 22 CFR 217.23 - New construction.

    Science.gov (United States)

    2010-04-01

    ... Uniform Federal Accessibility Standards (USAF) (appendix A to 41 CFR subpart 101-19.6) shall be deemed to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design...

  8. 22 CFR 120.14 - Person.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Person. 120.14 Section 120.14 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.14 Person. Person means a natural person as well as a corporation, business association, partnership, society, trust,...

  9. Carbon and oxygen isotopic composition of the carbonates from the Jacupiranga and Catalao I carbonatite complexes, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Morikiyo, Toshiro (Shinshu Univ., Matsumoto, Nagano (Japan). Faculty of Science); Hirano, Hideo; Matsuhisa, Yukihiro

    1990-11-01

    Carbon and oxygen isotope compositions were measured for carbonates from the Jacupiranga and Catalao I carbonatite complexes in Brazil. The {delta}{sup 13}C values of the Jacupiranga carbonates are uniform, ranging from -6.4 to -5.6 per mille with the average of -6.07 per mille. Except for one sample, the {delta}{sup 18}O values of the carbonates are between 7.1 and 8.1 per mille, and the average value is 7.6 per mille. The isotopic compositions of the Jacupiranga carbonates represent the value of primary igneous carbonatite. The {delta}{sup 13}C values of dolomites are about 0.5 per mille higher than those of calcites. The {delta}{sup 13}C values of carbonates from the Catalao I complex range from -6.8 to -5.2 per mille with the average of -5.83 per mille. Those values are similar to the values of the Jacupiranga carbonates. However, oxygen isotopic compositions of the Catalao I carbonates show a wide range of 8.4 to 22.3 per mille. Carbonates with the lowest {delta}{sup 18}O values in the complex are considered to represent the igneous stage. Carbonates with extremely high {delta}{sup 18}O values of about 22 per mille are considered to have precipitated from low-temperature hydrothermal fluids. The group of intermediate {delta}{sup 18}O values indicates a variable degree of contamination by the {delta}{sup 18}O-rich hydrothermal carbonates. The contribution of secondary stage hydrothermal carbonates seems to be significant in the Catalao I complex as compared with the Jacupiranga complex. The development of a network structure in the Catalao I complex may have enhanced the circulation of the later stage hydrothermal fluids. (author).

  10. Beyond temperature: Clumped isotope signatures in dissolved inorganic carbon species and the influence of solution chemistry on carbonate mineral composition

    OpenAIRE

    Tripati, Aradhna K.; Hill, Pamela S.; Eagle, Robert A.; Mosenfelder, Jed L.; Tang, Jianwu; Schauble, Edwin A.; Eiler, John M.; Zeebe, Richard E.; Uchikawa, Joji; Coplen, Tyler B.; Ries, Justin B; Henry, Drew

    2015-01-01

    “Clumped-isotope” thermometry is an emerging tool to probe the temperature history of surface and subsurface environments based on measurements of the proportion of ^(13)C and ^(18)O isotopes bound to each other within carbonate minerals in ^(13)C^(18)O^(16)O_2^(2−) groups (heavy isotope “clumps”). Although most clumped isotope geothermometry implicitly presumes carbonate crystals have attained lattice equilibrium (i.e., thermodynamic equilibrium for a mineral, which is independent of solutio...

  11. Rhodium(i)-catalysed skeletal reorganisation of benzofused spiro[3.3]heptanes via consecutive carbon-carbon bond cleavage.

    Science.gov (United States)

    Matsuda, Takanori; Yuihara, Itaru; Kondo, Kazuki

    2016-08-01

    Skeletal reorganisation of benzofused spiro[3.3]heptanes has been achieved using rhodium(i) catalysts. The reaction of benzofused 2-(2-pyridylmethylene)spiro[3.3]heptanes proceeds via sequential C-C bond oxidative addition and β-carbon elimination. On the other hand, benzofused spiro[3.3]heptan-2-ols undergo two consecutive β-carbon elimination processes. In both cases, substituted naphthalenes are obtained. PMID:27357097

  12. Environmental Green Chemistry Applications of Nanoporous Carbons

    Energy Technology Data Exchange (ETDEWEB)

    Matos, J.; Garcia, A; Poon, P

    2010-01-01

    Influence of surface properties of nanoporous carbons on activity and selectivity during the photooxidation of 4-chlorophenol on UV-irradiated TiO{sub 2} was performed. Characterization by infrared spectroscopy, X-ray photoelectronic spectroscopy and X-ray absorption near edge structure spectroscopy confirm the presence of a contact interface between both solids and suggest the coordination of some functional organic groups of the carbon surface, mainly ethers and carboxylic acids, to metallic centre Ti{sup +4} in TiO{sub 2}. Changes in surface pH of carbons from basic to neutral or acid remarkably increase the production of 4-chlorocathecol by a factor of 22 on TiO{sub 2}-Carbon in comparison of TiO{sub 2} alone. A scheme of interaction between TiO{sub 2} and carbon is proposed to the increased photoactivity of TiO{sub 2} and a reaction mechanism for the different intermediate products detected is also proposed. Results showed that TiO{sub 2}-Carbon can be used as an alternative photocatalyst for environmental green chemistry and selective organic synthesis applications.

  13. New binary R 22-alternative: SUVA 9100; Neue binaere R 22-Alternative: SUVA 9100

    Energy Technology Data Exchange (ETDEWEB)

    Gerstel, J. [Du-Pont de Nemours (Deutschland) GmbH, Bad Homburg v.d.H. (Germany); Zakrzewski, U. [Du-Pont de Nemours (Deutschland) GmbH, Bad Homburg v.d.H. (Germany)

    1995-07-01

    The environmental impact, the safety (e.g. non-flammability) and better efficiencies are the main criteria in development of new alternative refrigerants. R22 can not be replaced in all areas by one single new product. The four refrigerant SUVA 9100 (registered as R410B), R 134a, R 407 c and R 404A will have a major sole in the replacement of R22. (orig.) [Deutsch] R22 wird gegenwaertig in der Klimatisierung, der Gewerbe- und Transportkaelte, in Kaltwassersaetzen und in Waermepumpen eingesetzt. Als Ersatz fuer R22 fuer diese Anwendungen wurden HFKW`s untersucht. Bei den von Anlagenherstellern durchgefuehrten Untersuchungen entstanden unterschiedliche Anforderungen an die zukuenftige Alternative. Einige Hersteller benoetigen bereits jetzt einen Ersatzstoff. Andere erwarten ein Kaeltemittel, das in vorhandenen Anlagen eingesetzt werden kann. Eine weitere Gruppe moechte gern einen neuen Ersatzstoff mit hoeherer Kaelte- bzw. Waermeleistung und hoeherer Leistungszahl im Vergleich zu R22. Aufgrund der deutlich unterschiedlichen Anforderungen kann es nicht nur eine Ersatzloesung geben. Um dieser Markterwartung zu entsprechen, entwickelte DuPont eine Familie von R22-Alternativen. Die darin enthaltenen Produkte sind: SUVA 9100, SUVA 134a, SUVA 9000 und SUVA HP 62. Im folgenden werden die vier Ersatzkaeltemittel fuer R22 kurz vorgestellt. Danach wird dargelegt, wie die verschiedenen Zusammensetzungen fuer SUVA 9100 untersucht wurden (Leistungs- und Entflammbarkeitsmessungen) und welche Zusammensetzung letztendlich ausgewaehlt wurde. (orig.)

