WorldWideScience

Sample records for capture dissociation ai

  1. Radiative capture versus Coulomb dissociation

    International Nuclear Information System (INIS)

    Esbensen, H.; Physics

    2006-01-01

    Measurements of the Coulomb dissociation of 8 B have been used to infer the rate of the inverse radiative proton capture on 7 Be. The analysis is usually based on the assumptions that the two processes are related by detailed balance and described by E1 transitions. However, there are corrections to this relation. The Coulomb form factors for the two processes, for example, are not identical. There are also E2 transitions and higher-order effects in the Coulomb dissociation, and the nuclear induced breakup cannot always be ignored. While adding first-order E2 transitions enhances the decay energy spectrum, the other mechanisms cause a suppression at low relative energies. The net result may accidentally be close to the conventional first-order E1 calculation, but there are differences which cannot be ignored if accuracies of 10% or better are needed

  2. Radiative Capture versus Coulomb Dissociation

    International Nuclear Information System (INIS)

    Esbensen, Henning

    2006-01-01

    Measurements of the Coulomb dissociation of 8B have been used to infer the rate of the inverse radiative proton capture on 7Be. The analysis is usually based on the assumptions that the two processes are related by detailed balance and described by E1 transitions. However, there are corrections to this relation. The Coulomb form factors for the two processes, for example, are not identical. There are also E2 transitions and higher-order effects in the Coulomb dissociation, and the nuclear induced breakup cannot always be ignored. While adding first-order E2 transitions enhances the decay energy spectrum, the other mechanisms cause a suppression at low relative energies. The net result may accidentally be close to the conventional first-order E1 calculation, but there are differences which cannot be ignored if accuracies of 10% or better are needed

  3. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  4. Electron Capture Dissociation of Weakly Bound Polypeptide Polycationic Complexes

    DEFF Research Database (Denmark)

    Haselmann, Kim F; Jørgensen, Thomas J D; Budnik, Bogdan A

    2002-01-01

    as well as specific complexes of modified glycopeptide antibiotics with their target peptide. The weak nature of bonding is substantiated by blackbody infrared dissociation, low-energy collisional excitation and force-field simulations. The results are consistent with a non-ergodic ECD cleavage mechanism.......We have previously reported that, in electron capture dissociation (ECD), rupture of strong intramolecular bonds in weakly bound supramolecular aggregates can proceed without dissociation of weak intermolecular bonds. This is now illustrated on a series of non-specific peptide-peptide dimers...

  5. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  6. Dipole and Coulomb forces in electron capture dissociation and electron transfer dissociation mass spectroscopy.

    Science.gov (United States)

    Świerszcz, Iwona; Skurski, Piotr; Simons, Jack

    2012-02-23

    Ab initio electronic structure calculations were performed on a doubly charged polypeptide model H(+)-Lys(Ala)(19)-CO-CH(NH(2))-CH(2)-SS-CH(2)-(NH(2))CH-CO-(Ala)(19)-Lys-H(+) consisting of a C-terminal protonated Lys followed by a 19-Ala α-helix with a 20th Ala-like unit whose side chain is linked by a disulfide bond to a corresponding Ala-like unit connected to a second 19-Ala α-helix terminated by a second C-terminal-protonated Lys. The Coulomb potentials arising from the two charged Lys residues and dipole potentials arising from the two oppositely directed 72 D dipoles of the α-helices act to stabilize the SS bond's σ* orbital. The Coulomb potentials provide stabilization of 1 eV, while the two large dipoles generate an additional 4 eV. Such stabilization allows the SS σ* orbital to attach an electron and thereby generate disulfide bond cleavage products. Although calculations are performed only on SS bond cleavage, discussion of N-C(α) bond cleavage caused by electron attachment to amide π* orbitals is also presented. The magnitudes of the stabilization energies as well as the fact that they arise from Coulomb and dipole potentials are supported by results on a small model system consisting of a H(3)C-SS-CH(3) molecule with positive and negative fractional point charges to its left and right designed to represent (i) two positive charges ca. 32 Å distant (i.e., the two charged Lys sites of the peptide model) and (ii) two 72 D dipoles (i.e., the two α-helices). Earlier workers suggested that internal dipole forces in polypeptides could act to guide incoming free electrons (i.e., in electron capture dissociation (ECD)) toward the positive end of the dipole and thus affect the branching ratios for cleaving various bonds. Those workers argued that, because of the huge mass difference between an anion donor and a free electron, internal dipole forces would have a far smaller influence over the trajectory of a donor (i.e., in electron transfer dissociation

  7. Electron capture dissociation proceeds with a low degree of intramolecular migration of peptide amide hydrogens

    DEFF Research Database (Denmark)

    Rand, Kasper D; Adams, Christopher M; Zubarev, Roman A

    2008-01-01

    scrambling) that occurs during vibrational excitation of gas-phase ions. Unlike traditional collisional ion activation, electron capture dissociation (ECD) is not associated with substantial vibrational excitation. We investigated the extent of intramolecular backbone amide hydrogen (1H/2H) migration upon...... ECD using peptides with a unique selective deuterium incorporation. Our results show that only limited amide hydrogen migration occurs upon ECD, provided that vibrational excitation prior to the electron capture event is minimized. Peptide ions that are excessively vibrationally excited...

  8. Acidic gases (CO_2, NO_2 and SO_2) capture and dissociation on metal decorated phosphorene

    International Nuclear Information System (INIS)

    Kuang, Anlong; Kuang, Minquan; Yuan, Hongkuan; Wang, Guangzhao; Chen, Hong; Yang, Xiaolan

    2017-01-01

    Highlights: • The light metal decorated phosphorene sheets are very effective for capture of CO_2, NO_2 and SO_2 because of large adsorption energies. • The adsorption energy is obviously dependent on the amount of electrons transferred between acidic gases and metal decorated phosphorene. • Pt-decorated phosphorene can effectively catalyze the dissociation of acidic gas. - Abstract: Density functional theory is employed to investigate the adsorption and dissociation of several acidic gases (CO_2, NO_2 and SO_2) on metal (Li, Al, Ni and Pt) decorated phosphorene. The results show that light metal (Li, Al) decorated phosphorene exhibits a strong adsorption of acidic gases, i.e., the adsorption energy of CO_2 on Li decorated phosphorene is 0.376 eV which is the largest in all adsorption of CO_2 on metal decorated phosphorene and Al decorated phosphorene is most effective for capture of NO_2 and SO_2 due to large adsorption energies of 3.951 and 3.608 eV, respectively. Moreover, Li and Al light metals have stronger economic effectiveness and more friendly environment compared with the transition metals, the strong adsorption ability of acidic gases and low price suggest that Li, Al decorated phosphorene may be useful and promising for collection and filtration of exhaust gases. The reaction energy barriers of acidic gases dissociated process on Pt decorated phosphorene are relatively low and the reaction processes are significantly exothermic, indicating that the dissociation process is favorable.

  9. Dipole-Guided Electron Capture Causes Abnormal Dissociations of Phosphorylated Pentapeptides

    DEFF Research Database (Denmark)

    Moss, Christopher L.; Chung, Thomas W.; Wyer, Jean

    2011-01-01

    energies and fluoranthene anion radicals in an ion trap resulted in the loss of a hydrogen atom, ammonia, and backbone cleavages forming complete series of sequence z ions. Elimination of phosphoric acid was negligible. In contrast, capture of lowenergy electrons by doubly charged ions in a Penning ion...... mapping of the potential energy surface provided structures for the precursor phosphopeptide dications. Electron attachment produces a multitude of low lying electronic states in charge-reduced ions that determine their reactivity in backbone dissociations and H- atom loss. The predominant loss of H atoms......Abstract Electron transfer and capture mass spectra of a series of doubly charged ions that were phosphorylated pentapeptides of a tryptic type (pS,A,A,A,R) showed conspicuous differences in dissociations of charge-reduced ions. Electron transfer from both gaseous cesium atoms at 100 keV kinetic...

  10. Probing Protein Structure and Folding in the Gas Phase by Electron Capture Dissociation

    Science.gov (United States)

    Schennach, Moritz; Breuker, Kathrin

    2015-07-01

    The established methods for the study of atom-detailed protein structure in the condensed phases, X-ray crystallography and nuclear magnetic resonance spectroscopy, have recently been complemented by new techniques by which nearly or fully desolvated protein structures are probed in gas-phase experiments. Electron capture dissociation (ECD) is unique among these as it provides residue-specific, although indirect, structural information. In this Critical Insight article, we discuss the development of ECD for the structural probing of gaseous protein ions, its potential, and limitations.

  11. Dissociating location-specific inhibition and attention shifts: evidence against the disengagement account of contingent capture.

    Science.gov (United States)

    Anderson, Brian A; Folk, Charles L

    2012-08-01

    The study of attentional capture has provided a rich context for assessing the relative influence of top-down and bottom-up factors in visual perception. Some have argued that attentional capture by a salient, irrelevant stimulus is contingent on top-down attentional set (e.g., Folk, Remington, & Johnston, Journal of Experimental Psychology: Human Perception and Performance 18:1030-1044, 1992). Others, however, have argued that capture is driven entirely by bottom-up salience and that top-down factors influence the postallocation speed of disengagement from the irrelevant stimulus (e.g., Theeuwes, Acta Psychologica 135:77-99, 2010a). In support of this speed-of-disengagement hypothesis, recent findings from the modified spatial-cuing paradigm show that cues carrying a no-go target property produce reverse, or negative, cuing effects, consistent with inhibition of the cue location from which attention has been very quickly disengaged (Belopolsky, Schreij, & Theeuwes, Perception, & Psychophysics, 72, 326-341, 2010). Across six experiments, we show that this inhibitory process can be dissociated from shifts of spatial attention and is, thus, not a reliable marker of capture. We conclude that the data are inconsistent with the predictions of the disengagement hypothesis.

  12. Gene-specific characterization of human histone H2B by electron capture dissociation.

    Science.gov (United States)

    Siuti, Nertila; Roth, Michael J; Mizzen, Craig A; Kelleher, Neil L; Pesavento, James J

    2006-02-01

    The basis set of protein forms expressed by human cells from the H2B gene family was determined by Top Down Mass Spectrometry. Using Electron Capture Dissociation for MS/MS of H2B isoforms, direct evidence for the expression of unmodified H2B.Q, H2B.A, H2B.K/T, H2B.J, H2B.E, H2B.B, H2B.F, and monoacetylated H2B.A was obtained from asynchronous HeLa cells. H2B.A was the most abundant form, with the overall expression profile not changing significantly in cells arrested in mitosis by colchicine or during mid-S, mid-G2, G2/M, and mid-G1 phases of the cell cycle. Modest hyperacetylation of H2B family members was observed after sodium butyrate treatment.

  13. A Variety of Activation Methods Employed in 'Activated-Ion' Electron Capture Dissociation Mass Spectrometry: A Test against Bovine Ubiquitin 7+ Ions

    International Nuclear Information System (INIS)

    Oh, Han Bin; McLafferty, Fred W.

    2006-01-01

    Fragmentation efficiencies of various 'activated-ion' electron capture dissociation (AI-ECD) methods are compared for a model system of bovine ubiquitin 7+ cations. In AI-ECD studies, sufficient internal energy was given to protein cations prior to ECD application using IR laser radiation, collisions, blackbody radiation, or in-beam collisions, in turn. The added energy was utilized in increasing the population of the precursor ions with less intra-molecular noncovalent bonds or enhancing thermal fluctuations of the protein cations. Removal of noncovalent bonds resulted in extended structures, which are ECD friendly. Under their best conditions, a variety of activation methods showed a similar effectiveness in ECD fragmentation. In terms of the number of fragmented inter-residue bonds, IR laser/blackbody infrared radiation and 'in-beam' activation were almost equally efficient with ∼70% sequence coverage, while collisions were less productive. In particular, 'in-beam' activation showed an excellent effectiveness in characterizing a pre-fractionated single kind of protein species. However, its inherent procedure did not allow for isolation of the protein cations of interest

  14. Feature-based attention is functionally distinct from relation-based attention: The double dissociation between color-based capture and color-relation-based capture of attention.

    Science.gov (United States)

    Du, Feng; Jiao, Jun

    2016-04-01

    The present study used a spatial blink task and a cuing task to examine the boundary between feature-based capture and relation-based capture. Feature-based capture occurs when distractors match the target feature such as target color. The occurrence of relation-based capture is contingent upon the feature relation between target and distractor (e.g., color relation). The results show that color distractors that match the target-nontarget color relation do not consistently capture attention when they appear outside of the attentional window, but distractors appearing outside the attentional window that match the target color consistently capture attention. In contrast, color distractors that best match the target-nontarget color relation but not the target color, are more likely to capture attention when they appear within the attentional window. Consistently, color cues that match the target-nontarget color relation produce a cuing effect when they appear within the attentional window, while target-color matched cues do not. Such a double dissociation between color-based capture and color-relation-based capture indicates functionally distinct mechanisms for these 2 types of attentional selection. This also indicates that the spatial blink task and the uninformative cuing task are measuring distinctive aspects of involuntary attention. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  15. Enhancing Protein Disulfide Bond Cleavage by UV Excitation and Electron Capture Dissociation for Top-Down Mass Spectrometry

    OpenAIRE

    Wongkongkathep, Piriya; Li, Huilin; Zhang, Xing; Loo, Rachel R. Ogorzalek; Julian, Ryan R.; Loo, Joseph A.

    2015-01-01

    The application of ion pre-activation with 266 nm ultraviolet (UV) laser irradiation combined with electron capture dissociation (ECD) is demonstrated to enhance top-down mass spectrometry sequence coverage of disulfide bond containing proteins. UV-based activation can homolytically cleave a disulfide bond to yield two separated thiol radicals. Activated ECD experiments of insulin and ribonuclease A containing three and four disulfide bonds, respectively, were performed. UV-activation in comb...

  16. Molecular treatment of single (dissociative and nondissociative) and double electron capture in He2+ + H2 collisions

    International Nuclear Information System (INIS)

    Errea, L F; Macias, A; Mendez, L; Pons, B; Riera, A

    2003-01-01

    We present close-coupling calculations of total cross sections for single and double electron capture in He 2+ + H 2 collisions in the range 0.5- 25 keV amu -1 , and compare them with experimental data. We confirm the experimental finding that the dominant process for E ∼> 3 keV amu -1 is the nondissociative capture He 2+ + H 2 → He + (2l) + H 2 + (1σ g ), while at lower energies it is dissociative capture leading to He + (1s) + H + + H. Our calculations also show that He(1s2l) is the main output of the two electron capture process. (letter to the editor)

  17. A review of electron-capture and electron-transfer dissociation tandem mass spectrometry in polymer chemistry

    International Nuclear Information System (INIS)

    Hart-Smith, Gene

    2014-01-01

    Graphical abstract: -- Highlights: •ECD and ETD can produce unique and diagnostically useful polymer ion fragmentation data. •The operating principles of ECD and ETD are discussed in relation to other dissociation techniques. •Key characteristics of ECD and ETD spectra, as observed from biological analytes, are discussed. •ECD and ETD analyses are compared to CID analyses for different classes of synthetic polymer. -- Abstract: Mass spectrometry (MS)-based studies of synthetic polymers often characterise detected polymer components using mass data alone. However when mass-based characterisations are ambiguous, tandem MS (MS/MS) offers a means by which additional analytical information may be collected. This review provides a synopsis of two particularly promising methods of dissociating polymer ions during MS/MS: electron-capture and electron-transfer dissociation (ECD and ETD, respectively). The article opens with a summary of the basic characteristics and operating principles of ECD and ETD, and relates these techniques to other methods of dissociating gas-phase ions, such as collision-induced dissociation (CID). Insights into ECD- and ETD-based MS/MS, gained from studies into proteins and peptides, are then discussed in relation to polymer chemistry. Finally, ECD- and ETD-based studies into various classes of polymer are summarised; for each polymer class, ECD- and ETD-derived data are compared to CID-derived data. These discussions identify ECD and ETD as powerful means by which unique and diagnostically useful polymer ion fragmentation data may be generated, and techniques worthy of increased utilisation by the polymer chemistry community

  18. Distinguishing of Ile/Leu amino acid residues in the PP3 protein by (hot) electron capture dissociation in Fourier transform ion cyclotron resonance mass spectrometry

    DEFF Research Database (Denmark)

    Kjeldsen, Frank; Haselmann, Kim F; Sørensen, Esben Skipper

    2003-01-01

    In hot electron capture dissociation (HECD), multiply protonated polypeptides fragment upon capturing approximately 11-eV electrons. The excess of energy upon the primary c, z* cleavage induces secondary fragmentation in z* fragments. The resultant w ions allow one to distinguish between the isom...

  19. Dissociating Goal-Directed and Stimulus-Driven Determinants in Attentional Capture

    Directory of Open Access Journals (Sweden)

    Louis K. H. Chan

    2011-05-01

    Full Text Available Although attentional capture is now a commonplace finding, the exact roles played by goal-directed and stimulus-driven determents remain elusive. An unsettled issue is on the relative contribution of attentional set and visual saliency. In the present study, we investigated this issue by mixing color and orientation search trials, so that distractors of either feature dimension fell into the current attentional set. In our test, color features were more salient. As a result, in orientation search, whereas a color distractor produced huge capture (109 ms, an orientation distractor produced moderate capture (50 ms. With color targets, distractors were not interfering. On one hand, these results reflect that relative salience of the target and the distractor is critical for producing capture; on the other hand, a huge capture size associated with a nontarget dimension feature is novel. Similar previous measurements, but without matching the attentional set, consistently report attentional capture of only 20-30 ms. This comparison shows the role played by attentional set. Taken together, we suggest that visual saliency determines search order, and sets the platform for capture. However, attentional dwell time on the distractor is determined by how much it matches the current attentional set, and in turn explains the capture size.

  20. Evidence for a dissociation between the control of oculomotor capture and disengagement

    NARCIS (Netherlands)

    Born, S.A.; Kerzel, D.; Theeuwes, J.

    2011-01-01

    The current study investigated whether capture of the eyes by a salient onset distractor and the disengagement of the eyes from that distractor are driven by the same or by different underlying control modes. A variant of the classic oculomotor capture task was used. Observers had to make a saccade

  1. Dissociative resonance electron capture in methylmercaptane and methylmercaptane-d3

    International Nuclear Information System (INIS)

    Sugiura, Toshio; Arakawa, Kazuo.

    1975-01-01

    The formation of negative ions by electron impact of methylmercaptane and methylmercaptane-3 3 has been investigated as a function of the electron energy. Appearance potentials, energies of resonance peaks, full widths of half maxima in resonance peak and relative formation cross sections have been determined about the negative ions of H - , D - , CH 3 S - , CD 3 S - , SH - , S - , CH 2 - , CD 2 - , Ch - and CD - . The dissociation energy of S-H bond and an electron affinity of CH 3 S radical have been determined as 4.7 +- 0.1 and 3.18 +- 0.2 eV, respectively. (auth.)

  2. Probing the Gaseous Structure of a β-Hairpin Peptide with H/D Exchange and Electron Capture Dissociation.

    Science.gov (United States)

    Straus, Rita N; Jockusch, Rebecca A

    2017-02-01

    An improved understanding of the extent to which native protein structure is retained upon transfer to the gas phase promises to enhance biological mass spectrometry, potentially streamlining workflows and providing fundamental insights into hydration effects. Here, we investigate the gaseous conformation of a model β-hairpin peptide using gas-phase hydrogen-deuterium (H/D) exchange with subsequent electron capture dissociation (ECD). Global gas-phase H/D exchange levels, and residue-specific exchange levels derived from ECD data, are compared among the wild type 16-residue peptide GB1p and several variants. High protection from H/D exchange observed for GB1p, but not for a truncated version, is consistent with the retention of secondary structure of GB1p in the gas phase or its refolding into some other compact structure. Four alanine mutants that destabilize the hairpin in solution show levels of protection similar to that of GB1p, suggesting collapse or (re)folding of these peptides upon transfer to the gas phase. These results offer a starting point from which to understand how a key secondary structural element, the β-hairpin, is affected by transfer to the gas phase. This work also demonstrates the utility of a much-needed addition to the tool set that is currently available for the investigation of the gaseous conformation of biomolecules, which can be employed in the future to better characterize gaseous proteins and protein complexes. Graphical Abstract ᅟ.

  3. Enhancing Protein Disulfide Bond Cleavage by UV Excitation and Electron Capture Dissociation for Top-Down Mass Spectrometry.

    Science.gov (United States)

    Wongkongkathep, Piriya; Li, Huilin; Zhang, Xing; Loo, Rachel R Ogorzalek; Julian, Ryan R; Loo, Joseph A

    2015-11-15

    The application of ion pre-activation with 266 nm ultraviolet (UV) laser irradiation combined with electron capture dissociation (ECD) is demonstrated to enhance top-down mass spectrometry sequence coverage of disulfide bond containing proteins. UV-based activation can homolytically cleave a disulfide bond to yield two separated thiol radicals. Activated ECD experiments of insulin and ribonuclease A containing three and four disulfide bonds, respectively, were performed. UV-activation in combination with ECD allowed the three disulfide bonds of insulin to be cleaved and the overall sequence coverage to be increased. For the larger sized ribonuclease A with four disulfide bonds, irradiation from an infrared laser (10.6 µm) to disrupt non-covalent interactions was combined with UV-activation to facilitate the cleavage of up to three disulfide bonds. Preferences for disulfide bond cleavage are dependent on protein structure and sequence. Disulfide bonds can reform if the generated radicals remain in close proximity. By varying the time delay between the UV-activation and the ECD events, it was determined that disulfide bonds reform within 10-100 msec after their UV-homolytic cleavage.