  14. Soil Carbon Sequestration in India

    International Nuclear Information System (INIS)

    With a large land area and diverse ecoregions, there is a considerable potential of terrestrial/soil carbon sequestration in India. Of the total land area of 329 million hectares (Mha), 297 Mha is the land area comprising 162 Mha of arable land, 69 Mha of forest and woodland, 11 Mha of permanent pasture, 8 Mha of permanent crops and 58 Mha is other land uses. The soil organic carbon (SOC) pool is estimated at 21 Pg (petagram = Pg = 1 x 1015 g billion ton) to 30-cm depth and 63 Pg to 150-cm depth. The soil inorganic carbon (SIC) pool is estimated at 196 Pg to 1-m depth. The SOC concentration in most cultivated soils is less than 5 g/kg compared with 15 to 20 g/kg in uncultivated soils. Low SOC concentration is attributed to plowing, removal of crop residue and other biosolids, and mining of soil fertility. Accelerated soil erosion by water leads to emission of 6 Tg C/y. Important strategies of soil C sequestration include restoration of degraded soils, and adoption of recommended management practices (RMPs) of agricultural and forestry soils. Potential of soil C sequestration in India is estimated at 7 to 10 Tg C/y for restoration of degraded soils and ecosystems, 5 to 7 Tg C/y for erosion control, 6 to 7 Tg C/y for adoption of RMPs on agricultural soils, and 22 to 26 Tg C/y for secondary carbonates. Thus, total potential of soil C sequestration is 39 to 49 (44± 5) Tg C/y

  15. Adsorption of Carbon Dioxide on Activated Carbon

    Institute of Scientific and Technical Information of China (English)

    Bo Guo; Liping Chang; Kechang Xie

    2006-01-01

    The adsorption of CO2 on a raw activated carbon A and three modified activated carbon samples B, C, and D at temperatures ranging from 303 to 333 K and the thermodynamics of adsorption have been investigated using a vacuum adsorption apparatus in order to obtain more information about the effect of CO2 on removal of organic sulfur-containing compounds in industrial gases. The active ingredients impregnated in the carbon samples show significant influence on the adsorption for CO2 and its volumes adsorbed on modified carbon samples B, C, and D are all larger than that on the raw carbon sample A. On the other hand, the physical parameters such as surface area, pore volume, and micropore volume of carbon samples show no influence on the adsorbed amount of CO2. The Dubinin-Radushkevich (D-R) equation was the best model for fitting the adsorption data on carbon samples A and B, while the Freundlich equation was the best fit for the adsorption on carbon samples C and D. The isosteric heats of adsorption on carbon samples A, B, C, and D derived from the adsorption isotherms using the Clapeyron equation decreased slightly increasing surface loading. The heat of adsorption lay between 10.5 and 28.4 kJ/mol, with the carbon sample D having the highest value at all surface coverages that were studied. The observed entropy change associated with the adsorption for the carbon samples A, B, and C (above the surface coverage of 7 ml/g) was lower than the theoretical value for mobile adsorption. However, it was higher than the theoretical value for mobile adsorption but lower than the theoretical value for localized adsorption for carbon sample D.

  16. The role of urbanization in the global carbon cycle

    Directory of Open Access Journals (Sweden)

    Galina eChurkina

    2016-01-01

    Full Text Available Urban areas account for more than 70% of CO2 emissions from burning fossil fuels. Urban expansion in tropics is responsible for 5% of the annual emissions from land use change. Here I show that the effect of urbanization on the global carbon cycle extends beyond these emissions. I quantify the contribution of urbanization to the major carbon fluxes and pools globally and identify gaps crucial for predicting the evolution of the carbon cycle in the future. Urban residents currently control ~22 (12-40 % of the land carbon uptake (112 PgC/yr and ~24 (15-39 % of the carbon emissions (117 PgC/yr from land globally. Urbanization resulted in the creation of new carbon pools on land such as buildings (~6.7 PgC and landfills (~30 PgC. Together these pools store 1.6 (±0.3 % of the total vegetation and soil carbon pools globally. The creation and maintenance of these new pools has been associated with high emissions of CO2, which are currently better understood than the processes associated with the dynamics of these pools and accompanying uptake of carbon. Predictions of the future trajectories of the global carbon cycle will require a much better understanding of how urban development affects the carbon cycle over the long term.

  17. Could submarine groundwater discharge be a significant carbon source to the southern Baltic Sea?** The study reports the results obtained within the framework of the following projects: the statutory activities of the Institute of Oceanology Polish Academy of Sciences theme 2.2, research project No. 2012/05/N/ST10/02761 sponsored by the National Science Centre, and AMBER, the BONUS+EU FP6 Project.

    Directory of Open Access Journals (Sweden)

    Beata Szymczycha

    2014-01-01

    Full Text Available Submarine Groundwater Discharge (SGD is an important yet poorly recognised pathway of material transport to the marine environment. This work reports on the results of dissolved inorganic carbon (DIC and dissolved organic carbon (DOC concentrations and loads in the groundwater seeping into the southern Baltic Sea. Most of the research was carried out in the Bay of Puck (2009–2010, while in 2013 the study was extended to include several other groundwater seepage impacted areas situated along the Polish coastline. The annual average concentrations of DIC and DOC in the groundwater were equal to 64.5±10.0 mg C L−1 and 5.8±0.9 mg C L−1 respectively. The carbon specific flux into the Bay of Puck was estimated at 850 mg m−2 yr−1. The loads of carbon via SGD were scaled up for the Baltic Sea sub-basins and the entire Baltic Sea. The DIC and DOC fluxes via SGD to the Baltic Sea were estimated at 283.6±66.7 kt yr−1 and 25.5±4.2 kt yr−1. The SGD derived carbon load to the Baltic Sea is an important component of the carbon budget, which gives the sea a firmly heterotrophic status.