  4. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  5. Acidic gases (CO{sub 2}, NO{sub 2} and SO{sub 2}) capture and dissociation on metal decorated phosphorene

    Energy Technology Data Exchange (ETDEWEB)

    Kuang, Anlong, E-mail: alkuang@swu.edu.cn [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Kuang, Minquan; Yuan, Hongkuan; Wang, Guangzhao; Chen, Hong [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Yang, Xiaolan [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China)

    2017-07-15

    Highlights: • The light metal decorated phosphorene sheets are very effective for capture of CO{sub 2}, NO{sub 2} and SO{sub 2} because of large adsorption energies. • The adsorption energy is obviously dependent on the amount of electrons transferred between acidic gases and metal decorated phosphorene. • Pt-decorated phosphorene can effectively catalyze the dissociation of acidic gas. - Abstract: Density functional theory is employed to investigate the adsorption and dissociation of several acidic gases (CO{sub 2}, NO{sub 2} and SO{sub 2}) on metal (Li, Al, Ni and Pt) decorated phosphorene. The results show that light metal (Li, Al) decorated phosphorene exhibits a strong adsorption of acidic gases, i.e., the adsorption energy of CO{sub 2} on Li decorated phosphorene is 0.376 eV which is the largest in all adsorption of CO{sub 2} on metal decorated phosphorene and Al decorated phosphorene is most effective for capture of NO{sub 2} and SO{sub 2} due to large adsorption energies of 3.951 and 3.608 eV, respectively. Moreover, Li and Al light metals have stronger economic effectiveness and more friendly environment compared with the transition metals, the strong adsorption ability of acidic gases and low price suggest that Li, Al decorated phosphorene may be useful and promising for collection and filtration of exhaust gases. The reaction energy barriers of acidic gases dissociated process on Pt decorated phosphorene are relatively low and the reaction processes are significantly exothermic, indicating that the dissociation process is favorable.

  6. Capture and dissociation in the complex-forming CH + H2 → CH2 + H, CH + H2 reactions.

    Science.gov (United States)

    González, Miguel; Saracibar, Amaia; Garcia, Ernesto

    2011-02-28

    The rate coefficients for the capture process CH + H(2)→ CH(3) and the reactions CH + H(2)→ CH(2) + H (abstraction), CH + H(2) (exchange) have been calculated in the 200-800 K temperature range, using the quasiclassical trajectory (QCT) method and the most recent global potential energy surface. The reactions, which are of interest in combustion and in astrochemistry, proceed via the formation of long-lived CH(3) collision complexes, and the three H atoms become equivalent. QCT rate coefficients for capture are in quite good agreement with experiments. However, an important zero point energy (ZPE) leakage problem occurs in the QCT calculations for the abstraction, exchange and inelastic exit channels. To account for this issue, a pragmatic but accurate approach has been applied, leading to a good agreement with experimental abstraction rate coefficients. Exchange rate coefficients have also been calculated using this approach. Finally, calculations employing QCT capture/phase space theory (PST) models have been carried out, leading to similar values for the abstraction rate coefficients as the QCT and previous quantum mechanical capture/PST methods. This suggests that QCT capture/PST models are a good alternative to the QCT method for this and similar systems.

  7. Investigation of the Mechanism of Electron Capture and Electron Transfer Dissociation of Peptides with a Covalently Attached Free Radical Hydrogen Atom Scavenger.

    Science.gov (United States)

    Sohn, Chang Ho; Yin, Sheng; Peng, Ivory; Loo, Joseph A; Beauchamp, J L

    2015-11-15

    The mechanisms of electron capture and electron transfer dissociation (ECD and ETD) are investigated by covalently attaching a free-radical hydrogen atom scavenger to a peptide. The 2,2,6,6-tetramethylpiperidin-l-oxyl (TEMPO) radical was chosen as the scavenger due to its high hydrogen atom affinity (ca. 280 kJ/mol) and low electron affinity (ca. 0.45 ev), and was derivatized to the model peptide, FQX TEMPO EEQQQTEDELQDK. The X TEMPO residue represents a cysteinyl residue derivatized with an acetamido-TEMPO group. The acetamide group without TEMPO was also examined as a control. The gas phase proton affinity (882 kJ/mol) of TEMPO is similar to backbone amide carbonyls (889 kJ/mol), minimizing perturbation to internal solvation and sites of protonation of the derivatized peptides. Collision induced dissociation (CID) of the TEMPO tagged peptide dication generated stable odd-electron b and y type ions without indication of any TEMPO radical induced fragmentation initiated by hydrogen abstraction. The type and abundance of fragment ions observed in the CID spectra of the TEMPO and acetamide tagged peptides are very similar. However, ECD of the TEMPO labeled peptide dication yielded no backbone cleavage. We propose that a labile hydrogen atom in the charge reduced radical ions is scavenged by the TEMPO radical moiety, resulting in inhibition of N-C α backbone cleavage processes. Supplemental activation after electron attachment (ETcaD) and CID of the charge-reduced precursor ion generated by electron transfer of the TEMPO tagged peptide dication produced a series of b + H (b H ) and y + H (y H ) ions along with some c ions having suppressed intensities, consistent with stable O-H bond formation at the TEMPO group. In summary, the results indicate that ECD and ETD backbone cleavage processes are inhibited by scavenging of a labile hydrogen atom by the localized TEMPO radical moiety. This observation supports the conjecture that ECD and ETD processes involve long

  8. Erratum: Extracting (n,γ) direct capture cross sections from Coulomb dissociation: application to 14C(n,γ)15C

    International Nuclear Information System (INIS)

    Summers, N.C.; Nunes, F.M.

    2008-01-01

    In Ref. (1) we proposed a systematic methodology to extract neutron capture cross sections from Coulomb Dissociation data. Using the Continuum Discretized Coupled Channel formalism to describe the 15 C breakup process, the asymptotic normalization coefficient (ANC) for the ground state is extracted through a χ 2 fit. The corresponding error bar is defined using χ min 2 + 1. We discovered a mistake in the calculation of the errors associated with the extracted ANC and here we present the corrected values. The experimental data from which the ANC is extracted covers a range of energies up to 4 MeV, and the value obtained for the full energy range is C 0 = 1.31 ± 0.07 fm -1/2 . We find that the ANC is better determined if the high energy data is discarded and the maximum energy is cut at 1.2 MeV. This is justified since the direct measurements we are comparing to, and the peak of the cross section (Fig. 1 in Ref. (1)), all lie below this cut. The higher energy data is more uncertain and lies in a region where the theoretical cross section is insensitive to the ANC, thus adding unwarranted uncertainty to the extracted ANC. With this energy cut one can better determine the ANC as C 0 = 1.32 ± 0.04 fm -1/2 . All conclusions in our previous paper (1) hold. More details on the fitting procedure can be found in Ref. (2). Figure 2 of Ref. (1) should be replaced by the figure below, where the shaded area is the range of uncertainty for an ANC of C 0 = 1.32 ± 0.04 fm -1/2 , extracted from data up to E = 1.2 MeV

  9. Hydrogen/deuterium exchange mass spectrometry with top-down electron capture dissociation for characterizing structural transitions of a 17 kDa protein.

    Science.gov (United States)

    Pan, Jingxi; Han, Jun; Borchers, Christoph H; Konermann, Lars

    2009-09-09

    Amide H/D exchange (HDX) mass spectrometry (MS) is widely used for protein structural studies. Traditionally, this technique involves protein labeling in D(2)O, followed by acid quenching, proteolytic digestion, and analysis of peptide deuteration levels by HPLC/MS. There is great interest in the development of alternative HDX approaches involving the top-down fragmentation of electrosprayed protein ions, instead of relying on enzymatic cleavage and solution-phase separations. A number of recent studies have demonstrated that electron capture dissociation (ECD) results in fragmentation of gaseous protein ions with little or no H/D scrambling. However, the successful application of this approach for in-depth protein conformational studies has not yet been demonstrated. The current work uses horse myoglobin as a model system for assessing the suitability of HDX-MS with top-down ECD for experiments of this kind. It is found that ECD can pinpoint the locations of protected amides with an average resolution of less than two residues for this 17 kDa protein. Native holo-myoglobin (hMb) shows considerable protection from exchange in all of its helices, whereas loops are extensively deuterated. Fraying is observable at some helix termini. Removal of the prosthetic heme group from hMb produces apo-myoglobin (aMb). Both hMb and aMb share virtually the same HDX protection pattern in helices A-E, whereas helix F is unfolded in aMb. In addition, destabilization is evident for some residues close to the beginning of helix G, the end of helix H, and the C-terminus of the protein. The structural changes reported herein are largely consistent with earlier NMR data for sperm whale myoglobin, although small differences between the two systems are evident. Our findings demonstrate that the level of structural information obtainable with top-down ECD for small to medium-sized proteins considerably surpasses that of traditional HDX-MS experiments, while at the same time greatly reducing

  10. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  11. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  12. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  13. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  14. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  15. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  16. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  17. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  18. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  19. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  20. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  1. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  2. Isotope separation by photoselective dissociative electron

    International Nuclear Information System (INIS)

    Stevens, C.G.

    1978-01-01

    A method of separating isotopes based on photoselective electron capture dissociation of molecules having an electron capture cross section dependence on the vibrational state of the molecule is described. A molecular isotope source material is irradiated to selectively excite those molecules containing a desired isotope to a predetermined vibrational state having associated therewith an electron capture energy region substantially non-overlapping with the electron capture energy ranges associated with the lowest vibration states of the molecules. The isotope source is also subjected to electrons having an energy corresponding to the non-overlapping electron capture region whereby the selectively excited molecules preferentially capture electrons and dissociate into negative ions and neutrals. The desired isotope may be in the negative ion product or in the neutral product depending upon the mechanism of dissociation of the particular isotope source used. The dissociation product enriched in the desired isotope is then separated from the reaction system by conventional means. Specifically, 235 UF 6 is separated from a UF 6 mixture by selective excitation followed by dissociative electron capture into 235 UF 5 - and F

  3. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  4. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  5. Dissociation dynamics of methylal

    Energy Technology Data Exchange (ETDEWEB)

    Beaud, P; Frey, H -M; Gerber, T; Mischler, B; Radi, P P; Tzannis, A -P [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1999-08-01

    The dissociation of methylal is investigated using mass spectrometry, combined with a pyrolytic radical source and femtosecond pump probe experiments. Based on preliminary results two reaction paths of methylal dissociation are proposed and discussed. (author) 4 fig., 3 refs.

  6. Capturing Thoughts, Capturing Minds?

    DEFF Research Database (Denmark)

    Nielsen, Janni

    2004-01-01

    Think Aloud is cost effective, promises access to the user's mind and is the applied usability technique. But 'keep talking' is difficult, besides, the multimodal interface is visual not verbal. Eye-tracking seems to get around the verbalisation problem. It captures the visual focus of attention...

  7. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  8. Optimizing Limousine Service with AI

    OpenAIRE

    Chun, Andy Hon Wai

    2011-01-01

    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  9. Dissociation in small molecules

    International Nuclear Information System (INIS)

    Dehmer, P.M.

    1982-01-01

    The study of molecular dissociation processes is one of the most interesting areas of modern spectroscopy owing to the challenges presented bt even the simplest of diatomic molecules. This paper reviews the commonly used descriptions of molecular dissociation processes for diatomic molecules, the selection rules for predissociation, and a few of the principles to be remembered when one is forced to speculate about dissociation mechanisms in a new molecule. Some of these points will be illustrated by the example of dissociative ionization in O 2

  10. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  11. USACE AIS Transmit Technical Support Summary Report

    Science.gov (United States)

    2014-09-01

    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  12. Adaptive Motion Gaming AI for Health Promotion

    OpenAIRE

    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

    2017-01-01

    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  13. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  14. Sequencing Larger Intact Proteins (30-70 kDa) with Activated Ion Electron Transfer Dissociation

    Science.gov (United States)

    Riley, Nicholas M.; Westphall, Michael S.; Coon, Joshua J.

    2018-01-01

    The analysis of intact proteins via mass spectrometry can offer several benefits to proteome characterization, although the majority of top-down experiments focus on proteoforms in a relatively low mass range (AI-ETD) to proteins in the 30-70 kDa range. AI-ETD leverages infrared photo-activation concurrent to ETD reactions to improve sequence-informative product ion generation. This method generates more product ions and greater sequence coverage than conventional ETD, higher-energy collisional dissociation (HCD), and ETD combined with supplemental HCD activation (EThcD). Importantly, AI-ETD provides the most thorough protein characterization for every precursor ion charge state investigated in this study, making it suitable as a universal fragmentation method in top-down experiments. Additionally, we highlight several acquisition strategies that can benefit characterization of larger proteins with AI-ETD, including combination of spectra from multiple ETD reaction times for a given precursor ion, multiple spectral acquisitions of the same precursor ion, and combination of spectra from two different dissociation methods (e.g., AI-ETD and HCD). In all, AI-ETD shows great promise as a method for dissociating larger intact protein ions as top-down proteomics continues to advance into larger mass ranges. [Figure not available: see fulltext.

  15. Catalytic methanol dissociation

    International Nuclear Information System (INIS)

    Alcinikov, Y.; Fainberg, V.; Garbar, A.; Gutman, M.; Hetsroni, G.; Shindler, Y.; Tatrtakovsky, L.; Zvirin, Y.

    1998-01-01

    Results of the methanol dissociation study on copper/potassium catalyst with alumina support at various temperatures are presented. The following gaseous and liquid products at. The catalytic methanol dissociation is obtained: hydrogen, carbon monoxide, carbon dioxide, methane, and dimethyl ether. Formation rates of these products are discussed. Activation energies of corresponding reactions are calculated

  16. Dissociation in mediation

    Directory of Open Access Journals (Sweden)

    Daniela Muraru

    2008-01-01

    Full Text Available This paper approaches several texts that are part of the so-called discourse of mediation, adopting a pragma-dialectical perspective of the theory of dissociation. It is an attempt to identify the uses of dissociative patterns, with special emphasis on the indicators of dissociation. The paper investigates the various uses of the concept of dissociation as a discursive technique in the argumentation on the different aspects that are involved in international conflict, such as the discussion of the notion of peace. The purpose is to identify the role of dissociation, as a device strategically used by the mediator to help the parties minimize the disagreement space, and come to a conflict resolution.

  17. JGOMAS: New Approach to AI Teaching

    Science.gov (United States)

    Barella, A.; Valero, S.; Carrascosa, C.

    2009-01-01

    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  18. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  19. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  20. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.

    1979-01-01

    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  1. Coulomb dissociation studies for astrophysical thermonuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Motobayashi, T [Dept. of Physics, Rikkyo Univ., Toshima, Tokyo (Japan)

    1998-06-01

    The Coulomb dissociation method was applied to several radiative capture processes of astrophysical interest. The method has an advantage of high experimental efficiency, which allow measurements with radioactive nuclear beams. The reactions {sup 13}N(p,{gamma}){sup 14}O and {sup 7}Be(p,{gamma}){sup 8}B are mainly discussed. They are the key reaction in the hot CNO cycle in massive stars and the one closely related to the solar neutrino problem, respectively. (orig.)

  2. Attempting to model dissociations of memory.

    Science.gov (United States)

    Reber, Paul J.

    2002-05-01

    Kinder and Shanks report simulations aimed at describing a single-system model of the dissociation between declarative and non-declarative memory. This model attempts to capture both Artificial Grammar Learning (AGL) and recognition memory with a single underlying representation. However, the model fails to reflect an essential feature of recognition memory - that it occurs after a single exposure - and the simulations may instead describe a potentially interesting property of over-training non-declarative memory.

  3. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  4. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

    2013-01-01

    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  5. Health Information in French (français)

    Science.gov (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  6. Gravitational capture

    International Nuclear Information System (INIS)

    Bondi, H.

    1979-01-01

    In spite of the strength of gravitational focres between celestial bodies, gravitational capture is not a simple concept. The principles of conservation of linear momentum and of conservation of angular momentum, always impose severe constraints, while conservation of energy and the vital distinction between dissipative and non-dissipative systems allows one to rule out capture in a wide variety of cases. In complex systems especially those without dissipation, long dwell time is a more significant concept than permanent capture. (author)

  7. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  8. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.

    1983-10-01

    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  9. National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  10. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  11. Learning game AI programming with Lua

    CERN Document Server

    Young, David

    2014-01-01

    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  12. Adaptive game AI with dynamic scripting

    OpenAIRE

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  13. Research Directions for AI in Computer Games

    OpenAIRE

    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

    2001-01-01

    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  14. Duality in diffraction dissociations

    International Nuclear Information System (INIS)

    Santoro, Alberto.

    1977-01-01

    Diffractive dissociations (aN→a*πN) are naturally explained and a model that accounts for the three-variable correlation (mass-transfer-Jackson angle correlation) is presented. This model takes into account the three possible exchanges: t (pion), u(a*) and s(a) channel exchanger. The physical consequences of the model are: a strong mass-slope correlation due to the zeros of the amplitude, a factorization of diffractive dissociations (factorization of the Pomeron), the possibility of extending this model to double diffractive dissociation and diffraction by nuclei. This model was applied to the NN→NπN reaction. Using the usual parameters of the Deck model, a comparison is made with experiments for all available distributions. the strong slope of the peak at 1400 MeV is naturally explained [fr

  15. Dissociative charge exchange of H2+

    International Nuclear Information System (INIS)

    Bruijn, D. de.

    1983-01-01

    This thesis is devoted to molecular dissociation, in particular the dissociation of the hydrogen molecule H 2 arising from electron capture of its ion H 2 + in a collision. Thereby the important practical question how a chemical bond can be broken is implicitly addressed. This thesis opens (chapter I) with an overview of the available experimental approaches in molecular physics. Further the simple Demkov model for NRCE is described. In chapter II a novel experimental technique for measurements on dissociative processes is introduced which combines a high efficiency with a high energy resolution. A detailed description of the techniques applied in the detector, which has a high spatial and timing resolution with 30 μm and 350 psec FWHM respectively for the detection of one particle, is given in chapter III. A semi-classical theory for NRCE in the medium energy range between a diatomic molecular ion and an atom is developed in chapter IV. The experiments on dissociative charge exchange of H 2 + with Ar, Mg, Na and Cs targets at keV energies are described in Chapter V. The predissociation of the c 3 PIsub(u)-state of H 2 populated after charge exchange of H 2 with several targets at keV energies; is the subject of chapter VI. In chapter VII, orientational oscillations in the cross section for charge exchange of H 2 + with alkali targets are discussed. The last chapter deals with predissociation of highly excited states in H 2 . (Auth.)

  16. Dissociative symptoms in kleptomania.

    Science.gov (United States)

    Grant, Jon E

    2004-02-01

    Many patients with kleptomania report an altered state of consciousness during acts of theft. The purpose of this investigation was to clarify a possible link between dissociation and kleptomania, a disabling disorder whose phenomenology remains understudied. 26 adult outpatients who met DSM-IV criteria for kleptoania were administered the Dissociative Experiences Scale and compared to 22 normal controls. The patients with kleptomania had scores that differed significantly from those reported by normal controls. There were no statistically significant differences by sex. Because kleptomania patients seeking treatment with medication may differ from others with kleptomania, further studies are needed.

  17. Dissociation and psychosis in dissociative identity disorder and schizophrenia.

    Science.gov (United States)

    Laddis, Andreas; Dell, Paul F

    2012-01-01

    Dissociative symptoms, first-rank symptoms of schizophrenia, and delusions were assessed in 40 schizophrenia patients and 40 dissociative identity disorder (DID) patients with the Multidimensional Inventory of Dissociation (MID). Schizophrenia patients were diagnosed with the Structured Clinical Interview for the DSM-IV Axis I Disorders; DID patients were diagnosed with the Structured Clinical Interview for DSM-IV Dissociative Disorders-Revised. DID patients obtained significantly (a) higher dissociation scores; (b) higher passive-influence scores (first-rank symptoms); and (c) higher scores on scales that measure child voices, angry voices, persecutory voices, voices arguing, and voices commenting. Schizophrenia patients obtained significantly higher delusion scores than did DID patients. What is odd is that the dissociation scores of schizophrenia patients were unrelated to their reports of childhood maltreatment. Multiple regression analyses indicated that 81% of the variance in DID patients' dissociation scores was predicted by the MID's Ego-Alien Experiences Scale, whereas 92% of the variance in schizophrenia patients' dissociation scores was predicted by the MID's Voices Scale. We propose that schizophrenia patients' responses to the MID do not index the same pathology as do the responses of DID patients. We argue that neither phenomenological definitions of dissociation nor the current generation of dissociation instruments (which are uniformly phenomenological in nature) can distinguish between the dissociative phenomena of DID and what we suspect are just the dissociation-like phenomena of schizophrenia.

  18. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  19. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.

    2012-01-01

    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  20. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

    1975-01-01

    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  1. Dissociative Identity Disorder

    Science.gov (United States)

    Schmidt, Tom

    2007-01-01

    Few psychological disorders in the Diagnostic Statistical Manual have generated as much controversy as Dissociative Identity Disorder (DID). For the past 35 years diagnoses of DID, previously referred to as Multiple Personality Disorder (MPD), have increased exponentially, causing various psychological researchers and clinicians to question the…

  2. Neurophysiological correlates of dissociative symptoms

    NARCIS (Netherlands)

    Kruijs, van der S.J.M.; Bodde, N.M.G; Carrette, E.C.B.; Lazeron, R.H.C; Vonck, K.E.J.; Boon, P.A.J.M.; Langereis, G.R.; Cluitmans, P.J.M.; Feijs, L.M.G.; Hofman, P.A.M.; Backes, W.H.; Jansen, J.F.A.; Aldenkamp, A.P.

    2014-01-01

    Objective: Dissociation is a mental process with psychological and somatoform manifestations, which is closely related to hypnotic suggestibility and essentially shows the ability to obtain distance from reality. An increased tendency to dissociate is a frequently reported characteristic of patients

  3. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  4. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  5. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John

    2008-01-01

    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  6. Three dimensions of dissociative amnesia.

    Science.gov (United States)

    Dell, Paul F

    2013-01-01

    Principal axis factor analysis with promax rotation extracted 3 factors from the 42 memory and amnesia items of the Multidimensional Inventory of Dissociation (MID) database (N = 2,569): Discovering Dissociated Actions, Lapses of Recent Memory and Skills, and Gaps in Remote Memory. The 3 factors' shared variance ranged from 36% to 64%. Construed as scales, the 3 factor scales had Cronbach's alpha coefficients of .96, .94, and .93, respectively. The scales correlated strongly with mean Dissociative Experiences Scale scores, mean MID scores, and total scores on the Structured Clinical Interview for DSM-IV Dissociative Disorders-Revised (SCID-D-R). What is interesting is that the 3 amnesia factors exhibited a range of correlations with SCID-D-R Amnesia scores (.52, .63, and .70, respectively), suggesting that the SCID-D-R Amnesia score emphasizes gaps in remote memory over amnesias related to dissociative identity disorder. The 3 amnesia factor scales exhibited a clinically meaningful pattern of significant differences among dissociative identity disorder, dissociative disorder not otherwise specified-1, dissociative amnesia, depersonalization disorder, and nonclinical participants. The 3 amnesia factors may have greater clinical utility for frontline clinicians than (a) amnesia as discussed in the context of the Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition, nosology of the dissociative disorders or (b) P. Janet's (1893/1977 ) 4-fold classification of dissociative amnesia. The author recommends systematic study of the phenomenological differences within specific dissociative symptoms and their differential relationship to specific dissociative disorders.