  18. Accelerating Mineral Carbonation Using Carbonic Anhydrase.

    Science.gov (United States)

    Power, Ian M; Harrison, Anna L; Dipple, Gregory M

    2016-03-01

    Carbonic anhydrase (CA) enzymes have gained considerable attention for their potential use in carbon dioxide (CO2) capture technologies because they are able to catalyze rapidly the interconversion of aqueous CO2 and bicarbonate. However, there are challenges for widespread implementation including the need to develop mineralization process routes for permanent carbon storage. Mineral carbonation of highly reactive feedstocks may be limited by the supply rate of CO2. This rate limitation can be directly addressed by incorporating enzyme-catalyzed CO2 hydration. This study examined the effects of bovine carbonic anhydrase (BCA) and CO2-rich gas streams on the carbonation rate of brucite [Mg(OH)2], a highly reactive mineral. Alkaline brucite slurries were amended with BCA and supplied with 10% CO2 gas while aqueous chemistry and solids were monitored throughout the experiments (hours to days). In comparison to controls, brucite carbonation using BCA was accelerated by up to 240%. Nesquehonite [MgCO3·3H2O] precipitation limited the accumulation of hydrated CO2 species, apparently preventing BCA from catalyzing the dehydration reaction. Geochemical models reproduce observed reaction progress in all experiments, revealing a linear correlation between CO2 uptake and carbonation rate. Data demonstrates that carbonation in BCA-amended reactors remained limited by CO2 supply, implying further acceleration is possible. PMID:26829491

  19. Carbon fuel cells with carbon corrosion suppression

    Science.gov (United States)

    Cooper, John F.

    2012-04-10

    An electrochemical cell apparatus that can operate as either a fuel cell or a battery includes a cathode compartment, an anode compartment operatively connected to the cathode compartment, and a carbon fuel cell section connected to the anode compartment and the cathode compartment. An effusion plate is operatively positioned adjacent the anode compartment or the cathode compartment. The effusion plate allows passage of carbon dioxide. Carbon dioxide exhaust channels are operatively positioned in the electrochemical cell to direct the carbon dioxide from the electrochemical cell.

  20. Cayler cardiofacial syndrome and del 22q11: Part of the CATCH22 phenotype

    Energy Technology Data Exchange (ETDEWEB)

    Giannotti, A.; Digilio, M.C.; Marino, B. [Bambino Gesu Hospital, Rome (Italy); Mingarelli, R.; Dallapiccola, B. [Tor Vergata Univ., Rome (Italy)

    1994-11-15

    The authors report evidence supporting the hypothesis that del(22)(q11) can be a pathogenetic mechanism for the association between hypoplasia of the depressor anguli oris muscle (DAOM) and conotruncal cardiac malformations. A series of over 180 patients was investigated with deletions of 22q11 with conotruncal defects. About 2/3 of these patients had isolated, nonfamilial cardiac defects. Hemizygosity was searched using the HD7k probe and densitometric analysis. In the patients with molecular evidence of del(22)(q11), hemizygosity was confirmed also using fluorescence in situ hybridization (FISH) with SC11.1 probe. No deletion was found in the parents of hemizygous patients. 16 refs.

  1. Stifling of Crevice Corrosion in Alloy 22

    Energy Technology Data Exchange (ETDEWEB)

    Mon, K G; Gordon, G M; Rebak, R B

    2005-06-08

    Artificially creviced Alloy 22 (N06022) specimens may be susceptible to crevice corrosion in presence of hot chloride containing solutions. The presence of oxyanions in the electrolyte, especially nitrate, may inhibit the nucleation and growth of crevice corrosion. Constant potential tests were performed using tightly creviced specimens of Alloy 22. It was found that crevice corrosion may initiate when a constant potential above the crevice repassivation potential is applied. It was found that as the crevice corrosion nucleated, the current initially increased but later decreased. The net measured current can be converted into penetration following a power law fit of the experimental data. The average power law coefficient ''n'' was found to be 0.439, suggesting that even under constant applied potential crevice corrosion penetration is diffusion controlled.

  2. STIFLING OF CREVICE CORROSION IN ALLOY 22

    Energy Technology Data Exchange (ETDEWEB)

    K.G. Mon; G.M. Gordon; R.B. Rebak

    2005-07-01

    Artificially creviced Alloy 22 (N06022) specimens may be susceptible to crevice corrosion in presence of hot chloride containing solutions. The presence of oxyanions in the electrolyte, especially nitrate, may inhibit the nucleation and growth of crevice corrosion. Constant potential tests were performed using tightly creviced specimens of Alloy 22. It was found that crevice corrosion may initiate when a constant potential above the crevice repassivation potential is applied. It was found that as the crevice corrosion nucleated, the current initially increased but later decreased. The net measured current can be converted into penetration following a power law fit of the experimental data. The average power law coefficient ''n'' was found to be 0.439, suggesting that even under constant applied potential, crevice corrosion penetration is diffusion controlled.

  3. AcEST: CL22Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL22Contig1 1518 45 Adiantum capillus-veneris contig: CL22contig1 sequence. Link to clone list Show CL2...2Contig1 Contig ID CL22Contig1 Length 1518 Number of clones 45 Definition Adiantum capillus-veneris contig: CL2

  4. 27 CFR 28.22 - Vessels employed in the fisheries.

    Science.gov (United States)

    2010-04-01

    ... affecting § 28.22, see the List of CFR Sections Affected in the Finding Aids section of this volume. ... fisheries. 28.22 Section 28.22 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Lading for Use on Certain Vessels and Aircraft § 28.22 Vessels employed in the fisheries. Liquors may...

  5. 22 CFR 192.52 - Disability benefits.

    Science.gov (United States)

    2010-04-01

    .... 8107 and 20 CFR 10.304. The Director General of the Foreign Service of State or the Agency Head, may at... members of the body specified in 5 U.S.C. 8107 and in 20 CFR 10.304. The provisions of 20 CFR part 10... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disability benefits. 192.52 Section...

  6. Intrauterine Device Removal after 22 Years

    Directory of Open Access Journals (Sweden)

    Tahereh Boryri

    2014-01-01

    Full Text Available IUD T380A is one of the most effective, reversible, long term methods of contraception all over the world based on the experience of World Health Organization and our own observation of women who continued to use the IUD beyond 10 years or even longer years. In this article one case of Intrauterine device removal after 22 years is reported without complications and pregnancy.

  7. 22 CFR 224.22 - Exchange of witness lists, statements, and exhibits.