  7. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  8. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  9. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.

    1994-08-01

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  10. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

    2017-04-15

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  11. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

    2017-01-01

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  12. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  13. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  14. Deploying Embodied AI into Virtual Worlds

    Science.gov (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  15. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  16. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  17. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  18. [Dissociative disorders and affective disorders].

    Science.gov (United States)

    Montant, J; Adida, M; Belzeaux, R; Cermolacce, M; Pringuey, D; Da Fonseca, D; Azorin, J-M

    2014-12-01

    The phenomenology of dissociative disorders may be complex and sometimes confusing. We describe here two cases who were initially misdiagnosed. The first case concerned a 61 year-old woman, who was initially diagnosed as an isolated dissociative fugue and was actually suffering from severe major depressive episode. The second case concerned a 55 year-old man, who was suffering from type I bipolar disorder and polyvascular disease, and was initially diagnosed as dissociative fugue in a mooddestabilization context, while it was finally a stroke. Yet dissociative disorders as affective disorder comorbidity are relatively unknown. We made a review on this topic. Dissociative disorders are often studied through psycho-trauma issues. Litterature is rare on affective illness comorbid with dissociative disorders, but highlight the link between bipolar and dissociative disorders. The later comorbidity often refers to an early onset subtype with also comorbid panic and depersonalization-derealization disorder. Besides, unipolar patients suffering from dissociative symptoms have more often cyclothymic affective temperament. Despite the limits of such studies dissociative symptoms-BD association seems to correspond to a clinical reality and further works on this topic may be warranted. Copyright © 2014 L’Encéphale. Published by Elsevier Masson SAS.. All rights reserved.

  19. Multiphoton dissociation of polyatomic molecules

    International Nuclear Information System (INIS)

    Schulz, P.A.

    1979-10-01

    The dynamics of infrared multiphoton excitation and dissociation of SF 6 was investigated under collision free conditions by a crossed laser-molecular beam method. In order to understand the excitation mechanism and to elucidate the requirements of laser intensity and energy fluence, a series of experiments were carried out to measure the dissociation yield dependences on energy fluence, vibrational temperature of SF 6 , the pulse duration of the CO 2 laser and the frequency in both one and two laser experiments. Translational energy distributions of the SF 5 dissociation product measured by time of flight and angular distributions and the dissociation lifetime of excited SF 6 as inferred from the observation of secondary dissociation of SF 5 into SF 4 and F during the laser pulse suggest that the dynamics of dissociation of excited molecules is dominated by complete energy randomization and rapid intramolecular energy transfer on a nanosecond timescale, and can be adequately described by RRKM theory. An improved phenomenological model including the initial intensity dependent excitation, a rate equation describing the absorption and stimulated emission of single photons, and the unimolecular dissociation of excited molecules is constructed based on available experimental results. The model shows that the energy fluence of the laser determines the excitation of molecules in the quasi-continuum and the excess energy with which molecules dissociate after the laser pulse. The role played by the laser intensity in multiphoton dissociation is more significant than just that of overcoming the intensity dependent absorption in the lowest levels. 63 references

  20. Strong-field dissociation dynamics

    International Nuclear Information System (INIS)

    DiMauro, L.F.; Yang, Baorui.

    1993-01-01

    The strong-field dissociation behavior of diatomic molecules is examined under two distinctive physical scenarios. In the first scenario, the dissociation of the isolated hydrogen and deuterium molecular ions is discussed. The dynamics of above-threshold dissociation (ATD) are investigated over a wide range of green and infrared intensities and compared to a dressed-state model. The second situation arises when strong-field neutral dissociation is followed by ionization of the atomic fragments. The study results in a direct measure of the atomic fragment's ac-Stark shift by observing the intensity-dependent shifts in the electron or nuclear fragment kinetic energy. 8 figs., 14 refs

  1. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  2. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  3. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  4. Why Don't Accounting Students like AIS?

    Science.gov (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi

    2011-01-01

    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  5. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  6. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  7. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  8. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  9. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  10. Dissociative State and Competence

    Directory of Open Access Journals (Sweden)

    Yu-Ju Lin

    2007-10-01

    Full Text Available This report presents the results of forensic evaluation of the civil competence of a case of alleged dissociative identity disorder (DID and discusses whether such dissociative states substantially jeopardize civil competence. A 40-year-old woman claimed that she had had many personalities since her college days. From the age of 37 to 40, she shopped excessively, which left her with millions of dollars of debt. She ascribed her shopping to a certain identity state, over which she had no control. (In this article, we use the term identity state to replace personality as an objective description of a mental state. She thus raised the petition of civil incompetence. During the forensic evaluation, it was found that the identity states were relatively stable and mutually aware of each other. The switch into another identity state was sometimes under voluntary control. The subject showed consistency and continuity in behavioral patterns across the different identity states, and no matter which identity state she was in, there was no evidence of impairment in her factual knowledge of social situations and her capacity for managing personal affairs. We hence concluded that she was civilly competent despite the claimed DID. Considering that the existence and diagnosis of DID are still under dispute and a diagnosis of DID alone is not sufficient to interdict a person's civil right, important clinical and forensic issues remain to be answered.

  11. Hyperglycemia associated dissociative fugue (organic dissociative disorder) in an elderly.

    Science.gov (United States)

    Ram, Dushad; Ashoka, H G; Gowdappa, Basavnna

    2015-01-01

    Inadequate glycemic control in patients with diabetes is known to be associated with psychiatric disorders such as depression, anxiety disorder, and cognitive impairment. However, dissociative syndrome has not been reported so far. Here we are reporting a case of repeated dissociative fugue associated with hyperglycemia, in an elderly with type II diabetes. Possible neurobiological mechanism has been discussed.

  12. Hyperglycemia associated dissociative fugue (organic dissociative disorder) in an elderly

    OpenAIRE

    Ram, Dushad; Ashoka, H. G; Gowdappa, Basavnna

    2015-01-01

    Inadequate glycemic control in patients with diabetes is known to be associated with psychiatric disorders such as depression, anxiety disorder, and cognitive impairment. However, dissociative syndrome has not been reported so far. Here we are reporting a case of repeated dissociative fugue associated with hyperglycemia, in an elderly with type II diabetes. Possible neurobiological mechanism has been discussed.

  13. Hyperglycemia associated dissociative fugue (organic dissociative disorder in an elderly

    Directory of Open Access Journals (Sweden)

    Dushad Ram

    2015-01-01

    Full Text Available Inadequate glycemic control in patients with diabetes is known to be associated with psychiatric disorders such as depression, anxiety disorder, and cognitive impairment. However, dissociative syndrome has not been reported so far. Here we are reporting a case of repeated dissociative fugue associated with hyperglycemia, in an elderly with type II diabetes. Possible neurobiological mechanism has been discussed.

  14. Dissociation: a developmental psychoneurobiological perspective

    African Journals Online (AJOL)

    Adele

    ... the stream of con- sciousness and memory.1 It is a frequent symptom of a range ... infant for long time spans in an extremely disturbed psycho- biological state that ... Advantage: Dissociation is adaptive in the short-term. Dissociation can be ...

  15. Dissociative recombination of dications

    International Nuclear Information System (INIS)

    Seiersen, K.; Heber, O.; Jensen, M.J.; Safvan, C.P.; Andersen, L. H.

    2003-01-01

    Dissociative recombination (DR) of doubly-charged positive ions has been studied at the heavy ion storage ring ASTRID. Low-energy electrons were scattered on the dication of the N 2 molecule, and the absolute cross section was measured in the energy range of 10 -4 -50 eV. From the measured cross section, a thermal rate coefficient of 5.8x10 -7 cm 3 s -1 at 300 K was extracted. Furthermore, we present new results on the CO 2+ DR rate, and a summary and comparison of measured DR rate coefficients for both the singly and doubly-charged ions of CO, CO 2 , and N 2 is presented

  16. Quarkonium dissociation by anisotropy

    Science.gov (United States)

    Chernicoff, Mariano; Fernández, Daniel; Mateos, David; Trancanelli, Diego

    2013-01-01

    We compute the screening length for quarkonium mesons moving through an anisotropic, strongly coupled mathcal{N} = 4 super Yang-Mills plasma by means of its gravity dual. We present the results for arbitrary velocities and orientations of the mesons, as well as for arbitrary values of the anisotropy. The anisotropic screening length can be larger or smaller than the isotropic one, and this depends on whether the comparison is made at equal temperatures or at equal entropy densities. For generic motion we find that: (i) mesons dissociate above a certain critical value of the anisotropy, even at zero temperature; (ii) there is a limiting velocity for mesons in the plasma, even at zero temperature; (iii) in the ultra-relativistic limit the screening length scales as (1 - v 2)ɛ with ɛ = 1 /2, in contrast with the isotropic result ɛ = 1 /4.

  17. Dissociation - a preliminary contextual model

    Directory of Open Access Journals (Sweden)

    C Krüger

    2007-02-01

    Full Text Available Background. The Diagnostic and Statistical Manual of Mental Disorders (DSM system has certain limitations when applied to two South African examples of dissociation, because it is descriptive (non-explanatory and focuses on intrapsychic (non-communal processes. Even the existing Western explanatory models of dissociation fail to accommodate fully the communal aspects of dissociation in our South African context. Objectives and methods. The aim was to explore an expanded perspective on dissociation that does not limit it to an intrapsychic phenomenon, but that accounts for the interrelatedness of individuals within their social context. Auto-ethnography was used. In this article a collective, socially orientated, contextual hermeneutic was applied to two local examples of dissociation. Three existing Western models were expanded along multicontextual, collective lines, for them to be more useful in the pluralistic South African context. Results. This preliminary contextual model of dissociation includes a person’s interpersonal, socio-cultural, and spiritual contexts, in addition to the intrapsychic context. Dissociation is considered to be a normal information-processing tool that maintains balanced, coherent selves-in-society, i.e. individuals connected to each other. In the South African context dissociation appears mostly as a normal phenomenon and seldom as a sign of mental illness. Dissociation is pivotal for the normal construction of individual and communal identities in the face of conflicting sets of information from various contexts. Dissociation may help individuals or communities to survive in a world of conflicting messages, where conflict is often interpersonal/cultural/societal in nature, rather than primarily intrapsychic. Conclusions. This model should be developed and evaluated further. Such evaluation would require suitable new local terminology.

  18. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  19. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  20. Developing Pokemon AI For Finding Comfortable Settings

    OpenAIRE

    Panumate, Chetprayoon; Iida, Hiroyuki

    2016-01-01

    This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

  1. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  2. Dissecting phenotypic variation among AIS patients

    International Nuclear Information System (INIS)

    Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

    2005-01-01

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  3. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  4. Dissociative symptomatology in cancer patients

    Science.gov (United States)

    Civilotti, Cristina; Castelli, Lorys; Binaschi, Luca; Cussino, Martina; Tesio, Valentina; Di Fini, Giulia; Veglia, Fabio; Torta, Riccardo

    2015-01-01

    Introduction: The utilization of the post-traumatic stress disorder (PTSD) diagnostic spectrum is currently being debated to categorize psychological adjustment in cancer patients. The aims of this study were to: (1) evaluate the presence of cancer-related traumatic dissociative symptomatology in a sample of cancer patients; (2) examine the correlation of cancer-related dissociation and sociodemographic and medical variables, anxiety, depression, and post-traumatic stress symptomatology; (3) investigate the predictors of cancer-related dissociation. Methods: Ninety-two mixed cancer patients (mean age: 58.94, ds = 10.13) recruited from two hospitals in northern Italy were administered a questionnaire on sociodemographic and medical characteristics, the Karnofsky Scale to measure the level of patient activity and medical care requirements, the Hospital Anxiety and Depression Scale (HADS) to evaluate the presence of anxiety and depression, the Impact of Event Scale Revised (IES-R) to assess the severity of intrusion, avoidance, and hypervigilance, and the Peritraumatic Dissociative Experiences Questionnaire (PDEQ) to quantify the traumatic dissociative symptomatology. Results: 31.5% of participants report a PDEQ score above the cutoff. The results indicated that dissociative symptomatology was positively correlated with HADS scores (HADS-Anxiety: r = 0.476, p dissociative symptomatology. The results converged on a three predictor model revealing that IES-R-Intrusion, IES-R-Avoidance, and IES-R-Hyperarousal accounted for 53.9% of the explained variance. Conclusion: These findings allow us to hypothesize a specific psychological reaction which may be ascribed to the traumatic spectrum within the context of cancer, emphasizing the close relationship between the origin of dissociative constituents which, according to the scientific literature, compose the traumatic experience. Our results have implications for understanding dissociative symptomatology in a cancer

  5. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  6. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  7. Dissociative absorption: An empirically unique, clinically relevant, dissociative factor.

    Science.gov (United States)

    Soffer-Dudek, Nirit; Lassri, Dana; Soffer-Dudek, Nir; Shahar, Golan

    2015-11-01

    Research of dissociative absorption has raised two questions: (a) Is absorption a unique dissociative factor within a three-factor structure, or a part of one general dissociative factor? Even when three factors are found, the specificity of the absorption factor is questionable. (b) Is absorption implicated in psychopathology? Although commonly viewed as "non-clinical" dissociation, absorption was recently hypothesized to be specifically associated with obsessive-compulsive symptoms. To address these questions, we conducted exploratory and confirmatory factor analyses on 679 undergraduates. Analyses supported the three-factor model, and a "purified" absorption scale was extracted from the original inclusive absorption factor. The purified scale predicted several psychopathology scales. As hypothesized, absorption was a stronger predictor of obsessive-compulsive symptoms than of general psychopathology. In addition, absorption was the only dissociative scale that longitudinally predicted obsessive-compulsive symptoms. We conclude that absorption is a unique and clinically relevant dissociative tendency that is particularly meaningful to obsessive-compulsive symptoms. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  9. Dissociation Energies of Diatomic Molecules

    International Nuclear Information System (INIS)

    Qun-Chao, Fan; Wei-Guo, Sun

    2008-01-01

    Molecular dissociation energies of 10 electronic states of alkali molecules of KH, 7 LiD, 7 LiH, 6 LiH, NaK, NaLi and NaRb are studied using the highest three accurate vibrational energies of each electronic state, and an improved parameter-free analytical formula which is obtained starting from the LeRoy–Bernstein vibrational energy expression near the dissociation limit. The results show that as long as the highest three vibrational energies are accurate, the current analytical formula will give accurate theoretical dissociation energies D e theory , which are in excellent agreement with the experimental dissociation energies D e expt . (atomic and molecular physics)

  10. Neural complexity, dissociation, and schizophrenia

    Czech Academy of Sciences Publication Activity Database

    Bob, P.; Šusta, M.; Chládek, Jan; Glaslová, K.; Fedor-Ferybergh, P.

    2007-01-01

    Roč. 13, č. 10 (2007), HY1-5 ISSN 1234-1010 Institutional research plan: CEZ:AV0Z20650511 Keywords : neural complexity * dissociation * schizophrenia Subject RIV: FH - Neurology Impact factor: 1.607, year: 2007

  11. Dissociative Tendencies and Traffic Incidents

    Directory of Open Access Journals (Sweden)

    Valle, Virginia

    2012-01-01

    Full Text Available This paper analyses the relationship between dissociative experiences and road traffic incidents (crashes and traffic tickets in drivers (n=295 from Mar del Plata (Argentina city. A self-report questionnaire was applied to assess traffic crash involvement and sociodemographic variables. Dissociative tendencies were assessed by a modified version of the DES scale. To examine differences in DES scores tests of the difference of means were applied. Drivers who reported to be previously involved in traffic incidents obtained higher puntuations in the dissociative experiences scale than drivers who did not report such events. This result is observed for the total scale and for the three sub-scales (absorption, amnesia and depersonalization. However, differences appeared mainly for minor damage collisions. Further studies are needed to evaluate the role of dissociative tendencies as a risk factor in road traffic safety.

  12. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  13. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  14. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  15. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  16. Dissociative electron attachment studies on acetone

    International Nuclear Information System (INIS)

    Prabhudesai, Vaibhav S.; Tadsare, Vishvesh; Ghosh, Sanat; Gope, Krishnendu; Davis, Daly; Krishnakumar, E.

    2014-01-01

    Dissociative electron attachment (DEA) to acetone is studied in terms of the absolute cross section for various fragment channels in the electron energy range of 0–20 eV. H − is found to be the most dominant fragment followed by O − and OH − with only one resonance peak between 8 and 9 eV. The DEA dynamics is studied by measuring the angular distribution and kinetic energy distribution of fragment anions using Velocity Slice Imaging technique. The kinetic energy and angular distribution of H − and O − fragments suggest a many body break-up for the lone resonance observed. The ab initio calculations show that electron is captured in the multi-centered anti-bonding molecular orbital which would lead to a many body break-up of the resonance

  17. Dissociative electron attachment studies on acetone

    Energy Technology Data Exchange (ETDEWEB)

    Prabhudesai, Vaibhav S., E-mail: vaibhav@tifr.res.in; Tadsare, Vishvesh; Ghosh, Sanat; Gope, Krishnendu; Davis, Daly; Krishnakumar, E. [Tata Institute of Fundamental Research, Homi Bhabha Road, Colaba, Mumbai 400005 (India)

    2014-10-28

    Dissociative electron attachment (DEA) to acetone is studied in terms of the absolute cross section for various fragment channels in the electron energy range of 0–20 eV. H{sup −} is found to be the most dominant fragment followed by O{sup −} and OH{sup −} with only one resonance peak between 8 and 9 eV. The DEA dynamics is studied by measuring the angular distribution and kinetic energy distribution of fragment anions using Velocity Slice Imaging technique. The kinetic energy and angular distribution of H{sup −} and O{sup −} fragments suggest a many body break-up for the lone resonance observed. The ab initio calculations show that electron is captured in the multi-centered anti-bonding molecular orbital which would lead to a many body break-up of the resonance.

  18. Atrioventricular Dissociation after Electroconvulsive Therapy

    Directory of Open Access Journals (Sweden)

    Siegfried William Yu

    2011-01-01

    Full Text Available Electroconvulsive therapy (ECT is increasingly used as a treatment for psychiatric disorders. Cardiac effects are the principal cause of medical complications in these patients. We report a case of atrioventricular (AV dissociation that occurred after ECT that was treated with pacemaker implantation. The mechanisms contributing to the onset of AV dissociation in this patient, and the management and rationale for device therapy, in light of the most recent guidelines, are reviewed.

  19. Feasibility of large-scale phosphoproteomics with higher energy collisional dissociation fragmentation

    DEFF Research Database (Denmark)

    Nagaraj, Nagarjuna; D'Souza, Rochelle C J; Cox, Juergen

    2010-01-01

    Mass spectrometry (MS)-based proteomics now enables the analysis of thousands of phosphorylation sites in single projects. Among a wide range of analytical approaches, the combination of high resolution MS scans in an Orbitrap analyzer with low resolution MS/MS scans in a linear ion trap has proven......-scale phosphoproteome analysis alongside collisional induced dissociation, (CID) and electron capture/transfer dissociation (ECD/ETD)....

  20. The implementation of AI technologies in computer wargames

    Science.gov (United States)

    Tiller, John A.

    2004-08-01

    Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

  1. Dissociative disorders in DSM-5.

    Science.gov (United States)

    Spiegel, David; Lewis-Fernández, Roberto; Lanius, Ruth; Vermetten, Eric; Simeon, Daphne; Friedman, Matthew

    2013-01-01

    The rationale, research literature, and proposed changes to the dissociative disorders and conversion disorder in the fifth edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5) are presented. Dissociative identity disorder will include reference to possession as well as identity fragmentation, to make the disorder more applicable to culturally diverse situations. Dissociative amnesia will include dissociative fugue as a subtype, since fugue is a rare disorder that always involves amnesia but does not always include confused wandering or loss of personality identity. Depersonalization disorder will include derealization as well, since the two often co-occur. A dissociative subtype of posttraumatic stress disorder (PTSD), defined by the presence of depersonalization or derealization in addition to other PTSD symptoms, is being recommended, based upon new epidemiological and neuroimaging evidence linking it to an early life history of adversity and a combination of frontal activation and limbic inhibition. Conversion disorder (functional neurological symptom disorder) will likely remain with the somatic symptom disorders, despite considerable dissociative comorbidity.

  2. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  3. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  4. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  5. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  6. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  7. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  8. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  9. Grammaire progressive du français avec 400 exercices : niveau avancé

    CERN Document Server

    Boularès, Michèle

    1997-01-01

    La Grammaire progressive du français, de niveau avancé, s'adresse à de grands adolescents et adultes ayant suivi environ 250 heures de cours.Par une méthode progressive, des exemples nombreux et pertinents pour renforcer les règles de grammaire, une langue authentique, cet ouvrage a pour objectif de rendre vivant et stimulant l'apprentissage de la grammaire.Elle présente et explique des points complexes (subjonctif, gérondif, adjectif verbal, participe présent...) et relie résolument la forme et le sens afin de ne pas dissocier grammaire et communication. La Grammaire progressive du français est une grammaire pédagogique: les explications grammaticales sont simples, le plus souvent de l'ordre de la phrase, elles utilisent un minimum de métalangage; des exemples clairs et nombreux illustrent chque explication grammaticale; la langue utilisée dans les exemples et les exercices est authentique. Quand l'exemple illustrant un point grammatical exige un niveau de langage soutenue, celui-ci est signalé...

  10. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  11. Integrating the Wall Street Journal into AIS Courses

    Science.gov (United States)

    Kohlmeyer, James M., III

    2008-01-01

    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  12. Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

    Science.gov (United States)

    Takashima, Junko; Ohsaki, Ayumi

    2002-12-01

    Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

  13. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  14. the Lexique kikongo–français by

    African Journals Online (AJOL)

    Gilles-Maurice de Schryver

    français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

  15. Radioimmunoassay of apolipoprotein A-I of rat serum

    International Nuclear Information System (INIS)

    Fainaru, M.; Havel, R.J.; Felker, T.E.

    1976-01-01

    A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

  16. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon

    2017-01-01

    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  17. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  18. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  19. Dipole-bound states as doorways in (dissociative) electron attachment

    International Nuclear Information System (INIS)

    Sommerfeld, Thomas

    2005-01-01

    This communication starts with a comparison of dissociative recombination and dissociative attachment placing emphasis on the role of resonances as reactive intermediates. The main focus is then the mechanism of electron attachment to polar molecules at very low energies (100 meV). The scheme considered consists of two steps: First, an electron is captured in a diffuse dipole-bound state depositing its energy in the vibrational degrees of freedom, in other words, a vibrational Feshbach resonance is formed. Then, owing to the coupling with a valence state, the electron is transferred into a compact valence orbital, and depending on the electron affinities of the valence state and possible dissociation products, as well as on the details of the intramolecular redistribution of vibrational energy, long-lived anions can be generated or dissociation reactions can be initiated. The key property in this context is the electronic coupling strength between the diffuse dipole-bound and the compact valence states. We describe how the coupling strength can be extracted from ab initio data, and present results for Nitromethane, Uracil and Cyanoacetylene

  20. [Dissociative identity disorder or schizophrenia?].

    Science.gov (United States)

    Tschöke, S; Steinert, T

    2010-01-01

    We present a case of dissociative identity disorder in which Schneiderian first rank symptoms were present besides of various states of consciousness. Thus the diagnosis of schizophrenia had to be considered. Formally, the symptoms met ICD-10 criteria for schizophrenia. However, taking into account the lack of formal thought disorder and of negative symptoms as well as a typical history of severe and prolonged traumatisation, we did not diagnose a co-morbid schizophrenic disorder. There is good evidence for the existence of psychotic symptoms among patients with dissociative disorders. However, in clinical practice this differential diagnosis is rarely considered.

  1. Diffraction dissociation at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Jenkovszky, Laszlo [Bogolyubov Institute for Theoretical Physics (BITP), Ukrainian National Academy of Sciences 14-b, Metrolohichna str., Kiev, 03680, Ukraine and Wigner Research Centre for Physics, Hungarian Academy of Sciences 1525 Budapest, POB 49 (Hungary); Orava, Risto [Institute of Physics, Division of Elementary Particle Physics, P.O. Box 64 (Gustaf Haellstroeminkatu 2a), FI-00014 University of Helsinki, Finland and CERN, CH-1211 Geneva 23 (Switzerland); Salii, Andrii [Bogolyubov Institute for Theoretical Physics (BITP), Ukrainian National Academy of Sciences 14-b, Metrolohichna str., Kiev, 03680 (Ukraine)

    2013-04-15

    We report on recent calculations of low missing mass single (SD) and double (DD) diffractive dissociation at LHC energies. The calculations are based on a dual-Regge model, dominated by a single Pomeron exchange. The diffractively excited states lie on the nucleon trajectory N*, appended by the isolated Roper resonance. Detailed predictions for the squared momentum transfer and missing mass dependence of the differential and integrated single-and double diffraction dissociation in the kinematical range of present and future LHC measurements are given.

  2. Diffraction dissociation at the LHC

    International Nuclear Information System (INIS)

    Jenkovszky, László; Orava, Risto; Salii, Andrii

    2013-01-01

    We report on recent calculations of low missing mass single (SD) and double (DD) diffractive dissociation at LHC energies. The calculations are based on a dual-Regge model, dominated by a single Pomeron exchange. The diffractively excited states lie on the nucleon trajectory N*, appended by the isolated Roper resonance. Detailed predictions for the squared momentum transfer and missing mass dependence of the differential and integrated single-and double diffraction dissociation in the kinematical range of present and future LHC measurements are given.

  3. Dissociative symptoms and dissociative disorders comorbidity in obsessive compulsive disorder: Symptom screening, diagnostic tools and reflections on treatment

    OpenAIRE

    Belli, Hasan

    2014-01-01

    Borderline personality disorder, conversion disorder and obsessive compulsive disorder frequently have dissociative symptoms. The literature has demonstrated that the level of dissociation might be correlated with the severity of obsessive compulsive disorder (OCD) and that those not responding to treatment had high dissociative symptoms. The structured clinical interview for DSM-IV dissociative disorders, dissociation questionnaire, somatoform dissociation questionnaire and dissociative expe...

  4. Dissociative symptoms and neuroendocrine dysregulation in depression.

    Science.gov (United States)

    Bob, Petr; Fedor-Freybergh, Peter; Jasova, Denisa; Bizik, Gustav; Susta, Marek; Pavlat, Josef; Zima, Tomas; Benakova, Hana; Raboch, Jiri

    2008-10-01

    Dissociative symptoms are traditionally attributed to psychological stressors that produce dissociated memories related to stressful life events. Dissociative disorders and dissociative symptoms including psychogenic amnesia, fugue, dissociative identity-disorder, depersonalization, derealization and other symptoms or syndromes have been reported as an epidemic psychiatric condition that may be coexistent with various psychiatric diagnoses such as depression, schizophrenia, borderline personality disorder or anxiety disorders. According to recent findings also the somatic components of dissociation may occur and influence brain, autonomic and neuroendocrine functions. At this time there are only few studies examining neuroendocrine response related to dissociative symptoms that suggest significant dysregulation of the hypothalamus-pituitary-adrenal (HPA) axis. The aim of the present study is to perform examination of HPA axis functioning indexed by basal cortisol and prolactin and test their relationship to psychic and somatoform dissociative symptoms. Basal cortisol and prolactin and psychic and somatoform dissociative symptoms were assessed in 40 consecutive inpatients with diagnosis of unipolar depression mean age 43.37 (SD=12.21). The results show that prolactin and cortisol as indices of HPA axis functioning manifest significant relationship to dissociative symptoms. Main results represent highly significant correlations obtained by simple regression between psychic dissociative symptoms (DES) and serum prolactin (R=0.55, p=0.00027), and between somatoform dissociation (SDQ-20) and serum cortisol (R=-0.38, p=0.015). These results indicate relationship between HPA-axis reactivity and dissociative symptoms in unipolar depressive patients that could reflect passive coping behavior and disengagement.

  5. DISSOCIATIVE DISORDERS IN DSM-5

    NARCIS (Netherlands)

    Spiegel, David; Loewenstein, Richard J.; Lewis-Fernandez, Roberto; Sar, Vedat; Simeon, Daphne; Vermetten, Eric; Cardena, Etzel; Dell, Paul F.

    Background: We present recommendations for revision of the diagnostic criteria for the Dissociative Disorders (DDs) for DSM-5. The periodic revision of the DSM provides an opportunity to revisit the assumptions underlying specific diagnoses and the empirical support, or lack of it, for the defining

  6. Hydrogen dissociation on metal surfaces

    NARCIS (Netherlands)

    Wijzenbroek, M.

    2016-01-01

    Dissociative chemisorption is an important reaction step in many catalytic reactions. An example of such a reaction is the Haber-Bosch process, which is used commercially to produce ammonia, an important starting material in the production of fertilisers. In theoretical descriptions of such chemical

  7. Energy localization and molecular dissociation

    International Nuclear Information System (INIS)

    Takeno, S.; Tsironis, G.P.

    2005-01-01

    We study analytically as well as numerically the role that large-amplitude vibrations play during the process of molecular dissociation. Our model consists of a linear three-atom molecule composed of identical atoms interacting with their nearest neighbors by Morse potentials. We find a close relation between energy localization and bond breaking and evaluate numerically the corresponding reaction paths

  8. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  9. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  10. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  11. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  12. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  13. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  14. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  15. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  16. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  17. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  18. Wave-packet approach to Rydberg resonances in dissociative recombination

    International Nuclear Information System (INIS)

    Morisset, Sabine; Pichl, Lukas; Orel, Ann E.; Schneider, Ioan F.

    2007-01-01

    We report the time-dependent approach to resonant electron capture into Rydberg states in collisions with molecular cations at low impact energy, as an alternative to the method based on multichannel quantum defect theory (MQDT), and present the results for the HD + ion. The propagation of the initial wave function on 13 Rydberg states (besides one valence state) correctly describes the indirect dissociative recombination mechanism in the time domain. Notably, the nonlocal coupling operator between the ionization and dissociation channels is accounted for in the indirect process, extending previous work on the case of direct coupling. The present approach compares to the MQDT framework with remarkable precision: resonant structures in the cross section correctly emerge from the wave-packet propagation; the time-dependent result also forms a cross section envelope for the dense series of ultrafine MQDT resonances corresponding to the quasicontinuous part of the Rydberg state manifold

  19. Global functioning and disability in dissociative disorders.

    Science.gov (United States)

    Mueller-Pfeiffer, Christoph; Rufibach, Kaspar; Perron, Noelle; Wyss, Daniela; Kuenzler, Cornelia; Prezewowsky, Cornelia; Pitman, Roger K; Rufer, Michael

    2012-12-30

    Dissociative disorders are frequent comorbid conditions of other mental disorders. Yet, there is controversy about their clinical relevance, and little systematic research has been done on how they influence global functioning. Outpatients and day care patients (N=160) of several psychiatric units in Switzerland were assessed with the Structured Clinical Interview for Diagnostic and Statistical Manual of Mental Disorders (DSM)-IV Axis I Disorders, Structured Clinical Interview for DSM-IV Dissociative Disorders, Global Assessment of Functioning Scale, and World Health Organization Disability Assessment Schedule-II. The association between subjects with a dissociative disorder (N=30) and functional impairment after accounting for non-dissociative axis I disorders was evaluated by linear regression models. We found a proportion of 18.8% dissociative disorders (dissociative amnesia=0%, dissociative fugue=0.6%, depersonalization disorder=4.4%, dissociative identity disorder=7.5%, dissociative disorder-not-otherwise-specified=6.3%) across treatment settings. Adjusted for other axis I disorders, subjects with a comorbid dissociative identity disorder or dissociative disorder-not-otherwise-specified had a median global assessment of functioning score that was 0.86 and 0.88 times, respectively, the score of subjects without a comorbid dissociative disorder. These findings support the hypothesis that complex dissociative disorders, i.e., dissociative identity disorder and dissociative disorder-not-otherwise-specified, contribute to functional impairment above and beyond the impact of co-existing non-dissociative axis I disorders, and that they qualify as "serious mental illness". Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  20. Dissociative Functions in the Normal Mourning Process.

    Science.gov (United States)

    Kauffman, Jeffrey

    1994-01-01

    Sees dissociative functions in mourning process as occurring in conjunction with integrative trends. Considers initial shock reaction in mourning as model of normal dissociation in mourning process. Dissociation is understood to be related to traumatic significance of death in human consciousness. Discerns four psychological categories of…

  1. Correlations in the hadronic double diffractive dissociation

    International Nuclear Information System (INIS)

    Goldegol, Alexandre.

    1991-05-01

    A given reaction of double diffractive dissociation is studied based on the three-component Deck Model. The correlations among the diffractive slope, the effective mass of the dissociated particle sub-system and the dissociation angle in the Gottfried-Jackson are studied based in this model. 9 refs, 19 figs

  2. Recent progresses on AI-2 bacterial quorum sensing inhibitors.

    Science.gov (United States)

    Zhu, Peng; Li, Minyong

    2012-01-01

    Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

  3. Expanding the Possibilities of AIS Data with Heuristics

    Directory of Open Access Journals (Sweden)

    Bjørnar Brende Smestad

    2017-06-01

    Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

  4. Creating an AI modeling application for designers and developers

    Science.gov (United States)

    Houlette, Ryan; Fu, Daniel; Jensen, Randy

    2003-09-01

    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  5. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  6. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    The AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  7. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  8. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  9. Effect of ketamine dose on self-rated dissociation in patients with treatment refractory anxiety disorders.

    Science.gov (United States)

    Castle, Cameron; Gray, Andrew; Neehoff, Shona; Glue, Paul

    2017-10-01

    Patients receiving ketamine for refractory depression and anxiety report dissociative symptoms in the first 60 min post-dose. The most commonly used instrument to assess this is the Clinician-Administered Dissociative States Scale (CADSS), developed based on the assessment of patients with dissociative symptoms. Its psychometric properties for ketamine-induced dissociation have not been reported. We evaluated these from a study using 0.25-1 mg/kg ketamine and midazolam (as an active control) in 18 patients with treatment-resistant anxiety. Dissociation ratings were increased by ketamine in a dose-dependent manner. In contrast, midazolam showed no effect on ratings of dissociation. For individual CADSS items, the magnitude of change and the ketamine dose at which changes were observed were not homogenous. The Cronbach alpha for the total scale was high (0.937), with acceptable item-rest correlations for almost all individual items. Purposefully removing items to maximise alpha did not lead to meaningful improvements. Acceptable internal consistency was still observed after removing items which lacked evidence of responsiveness at lower doses. The high Cronbach alpha values identified in this study suggests that the CADSS is an internally consistent instrument for evaluating ketamine-induced dissociation in clinical trials in anxiety, although it does not capture symptoms such as thought disorder.

  10. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  11. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  12. Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

    OpenAIRE

    Darty , Kevin; Sabouret , Nicolas

    2012-01-01

    International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

  13. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  14. AI, Native Supercomputing and The Revival of Moore's Law

    OpenAIRE

    Lu, Chien-Ping

    2017-01-01

    Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

  15. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Directory of Open Access Journals (Sweden)

    Endang W. Bachtiar

    2014-07-01

    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  16. Highlights on artificial insemination (AI technology in the pig

    Directory of Open Access Journals (Sweden)

    Tarek Khalifa

    2014-03-01

    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  17. Calibrating AIS images using the surface as a reference

    Science.gov (United States)

    Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

    1987-01-01

    A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

  18. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  19. Single-electron capture in He2+-D2 collisions

    International Nuclear Information System (INIS)

    Bordenave-Montesquieu, D.; Dagnac, R.

    1994-01-01

    Doubly differential cross sections of single-electron capture were measured for He 2+ impinging on a molecular deuterium target. The investigated collision energies are 4, 6 and 8 keV and the scattering angles range from 10' to 2 o 30' (laboratory frame). The exothermic capture leading to He + (1s) + D 2 +* was found to be the most important process at low energies and angles, whereas the endothermic channels leading to dissociative capture become the main processes at high scattering angles, i.e. at small impact parameters. (author)

  20. Hydrogen dissociation on metal surfaces

    OpenAIRE

    Wijzenbroek, M.

    2016-01-01

    Dissociative chemisorption is an important reaction step in many catalytic reactions. An example of such a reaction is the Haber-Bosch process, which is used commercially to produce ammonia, an important starting material in the production of fertilisers. In theoretical descriptions of such chemical processes often approximations need to be made in order to keep the computational cost feasible, such as fixing the surface atoms in place, rather than allowing them to vibrate. In this work, seve...

  1. Diffraction dissociation and elastic scattering

    International Nuclear Information System (INIS)

    Verebryusov, V.S.; Ponomarev, L.A.; Smorodinskaya, N.Ya.

    1987-01-01

    In the framework of Regge scheme with supercritical pomeron a model is suggested for the NN-scattering amplitude which takes into account the contribution introduced to the intermediate state by diffraction dissociation (DD) processes. The DD amplitude is written in terms of the Deck model which has been previously applied to describing the main DD features. The calculated NN cross sections are compared with those obtained experimentally. Theoretical predictions for higher energy are presented

  2. Dissociative Photoionization of Diethyl Ether.

    Science.gov (United States)

    Voronova, Krisztina; Mozaffari Easter, Chrissa M; Covert, Kyle J; Bodi, Andras; Hemberger, Patrick; Sztáray, Bálint

    2015-10-29

    The dissociative photoionization of internal energy selected diethyl ether ions was investigated by imaging photoelectron photoion coincidence spectroscopy. In a large, 5 eV energy range Et2O(+) cations decay by two parallel and three sequential dissociative photoionization channels, which can be modeled well using statistical theory. The 0 K appearance energies of the CH3CHOCH2CH3(+) (H-loss, m/z = 73) and CH3CH2O═CH2(+) (methyl-loss, m/z = 59) fragment ions were determined to be 10.419 ± 0.015 and 10.484 ± 0.008 eV, respectively. The reemergence of the hydrogen-loss ion above 11 eV is attributed to transition-state (TS) switching, in which the second, outer TS is rate-determining at high internal energies. At 11.81 ± 0.05 eV, a secondary fragment of the CH3CHOCH2CH3(+) (m/z = 73) ion, protonated acetaldehyde, CH3CH═OH(+) (m/z = 45) appears. On the basis of the known thermochemical onset of this fragment, a reverse barrier of 325 meV was found. Two more sequential dissociation reactions were examined, namely, ethylene and formaldehyde losses from the methyl-loss daughter ion. The 0 K appearance energies of 11.85 ± 0.07 and 12.20 ± 0.08 eV, respectively, indicate no reverse barrier in these processes. The statistical model of the dissociative photoionization can also be used to predict the fractional ion abundances in threshold photoionization at large temperatures, which could be of use in, for example, combustion diagnostics.

  3. Autonoesis and dissociative identity disorder.

    Science.gov (United States)

    Morton, John

    2018-01-01

    Dissociative identity disorder is characterised by the presence in one individual of two or more alternative personality states (alters). For such individuals, the memory representation of a particular event can have full episodic, autonoetic status for one alter, while having the status of knowledge or even being inaccessible to a second alter. This phenomenon appears to create difficulties for a purely representational theory and is presented to Mahr & Csibra (M&C) for their consideration.

  4. [Clinical Handling of Patients with Dissociative Disorders].

    Science.gov (United States)

    Okano, Kenichiro

    2015-01-01

    This paper discusses the way informed psychiatrists are expected to handle dissociative patients in clinical situations, with a specific focus on dissociative identity disorders and dissociative fugue. On the initial interview with dissociative patients, information on their history of trauma and any nascent dissociative symptoms in their childhood should be carefully obtained. Their level of stress in their current life should also be assessed in order to understand their symptomatology, as well as to predict their future clinical course. A psychoeducational approach is crucial; it might be helpful to give information on dissociative disorder to these patients as well as their family members in order to promote their adherence to treatment. Regarding the symptomatology of dissociative disorders, detailed symptoms and the general clinical course are presented. It was stressed that dissociative identity disorder and dissociative fugue, the most high-profile dissociative disorders, are essentially different in their etiology and clinical presentation. Dissociative disorders are often confused with and misdiagnosed as psychotic disorders, such as schizophrenia. Other conditions considered in terms of the differential diagnosis include borderline personality disorder as well as temporal lobe epilepsy. Lastly, the therapeutic approach to dissociative identity disorder is discussed. Each dissociative identity should be understood as potentially representing some traumatically stressful event in the past. The therapist should be careful not to excessively promote the creation or elaboration of any dissociative identities. Three stages are proposed in the individual psychotherapeutic process. In the initial stage, a secure environment and stabilization of symptoms should be sought. The second stage consists of aiding the "host" personality to make use of other more adaptive coping skills in their life. The third stage involves coaching as well as continuous awareness of

  5. Radiative electron capture

    International Nuclear Information System (INIS)

    Biggerstaff, J.A.; Appleton, B.R.; Datz, S.; Moak, C.D.; Neelavathi, V.N.; Noggle, T.S.; Ritchie, R.H.; VerBeek, H.

    1975-01-01

    Some data are presented for radiative electron capture by fast moving ions. The radiative electron capture spectrum is shown for O 8+ in Ag, along with the energy dependence of the capture cross-section. A discrepancy between earlier data, theoretical prediction, and the present data is pointed out. (3 figs) (U.S.)

  6. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2012-11-15

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

  7. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  8. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  9. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  10. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  11. Comparison of electromagnetic and nuclear dissociation of 17Ne

    Science.gov (United States)

    Wamers, F.; Marganiec, J.; Aksouh, F.; Aksyutina, Yu.; Alvarez-Pol, H.; Aumann, T.; Beceiro-Novo, S.; Bertulani, C. A.; Boretzky, K.; Borge, M. J. G.; Chartier, M.; Chatillon, A.; Chulkov, L. V.; Cortina-Gil, D.; Emling, H.; Ershova, O.; Fraile, L. M.; Fynbo, H. O. U.; Galaviz, D.; Geissel, H.; Heil, M.; Hoffmann, D. H. H.; Hoffman, J.; Johansson, H. T.; Jonson, B.; Karagiannis, C.; Kiselev, O. A.; Kratz, J. V.; Kulessa, R.; Kurz, N.; Langer, C.; Lantz, M.; Le Bleis, T.; Lehr, C.; Lemmon, R.; Litvinov, Yu. A.; Mahata, K.; Müntz, C.; Nilsson, T.; Nociforo, C.; Ott, W.; Panin, V.; Paschalis, S.; Perea, A.; Plag, R.; Reifarth, R.; Richter, A.; Riisager, K.; Rodriguez-Tajes, C.; Rossi, D.; Savran, D.; Schrieder, G.; Simon, H.; Stroth, J.; Sümmerer, K.; Tengblad, O.; Typel, S.; Weick, H.; Wiescher, M.; Wimmer, C.

    2018-03-01

    The Borromean drip-line nucleus 17Ne has been suggested to possess a two-proton halo structure in its ground state. In the astrophysical r p -process, where the two-proton capture reaction 15O(2 p ,γ )17Ne plays an important role, the calculated reaction rate differs by several orders of magnitude between different theoretical approaches. To add to the understanding of the 17Ne structure we have studied nuclear and electromagnetic dissociation. A 500 MeV/u 17Ne beam was directed toward lead, carbon, and polyethylene targets. Oxygen isotopes in the final state were measured in coincidence with one or two protons. Different reaction branches in the dissociation of 17Ne were disentangled. The relative populations of s and d states in 16F were determined for light and heavy targets. The differential cross section for electromagnetic dissociation (EMD) shows a continuous internal energy spectrum in the three-body system 15O+2 p . The 17Ne EMD data were compared to current theoretical models. None of them, however, yields satisfactory agreement with the experimental data presented here. These new data may facilitate future development of adequate models for description of the fragmentation process.