    Science.gov (United States)

    2010-04-01

    ... THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224.22 Exchange of witness lists, statements, and exhibits. (a... there is no prejudice to the objecting party. (c) Unless another party objects within the time set...

  8. Complexity of carbon market from multi-scale entropy analysis

    Science.gov (United States)

    Fan, Xinghua; Li, Shasha; Tian, Lixin

    2016-06-01

    Complexity of carbon market is the consequence of economic dynamics and extreme social political events in global carbon markets. The multi-scale entropy can measure the long-term structures in the daily price return time series. By using multi-scale entropy analysis, we explore the complexity of carbon market and mean reversion trend of daily price return. The logarithmic difference of data Dec16 from August 6, 2010 to May 22, 2015 is selected as the sample. The entropy is higher in small time scale, while lower in large. The dependence of the entropy on the time scale reveals the mean reversion of carbon prices return in the long run. A relatively great fluctuation over some short time period indicates that the complexity of carbon market evolves consistently with economic development track and the events of international climate conferences.

  9. Trading forest carbon - OSU

    Science.gov (United States)

    Issues associate with trading carbon sequestered in forests are discussed. Scientific uncertainties associated with carbon measurement are discussed with respect to proposed accounting procedures. Major issues include: (1) Establishing baselines. (2) Determining additivity from f...

  10. Soil Organic Carbon Stock

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Soil organic carbon (SOC) is the carbon held within soil organic constituents (i.e., products produced as dead plants and animals decompose and the soil microbial...

  11. Carbon Monoxide Information Center

    Medline Plus

    Full Text Available ... Education / Safety Education Centers En Español Carbon Monoxide Information Center The Invisible Killer Carbon monoxide, also known ... Install one and check its batteries regularly. View Information About CO Alarms Other CO Topics Safety Tips ...

  12. Biomass Carbon Stock

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Biomass carbon includes carbon stored in above- and below-ground live plant components (such as leaf, branch, stem and root) as well as in standing and down dead...

  13. Carbon Monoxide Safety

    Science.gov (United States)

    ... with the Media Fire Protection Technology Carbon monoxide safety outreach materials Help inform residents in your community ... KB | Spanish PDF 645 KB Handout: carbon monoxide safety Download this handout and add your organization's logo ...

  14. Calcium carbonate overdose

    Science.gov (United States)

    Tums overdose; Calcium overdose ... Calcium carbonate can be dangerous in large amounts. ... Some products that contain calcium carbonate are certain: ... and mineral supplements Other products may also contain calcium ...

  15. Potassium carbonate poisoning

    Science.gov (United States)

    Potassium carbonate is a white powder used to make soap, glass, and other items. This article discusses poisoning from swallowing or breathing in potassium carbonate. This article is for information only. Do ...

  16. Carbon nanotube nanoelectrode arrays

    Science.gov (United States)

    Ren, Zhifeng; Lin, Yuehe; Yantasee, Wassana; Liu, Guodong; Lu, Fang; Tu, Yi

    2008-11-18

    The present invention relates to microelectode arrays (MEAs), and more particularly to carbon nanotube nanoelectrode arrays (CNT-NEAs) for chemical and biological sensing, and methods of use. A nanoelectrode array includes a carbon nanotube material comprising an array of substantially linear carbon nanotubes each having a proximal end and a distal end, the proximal end of the carbon nanotubes are attached to a catalyst substrate material so as to form the array with a pre-determined site density, wherein the carbon nanotubes are aligned with respect to one another within the array; an electrically insulating layer on the surface of the carbon nanotube material, whereby the distal end of the carbon nanotubes extend beyond the electrically insulating layer; a second adhesive electrically insulating layer on the surface of the electrically insulating layer, whereby the distal end of the carbon nanotubes extend beyond the second adhesive electrically insulating layer; and a metal wire attached to the catalyst substrate material.

  17. Metal filled porous carbon

    Science.gov (United States)

    Gross, Adam F.; Vajo, John J.; Cumberland, Robert W.; Liu, Ping; Salguero, Tina T.

    2011-03-22

    A porous carbon scaffold with a surface and pores, the porous carbon scaffold containing a primary metal and a secondary metal, where the primary metal is a metal that does not wet the surface of the pores of the carbon scaffold but wets the surface of the secondary metal, and the secondary metal is interspersed between the surface of the pores of the carbon scaffold and the primary metal.

  18. Localized Corrosion of Alloy 22 -Fabrication Effects-

    Energy Technology Data Exchange (ETDEWEB)

    Rebak, R B

    2005-11-05

    This report deals with the impact of fabrication processes on the localized corrosion behavior of Alloy 22 (N06022). The four fabrication processes that were analyzed are: (1) Surface stress mitigation of final closure weld, (2) Manufacturing of the mockup container, (3) Black annealing of the container and (4) Use of different heats of Alloy 22 for container fabrication. Immersion and Electrochemical tests performed in the laboratory are generally aggressive and do not represent actual repository environments in Yucca Mountain. For example, to determine the intergranular attack in the heat affected zone of a weldment, tests are conducted in boiling acidic and oxidizing solutions according to ASTM standards. These solutions are used to compare the behavior of differently treated metallic coupons. Similarly for electrochemical tests many times pure sodium chloride or calcium chloride solutions are used. Pure chloride solutions are not representative of the repository environment. (1) Surface Stress Mitigation: When metallic plates are welded, for example using the Gas Tungsten Arc Welding (GTAW) method, residual tensile stresses may develop in the vicinity of the weld seam. Processes such as Low Plasticity Burnishing (LPB) and Laser Shock Peening (LSP) could be applied locally to eliminate the residual stresses produced by welding. In this study, Alloy 22 plates were welded and then the above-mentioned surface treatments were applied to eliminate the residual tensile stresses. The aim of the current study was to comparatively test the corrosion behavior of as-welded (ASW) plates with the corrosion behavior of plates with stress mitigated surfaces. Immersion and electrochemical tests were performed. Results from both immersion and electrochemical corrosion tests show that the corrosion resistance of the mitigated plates was not affected by the surface treatments applied. (2) Behavior of Specimens from a Mockup container: Alloy 22 has been extensively tested for

  19. Protolytic carbon film technology

    Energy Technology Data Exchange (ETDEWEB)

    Renschler, C.L.; White, C.A.

    1996-04-01

    This paper presents a technique for the deposition of polyacrylonitrile (PAN) on virtually any surface allowing carbon film formation with only the caveat that the substrate must withstand carbonization temperatures of at least 600 degrees centigrade. The influence of processing conditions upon the structure and properties of the carbonized film is discussed. Electrical conductivity, microstructure, and morphology control are also described.

  20. Carbon nanotube quantum dots

    NARCIS (Netherlands)

    Sapmaz, S.

    2006-01-01

    Low temperature electron transport measurements on individual single wall carbon nanotubes are described in this thesis. Carbon nanotubes are small hollow cylinders made entirely out of carbon atoms. At low temperatures (below ~10 K) finite length nanotubes form quantum dots. Because of its small si

  1. Carbon Goes To…

    Science.gov (United States)

    Savasci, Funda

    2014-01-01

    The purposes of this activity are to help middle school students understand the carbon cycle and realize how human activities affect the carbon cycle. This activity consists of two parts. The first part of the activity focuses on the carbon cycle, especially before the Industrial Revolution, while the second part of the activity focuses on how…

  2. Carbon/Carbon Pistons for Internal Combustion Engines

    Science.gov (United States)

    Taylor, A. H.

    1986-01-01

    Carbon/carbon piston performs same function as aluminum pistons in reciprocating internal combustion engines while reducing weight and increasing mechanical and thermal efficiencies of engine. Carbon/carbon piston concept features low piston-to-cylinder wall clearance - so low piston rings and skirts unnecessary. Advantages possible by negligible coefficient of thermal expansion of carbon/carbon.

  3. Interleukin-22: a likely target for treatment of autoimmune diseases

    Science.gov (United States)

    Yang, Xuyan; Zheng, Song Guo

    2014-01-01

    Interleukin -22 (IL-22) is a member of IL-10 family cytokines that is produced by many different types of lymphocytes including both those of the innate and adaptive immune system. This includes activated T cells, most notably Th17 and Th22 cells, and NK cells, γδ T cells, LTi cells and LTi-like cells. IL-22 mediates its effects via the IL-22-IL-22R complex and subsequent Janus Kinase-signal transduces and activators transcription (JAK-STAT) signaling pathway. Recently accumulated evidence has indicated that IL-22 also plays an important role in the pathogenesis of many autoimmune diseases. In this review, we discuss the recent findings and advancement of the role for IL-22 in several autoimmune diseases, such as psoriasis, rheumatoid arthritis (RA), hepatitis, graft versus host disease (GHVD) and allergic diseases, implicating that target IL-22 may have a therapeutic potential in those autoimmune diseases. PMID:24418299

  4. 22nd IAS Meeting of Sedimentology

    Institute of Scientific and Technical Information of China (English)

    DavorPavelic; IgorVlahovic; JosipHalamic

    2004-01-01

    The 22nd IAS Meeting of Sedimentology was held in the Convention Centre of the Grand Hotel Adriatic, in a small touristic town Opatija, located on the eastern Adriatic coast where Central Europe and the Mediterranean meet. It was the second IAS Meeting held in Croatia--the first one, 4th IAS Regional Meeting of Sedimentology, was held in Split in 1983. The Meeting in Opatija was organized by the Institute of Geology (Zagreb) and the Croatian Geological Society. The sponsor was Ministry of Science and Technology of the Reoublic of Croatia.

  5. Temporal dynamics and sPatial variations of forest vegetation carbon stock in Liaoning Province, China

    Institute of Scientific and Technical Information of China (English)

    LI Qing; TANG Li-Na; REN Yin

    2011-01-01

    There are many uncertainties in the estimation of forest carbon sequestration in China,especially in Liaoning Province where various forest inventory data have not been fully utilized.By using forest inventory data,we estimated forest vegetation carbon stock of Liaoning Province between 1993 and 2005.Results showed that forest biomass carbon stock increased from 68.91 Tg C in 1993 to 97.51 Tg C in 2005,whereas mean carbon density increased from 18.48 Mg.ha-1 C to 22.33 Mg·ha-1 C.The carbon storage of young- and middle-aged forests increased by 22.1 Tg C and 5.95 Tg C,but that of mature forests has decreased by 0.25 Tg C.The carbon stock and density of forests in Liaoning Province varied greatly in space:larger carbon storage and higher carbon density were primarily found in the east area.The spatial distribution of carbon density was determined by many factors,of which human activities played an important role.The forests in Liauning Province played a positive role as a sink of atmospheric carbon dioxide.The carbun fixation ability of forests in this area was primarily derived from forest plantation and the total forest carbon sequestration can be enhanced by expanding young- and middle-aged forests.

  6. A synthesis of carbon in international trade

    Science.gov (United States)

    Peters, G. P.; Davis, S. J.; Andrew, R.

    2012-08-01

    In a globalised world, the transfer of carbon between regions, either physically or embodied in production, represents a substantial fraction of global carbon emissions. The resulting emission transfers are important for balancing regional carbon budgets and for understanding the drivers of emissions. In this paper we synthesise current understanding in two parts: (1) CO2 emissions embodied in goods and services that are produced in one country but consumed in others, and (2) carbon physically present in fossil fuels, petroleum-derived products, harvested wood products, crops, and livestock products. We describe the key differences between studies and provide a consistent set of estimates using the same definitions, modelling framework, and consistent data. We find the largest trade flows of carbon in international trade in 2004 were fossil fuels (2673 MtC, 37 % of global emissions), CO2 embodied in traded goods and services (1661 MtC, 22 % of global emissions), crops (522 MtC, 31 % of total harvested crop carbon), petroleum-based products (183 MtC, 50 % of their total production), harvested wood products (149 MtC, 40 % of total roundwood extraction), and livestock products (28 MtC, 22 % of total livestock carbon). We find that for embodied CO2 emissions, estimates from independent studies are robust, and that differences between individual studies are not a reflection of the uncertainty in consumption-based estimates, but rather these differences result from the use of different production-based emissions input data and different definitions for allocating emissions to international trade. After adjusting for these issues, results across independent studies converge to give less uncertainty than previously assumed. For physical carbon flows there are relatively few studies to be synthesised, but differences between existing studies are due to the method of allocating to international trade, with some studies using "apparent consumption" as opposed to "final

  7. 从炭材料到低碳社会——2012世界炭会议介绍%How will carbon material lead to a low carbon society——A review of Carbon 2012

    Institute of Scientific and Technical Information of China (English)

    刘旭光

    2012-01-01

    A review is given of the Annual World Conference on Carbon, which was held on June 17-22, 2012 in Krakow, Poland and organized by the Polish Carbon Society. In this conference, 5 plenary lectures, 30 keynote lectures, 220 oral presentations and 465 posters were divided into 10 topics, i. e. , carbons for energy storage ; carbons for health and environmental protection; precursors, processing and technology; carbon nanomate-rials; porous carbons; carbon-based composites; graphene; new methods for carbon characterization; computation and modeling; and industrial news. Besides traditional modification on surface area and porosity, doping with hetero atoms such as N, B and P or compositing with metals or metal oxides have been developed into effective means for modifying carbon materials for improved adsorption, catalysis and energy-storage performance. The applications of novel carbon structures like nanotubes are still limited by the controllable and scalable preparation, processability and reactivity. Research on the structure and properties of graphene is moving from curiosity-oriented to application-oriented. Mathematical formulation or modeling of pore structures has been promoted by the progress in characterization methods. The modification of the surface/interface in carbon materials, which plays important roles in determining their physical, chemical or mechanical properties is still a focus of research activity in carbon materials.