  12. Electron scattering resonances and dissociative attachment in polyatomic molecules

    International Nuclear Information System (INIS)

    Olthoff, J.K.

    1985-01-01

    A relatively new technique, electron transmission spectroscopic, is now being used to investigate the unoccupied valence molecular orbitals of many chemical compounds. Electron-transmission spectroscopy measures the energy of negative ion states that arise from electron capture into unoccupied molecular orbitals. Additional information about the unoccupied orbitals may be obtained if the negative ion decays by way of dissociation. Determination of the identity, kinetic energy, and production rates of stable ion fragments supplies information about the shape and position of the potential energy curves which describe the electronic states of the molecule and the anion. Used together, photoelectron, electron transmission, and dissociation data can produce a complete picture of a molecule's valence electronic structure. For this work, a time-of-flight mass spectrometer was attached to an electron transmission spectrometer to observe negative ion fragments due to dissociative attachment. The mass spectrometer measures the identify and kinetic energy of stable negative ions as a function of incident electron energy. Electron transmission spectra and ion production data were acquired for many compounds in four chemical categories

  13. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  14. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  15. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  16. Dissociable Fronto-Operculum-Insula Control Signals for Anticipation and Detection of Inhibitory Sensory Cue.

    Science.gov (United States)

    Cai, Weidong; Chen, Tianwen; Ide, Jaime S; Li, Chiang-Shan R; Menon, Vinod

    2017-08-01

    The ability to anticipate and detect behaviorally salient stimuli is important for virtually all adaptive behaviors, including inhibitory control that requires the withholding of prepotent responses when instructed by external cues. Although right fronto-operculum-insula (FOI), encompassing the anterior insular cortex (rAI) and inferior frontal cortex (rIFC), involvement in inhibitory control is well established, little is known about signaling mechanisms underlying their differential roles in detection and anticipation of salient inhibitory cues. Here we use 2 independent functional magnetic resonance imaging data sets to investigate dynamic causal interactions of the rAI and rIFC, with sensory cortex during detection and anticipation of inhibitory cues. Across 2 different experiments involving auditory and visual inhibitory cues, we demonstrate that primary sensory cortex has a stronger causal influence on rAI than on rIFC, suggesting a greater role for the rAI in detection of salient inhibitory cues. Crucially, a Bayesian prediction model of subjective trial-by-trial changes in inhibitory cue anticipation revealed that the strength of causal influences from rIFC to rAI increased significantly on trials in which participants had higher anticipation of inhibitory cues. Together, these results demonstrate the dissociable bottom-up and top-down roles of distinct FOI regions in detection and anticipation of behaviorally salient cues across multiple sensory modalities. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  17. Experimentally-induced dissociation impairs visual memory.

    Science.gov (United States)

    Brewin, Chris R; Mersaditabari, Niloufar

    2013-12-01

    Dissociation is a phenomenon common in a number of psychological disorders and has been frequently suggested to impair memory for traumatic events. In this study we explored the effects of dissociation on visual memory. A dissociative state was induced experimentally using a mirror-gazing task and its short-term effects on memory performance were investigated. Sixty healthy individuals took part in the experiment. Induced dissociation impaired visual memory performance relative to a control condition; however, the degree of dissociation was not associated with lower memory scores in the experimental group. The results have theoretical and practical implications for individuals who experience frequent dissociative states such as patients with posttraumatic stress disorder (PTSD). Copyright © 2013 Elsevier Inc. All rights reserved.

  18. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  19. Analysis of raw AIS spectrum recordings from a LEO satellite

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  20. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  1. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  2. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  3. Procedure for Marine Traffic Simulation with AIS Data

    Directory of Open Access Journals (Sweden)

    Rina Miyake

    2015-03-01

    Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

  4. Diffractive dissociation and new quarks

    International Nuclear Information System (INIS)

    White, A.R.

    1983-04-01

    We argue that the chiral limit of QCD can be identified with the strong (diffractive dissociation) coupling limit of reggeon field theory. Critical Pomeron scaling at high energy must then be directly related to an infra-red fixed-point of massless QCD and so requires a large number of flavors. This gives a direct argument that the emergence of diffraction-peak scaling, KNO scaling etc. at anti p-p colliders are evidence of a substantial quark structure still to be discovered

  5. [Characteristics of Bacillus cereus dissociants].

    Science.gov (United States)

    Doroshenko, E V; Loĭko, N G; Il'inskaia, O N; Kolpakov, A I; Gornova, I B; Klimanova, E V; El'-Registan, G I

    2001-01-01

    The autoregulation of the phenotypic (populational) variability of the Bacillus cereus strain 504 was studied. The isolated colonial morphotypes of this bacterium were found to differ in their growth characteristics and the synthesis of extracellular proteases. The phenotypic variabilities of vegetative proliferating cells and those germinated from endospores and cystlike refractory cells were different. Bacterial variants also differed in the production of the d1 and d2 factors (the autoinducers of dormancy and autolysis, respectively) and sensitivity to them. The possible role of these factors in the dissociation of microorganisms is discussed.

  6. Collision-induced dissociation of diatomic ions

    International Nuclear Information System (INIS)

    Los, J.; Govers, T.R.

    1978-01-01

    An attempt is made to illustrate how mass spectrometric studies of dissociation in diatomic molecular ions can provide information on the dynamics of these collisions and on the predissociative states involved. Restriction is made to primary beam energies of the order of at least keV. The review covers the dynamics of dissociation, experimental techniques, direct dissociation in heavy-particle collisions, and translational spectroscopy. 120 references

  7. Mirror Writing and a Dissociative Identity Disorder

    OpenAIRE

    Le, Catherine; Smith, Joyce; Cohen, Lewis

    2009-01-01

    Individuals with dissociative identity disorder (DID) have been known to show varied skills and talents as they change from one dissociative state to another. For example, case reports have described people who have changed their handedness or have spoken foreign languages during their dissociative states. During an interview with a patient with DID, a surprising talent emerged when she wrote a sentence for the Folstein Mini-Mental State Exam—mirror writing. It is not known whether her mirror...

  8. Collisional Cascades Following Triton's Capture

    Science.gov (United States)

    Cuk, Matija; Hamilton, Douglas P.; Stewart-Mukhopadhyay, Sarah T.

    2017-10-01

    Neptune's moon Triton is widely thought to have been captured from heliocentric orbit, most likely through binary dissociation (Agnor and Hamilton, 2006). Triton's original eccentric orbit must have been subsequently circularized by satellite tides (Goldreich et al. 1989). Cuk and Gladman (2005) found that Kozai oscillations make early tidal evolution inefficient, and have proposed that collisions between Triton and debris from pre-existing satellites was the dominant mechanism of shrinking Triton's large post-capture orbit. However, Cuk and Hamilton (DPS 2016), using numerical simulations and results of Stewart and Leinhardt (2012), have found that collisions between regular satellites are unlikely to be destructive, while collisions between prograde moons and Triton are certainly erosive if not catastrophic. An obvious outcome would be pre-existing moon material gradually grinding down Triton and making it reaccrete in the local Laplace plane, in conflict with Triton's large current inclination. We propose that the crucial ingredient for understanding the early evolution of the Neptunian system are the collisions between the moons and the prograde and retrograde debris originating from the pre-existing moons and Triton. In particular, we expect early erosive impact(s) on Triton to generate debris that will, in subsequent collisions, disrupt the regular satellites. If the retrograde material were to dominate at some planetocentric distances, the end result may be a large cloud or disk of retrograde debris that would be accreted by Triton, shrinking Triton's orbit. Some of the prograde debris could survive in a compact disk interior to Triton's pericenter, eventually forming the inner moons of Neptune. We will present results of numerical modeling of these complex dynamical processes at the meeting.

  9. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  10. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  11. Mirror Writing and a Dissociative Identity Disorder

    Directory of Open Access Journals (Sweden)

    Catherine Le

    2009-01-01

    Full Text Available Individuals with dissociative identity disorder (DID have been known to show varied skills and talents as they change from one dissociative state to another. For example, case reports have described people who have changed their handedness or have spoken foreign languages during their dissociative states. During an interview with a patient with DID, a surprising talent emerged when she wrote a sentence for the Folstein Mini-Mental State Exam—mirror writing. It is not known whether her mirror writing had a deeper level of meaning; however, it does emphasize the idiosyncratic nature of dissociative identity disorder.

  12. Mirror writing and a dissociative identity disorder.

    Science.gov (United States)

    Le, Catherine; Smith, Joyce; Cohen, Lewis

    2009-01-01

    Individuals with dissociative identity disorder (DID) have been known to show varied skills and talents as they change from one dissociative state to another. For example, case reports have described people who have changed their handedness or have spoken foreign languages during their dissociative states. During an interview with a patient with DID, a surprising talent emerged when she wrote a sentence for the Folstein Mini-Mental State Exam-mirror writing. It is not known whether her mirror writing had a deeper level of meaning; however, it does emphasize the idiosyncratic nature of dissociative identity disorder.

  13. Coulomb dissociation of 8B at 254 MeV/u

    International Nuclear Information System (INIS)

    Surowka, G.; Iwasa, N.; Boue, F.

    1999-01-01

    As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)

  14. Dissociative symptoms and dissociative disorder comorbidity in patients with obsessive-compulsive disorder.

    Science.gov (United States)

    Belli, Hasan; Ural, Cenk; Vardar, Melek Kanarya; Yesılyurt, Sema; Oncu, Fatıh

    2012-10-01

    The present study attempted to assess the dissociative symptoms and overall dissociative disorder comorbidity in patients with obsessive-compulsive disorder (OCD). In addition, we examined the relationship between the severity of obsessive-compulsive symptoms and dissociative symptoms. All patients admitted for the first time to the psychiatric outpatient unit were included in the study. Seventy-eight patients had been diagnosed as having OCD during the 2-year study period. Patients had to meet the Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition criteria for OCD. Most (76.9%; n = 60) of the patients were female, and 23.1% (n = 18) of the patients were male. Dissociation Questionnaire was used to measure dissociative symptoms. The Structured Clinical Interview for Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition Dissociative Disorders interviews and Yale-Brown Obsessive Compulsive Checklist and Severity Scale were used. Eleven (14%) of the patients with OCD had comorbid dissociative disorder. The most prevalent disorder in our study was dissociative depersonalization disorder. Dissociative amnesia and dissociative identity disorder were common as well. The mean Yale-Brown score was 23.37 ± 7.27 points. Dissociation Questionnaire scores were between 0.40 and 3.87 points, and the mean was 2.23 ± 0.76 points. There was a statistically significant positive correlation between Yale-Brown points and Dissociation Questionnaire points. We conclude that dissociative symptoms among patients with OCD should alert clinicians for the presence of a chronic and complex dissociative disorder. Clinicians may overlook an underlying dissociative process in patients who have severe symptoms of OCD. However, a lack of adequate response to cognitive-behavioral and drug therapy may be a consequence of dissociative process. Copyright © 2012 Elsevier Inc. All rights reserved.

  15. Dissociative identity disorder: Medicolegal challenges.

    Science.gov (United States)

    Farrell, Helen M

    2011-01-01

    Persons with dissociative identity disorder (DID) often present in the criminal justice system rather than the mental health system and perplex experts in both professions. DID is a controversial diagnosis with important medicolegal implications. Defendants have claimed that they committed serious crimes, including rape or murder, while they were in a dissociated state. Asserting that their alter personality committed the bad act, defendants have pleaded not guilty by reason of insanity (NGRI). In such instances, forensic experts are asked to assess the defendant for DID and provide testimony in court. Debate continues over whether DID truly exists, whether expert testimony should be allowed into evidence, and whether it should exculpate defendants for their criminal acts. This article reviews historical and theoretical perspectives on DID, presents cases that illustrate the legal implications and controversies of raising an insanity defense based on multiple personalities, and examines the role of forensic experts asked to comment on DID with the goal of assisting clinicians in the medicolegal assessment of DID in relation to crimes.

  16. From dissociation to trauma? Individual differences in dissociation as predictor of 'trauma' perception

    NARCIS (Netherlands)

    Rassin, Eric; van Rootselaar, Anne-Fleur

    2006-01-01

    In clinical literature, dissociative complaints are generally considered to be the result of traumatic experiences. However, it has been argued that dissociative complaints, in turn, may indulge over-reporting of traumatic experiences. Hence, correlations between dissociation and self-reported

  17. Dissociation in patients with dissociative seizures: relationships with trauma and seizure symptoms.

    Science.gov (United States)

    Pick, S; Mellers, J D C; Goldstein, L H

    2017-05-01

    This study aimed to extend the current understanding of dissociative symptoms experienced by patients with dissociative (psychogenic, non-epileptic) seizures (DS), including psychological and somatoform types of symptomatology. An additional aim was to assess possible relationships between dissociation, traumatic experiences, post-traumatic symptoms and seizure manifestations in this group. A total of 40 patients with DS were compared with a healthy control group (n = 43), matched on relevant demographic characteristics. Participants completed several self-report questionnaires, including the Multiscale Dissociation Inventory (MDI), Somatoform Dissociation Questionnaire-20, Traumatic Experiences Checklist and the Post-Traumatic Diagnostic Scale. Measures of seizure symptoms and current emotional distress (Hospital Anxiety and Depression Scale) were also administered. The clinical group reported significantly more psychological and somatoform dissociative symptoms, trauma, perceived impact of trauma, and post-traumatic symptoms than controls. Some dissociative symptoms (i.e. MDI disengagement, MDI depersonalization, MDI derealization, MDI memory disturbance, and somatoform dissociation scores) were elevated even after controlling for emotional distress; MDI depersonalization scores correlated positively with trauma scores while seizure symptoms correlated with MDI depersonalization, derealization and identity dissociation scores. Exploratory analyses indicated that somatoform dissociation specifically mediated the relationship between reported sexual abuse and DS diagnosis, along with depressive symptoms. A range of psychological and somatoform dissociative symptoms, traumatic experiences and post-traumatic symptoms are elevated in patients with DS relative to healthy controls, and seem related to seizure manifestations. Further studies are needed to explore peri-ictal dissociative experiences in more detail.

  18. Stimulus-driven capture and contingent capture

    NARCIS (Netherlands)

    Theeuwes, J.; Olivers, C.N.L.; Belopolsky, A.V.

    2010-01-01

    Whether or not certain physical events can capture attention has been one of the most debated issues in the study of attention. This discussion is concerned with how goal-directed and stimulus-driven processes interact in perception and cognition. On one extreme of the spectrum is the idea that

  19. A Note on the Lithuanian 2nd Sg. Ending "-ai."

    Science.gov (United States)

    Schmalstieg, William R.

    1980-01-01

    Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

  20. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  1. Archiving AIS messages in a Geo-DBMS

    NARCIS (Netherlands)

    Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

    2017-01-01

    This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

  2. PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

    African Journals Online (AJOL)

    PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

  3. The hidden dangers of experimenting in distributed AI

    NARCIS (Netherlands)

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

    2006-01-01

    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  4. The 2010 Mario AI Championship: Level Generation Track

    DEFF Research Database (Denmark)

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

    2011-01-01

    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  5. AIS reception from a CubeSat in LEO

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2013-01-01

    The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

  6. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  7. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  8. Measuring the Value of AI in Space Science and Exploration

    Science.gov (United States)

    Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

    2017-10-01

    FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

  9. On the homotopy equivalence of simple AI-algebras

    International Nuclear Information System (INIS)

    Aristov, O Yu

    1999-01-01

    Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

  10. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  11. Predicting Vessel Trajectories from Ais Data Using R

    Science.gov (United States)

    2017-06-01

    Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

  12. Capture ready study

    Energy Technology Data Exchange (ETDEWEB)

    Minchener, A.

    2007-07-15

    There are a large number of ways in which the capture of carbon as carbon dioxide (CO{sub 2}) can be integrated into fossil fuel power stations, most being applicable for both gas and coal feedstocks. To add to the choice of technology is the question of whether an existing plant should be retrofitted for capture, or whether it is more attractive to build totally new. This miscellany of choices adds considerably to the commercial risk of investing in a large power station. An intermediate stage between the non-capture and full capture state would be advantageous in helping to determine the best way forward and hence reduce those risks. In recent years the term 'carbon capture ready' or 'capture ready' has been coined to describe such an intermediate stage plant and is now widely used. However a detailed and all-encompassing definition of this term has never been published. All fossil fuel consuming plant produce a carbon dioxide gas byproduct. There is a possibility of scrubbing it with an appropriate CO{sub 2} solvent. Hence it could be said that all fossil fuel plant is in a condition for removal of its CO{sub 2} effluent and therefore already in a 'capture ready' state. Evidently, the practical reality of solvent scrubbing could cost more than the rewards offered by such as the ETS (European Trading Scheme). In which case, it can be said that although the possibility exists of capturing CO{sub 2}, it is not a commercially viable option and therefore the plant could not be described as ready for CO{sub 2} capture. The boundary between a capture ready and a non-capture ready condition using this definition cannot be determined in an objective and therefore universally acceptable way and criteria must be found which are less onerous and less potentially contentious to assess. 16 refs., 2 annexes.

  13. Dissociation and the Development of Psychopathology.

    Science.gov (United States)

    Putnam, Frank W.; Trickett, Penelope K.

    This paper reviews the research on dissociation and the development of psychopathology in children and adolescents. Definitions and dimensions of dissociation are addressed, noting its range from normative daydreaming to the extremes found in individuals with multiple personality disorder. Memory dysfunctions, disturbances of identity, passive…

  14. Inflight dissociation of zircon in air plasma

    Energy Technology Data Exchange (ETDEWEB)

    Yugeswaran, S; Selvarajan, V [Bharathiar University, Coimbatore 641046 (India); Ananthapadmanabhan, P V; Thiyagarajan, T K [Laser and Plasma Technology Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Nair, Janardhanan [Ion Arc Technologies Pvt Ltd, Coimbatore (India)

    2010-02-01

    Thermal dissociation of zircon can be conveniently carried out in a plasma reactor, which is characterized by high temperature, high energy density and high quench rate. Zirconia is recovered from this partially dissociated zircon by alkali leaching. Dissociation of zircon has been conventionally carried out in argon gas, which is expensive. The present paper reports experimental results on thermal dissociation of zircon in air plasma medium. Process simulation for 'inflight' dissociation of zircon in air plasma medium is also presented. The experimental system consists of a central hollow graphite electrode, which acts as the cathode and a graphite anode. The material to be processed is fed centrally through the cathode. The unique feature of the system is that it uses air as the working gas to generate the thermal plasma. The system has been used to study in-flight dissociation of zircon in the thermal plasma jet. Dissociation was carried out over 10-25 kW power range. Results of the study indicate that complete dissociation of zircon to ZrO{sub 2} and silica could be accomplished at 25 kW in air plasma.

  15. Inflight dissociation of zircon in air plasma

    International Nuclear Information System (INIS)

    Yugeswaran, S; Selvarajan, V; Ananthapadmanabhan, P V; Thiyagarajan, T K; Nair, Janardhanan

    2010-01-01

    Thermal dissociation of zircon can be conveniently carried out in a plasma reactor, which is characterized by high temperature, high energy density and high quench rate. Zirconia is recovered from this partially dissociated zircon by alkali leaching. Dissociation of zircon has been conventionally carried out in argon gas, which is expensive. The present paper reports experimental results on thermal dissociation of zircon in air plasma medium. Process simulation for 'inflight' dissociation of zircon in air plasma medium is also presented. The experimental system consists of a central hollow graphite electrode, which acts as the cathode and a graphite anode. The material to be processed is fed centrally through the cathode. The unique feature of the system is that it uses air as the working gas to generate the thermal plasma. The system has been used to study in-flight dissociation of zircon in the thermal plasma jet. Dissociation was carried out over 10-25 kW power range. Results of the study indicate that complete dissociation of zircon to ZrO 2 and silica could be accomplished at 25 kW in air plasma.

  16. Coulomb dissociation of N-20,N-21

    NARCIS (Netherlands)

    Roeder, Marko; Adachi, Tatsuya; Aksyutina, Yulia; Alcantara, Juan; Altstadt, Sebastian; Alvarez-Pol, Hector; Ashwood, Nicholas; Atar, Leyla; Aumann, Thomas; Avdeichikov, Vladimir; Barr, M.; Beceiro, Saul; Bemmerer, Daniel; Benlliure, Jose; Bertulani, Carlos; Boretzky, Konstanze; Borge, Maria J. G.; Burgunder, G.; Caamano, Manuel; Caesar, Christoph; Casarejos, Enrique; Catford, Wilton; Cederkall, Joakim; Chakraborty, S.; Chartier, Marielle; Chulkov, Leonid; Cortina-Gil, Dolores; Crespo, Raquel; Pramanik, Ushasi Datta; Diaz-Fernandez, Paloma; Dillmann, Iris; Elekes, Zoltan; Enders, Joachim; Ershova, Olga; Estrade, A.; Farinon, F.; Fraile, Luis M.; Freer, Martin; Freudenberger, M.; Fynbo, Hans; Galaviz, Daniel; Geissel, Hans; Gernhaeuser, Roman; Goebel, Kathrin; Kalantar-Nayestanaki, Nasser; Najafi, Mohammad Ali; Rigollet, Catherine; Stoica, V.; Streicher, Branislav; Van de Walle, J.

    2016-01-01

    Neutron-rich light nuclei and their reactions play an important role in the creation of chemical elements. Here, data from a Coulomb dissociation experiment on N-20,N-21 are reported. Relativistic N-20,N-21 ions impinged on a lead target and the Coulomb dissociation cross section was determined in a

  17. Dissociative depression among women in the community.

    Science.gov (United States)

    Sar, Vedat; Akyüz, Gamze; Oztürk, Erdinç; Alioğlu, Firdevs

    2013-01-01

    This study screened the prevalence and correlates of dissociative disorders among depressive women in the general population. The Dissociative Disorders Interview Schedule and the posttraumatic stress disorder (PTSD) and borderline personality disorder sections of the Structured Clinical Interview for DSM-IV were administered to 628 women in 500 homes. The prevalence of current major depressive episode was 10.0%. Of the women, 26 (40.6%) had the lifetime diagnosis of a DSM-IV, dissociative disorder, yielding a prevalence of 4.1% for dissociative depression. This group was younger (mean age = 30.7 years) than the nondissociative depression women (mean age = 39.6 years). There was no difference between the 2 groups on comorbid somatization disorder, PTSD, or borderline personality disorder. Besides suicide attempts, the dissociative group was characterized by secondary features of dissociative identity disorder; Schneiderian symptoms; borderline personality disorder criteria; and extrasensory perceptions, including possession experiences. They reported suicidality, thoughts of guilt and worthlessness, diminished concentration and indecisiveness, and appetite and weight changes more frequently than the nondissociative group. Early cessation of school education and childhood sexual abuse were frequently reported by the dissociative depression group. With its distinct features, the concept of dissociative depression may facilitate understanding of treatment resistance in, development of better psychotherapy strategies for, and new thinking on the neurobiology and pharmacotherapy of depressive disorders.