  8. Carbon-14 waste management

    International Nuclear Information System (INIS)

    Carbon-14 occurs in nature, but is also formed in nuclear reactors. Because of its long half-life and the biological significance of carbon, releases from nuclear facilities could have a significant radiological impact. Waste management strategies for carbon-14 are therefore of current concern. Carbon-14 is present in a variety of waste streams both at reactors and at reprocessing plants. A reliable picture of the production and release of carbon-14 from various reactor systems has been built up for the purposes of this study. A possible management strategy for carbon-14 might be the reduction of nitrogen impurity levels in core materials, since the activation of 14N is usually the dominant source of carbon-14. The key problem in carbon-14 management is its retention of off-gas streams, particularly in the dissolver off-gas stream at reprocessing plants. Three alternative trapping processes that convert carbon dioxide into insoluble carbonates have been suggested. The results show that none of the options considered need be rejected on the grounds of potential radiation doses to individuals. All exposures should be as low as reasonably achievable, economic and social factors being taken into account. If, on these grounds, retention and disposal of carbon-14 is found to be beneficial, then, subject to the limitations noted, appropriate retention, immobilization and disposal technologies have been identified

  9. Identification of Serratia marcescens SE1 and determination of its Herbicide 2,2-dichloropropionate (2,2-DCP Degradation Potential

    Directory of Open Access Journals (Sweden)

    Abel, E.

    2012-01-01

    Full Text Available Aims: The goal of the study is to isolate species of bacteria that capable of utilizing 2,2-dichloropropionic acid (2,2-DCP as sole carbon source from soil sample collected from surrounding lake water located in Universiti Teknologi Malaysia, Skudai, Johor. Methodology and Results: Genomic DNA from bacterium SE1 was extracted and PCR amplification was carried out using universal primers, Fd1 (5’ - AGA GTT TGA TCC TGGCTC AG - 3’ and rP1 (5’- ACG GTC ATA CCT TGT TAC GAC TT - 3’ before sending for sequencing. The 16S rDNA nucleotide sequences were compared with Basic Local Alignment Search Tool nucleotide (BLASTn and further analyzed using phylogenetic tree of Neighbour-Joining method (MEGA 5. Phylogenetic analysis indicated that SE1 strain clearly shared 97% homology to the genus of Serratia marcescens and therefore designated as Serratia marcescens sp. SE1. SE1 exhibited the ability to utilize 2,2-DCP as sole carbon source at 20 mM concentration with cell doubling time of 5 h and maximum chloride ion release of 38 μmolCl-/mL. This result suggests that the dehalogenase enzyme present in the bacteria has high affinity towards the substrate. Based on morphological and partial biochemical characteristics, strain SE1 was a non-motile Gram negative bacterium with red colonies, that gave a catalase positive reaction. Conclusion, significance and impact of study: A better understanding of dehalogenases enzyme produce by this S. marcescens sp. SE1 in general will be useful to be used as bioremediation tools for environmental management. This is the first reported case that Serratia sp. has the ability to degrade halogenated compound.

  10. Tracheoesophageal fistula in utero: 22 cases

    International Nuclear Information System (INIS)

    A retrospective review of 22 infants born with tracheoesophageal fistula (TEF) detected on in utero US was performed. In addition, ten cases reported in the literature were reviewed. TEF or esophageal atresia should be considered when there is polydramnios and the stomach is not fluid filled; these findings were seen in 32% of the cases. Amniotic fluid flows freely through some TEFs, resulting in a normal amount of amniotic fluid and a fluid-filled stomach (6 of 22 cases), while in other cases the fluid does not traverse the fistula easily and polyhydramnios results. Polyhdramnios was present in 62% of the cases we reviewed and was the most common sonographic finding. The earliest age at which polyhdramnios was diagnosed was 24 weeks. Associated abnormalities are seen in 50%-70% of cases of TEF and are a major contributing factor to morbidity and mortality. Sonography will continue to miss many cases of TEF; however, when TEF is suspected from fetal US (i.e., polyhdramnios and no fluid-filled stomach, or polyhdramnios with no etiology identified), an improved outcome is expected

  11. Bioleaching of UO22+ ions from a Romanian poor uranium ore

    International Nuclear Information System (INIS)

    An experimental study on the bioleaching of a poor uranium ore by means of hydrophytic plants Lemna minor and Riccia fluitans, under various operating conditions is discussed. The maximum degree of bioleaching (42%) of the reduced uranium species to U(VI) has been attained for the ore-Lemna minor-alkaline carbonate solution system. The UO22+ ions amount accumulated in the plants is negligible as compared to the dissolved quantity, owing to the ionic competition between uranyl ions and the cations necessary to the mineral nutrition. The X-ray diffraction patterns prove that the uranium species in pyrochlore mineral are completely oxidized to U(VI), while thucolite is only partially turned into UO22+ ions, in the presence of living plants. (author)

  12. Activationless charge transport across 4.5 to 22 nm in molecular electronic junctions.

    Science.gov (United States)

    Yan, Haijun; Bergren, Adam Johan; McCreery, Richard; Della Rocca, Maria Luisa; Martin, Pascal; Lafarge, Philippe; Lacroix, Jean Christophe

    2013-04-01

    In this work, we bridge the gap between short-range tunneling in molecular junctions and activated hopping in bulk organic films, and greatly extend the distance range of charge transport in molecular electronic devices. Three distinct transport mechanisms were observed for 4.5-22-nm-thick oligo(thiophene) layers between carbon contacts, with tunneling operative when d  16 nm for high temperatures and low bias, and a third mechanism consistent with field-induced ionization of highest occupied molecular orbitals or interface states to generate charge carriers when d = 8-22 nm. Transport in the 8-22-nm range is weakly temperature dependent, with a field-dependent activation barrier that becomes negligible at moderate bias. We thus report here a unique, activationless transport mechanism, operative over 8-22-nm distances without involving hopping, which severely limits carrier mobility and device lifetime in organic semiconductors. Charge transport in molecular electronic junctions can thus be effective for transport distances significantly greater than the 1-5 nm associated with quantum-mechanical tunneling.

  13. PMP22 and its related diseases%PMP22及其相关疾病

    Institute of Scientific and Technical Information of China (English)

    郭家松; 李俊

    2010-01-01

    由基因突变引起的外周神经病统称为Charcot-Marie-Tooth(CMT)病,它是最常见的遗传性神经系统疾病之一,发病率为1/2 500.目前已知有超过53个染色体位点和35个特定基因与CMT有关,但是大部分CMT都是由周围髓鞘蛋白22(PMP22)基因变异所引起的.该文重点对PMP22的生物学及相关疾病的病理生理学进行综述.

  14. Proton magnetic resonance spectroscopy in 22q11 deletion syndrome.

    Directory of Open Access Journals (Sweden)

    Fabiana da Silva Alves

    Full Text Available OBJECTIVE: People with velo-cardio-facial syndrome or 22q11 deletion syndrome (22q11DS have behavioral, cognitive and psychiatric problems. Approximately 30% of affected individuals develop schizophrenia-like psychosis. Glutamate dysfunction is thought to play a crucial role in schizophrenia. However, it is unknown if and how the glutamate system is altered in 22q11DS. People with 22q11DS are vulnerable for haploinsufficiency of PRODH, a gene that codes for an enzyme converting proline into glutamate. Therefore, it can be hypothesized that glutamatergic abnormalities may be present in 22q11DS. METHOD: We employed proton magnetic resonance spectroscopy ((1H-MRS to quantify glutamate and other neurometabolites in the dorsolateral prefrontal cortex (DLPFC and hippocampus of 22 adults with 22q11DS (22q11DS SCZ+ and without (22q11DS SCZ- schizophrenia and 23 age-matched healthy controls. Also, plasma proline levels were determined in the 22q11DS group. RESULTS: We found significantly increased concentrations of glutamate and myo-inositol in the hippocampal region of 22q11DS SCZ+ compared to 22q11DS SCZ-. There were no significant differences in levels of plasma proline between 22q11DS SCZ+ and 22q11DS SCZ-. There was no relationship between plasma proline and cerebral glutamate in 22q11DS. CONCLUSION: This is the first in vivo(1H-MRS study in 22q11DS. Our results suggest vulnerability of the hippocampus in the psychopathology of 22q11DS SCZ+. Altered hippocampal glutamate and myo-inositol metabolism may partially explain the psychotic symptoms and cognitive impairments seen in this group of patients.

  15. Th22 Cells Contribution in Immunopathogenesis of Rheumatic Diseases

    Directory of Open Access Journals (Sweden)

    Gholamreza Azizi

    2015-10-01

    Full Text Available Newly  identified  T  helper  cell  22  (Th22  is  a  subset  of  CD4+T  cells  with  specific properties apart from other known CD4+ T cell subsets with distinguished gene expression and function. Th22 cells are characterized by production of a distinct profile of effector cytokines, including interleukin (IL-22, IL-13, and tumor necrosis factor-α (TNF-α. The levels of Th22 and related cytokine IL-22 are increased in various autoimmune diseases and positively associated with some rheumatic diseases such as rheumatoid arthritis, systemic lupus erythematosus, behcet's disease, ankylosing spondylitis and psoriatic arthritis. In summary, IL-22 and Th22 cells play a significant and complicated role in inflammatory and autoimmune  rheumatic  diseases,  therefore,  targeting  IL-22  or  Th22  have  unique  and attractive advantages due to the fact that Th22 subset is recently identified and its associated research is extremely limited. This review discusses the role of Th22 and its cytokine IL-22 in the immunopathogenesis of rheumatic disease.

  16. Seagrass meadows as a globally significant carbonate reservoir

    Directory of Open Access Journals (Sweden)

    I. Mazarrasa

    2015-03-01

    Full Text Available There has been a growing interest in quantifying the capacity of seagrass ecosystems to act as carbon sinks as a natural way of offsetting anthropogenic carbon emissions to the atmosphere. However, most of the efforts have focused on the organic carbon (POC stocks and accumulation rates and ignored the inorganic carbon (PIC fraction, despite important carbonate pools associated with calcifying organisms inhabiting the meadows, such as epiphytes and benthic invertebrates, and despite the relevance that carbonate precipitation and dissolution processes have in the global carbon cycle. This study offers the first assessment of the global PIC stocks in seagrass sediments using a synthesis of published and unpublished data on sediment carbonate concentration from 402 vegetated and 34 adjacent un-vegetated sites. PIC stocks in the top 1 m sediments ranged between 3 and 1660 Mg PIC ha-1, with an average of 654 ± 24 Mg PIC ha-1, exceeding about 5 fold those of POC reported in previous studies. Sedimentary carbonate stocks varied across seagrass communities, with meadows dominated by Halodule, Thalassia or Cymodocea supporting the highest PIC stocks, and tended to decrease polewards at a rate of -8 ± 2 Mg PIC ha-1 degree-1 of latitude (GLM, p -2 y-1. Based on the global extent of seagrass meadows (177 000 to 600 000 km2, these ecosystems globally store between 11 and 39 Pg of PIC in the top meter of sediment and accumulate between 22 and 76 Tg PIC y-1, representing a significant contribution to the carbonate dynamics of coastal areas. Despite that these high rates of carbonate accumulation imply CO2 emissions from precipitation, seagrass meadows are still strong CO2 sinks as demonstrates the comparison of carbon (POC and POC stocks between vegetated and adjacent un-vegetated sediments.

  17. Seagrass meadows as a globally significant carbonate reservoir

    Science.gov (United States)

    Mazarrasa, I.; Marbà, N.; Lovelock, C. E.; Serrano, O.; Lavery, P. S.; Fourqurean, J. W.; Kennedy, H.; Mateo, M. A.; Krause-Jensen, D.; Steven, A. D. L.; Duarte, C. M.