  18. Dissociation of ethane by electron impact

    International Nuclear Information System (INIS)

    Winters, H.F.

    1979-01-01

    The absolute total dissociation cross section for ethane is reported for electron energies between 10 and 600 eV. A maximum value of 7.6 X 10 -16 cm 2 occurs at 80 eV while the apparent threshold is approximately 10 eV. Dissociative ionization is more probable than dissociation into neutral fragments at all energies except in the threshold region. The data indicates that fragmentation involving methane elimination (e - +C 2 H 6 → CH 4 + CH 2 ) occurs in less than 2% of the dissociative events for 50 < E < 600 eV. Arguments are presented which suggest that some of the lower excited states of ethane are stable against dissociation. (Auth.)

  19. Carbon Capture and Storage

    NARCIS (Netherlands)

    Benson, S.M.; Bennaceur, K.; Cook, P.; Davison, J.; Coninck, H. de; Farhat, K.; Ramirez, C.A.; Simbeck, D.; Surles, T.; Verma, P.; Wright, I.

    2012-01-01

    Emissions of carbon dioxide, the most important long-lived anthropogenic greenhouse gas, can be reduced by Carbon Capture and Storage (CCS). CCS involves the integration of four elements: CO 2 capture, compression of the CO2 from a gas to a liquid or a denser gas, transportation of pressurized CO 2

  20. CAPTURED India Country Evaluation

    NARCIS (Netherlands)

    O'Donoghue, R.; Brouwers, J.H.A.M.

    2012-01-01

    This report provides the findings of the India Country Evaluation and is produced as part of the overall CAPTURED End Evaluation. After five years of support by the CAPTURED project the End Evaluation has assessed that results are commendable. I-AIM was able to design an approach in which health

  1. Interatomic Coulombic electron capture

    International Nuclear Information System (INIS)

    Gokhberg, K.; Cederbaum, L. S.

    2010-01-01

    In a previous publication [K. Gokhberg and L. S. Cederbaum, J. Phys. B 42, 231001 (2009)] we presented the interatomic Coulombic electron capture process--an efficient electron capture mechanism by atoms and ions in the presence of an environment. In the present work we derive and discuss the mechanism in detail. We demonstrate thereby that this mechanism belongs to a family of interatomic electron capture processes driven by electron correlation. In these processes the excess energy released in the capture event is transferred to the environment and used to ionize (or to excite) it. This family includes the processes where the capture is into the lowest or into an excited unoccupied orbital of an atom or ion and proceeds in step with the ionization (or excitation) of the environment, as well as the process where an intermediate autoionizing excited resonance state is formed in the capturing center which subsequently deexcites to a stable state transferring its excess energy to the environment. Detailed derivation of the asymptotic cross sections of these processes is presented. The derived expressions make clear that the environment assisted capture processes can be important for many systems. Illustrative examples are presented for a number of model systems for which the data needed to construct the various capture cross sections are available in the literature.

  2. Atom capture and loss in ion molecule collisions

    International Nuclear Information System (INIS)

    Breinig, M.; Lasley, S.E.; Gaither, C.C. III.

    1985-01-01

    Progress is reported in measuring the energy and angular distribution of protons emerging with velocity close to the beam velocity from the target region when Ar + beams collide with a CH 4 target and ArH + beams collide with a He target at asymptotically high speeds. The protons result from the transfer of a target constituent to the projectile (atom capture) or from the dissociation of the projectile molecule in the collision (atom loss). For atom capture processes the Thomas peak is clearly observed. 10 refs., 3 figs

  3. Is the dissociative adult suggestible? A test of the trauma and fantasy models of dissociation.

    Science.gov (United States)

    Kluemper, Nicole S; Dalenberg, Constance

    2014-01-01

    Psychologists have long assumed a connection between traumatic experience and psychological dissociation. This hypothesis is referred to as the trauma model of dissociation. In the past decade, a series of papers have been published that question this traditional causal link, proposing an alternative fantasy model of dissociation. In the present research, the relationship among dissociation, suggestibility, and fantasy proneness was examined. Suggestibility was measured through the Gudjonsson Scale of Interrogative Suggestibility (GSS) as well as an autobiographically based version of this measure based on the events of September 11, 2001. Consistent with prior research and with the trauma model, dissociation correlated positively with trauma severity (r = .32, p suggestibility measure. Although some participants did become quite emotional during the procedure, the risk/benefit ratio was perceived by almost all participants to be positive, with more reactive individuals evaluating the procedure more positively. The results consistently support the trauma model of dissociation and fail to support the fantasy model of dissociation.

  4. Dissociation and Memory Fragmentation in Posttraumatic Stress Disorder: An Evaluation of the Dissociative Encoding Hypothesis

    Science.gov (United States)

    Bedard-Gilligan, Michele; Zoellner, Lori A.

    2012-01-01

    Several prominent theories of posttraumatic stress disorder (PTSD) posit that peritraumatic dissociation results in insufficient encoding of the trauma memory and that persistent dissociation prevents memory elaboration, resulting in memory fragmentation and PTSD. In this review, we summarize the empirical literature on peritraumatic and trait dissociation and trauma narrative fragmentation as measured by meta-memory and rater/objective coding. Across 16 studies to date, the association between dissociation and fragmentation was most prominent when examining peritraumatic dissociation and patient's own ratings of memory fragmentation. This relationship did not hold when examining trait dissociation or rater-coded or computer-generated measures of fragmentation. Thus, initial evidence points more toward a strong self-reported association between constructs that is not supported on more objective fragmentation coding. Measurement overlap, construct ambiguity, and exclusion of potential confounds may underlie lack of a strong association between dissociation and objective-rated fragmentation. PMID:22348400

  5. The Shutdown Dissociation Scale (Shut-D)

    Science.gov (United States)

    Schalinski, Inga; Schauer, Maggie; Elbert, Thomas

    2015-01-01

    The evolutionary model of the defense cascade by Schauer and Elbert (2010) provides a theoretical frame for a short interview to assess problems underlying and leading to the dissociative subtype of posttraumatic stress disorder. Based on known characteristics of the defense stages “fright,” “flag,” and “faint,” we designed a structured interview to assess the vulnerability for the respective types of dissociation. Most of the scales that assess dissociative phenomena are designed as self-report questionnaires. Their items are usually selected based on more heuristic considerations rather than a theoretical model and thus include anything from minor dissociative experiences to major pathological dissociation. The shutdown dissociation scale (Shut-D) was applied in several studies in patients with a history of multiple traumatic events and different disorders that have been shown previously to be prone to symptoms of dissociation. The goal of the present investigation was to obtain psychometric characteristics of the Shut-D (including factor structure, internal consistency, retest reliability, predictive, convergent and criterion-related concurrent validity). A total population of 225 patients and 68 healthy controls were accessed. Shut-D appears to have sufficient internal reliability, excellent retest reliability, high convergent validity, and satisfactory predictive validity, while the summed score of the scale reliably separates patients with exposure to trauma (in different diagnostic groups) from healthy controls. The Shut-D is a brief structured interview for assessing the vulnerability to dissociate as a consequence of exposure to traumatic stressors. The scale demonstrates high-quality psychometric properties and may be useful for researchers and clinicians in assessing shutdown dissociation as well as in predicting the risk of dissociative responding. PMID:25976478

  6. The Shutdown Dissociation Scale (Shut-D

    Directory of Open Access Journals (Sweden)

    Inga Schalinski

    2015-05-01

    Full Text Available The evolutionary model of the defense cascade by Schauer and Elbert (2010 provides a theoretical frame for a short interview to assess problems underlying and leading to the dissociative subtype of posttraumatic stress disorder. Based on known characteristics of the defense stages “fright,” “flag,” and “faint,” we designed a structured interview to assess the vulnerability for the respective types of dissociation. Most of the scales that assess dissociative phenomena are designed as self-report questionnaires. Their items are usually selected based on more heuristic considerations rather than a theoretical model and thus include anything from minor dissociative experiences to major pathological dissociation. The shutdown dissociation scale (Shut-D was applied in several studies in patients with a history of multiple traumatic events and different disorders that have been shown previously to be prone to symptoms of dissociation. The goal of the present investigation was to obtain psychometric characteristics of the Shut-D (including factor structure, internal consistency, retest reliability, predictive, convergent and criterion-related concurrent validity.A total population of 225 patients and 68 healthy controls were accessed. Shut-D appears to have sufficient internal reliability, excellent retest reliability, high convergent validity, and satisfactory predictive validity, while the summed score of the scale reliably separates patients with exposure to trauma (in different diagnostic groups from healthy controls.The Shut-D is a brief structured interview for assessing the vulnerability to dissociate as a consequence of exposure to traumatic stressors. The scale demonstrates high-quality psychometric properties and may be useful for researchers and clinicians in assessing shutdown dissociation as well as in predicting the risk of dissociative responding.

  7. Psychotherapy and Pharmacotherapy for Patients with Dissociative Identity Disorder

    OpenAIRE

    Gentile, Julie P.; Dillon, Kristy S.; Gillig, Paulette Marie

    2013-01-01

    There is a wide variety of what have been called “dissociative disorders,” including dissociative amnesia, dissociative fugue, depersonalization disorder, dissociative identity disorder, and forms of dissociative disorder not otherwise specified. Some of these diagnoses, particularly dissociative identity disorder, are controversial and have been questioned by many clinicians over the years. The disorders may be under-diagnosed or misdiagnosed, but many persons who have experienced trauma rep...

  8. Dissociative Part-Dependent Resting-State Activity in Dissociative Identity Disorder : A Controlled fMRI Perfusion Study

    NARCIS (Netherlands)

    Schlumpf, Yolanda R.; Reinders, Antje A. T. S.; Nijenhuis, Ellert R. S.; Luechinger, Roger; van Osch, Matthias J. P.; Jaencke, Lutz

    2014-01-01

    Background: In accordance with the Theory of Structural Dissociation of the Personality (TSDP), studies of dissociative identity disorder (DID) have documented that two prototypical dissociative subsystems of the personality, the "Emotional Part'' (EP) and the "Apparently Normal Part'' (ANP), have

  9. Optional carbon capture

    Energy Technology Data Exchange (ETDEWEB)

    Alderson, T.; Scott, S.; Griffiths, J. [Jacobs Engineering, London (United Kingdom)

    2007-07-01

    In the case of IGCC power plants, carbon capture can be carried out before combustion. The carbon monoxide in the syngas is catalytically shifted to carbon dioxide and then captured in a standard gas absorption system. However, the insertion of a shift converter into an existing IGCC plant with no shift would mean a near total rebuild of the gasification waste heat recovery, gas treatment system and HRSG, with only the gasifier and gas turbine retaining most of their original features. To reduce the extent, cost and time taken for the revamping, the original plant could incorporate the shift, and the plant would then be operated without capture to advantage, and converted to capture mode of operation when commercially appropriate. This paper examines this concept of placing a shift converter into an IGCC plant before capture is required, and operating the same plant first without and then later with CO{sub 2} capture in a European context. The advantages and disadvantages of this 'capture ready' option are discussed. 6 refs., 2 figs., 4 tabs.

  10. An exploration of the influence of diagonal dissociation and moderate changes in speed on locomotor parameters in trotting horses

    Directory of Open Access Journals (Sweden)

    Sarah Jane Hobbs

    2016-06-01

    Full Text Available Background. Although the trot is described as a diagonal gait, contacts of the diagonal pairs of hooves are not usually perfectly synchronized. Although subtle, the timing dissociation between contacts of each diagonal pair could have consequences on gait dynamics and provide insight into the functional strategies employed. This study explores the mechanical effects of different diagonal dissociation patterns when speed was matched between individuals and how these effects link to moderate, natural changes in trotting speed. We anticipate that hind-first diagonal dissociation at contact increases with speed, diagonal dissociation at contact can reduce collision-based energy losses and predominant dissociation patterns will be evident within individuals. Methods. The study was performed in two parts: in the first 17 horses performed speed-matched trotting trials and in the second, five horses each performed 10 trotting trials that represented a range of individually preferred speeds. Standard motion capture provided kinematic data that were synchronized with ground reaction force (GRF data from a series of force plates. The data were analyzed further to determine temporal, speed, GRF, postural, mass distribution, moment, and collision dynamics parameters. Results. Fore-first, synchronous, and hind-first dissociations were found in horses trotting at (3.3 m/s ± 10%. In these speed-matched trials, mean centre of pressure (COP cranio-caudal location differed significantly between the three dissociation categories. The COP moved systematically and significantly (P = .001 from being more caudally located in hind-first dissociation (mean location = 0.41 ± 0.04 through synchronous (0.36 ± 0.02 to a more cranial location in fore-first dissociation (0.32 ± 0.02. Dissociation patterns were found to influence function, posture, and balance parameters. Over a moderate speed range, peak vertical forelimb GRF had a strong relationship with dissociation

  11. From state dissociation to status dissociatus.

    Science.gov (United States)

    Antelmi, Elena; Ferri, Raffaele; Iranzo, Alex; Arnulf, Isabelle; Dauvilliers, Yves; Bhatia, Kailash P; Liguori, Rocco; Schenck, Carlos H; Plazzi, Giuseppe

    2016-08-01

    The states of being are conventionally defined by the simultaneous occurrence of behavioral, neurophysiological and autonomic descriptors. State dissociation disorders are due to the intrusion of features typical of a different state into an ongoing state. Disorders related to these conditions are classified according to the ongoing main state and comprise: 1) Dissociation from prevailing wakefulness as seen in hypnagogic or hypnopompic hallucinations, automatic behaviors, sleep drunkenness, cataplexy and sleep paralysis 2) Dissociation from rapid eye movement (REM) sleep as seen in REM sleep behavior disorder and lucid dreaming and 3) Dissociation from NREM sleep as seen in the disorders of arousal. The extreme expression of states dissociation is characterized by the asynchronous occurrence of the various components of the different states that prevents the recognition of any state of being. This condition has been named status dissociatus. According to the underlying disorders/diseases and to their severity, among status dissociatus we may recognize disorders in which such an extreme dissociation occurs only at night time or intermittently (i.e., autoimmune encephalopathies, narcolepsy type 1 and IgLON5 parasomnia), and others in which it occurs nearly continuously with complete loss of any conventionally defined state of being, and of the circadian pattern (agrypnia excitata). Here, we render a comprehensive review of all diseases/disorders associated with state dissociation and status dissociatus and propose a critical classification of this complex scenario. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

    Directory of Open Access Journals (Sweden)

    Diangang Liu

    2017-01-01

    Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

  13. Dissociation in Psychiatric Disorders: A Meta-Analysis of Studies Using the Dissociative Experiences Scale.

    Science.gov (United States)

    Lyssenko, Lisa; Schmahl, Christian; Bockhacker, Laura; Vonderlin, Ruben; Bohus, Martin; Kleindienst, Nikolaus

    2018-01-01

    Dissociation is a complex, ubiquitous construct in psychopathology. Symptoms of dissociation are present in a variety of mental disorders and have been connected to higher burden of illness and poorer treatment response, and not only in disorders with high levels of dissociation. This meta-analysis offers a systematic and evidence-based study of the prevalence and distribution of dissociation, as assessed by the Dissociative Experiences Scale, within different categories of mental disorders, and it updates an earlier meta-analysis. More than 1,900 original publications were screened, and 216 were included in the meta-analysis, comprising 15,219 individuals in 19 diagnostic categories. The largest mean dissociation scores were found in dissociative disorders (mean scores >35), followed by posttraumatic stress disorder, borderline personality disorder, and conversion disorder (mean scores >25). Somatic symptom disorder, substance-related and addictive disorders, feeding and eating disorders, schizophrenia, anxiety disorder, OCD, and most affective disorders also showed mean dissociation scores >15. Bipolar disorders yielded the lowest dissociation scores (mean score, 14.8). The findings underline the importance of careful psychopathological assessment of dissociative symptoms in the entire range of mental disorders.

  14. Energy distribution in dissociations of polyatomic molecules

    International Nuclear Information System (INIS)

    Koernig, S.A.

    1989-01-01

    In this thesis studies are reported of fragmentation processes in polyatomic molecules. In order to find out which dessocaciation reactions take place, how they are brought about by the internal energy of the reactant, and to investigate the structure of the dissociating 'transition state', the fragment mass and the corresponding kinetic energy release (KER) are determined by differential translational spectroscopy using a position and time sensitive two-particle coincidence detector. The results are interpreted using the statistical theory of unimolecular dissociation. It turns out that the standard assumptions of the theory, especially in calculating KER-distributions, are not realistic in all molecules considered. Dissociation is induced by the neutralization with alkali metal vapour. In ch. 2 the experimental method and the analysis of the data (dissociation pathways, branching ratios and ε-d-distributions) are introduced and exemplified by measurements of cyclohexane, which represents the upper limit in precursor and fragment mass accessible in the apparatus. In ch. 3 a study is reported of the molecules methylchloride (CH 3 Cl) and the acetylradical (CH 3 CO). In spite of their similar geometric structures, completely different dissociation mechanisms have been found. Methylchloride dissociates via a repulsive state; acetyl radicals show energy scrambling. The energy distribution from dissociating acetyl exemplifies dynamical effects in the dissociation. In ch. 4 an investigation of a number of prototype hydrocarbons is presented. The dissociation pathways of several small linear alkanes indicate that neutralization takes place to unknown repulsive potentials, of which the position and steepness are determined from the kinetic energy release. (author). 118 refs.; 40 figs.; 5 tabs

  15. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-01-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  16. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  17. Dissociative identity disorder: a controversial diagnosis.

    Science.gov (United States)

    Gillig, Paulette Marie

    2009-03-01

    A brief description of the controversies surrounding the diagnosis of dissociative identity disorder is presented, followed by a discussion of the proposed similarities and differences between dissociative identity disorder and borderline personality disorder. The phenomenon of autohypnosis in the context of early childhood sexual trauma and disordered attachment is discussed, as is the meaning of alters or alternate personalities. The author describes recent neurosciences research that may relate the symptoms of dissociative identity disorder to demonstrable disordered attention and memory processes. A clinical description of a typical patient presentation is included, plus some recommendations for approaches to treatment.

  18. Dissociative recombination of molecular ions H2+

    International Nuclear Information System (INIS)

    Abarenov, A.V.; Marchenko, V.S.

    1989-01-01

    The total cross sections of dissociation and dissociative recombination of slow electrons and molecular ions H 2 + have been calculated in terms of the quasiclassical and dipole approximations. In the calculations allowance was made for the quantum nature of vibrational motion of heavy particles and presence of autoionization of divergence states of the H 2 (Σ u , nl) molecules. It is shown that the H 2 + ion dissociation cross sections are dominant in increase of the electron energy in the ε >or approx. 2-3 eV region for H 2 + (v) ion distribution over the vibrational levels characteristic for the beam experiments. 15 refs.; 5 figs

  19. Wavepacket theory of collisional dissociation in molecules

    International Nuclear Information System (INIS)

    Kulander, K.

    1980-01-01

    An explicit integration scheme is used to solve the time dependent Schroedinger equation for wavepackets which model collisions in the collinear H + H 2 system. A realistic LEPS-type potential energy surface is used. Collision energies considered are above the dissociation threshold and probabilities for collision induced dissociation are reported. Also quantum mechanical state-to-state transition probabilities are generated. These results are compared to extensive classical trajectory calculations performed on this same system. The time evolution of the wavepacket densities is studied to understand the dynamics of the collinear collisional dissociation process

  20. Oil spills and AI: How to manage resources through simulation

    International Nuclear Information System (INIS)

    Giribone, P.; Bruzzone, A.G.; Caddeo, S.

    1995-01-01

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  1. Companion Cognitive Systems: A Step toward Human-Level AI

    OpenAIRE

    Forbus, Kenneth D.; Hinrichs, Thomas R.

    2006-01-01

    We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

  2. Conversational AI: The Science Behind the Alexa Prize

    OpenAIRE

    Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

    2018-01-01

    Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

  3. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  4. Multiplexed evaluation of capture agent binding kinetics using arrays of silicon photonic microring resonators.

    Science.gov (United States)

    Byeon, Ji-Yeon; Bailey, Ryan C

    2011-09-07

    High affinity capture agents recognizing biomolecular targets are essential in the performance of many proteomic detection methods. Herein, we report the application of a label-free silicon photonic biomolecular analysis platform for simultaneously determining kinetic association and dissociation constants for two representative protein capture agents: a thrombin-binding DNA aptamer and an anti-thrombin monoclonal antibody. The scalability and inherent multiplexing capability of the technology make it an attractive platform for simultaneously evaluating the binding characteristics of multiple capture agents recognizing the same target antigen, and thus a tool complementary to emerging high-throughput capture agent generation strategies.

  5. Annealing Induced Softening in Deformed AI-4043 Alloy

    International Nuclear Information System (INIS)

    Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

    2011-01-01

    The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

  6. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  7. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  8. Accretion in Radiative Equipartition (AiRE) Disks

    Energy Technology Data Exchange (ETDEWEB)

    Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

    2017-07-01

    Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

  9. AIS Algorithm for Smart Antenna Application in WLAN

    Directory of Open Access Journals (Sweden)

    Evizal Abdul Kadir

    2015-07-01

    Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

  10. Functional subdivisions in low-frequency primary auditory cortex (AI).

    Science.gov (United States)

    Wallace, M N; Palmer, A R

    2009-04-01

    We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

  11. Excited neutral atomic fragments in the strong-field dissociation of N2 molecules

    International Nuclear Information System (INIS)

    Nubbemeyer, T; Eichmann, U; Sandner, W

    2009-01-01

    Excited neutral N* fragments with energies between 3 eV and 15 eV have been observed from the dissociation of N 2 molecules in strong laser fields. The kinetic energy spectrum of the excited neutral atoms corresponds to Coulomb explosion processes involving N + ions. This supports the assumption that the production of excited neutral fragments stems from a process in which one of the participating ions in the Coulomb explosion captures an electron into a Rydberg state.