    2015-08-01

    There has been growing interest in quantifying the capacity of seagrass ecosystems to act as carbon sinks as a natural way of offsetting anthropogenic carbon emissions to the atmosphere. However, most of the efforts have focused on the particulate organic carbon (POC) stocks and accumulation rates and ignored the particulate inorganic carbon (PIC) fraction, despite important carbonate pools associated with calcifying organisms inhabiting the meadows, such as epiphytes and benthic invertebrates, and despite the relevance that carbonate precipitation and dissolution processes have in the global carbon cycle. This study offers the first assessment of the global PIC stocks in seagrass sediments using a synthesis of published and unpublished data on sediment carbonate concentration from 403 vegetated and 34 adjacent un-vegetated sites. PIC stocks in the top 1 m of sediment ranged between 3 and 1660 Mg PIC ha-1, with an average of 654 ± 24 Mg PIC ha-1, exceeding those of POC reported in previous studies by about a factor of 5. Sedimentary carbonate stocks varied across seagrass communities, with meadows dominated by Halodule, Thalassia or Cymodocea supporting the highest PIC stocks, and tended to decrease polewards at a rate of -8 ± 2 Mg PIC ha-1 per degree of latitude (general linear model, GLM; p seagrass meadows, the mean PIC accumulation rate in seagrass sediments is found to be 126.3 ± 31.05 g PIC m-2 yr-1. Based on the global extent of seagrass meadows (177 000 to 600 000 km2), these ecosystems globally store between 11 and 39 Pg of PIC in the top metre of sediment and accumulate between 22 and 75 Tg PIC yr-1, representing a significant contribution to the carbonate dynamics of coastal areas. Despite the fact that these high rates of carbonate accumulation imply CO2 emissions from precipitation, seagrass meadows are still strong CO2 sinks as demonstrated by the comparison of carbon (PIC and POC) stocks between vegetated and adjacent un-vegetated sediments.

  18. Seagrass meadows as a globally significant carbonate reservoir

    KAUST Repository

    Mazarrasa, I.

    2015-03-06

    There has been a growing interest in quantifying the capacity of seagrass ecosystems to act as carbon sinks as a natural way of offsetting anthropogenic carbon emissions to the atmosphere. However, most of the efforts have focused on the organic carbon (POC) stocks and accumulation rates and ignored the inorganic carbon (PIC) fraction, despite important carbonate pools associated with calcifying organisms inhabiting the meadows, such as epiphytes and benthic invertebrates, and despite the relevance that carbonate precipitation and dissolution processes have in the global carbon cycle. This study offers the first assessment of the global PIC stocks in seagrass sediments using a synthesis of published and unpublished data on sediment carbonate concentration from 402 vegetated and 34 adjacent un-vegetated sites. PIC stocks in the top 1 m sediments ranged between 3 and 1660 Mg PIC ha-1, with an average of 654 ± 24 Mg PIC ha-1, exceeding about 5 fold those of POC reported in previous studies. Sedimentary carbonate stocks varied across seagrass communities, with meadows dominated by Halodule, Thalassia or Cymodocea supporting the highest PIC stocks, and tended to decrease polewards at a rate of -8 ± 2 Mg PIC ha-1 degree-1 of latitude (GLM, p < 0.0003). Using PIC concentration and estimates of sediment accretion in seagrass meadows, mean PIC accumulation rates in seagrass sediments is 126.3 ± 0.7 g PIC m-2 y-1. Based on the global extent of seagrass meadows (177 000 to 600 000 km2), these ecosystems globally store between 11 and 39 Pg of PIC in the top meter of sediment and accumulate between 22 and 76 Tg PIC y-1, representing a significant contribution to the carbonate dynamics of coastal areas. Despite that these high rates of carbonate accumulation imply CO2 emissions from precipitation, seagrass meadows are still strong CO2 sinks as demonstrates the comparison of carbon (POC and POC) stocks between vegetated and adjacent un-vegetated sediments.

  19. Carbon cycle uncertainty in the Alaskan Arctic

    Directory of Open Access Journals (Sweden)

    J. B. Fisher

    2014-02-01

    Full Text Available Climate change is leading to a disproportionately large warming in the high northern latitudes, but the magnitude and sign of the future carbon balance of the Arctic are highly uncertain. Using 40 terrestrial biosphere models for Alaska, we provide a baseline of terrestrial carbon cycle structural and parametric uncertainty, defined as the multi-model standard deviation (σ against the mean (x for each quantity. Mean annual uncertainty (σ/x was largest for net ecosystem exchange (NEE (−0.01± 0.19 kg C m−2 yr−1, then net primary production (NPP (0.14 ± 0.33 kg C m−2 yr−1, autotrophic respiration (Ra (0.09 ± 0.20 kg C m−2 yr−1, gross primary production (GPP (0.22 ± 0.50 kg C m−2 yr−1, ecosystem respiration (Re (0.23 ± 0.38 kg C m−2 yr−1, CH4 flux (2.52 ± 4.02 g CH4 m−2 yr−1, heterotrophic respiration (Rh (0.14 ± 0.20 kg C m−2 yr−1, and soil carbon (14.0± 9.2 kg C m−2. The spatial patterns in regional carbon stocks and fluxes varied widely with some models showing NEE for Alaska as a strong carbon sink, others as a strong carbon source, while still others as carbon neutral. Additionally, a feedback (i.e., sensitivity analysis was conducted of 20th century NEE to CO2 fertilization (β and climate (γ, which showed that uncertainty in γ was 2x larger than that of β, with neither indicating that the Alaskan Arctic is shifting towards a certain net carbon sink or source. Finally, AmeriFlux data are used at two sites in the Alaskan Arctic to evaluate the regional patterns; observed seasonal NEE was captured within multi-model uncertainty. This assessment of carbon cycle uncertainties may be used as a baseline for the improvement of experimental and modeling activities, as well as a reference for future trajectories in carbon cycling with climate change in the Alaskan Arctic.

  20. Carbon isotopes in mollusk shell carbonates

    Science.gov (United States)

    McConnaughey, Ted A.; Gillikin, David Paul

    2008-10-01

    Mollusk shells contain many isotopic clues about calcification physiology and environmental conditions at the time of shell formation. In this review, we use both published and unpublished data to discuss carbon isotopes in both bivalve and gastropod shell carbonates. Land snails construct their shells mainly from respired CO2, and shell δ13C reflects the local mix of C3 and C4 plants consumed. Shell δ13C is typically >10‰ heavier than diet, probably because respiratory gas exchange discards CO2, and retains the isotopically heavier HCO3 -. Respired CO2 contributes less to the shells of aquatic mollusks, because CO2/O2 ratios are usually higher in water than in air, leading to more replacement of respired CO2 by environmental CO2. Fluid exchange with the environment also brings additional dissolved inorganic carbon (DIC) into the calcification site. Shell δ13C is typically a few ‰ lower than ambient DIC, and often decreases with age. Shell δ13C retains clues about processes such as ecosystem metabolism and estuarine mixing. Ca2+ ATPase-based models of calcification physiology developed for corals and algae likely apply to mollusks, too, but lower pH and carbonic anhydrase at the calcification site probably suppress kinetic isotope effects. Carbon isotopes in biogenic carbonates are clearly complex, but cautious interpretation can provide a wealth of information, especially after vital effects are better understood.