  12. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2011-07-22

    ... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

  13. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2013-03-20

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

  14. 10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

  15. Dissociative electron attachment and charge transfer in condensed matter

    International Nuclear Information System (INIS)

    Bass, A.D.; Sanche, L.

    2003-01-01

    Experiments using energy-selected beams of electrons incident from vacuum upon thin vapour deposited solids show that, as in the gas-phase, scattering cross sections at low energies are dominated by the formation of temporary negative ions (or resonances) and that molecular damage may be effected via dissociative electron attachment (DEA). Recent results also show that charge transfer between anionic states of target molecules and their environment is often crucial in determining cross sections for electron driven processes. Here, we review recent work from our laboratory, in which charge transfer is observed. For rare gas solids, electron exchange between the electron-exciton complex and either a metal substrate or co-adsorbed molecule enhances the desorption of metastable atoms and/or molecular dissociation. We discuss how transient electron capture by surface electron states of a substrate and subsequent electron transfer to a molecular adsorbate enhances the effective cross sections for DEA. We also consider the case of DEA to CF 2 Cl 2 condensed on water and ammonia ices, where electron exchange between pre-solvated electron states of ice and transient molecular anions can also increase DEA cross sections. Electron transfer from molecular resonances into pre-solvated electron states of ice is also discussed

  16. Hypnotic suggestibility, cognitive inhibition, and dissociation.

    Science.gov (United States)

    Dienes, Zoltán; Brown, Elizabeth; Hutton, Sam; Kirsch, Irving; Mazzoni, Giuliana; Wright, Daniel B

    2009-12-01

    We examined two potential correlates of hypnotic suggestibility: dissociation and cognitive inhibition. Dissociation is the foundation of two of the major theories of hypnosis and other theories commonly postulate that hypnotic responding is a result of attentional abilities (including inhibition). Participants were administered the Waterloo-Stanford Group Scale of Hypnotic Susceptibility, Form C. Under the guise of an unrelated study, 180 of these participants also completed: a version of the Dissociative Experiences Scale that is normally distributed in non-clinical populations; a latent inhibition task, a spatial negative priming task, and a memory task designed to measure negative priming. The data ruled out even moderate correlations between hypnotic suggestibility and all the measures of dissociation and cognitive inhibition overall, though they also indicated gender differences. The results are a challenge for existing theories of hypnosis.

  17. The co-occurrence of PTSD and dissociation: differentiating severe PTSD from dissociative-PTSD.

    Science.gov (United States)

    Armour, Cherie; Karstoft, Karen-Inge; Richardson, J Don

    2014-08-01

    A dissociative-posttraumatic stress disorder (PTSD) subtype has been included in the DSM-5. However, it is not yet clear whether certain socio-demographic characteristics or psychological/clinical constructs such as comorbid psychopathology differentiate between severe PTSD and dissociative-PTSD. The current study investigated the existence of a dissociative-PTSD subtype and explored whether a number of trauma and clinical covariates could differentiate between severe PTSD alone and dissociative-PTSD. The current study utilized a sample of 432 treatment seeking Canadian military veterans. Participants were assessed with the Clinician Administered PTSD Scale (CAPS) and self-report measures of traumatic life events, depression, and anxiety. CAPS severity scores were created reflecting the sum of the frequency and intensity items from each of the 17 PTSD and 3 dissociation items. The CAPS severity scores were used as indicators in a latent profile analysis (LPA) to investigate the existence of a dissociative-PTSD subtype. Subsequently, several covariates were added to the model to explore differences between severe PTSD alone and dissociative-PTSD. The LPA identified five classes: one of which constituted a severe PTSD group (30.5 %), and one of which constituted a dissociative-PTSD group (13.7 %). None of the included, demographic, trauma, or clinical covariates were significantly predictive of membership in the dissociative-PTSD group compared to the severe PTSD group. In conclusion, a significant proportion of individuals report high levels of dissociation alongside their PTSD, which constitutes a dissociative-PTSD subtype. Further investigation is needed to identify which factors may increase or decrease the likelihood of membership in a dissociative-PTSD subtype group compared to a severe PTSD only group.

  18. Dissociation of NF3 in shock waves

    International Nuclear Information System (INIS)

    Breshears, W.D.; Bird, P.F.

    1978-01-01

    The thermal dissociation rate of NF 3 in mixtures of 5% and 10%NF 3 in Ar has been measured behind incident shock waves over the temperature range 1330-2000 K. Dissociation rates were determined from postshock density gradients measured by laser beam deflection. The second order rate coefficient determined for NF 3 -Ar collisions is k/sub d/=2.31 x 10 15 exp(-20500/T) cm 3 mole sec

  19. Dissociation and decay of ultracold sodium molecules

    International Nuclear Information System (INIS)

    Mukaiyama, T.; Abo-Shaeer, J.R.; Xu, K.; Chin, J.K.; Ketterle, W.

    2004-01-01

    The dissociation of ultracold molecules was studied by ramping an external magnetic field through a Feshbach resonance. The observed dissociation energies directly yielded the strength of the atom-molecule coupling. They showed nonlinear dependence on the ramp speed. This was explained by a Wigner threshold law which predicts that the decay rate of the molecules above threshold increases with the density of states. In addition, inelastic molecule-molecule and molecule-atom collisions were characterized

  20. Schizophrenia masquerading as Dissociative Identity Disorder

    OpenAIRE

    Jegan Yogaratnam; Rajesh Jacob

    2012-01-01

    Dissociative symptoms can dominate the clinical picture in many psychiatric conditions and possess a huge challenge to the clinicians in management. We present a case report of a female with a strong family history of schizophrenia who initially presented with features suggestive of dissociative identity disorder, which is itself a rare clinical entity, was later diagnosed to have schizophrenia. Authors would like to emphasise that clinicians should have a high index of suspicion for schizoph...

  1. [Screening for major dissociative disorders with the FDS, the German version of the Dissociative Experience Scale].

    Science.gov (United States)

    Rodewald, Frauke; Gast, Ursula; Emrich, Hinderk M

    2006-06-01

    The prevalence of major dissociative disorders (dissociative identity disorder, DID and similar forms of dissociative disorder not otherwise specified, DDNOS) in clinical samples is about 5 %. Despite their frequency, major dissociative disorders are often overseen for a long time. Screening-scales have proved to be effective to support clinical diagnosis. The aim of this study was to test, whether the Fragebogen für dissoziative Symptome (FDS), the German version of the Dissociative Experiences Scale (DES), differentiates between patients with dissociative disorders, non-dissociative disorders and non-clinical controls. Additionally, an optimal FDS-cutoff for a more detailed differential-diagnostic evaluation of the dissociative symptomatology should be identified. 150 participants with DID (group DID: n = 44), DDNOS (DDNOS: n = 22), posttraumatic disorders (TRAUMA: n = 20), other non-dissociative disorders (non-TRAUMA: n = 34) and non-clinical controls (KG: n = 30) completed the FDS. In the five diagnostic groups, mean values were calculated and compared for the FDS, DES and FDS-20. Via receiver-operating-curves the cutoff-scores, which differentiated best between participants with and without major dissociative disorders, were identified. FDS, DES and FDS-20 differentiate significantly between patients with and without major dissociative disorders. For all scales, there were significant differences between the diagnostic groups, with mean-scores decreasing continuously from the groups DID to DDNOS and TRAUMA. Between the groups non-TRAUMA and KG tendencies were found in the predicted direction. The optimal cutoff-scores to differentiate between participants with and without major dissociative disorders were 13 (FDS/FDS-20) and 15 (DES). Using these cutoff-scores, at least 90 % of the patients with major dissociative disorders could be identified correctly (sensitivity). The specifity of the scales was 0.89 to 0.90. Screening for major dissociative disorders

  2. Dissociative Spectrum Disorders in the Primary Care Setting

    OpenAIRE

    Elmore, James L.

    2000-01-01

    Dissociative disorders have a lifetime prevalence of about 10%. Dissociative symptoms may occur in acute stress disorder, posttraumatic stress disorder, somatization disorder, substance abuse, trance and possession trance, Ganser's syndrome, and dissociative identity disorder, as well as in mood disorders, psychoses, and personality disorders. Dissociative symptoms and disorders are observed frequently among patients attending our rural South Carolina community mental health center. Given the...

  3. Fast kinetics of calcium dissociation from calsequestrin

    Directory of Open Access Journals (Sweden)

    MARIANELA BELTRÁN

    2006-01-01

    Full Text Available We measured the kinetics of calcium dissociation from calsequestrin in solution or forming part of isolated junctional sarcoplasmic reticulum membranes by mixing calsequestrin equilibrated with calcium with calcium-free solutions in a stopped-flow system. In parallel, we measured the kinetics of the intrinsic fluorescence changes that take place following calcium dissociation from calsequestrin. We found that at 25ºC calcium dissociation was 10-fold faster for calsequestrin attached to junctional membranes (k = 109 s-1 than in solution. These results imply that calcium dissociation from calsequestrin in vivo is not rate limiting during excitation-contraction coupling. In addition, we found that the intrinsic fluorescence decrease for calsequestrin in solution or forming part of junctional membranes was significantly slower than the rates of calcium dissociation. The kinetics of intrinsic fluorescence changes had two components for calsequestrin associated to junctional membranes and only one for calsequestrin in solution; the faster component was 8-fold faster (k = 54.1 s-1 than the slower component (k = 6.9 s-1, which had the same k value as for calsequestrin in solution. These combined results suggest that the presence of calsequestrin at high concentrations in a restricted space, such as when bound to the junctional membrane, accelerates calcium dissociation and the resulting structural changes, presumably as a result of cooperative molecular interactions.

  4. QML-AiNet: An immune network approach to learning qualitative differential equation models.

    Science.gov (United States)

    Pang, Wei; Coghill, George M

    2015-02-01

    In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

  5. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  6. US Spacesuit Knowledge Capture

    Science.gov (United States)

    Chullen, Cinda; Thomas, Ken; McMann, Joe; Dolan, Kristi; Bitterly, Rose; Lewis, Cathleen

    2011-01-01

    The ability to learn from both the mistakes and successes of the past is vital to assuring success in the future. Due to the close physical interaction between spacesuit systems and human beings as users, spacesuit technology and usage lends itself rather uniquely to the benefits realized from the skillful organization of historical information; its dissemination; the collection and identification of artifacts; and the education of those in the field. The National Aeronautics and Space Administration (NASA), other organizations and individuals have been performing United States (U.S.) Spacesuit Knowledge Capture since the beginning of space exploration. Avenues used to capture the knowledge have included publication of reports; conference presentations; specialized seminars; and classes usually given by veterans in the field. More recently the effort has been more concentrated and formalized whereby a new avenue of spacesuit knowledge capture has been added to the archives in which videotaping occurs engaging both current and retired specialists in the field presenting technical scope specifically for education and preservation of knowledge. With video archiving, all these avenues of learning can now be brought to life with the real experts presenting their wealth of knowledge on screen for future learners to enjoy. Scope and topics of U.S. spacesuit knowledge capture have included lessons learned in spacesuit technology, experience from the Gemini, Apollo, Skylab and Shuttle programs, hardware certification, design, development and other program components, spacesuit evolution and experience, failure analysis and resolution, and aspects of program management. Concurrently, U.S. spacesuit knowledge capture activities have progressed to a level where NASA, the National Air and Space Museum (NASM), Hamilton Sundstrand (HS) and the spacesuit community are now working together to provide a comprehensive closed-looped spacesuit knowledge capture system which includes

  7. Adiabatic capture and debunching

    International Nuclear Information System (INIS)

    Ng, K.Y.

    2012-01-01

    In the study of beam preparation for the g-2 experiment, adiabatic debunching and adiabatic capture are revisited. The voltage programs for these adiabbatic processes are derived and their properties discussed. Comparison is made with some other form of adiabatic capture program. The muon g-2 experiment at Fermilab calls for intense proton bunches for the creation of muons. A booster batch of 84 bunches is injected into the Recycler Ring, where it is debunched and captured into 4 intense bunches with the 2.5-MHz rf. The experiment requires short bunches with total width less than 100 ns. The transport line from the Recycler to the muon-production target has a low momentum aperture of ∼ ±22 MeV. Thus each of the 4 intense proton bunches required to have an emittance less than ∼ 3.46 eVs. The incoming booster bunches have total emittance ∼ 8.4 eVs, or each one with an emittance ∼ 0.1 eVs. However, there is always emittance increase when the 84 booster bunches are debunched. There will be even larger emittance increase during adiabatic capture into the buckets of the 2.5-MHz rf. In addition, the incoming booster bunches may have emittances larger than 0.1 eVs. In this article, we will concentrate on the analysis of the adiabatic capture process with the intention of preserving the beam emittance as much as possible. At this moment, beam preparation experiment is being performed at the Main Injector. Since the Main Injector and the Recycler Ring have roughly the same lattice properties, we are referring to adiabatic capture in the Main Injector instead in our discussions.

  8. Motion Capturing Emotions

    OpenAIRE

    Wood Karen; Cisneros Rosemary E.; Whatley Sarah

    2017-01-01

    The paper explores the activities conducted as part of WhoLoDancE: Whole Body Interaction Learning for Dance Education which is an EU-funded Horizon 2020 project. In particular, we discuss the motion capture sessions that took place at Motek, Amsterdam as well as the dancers’ experience of being captured and watching themselves or others as varying visual representations through the HoloLens. HoloLens is Microsoft’s first holographic computer that you wear as you would a pair of glasses. The ...

  9. Nuclear muon capture

    CERN Document Server

    Mukhopadhyay, N C

    1977-01-01

    Our present knowledge of the nuclear muon capture reactions is surveyed. Starting from the formation of the muonic atom, various phenomena, having a bearing on the nuclear capture, are reviewed. The nuclear reactions are then studied from two angles-to learn about the basic muon+nucleon weak interaction process, and to obtain new insights on the nuclear dynamics. Future experimental prospects with the newer generation muon 'factories' are critically examined. Possible modification of the muon+nucleon weak interaction in complex nuclei remains the most important open problem in this field. (380 refs).

  10. Proton capture resonance studies

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, G.E. [North Carolina State University, Raleigh, North Carolina (United States) 27695]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Bilpuch, E.G. [Duke University, Durham, North Carolina (United States) 27708]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Bybee, C.R. [North Carolina State University, Raleigh, North Carolina (United States) 27695]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Cox, J.M.; Fittje, L.M. [Tennessee Technological University, Cookeville, Tennessee (United States) 38505]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Labonte, M.A.; Moore, E.F.; Shriner, J.D. [North Carolina State University, Raleigh, North Carolina (United States) 27695]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Shriner, J.F. Jr. [Tennessee Technological University, Cookeville, Tennessee (United States) 38505]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Vavrina, G.A. [North Carolina State University, Raleigh, North Carolina (United States) 27695]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708; Wallace, P.M. [Duke University, Durham, North Carolina (United States) 27708]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina (United States) 27708

    1997-02-01

    The fluctuation properties of quantum systems now are used as a signature of quantum chaos. The analyses require data of extremely high quality. The {sup 29}Si(p,{gamma}) reaction is being used to establish a complete level scheme of {sup 30}P to study chaos and isospin breaking in this nuclide. Determination of the angular momentum J, the parity {pi}, and the isospin T from resonance capture data is considered. Special emphasis is placed on the capture angular distributions and on a geometric description of these angular distributions. {copyright} {ital 1997 American Institute of Physics.}

  11. Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...

    Indian Academy of Sciences (India)

    We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...

  12. Electron capture by C2+ and Ti2+ ions in H and H2

    International Nuclear Information System (INIS)

    Nutt, W.L.; McCullough, R.W.; Gilbody, H.B.

    1978-01-01

    Cross sections for electron capture by C 2+ and Ti 2+ ions in H and H 2 have been determined within the energy range 0.5 to 14 keV from measurements made using a tungsten-tube furnace to provide a target of highly dissociated hydrogen. (author)

  13. Dissociations between developmental dyslexias and attention deficits

    Science.gov (United States)

    Lukov, Limor; Friedmann, Naama; Shalev, Lilach; Khentov-Kraus, Lilach; Shalev, Nir; Lorber, Rakefet; Guggenheim, Revital

    2014-01-01

    We examine whether attention deficits underlie developmental dyslexia, or certain types of dyslexia, by presenting double dissociations between the two. We took into account the existence of distinct types of dyslexia and of attention deficits, and focused on dyslexias that may be thought to have an attentional basis: letter position dyslexia (LPD), in which letters migrate within words, attentional dyslexia (AD), in which letters migrate between words, neglect dyslexia, in which letters on one side of the word are omitted or substituted, and surface dyslexia, in which words are read via the sublexical route. We tested 110 children and adults with developmental dyslexia and/or attention deficits, using extensive batteries of reading and attention. For each participant, the existence of dyslexia and the dyslexia type were tested using reading tests that included stimuli sensitive to the various dyslexia types. Attention deficit and its type was established through attention tasks assessing sustained, selective, orienting, and executive attention functioning. Using this procedure, we identified 55 participants who showed a double dissociation between reading and attention: 28 had dyslexia with normal attention and 27 had attention deficits with normal reading. Importantly, each dyslexia with suspected attentional basis dissociated from attention: we found 21 individuals with LPD, 13 AD, 2 neglect dyslexia, and 12 surface dyslexia without attention deficits. Other dyslexia types (vowel dyslexia, phonological dyslexia, visual dyslexia) also dissociated from attention deficits. Examination of 55 additional individuals with both a specific dyslexia and a certain attention deficit found no attention function that was consistently linked with any dyslexia type. Specifically, LPD and AD dissociated from selective attention, neglect dyslexia dissociated from orienting, and surface dyslexia dissociated from sustained and executive attention. These results indicate that

  14. STAR - A computer language for hybrid AI applications

    Science.gov (United States)

    Borchardt, G. C.

    1986-01-01

    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  15. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  16. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  17. Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

    OpenAIRE

    Rayle, Keith

    2017-01-01

    There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...

  18. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  19. Muon capture in deuterium

    Czech Academy of Sciences Publication Activity Database

    Ricci, P.; Truhlík, Emil; Mosconi, B.; Smejkal, J.

    2010-01-01

    Roč. 837, - (2010), s. 110-144 ISSN 0375-9474 Institutional research plan: CEZ:AV0Z10480505 Keywords : Negative muon capture * Deuteron * Potential models Subject RIV: BE - Theoretical Physics Impact factor: 1.986, year: 2010

  20. Capture Matrices Handbook

    Science.gov (United States)

    2014-04-01

    materials, the affinity ligand would need identification , as well as chemistries that graft the affinity ligand onto the surface of magnetic...ACTIVE CAPTURE MATRICES FOR THE DETECTION/ IDENTIFICATION OF PHARMACEUTICALS...6 As shown in Figure 2.3-1a, the spectra exhibit similar baselines and the spectral peaks lineup . Under these circumstances, the spectral

  1. Capacitance for carbon capture

    International Nuclear Information System (INIS)

    Landskron, Kai

    2018-01-01

    Metal recycling: A sustainable, capacitance-assisted carbon capture and sequestration method (Supercapacitive Swing Adsorption) can turn scrap metal and CO 2 into metal carbonates at an attractive energy cost. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. Capacitance for carbon capture

    Energy Technology Data Exchange (ETDEWEB)

    Landskron, Kai [Department of Chemistry, Lehigh University, Bethlehem, PA (United States)

    2018-03-26

    Metal recycling: A sustainable, capacitance-assisted carbon capture and sequestration method (Supercapacitive Swing Adsorption) can turn scrap metal and CO{sub 2} into metal carbonates at an attractive energy cost. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Embedded enzymes catalyse capture

    Science.gov (United States)

    Kentish, Sandra

    2018-05-01

    Membrane technologies for carbon capture can offer economic and environmental advantages over conventional amine-based absorption, but can suffer from limited gas flux and selectivity to CO2. Now, a membrane based on enzymes embedded in hydrophilic pores is shown to exhibit combined flux and selectivity that challenges the state of the art.

  4. Attention Capture by Faces

    Science.gov (United States)

    Langton, Stephen R. H.; Law, Anna S.; Burton, A. Mike; Schweinberger, Stefan R.

    2008-01-01

    We report three experiments that investigate whether faces are capable of capturing attention when in competition with other non-face objects. In Experiment 1a participants took longer to decide that an array of objects contained a butterfly target when a face appeared as one of the distracting items than when the face did not appear in the array.…

  5. The co-occurrence of PTSD and dissociation: differentiating severe PTSD from dissociative-PTSD

    DEFF Research Database (Denmark)

    Armour, C.; Karstoft, K. I.; Richardson, J. D.

    2014-01-01

    A dissociative-posttraumatic stress disorder (PTSD) subtype has been included in the DSM-5. However, it is not yet clear whether certain socio-demographic characteristics or psychological/clinical constructs such as comorbid psychopathology differentiate between severe PTSD and dissociative-PTSD....... The current study investigated the existence of a dissociative-PTSD subtype and explored whether a number of trauma and clinical covariates could differentiate between severe PTSD alone and dissociative-PTSD. The current study utilized a sample of 432 treatment seeking Canadian military veterans. Participants...... were assessed with the Clinician Administered PTSD Scale (CAPS) and self-report measures of traumatic life events, depression, and anxiety. CAPS severity scores were created reflecting the sum of the frequency and intensity items from each of the 17 PTSD and 3 dissociation items. The CAPS severity...

  6. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-06-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

  7. Sensor assignment to mission in AI-TECD

    Science.gov (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

    2016-05-01

    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  8. Psychotherapy and pharmacotherapy for patients with dissociative identity disorder.

    Science.gov (United States)

    Gentile, Julie P; Dillon, Kristy S; Gillig, Paulette Marie

    2013-02-01

    There is a wide variety of what have been called "dissociative disorders," including dissociative amnesia, dissociative fugue, depersonalization disorder, dissociative identity disorder, and forms of dissociative disorder not otherwise specified. Some of these diagnoses, particularly dissociative identity disorder, are controversial and have been questioned by many clinicians over the years. The disorders may be under-diagnosed or misdiagnosed, but many persons who have experienced trauma report "dissociative" symptoms. Prevalence of dissociative disorders is unknown, but current estimates are higher than previously thought. This paper reviews clinical, phenomenological, and epidemiological data regarding diagnosis in general, and illustrates possible treatment interventions for dissociative identity disorder, with a focus on psychotherapy interventions and a review of current psychopharmacology recommendations as part of a comprehensive multidisciplinary treatment plan.

  9. Reconsidering the autohypnotic model of the dissociative disorders.

    Science.gov (United States)

    Dell, Paul F

    2018-03-22

    The dissociative disorders field and the hypnosis field currently reject the autohypnotic model of the dissociative disorders, largely because many correlational studies have shown hypnotizability and dissociation to be minimally related (r = .12). Curiously, it is also widely accepted that dissociative patients are highly hypnotizable. If dissociative patients are highly hypnotizable because only highly hypnotizable individuals can develop a dissociative disorder - as the author proposes - then the methodology of correlational studies of hypnotizability and dissociation in random clinical and community samples would necessarily be constitutively unable to detect, and statistically unable to reflect, that fact. That is, the autohypnotic, dissociative distancing of that small subset of highly hypnotizable individuals who repeatedly encountered intolerable circumstances is statistically lost among the data of (1) the highly hypnotizable subjects who do not dissociate and (2) subjects (of all levels of hypnotizability) who manifest other kinds of dissociation. The author proposes that, when highly hypnotizable individuals repeatedly engage in autohypnotic distancing from intolerable circumstances, they develop an overlearned, highly-motivated, automatized pattern of dissociative self-protection (i.e., a dissociative disorder). The author urges that theorists of hypnosis and the dissociative disorders explicitly include in their theories (a) the trait of high hypnotizability, (b) the phenomena of autohypnosis, and (c) the manifestations of systematized, autohypnotic pathology. Said differently, the author is suggesting that autohypnosis and autohypnotic pathology are unacknowledged nodes in the nomothetic networks of both hypnosis and dissociation.

  10. Studies of neutron dissociation at Fermilab energies

    International Nuclear Information System (INIS)

    Ferbel, T.

    1975-01-01

    The latest results obtained in a continuing investigation of neutron dissociation in (pπ - ) systems in neutron--nucleus collisions between 50 and 300 GeV/c are summarized. The nuclear coherent dissociation data are discussed first; then new measurements of total cross sections of neutrons on nuclei in the Fermilab momentum range are presented; finally, neutron dissociation using a hydrogen target is considered, and the hydrogen data are compared with expectations from simple Deck models. A substantial correlation was observed between the mass and the t of the system produced. The spin structure of the pπ - amplitudes at low mass was described surprisingly well by the simple Deck mechanism. The t-channel helicity amplitudes contained comparable contributions from flip and nonflip terms, and the states produced were not restricted to those expected on the basis of the Morrison rule. (19 figures, 2 tables) (U.S.)

  11. Dissociation in virtual reality: depersonalization and derealization

    Science.gov (United States)

    Garvey, Gregory P.

    2010-01-01

    This paper looks at virtual worlds such as Second Life7 (SL) as possible incubators of dissociation disorders as classified by the Diagnostic and Statistical Manual of Mental Disorders, 4th Edition3 (also known as the DSM-IV). Depersonalization is where "a person feels that he or she has changed in some way or is somehow unreal." Derealization when "the same beliefs are held about one's surroundings." Dissociative Identity Disorder (DID), previously known as multiple personality disorder fits users of Second Life who adopt "in-world" avatars and in effect, enact multiple distinct identities or personalities (known as alter egos or alters). Select questions from the Structured Clinical Interview for Depersonalization (SCI-DER)8 will be discussed as they might apply to the user's experience in Second Life. Finally I would like to consider the hypothesis that rather than a pathological disorder, dissociation is a normal response to the "artificial reality" of Second Life.

  12. Substrate dependence of electron-stimulated O - yields from dissociative electron attachment to physisorbed O2

    Science.gov (United States)

    Huels, M. A.; Parenteau, L.; Sanche, L.

    1994-03-01

    We present measurements of O- electron stimulated desorption yields obtained under identical experimental conditions from 0.15 monolayers (ML) of O2 deposited onto disordered substrates consisting of 4 ML of either Kr, Xe, C2H6, C2H4, N2O, CH3Cl, or H2O, all condensed on Pt (polycrystalline). The resulting O- yield functions, for incident electron energies below 20 eV, are compared to that obtained from the O2/Kr solid; this allows us to assess the order of magnitude effects of the local substrate environment on dissociative electron attachment (DEA) via the 2Πu and gas phase forbidden 2Σ+g,u resonances of O-2. We note that, in addition to electron energy losses in the substrate prior to DEA to O2 and post-dissociation interactions of the O- with the substrate molecules, charge or energy transfer from the O-2 transient anion to a substrate molecule, and capture of the incident electron into a dissociative anion resonance of the substrate molecule may contribute to a reduced O- yield from the physisorbed O2. In the case of O2 deposited on amorphous ice, we find that the O- signal from DEA to O2 is completely absent for electron energies below 14 eV; we attribute this to a complete quenching of the dissociative O-2(2Πu, 2Σ+) resonances by the adjacent water molecules.

  13. Gadolinium neutron capture therapy

    International Nuclear Information System (INIS)

    Akine, Yasuyuki; Tokita, Nobuhiko; Tokuuye, Koichi; Satoh, Michinao; Churei, Hisahiko

    1993-01-01

    Gadolinium neutron capture therapy makes use of photons and electrons produced by nuclear reactions between gadolinium and lower-energy neutrons which occur within the tumor. The results of our studies have shown that its radiation effect is mostly of low LET and that the electrons are the significant component in the over-all dose. The dose from gadolinium neutron capture reactions does not seem to increase in proportion to the gadolinium concentration, and the Gd-157 concentration of about 100 μg/ml appears most optimal for therapy. Close contact between gadolinium and the cell is not necessarily required for cell inactivation, however, the effect of electrons released from intracellular gadolinium may be significant. Experimental studies on tumor-bearing mice and rabbits have shown that this is a very promising modality though further improvements in gadolinium delivery to tumors are needed. (author)

  14. Performance testing of real-time AI systems using the activation framework

    International Nuclear Information System (INIS)

    Becker, L.; Duckworth, J.; Laznovsky, A.; Green, P.

    1992-01-01

    This paper describes methods for automated performance testing of real-time artificial intelligence systems using the Activation Framework software development tool. The Activation Framework is suitable for applications such as the diagnosis of power system failures, which require the interpretation of large volumes of data in real-time. The Activation Framework consists of tools for compiling groups of Expert Systems rules into executable code modules, for automatically generating code modules from high level system configuration descriptions, and for automatically generating command files for program compilation and linking. It includes an operating system environment which provides the code which is common from one real-time AI applications to the next. It also includes mechanisms, described here, for automatic performance testing. The principal emphasis of this paper is on a rule based language which is used to capture performance specifications. This specification is compiled into code modules which are used to automatically test the system. This testing can validate that the system meets performance requirements during development and after maintenance. A large number of tests can be randomly generated and executed and the correctness of the outputs automatically validated. The paper also describes graph directed testing methods to minimize the number of test runs required

  15. Dissociative amnesia: a case with management challenges

    Directory of Open Access Journals (Sweden)

    Priti Singh

    2015-07-01

    Full Text Available A case of dissociative amnesia with regressed behaviour was diagnosed applying the existing criteria for dissociative disorder in the tenth revision of the International Statistical Classification of Diseases and Related Health Problems (ICD-10. Though there are number of cases of such condition, but when coupled with regressed behaviour it adds to new dimension in the management. An applied strategy in lines with both pharmacological and non pharmacological was used, and we found that it helped our patient to gradually improve her behaviour. This is one of the few cases reported and we hope more such cases should be reported in understanding the psychopathology.

  16. Coulomb dissociation of N 20,21

    OpenAIRE

    Röder, Marko; Adachi, Tatsuya; Aksyutina, Yulia; Alcantara, Juan; Altstadt, Sebastian; Alvarez-Pol, Hector; Ashwood, Nicholas; Atar, Leyla; Aumann, Thomas; Avdeichikov, Vladimir; Barr, M.; Beceiro, Saul; Bemmerer, Daniel; Benlliure, Jose; Bertulani, Carlos

    2016-01-01

    Neutron-rich light nuclei and their reactions play an important role in the creation of chemical elements. Here, data from a Coulomb dissociation experiment on N20,21 are reported. Relativistic N20,21 ions impinged on a lead target and the Coulomb dissociation cross section was determined in a kinematically complete experiment. Using the detailed balance theorem, the N19(n,γ)N20 and N20(n,γ)N21 excitation functions and thermonuclear reaction rates have been determined. The N19(n,γ)N20 rate is...

  17. Objective documentation of child abuse and dissociation in 12 murderers with dissociative identity disorder.

    Science.gov (United States)

    Lewis, D O; Yeager, C A; Swica, Y; Pincus, J H; Lewis, M

    1997-12-01

    The skepticism regarding the existence of dissociative identity disorder as well as the abuse that engenders it persists for lack of objective documentation. This is doubly so for the disorder in murderers because of issues of suspected malingering. This article presents objective verification of both dissociative symptoms and severe abuse during childhood in a series of adult murderers with dissociative identity disorder. This study consisted of a review of the clinical records of 11 men and one woman with DSM-IV-defined dissociative identity disorder who had committed murder. Data were gathered from medical, psychiatric, social service, school, military, and prison records and from records of interviews with subjects' family members and others. Handwriting samples were also examined. Data were analyzed qualitatively. Signs and symptoms of dissociative identity disorder in childhood and adulthood were corroborated independently and from several sources in all 12 cases; objective evidence of severe abuse was obtained in 11 cases. The subjects had amnesia for most of the abuse and underreported it. Marked changes in writing style and/or signatures were documented in 10 cases. This study establishes, once and for all, the linkage between early severe abuse and dissociative identity disorder. Further, the data demonstrate that the disorder can be distinguished from malingering and from other disorders. The study shows that it is possible, with great effort, to obtain objective evidence of both the symptoms of dissociative identity disorder and the abuse that engenders it.

  18. High yield of recombinant human Apolipoprotein A-I expressed in Pichia pastoris by using mixed-mode chromatography.

    Science.gov (United States)

    Narasimhan Janakiraman, Vignesh; Noubhani, Abdelmajid; Venkataraman, Krishnan; Vijayalakshmi, Mookambeswaran; Santarelli, Xavier

    2016-01-01

    A vast majority of the cardioprotective properties exhibited by High-Density Lipoprotein (HDL) is mediated by its major protein component Apolipoprotein A-I (ApoA1). In order to develop a simplified bioprocess for producing recombinant human Apolipoprotein A-I (rhApoA1) in its near-native form, rhApoA1was expressed without the use of an affinity tag in view of its potential therapeutic applications. Expressed in Pichia pastoris at expression levels of 58.2 mg ApoA1 per litre of culture in a reproducible manner, the target protein was purified by mixed-mode chromatography using Capto™ MMC ligand with a purity and recovery of 84% and 68%, respectively. ApoA1 purification was scaled up to Mixed-mode Expanded Bed Adsorption chromatography to establish an 'on-line' process for the efficient capture of rhApoA1 directly from the P. pastoris expression broth. A polishing step using anion exchange chromatography enabled the recovery of ApoA1 up to 96% purity. Purified ApoA1 was identified and verified by RPLC-ESI-Q-TOF mass spectrometry. This two-step process would reduce processing times and therefore costs in comparison to the twelve-step procedure currently used for recovering rhApoA1 from P. pastoris. Copyright © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Single-electron capture in He[sup 2+]-D[sub 2] collisions

    Energy Technology Data Exchange (ETDEWEB)

    Bordenave-Montesquieu, D.; Dagnac, R. (Toulouse-3 Univ., 31 (France))

    1994-02-14

    Doubly differential cross sections of single-electron capture were measured for He[sup 2+] impinging on a molecular deuterium target. The investigated collision energies are 4, 6 and 8 keV and the scattering angles range from 10' to 2[sup o]30' (laboratory frame). The exothermic capture leading to He[sup +] (1s) + D[sub 2][sup +*] was found to be the most important process at low energies and angles, whereas the endothermic channels leading to dissociative capture become the main processes at high scattering angles, i.e. at small impact parameters. (author).

  20. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  1. Fully differential study of capture with vibrational dissociation in p + H.sub.2./sub. collisions

    Czech Academy of Sciences Publication Activity Database

    Lamichhane, B.R.; Arthanayaka, T.; Remolina, J.; Hasan, A.; Ciappina, Marcelo F.; Navarrete, F.; Barrachina, R.O.; Lomsadze, R.A.; Schulz, M.

    2017-01-01

    Roč. 119, č. 8 (2017), 1-5, č. článku 083402. ISSN 0031-9007 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk LQ1606 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : single ionization * cross-sections Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 8.462, year: 2016

  2. Hydrogen rearrangement to and from radical z fragments in electron capture dissociation of peptides

    DEFF Research Database (Denmark)

    Savitski, Mikhail M; Kjeldsen, Frank; Nielsen, Michael L

    2007-01-01

    Hydrogen rearrangement is an important process in radical chemistry. A high degree of H. rearrangement to and from z. ionic fragments (combined occurrence frequency 47% compared with that of z.) is confirmed in analysis of 15,000 tandem mass spectra of tryptic peptides obtained with electron...

  3. Computing Facilities for AI: A Survey of Present and Near-Future Options

    OpenAIRE

    Fahlman, Scott

    1981-01-01

    At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

  4. A Review of Future and Ethical Perspectives of Robotics and AI

    OpenAIRE

    Jim Torresen

    2018-01-01

    In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

  5. Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

    OpenAIRE

    Cook, Michael; Summerville, Adam; Colton, Simon

    2017-01-01

    MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

  6. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    OpenAIRE

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

  7. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  8. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  9. Le français de la communication professionnelle

    CERN Document Server

    Danilo, Michel; Lincoln, M

    A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

  10. Age and helium content of the eclipsing binary AI Phoenicis

    International Nuclear Information System (INIS)

    VandenBerg, D.A.; Hrivnak, B.J.

    1985-01-01

    Comparisons of new theoretical isochrones for heavy-element abundances Z = 0.0169 (solar) and Z = 0.04 with recently published parameters of AI Phoenicis suggest that this system has an age of approximately (3.6 +- 0.7) x 10 9 yr and a helium content of Y = 0.38 +- 0.05. The indicated uncertainty is largely due to the lack of precise knowledge about the metallicity of the binary, since the fits to the data by both sets of isochrones are exceedingly good. The high helium content, which is required in order to reproduce the observed mass-luminosity relation, is suggested to be comparable with the values generally derived for binaries if the latter are adjusted to take into account the effect of the new Los Alamos opacities

  11. Conjugaison progressive du français avec 400 exercices

    CERN Document Server

    Boularès, Michèle

    1999-01-01

    La Conjugaison progressive du français s'adresse aux grands adolescents et aux adultes de tous niveaux. C'est un ouvrage d'apprentissage des formes verbales. On trouve sur la page de gauche : - la règle de formation de chaque temps ; - les verbes types présentés en tableaux et accompagnés d'une liste de verbes conjugués sur le même modèle ; - des remarques phonétiques ou orthographiques ; - des explications sur les difficultés particulières. La page de droite propose des exercices et des activités de difficulté progressive. C'est également un ouvrage de référence grâce aux nombreux tableaux de conjugaison qu'il contient.

  12. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  13. Development of an advanced educational system using AI techniques

    International Nuclear Information System (INIS)

    Yoshimura, Seiichi

    1990-01-01

    This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

  14. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony

    2016-01-01

    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  15. New aspects of the neutron capture in light nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Mengoni, A. [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1997-03-01

    Several neutron capture cross sections of light nuclei (A {<=} 40) for neutron energies up to the MeV region have been recently calculated. Examples are (target nuclei): {sup 12}C, {sup 13}C, {sup 16}O and {sup 10}Be. The results of these calculations will be shown together with a comparison with the most recent experimental data. In the case of n + {sup 10}Be case, the cross section of the inverse process (Coulomb dissociation of {sup 11}Be) is considered and compared with the measurement. A discussion on the relevant nuclear structure information required for the evaluation of nuclear data of light nuclei is given. (author)

  16. Augmented Personalized Health: How Smart Data with IoTs and AI is about to Change Healthcare.

    Science.gov (United States)

    Sheth, Amit; Jaimini, Utkarshani; Thirunarayan, Krishnaprasad; Banerjee, Tanvi

    2017-09-01

    Healthcare as we know it is in the process of going through a massive change - from episodic to continuous, from disease focused to wellness and quality of life focused, from clinic centric to anywhere a patient is, from clinician controlled to patient empowered, and from being driven by limited data to 360-degree, multimodal personal-public-population physical-cyber-social big data driven. While ability to create and capture data is already here, the upcoming innovations will be in converting this big data into smart data through contextual and personalized processing such that patients and clinicians can make better decisions and take timely actions for augmented personalized health. This paper outlines current opportunities and challenges, with a focus on key AI approaches to make this a reality. The broader vision is exemplified using three ongoing applications (asthma in children, bariatric surgery, and pain management) as part of the Kno.e.sis kHealth personalized digital health initiative.

  17. Dissociative attachment reactions of electrons with gas phase superacids

    International Nuclear Information System (INIS)

    Liu, X.

    1992-01-01

    Using the flowing afterglow Langmuir probe (FALP) technique, dissociative attachment coefficients β for reactions of electrons with gas phase superacids HCo(PF 3 ) 4 , HRh(PF 3 ) 4 and carbonyl hydride complexes HMn(CO) 5 , HRe(CO) 5 have been determined under thermal conditions over the approximate temperature range 300∼550 K. The superacids react relatively slowly ( max ) with free electrons in a thermal plasma, and the values of β obtained this far do not show a correlation between acidity and β. The pioneer researchers in this field had speculated that any superacid would be a rapid attacher of electrons; it was found that this speculation is not true in general. The product distribution of electron attachment reaction to HCo(PF 3 ) 4 was found to be independent of temperature even though the β[HCo(PF 3 ) 4 ] increases with temperature. This proposes that the electron attachment process occurs well before the excited complex dissociates. In addition, the activation energy of HCo(PF 3 ) 4 for electron attachment has been derived from the Arrhenius plots. The carbonyl hydride complexes, HMn(CO) 5 and HRe(CO) 5 , react relatively rapidly (>1/4 of β max ) with free electrons in thermal plasma. This indicates that these reactions cannot be significantly endothermic. Observation of rapid attachment for these non-superacids shows that the Mn-CO and Re-CO bonds are weaker than the Mn-H and Re-H bonds, respectively. Comparisons between the carbonyl and trifluorophosphine cases implies that fast electron capture is related more to the CO ligand than to the transition-metal species

  18. GPU: the biggest key processor for AI and parallel processing

    Science.gov (United States)

    Baji, Toru

    2017-07-01

    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  19. Psychometric properties of the Dissociative Experiences Scale.

    Science.gov (United States)

    Dubester, K A; Braun, B G

    1995-04-01

    The test-retest reliability of the Dissociative Experiences Scale (DES; Bernstein EM, Putnam FW [1986] Development, reliability, and validity of a dissociation scale. The Journal of Nervous and Mental Disease 174:727-735) in a clinical sample was found to be .93 for the total DES score and .95, .89, and .82 for the three subscale scores of amnesia, depersonalization-derealization, and absorption (dissociative identity disorder [DID], DSM-IV), respectively. Test-retest reliabilities within diagnostic groups of multiple personality disorder, dissociative disorder not otherwise specified, and a general other category of psychiatric diagnoses were obtained for total and subscale scores on the DES. These ranged from .78 to .96. Tests of mean scores across the two test sessions showed the total and subscale scores to be temporally stable. The DES was also found to be highly internally consistent: Cronbach's alphas of .96 and .97 were observed for the total DES scores taken at times 1 and 2, respectively. Construct validity of the DES was demonstrated by differentiation among the subscale scores in a repeated-measures analysis of variance (F[2,154] = 32.03, p < or = .001). Normality and general distribution issues were also addressed and provided a rationale for using the DES with parametric statistics. Reasons why the DES (as it was originally designed) is not appropriate as a dependent measure in outcome research are discussed, along with needed future research. Implications of the findings for the clinical usefulness of the DES as a diagnostic instrument are noted.

  20. Process Dissociation and Mixture Signal Detection Theory

    Science.gov (United States)

    DeCarlo, Lawrence T.

    2008-01-01

    The process dissociation procedure was developed in an attempt to separate different processes involved in memory tasks. The procedure naturally lends itself to a formulation within a class of mixture signal detection models. The dual process model is shown to be a special case. The mixture signal detection model is applied to data from a widely…

  1. From dissociated hegemony towards embedded hegemony

    NARCIS (Netherlands)

    Gaay Fortman, B. de; Dhanrajgir, Nikhil

    2005-01-01

    An earlier paper by the second author, entitled ‘Bella Americana: Some Consequences for the International Community’ [1], dealt with the background and consequences of the American dissociation from the international legal and political order created after World War II. The current article

  2. Theory of the dissociation process, ch. 1

    International Nuclear Information System (INIS)

    Asselt, N.P.F.B. van

    1976-01-01

    The formalism of Moeller operators and channel Hamiltonians, originating from scattering theory, is used for the description of the dissociation process. The proper choice of the initial state wave function is discussed. A method is given which accounts for the symmetry requirements which appear in the case of a homonuclear molecule where identical particles are present

  3. CO dissociation on magnetic Fen clusters

    KAUST Repository

    Jedidi, Abdesslem; Markovits, Alexis; Minot, Christian; Abderrabba, Manef Ben; Van Hove, Michel A.

    2014-01-01

    triangular facet of the nanoparticle. Dissociation becomes easier when the cluster size increases. Then, the C atom is bonded to a square facet that is generated as a result of the adsorption if it does not yet exist in the bare cluster, while the O atom

  4. Quarkonium suppression: Gluonic dissociation vs. colour screening

    Indian Academy of Sciences (India)

    mechanism comes into play for the initial conditions taken from the self screened parton cascade model in these studies. Keywords. Quark gluon plasma; J ψ; suppression; dissociation; colour screening. PACS No. 12.38.M. 1. Introduction. The last two decades have seen hectic activity towards identifying unique signatures ...

  5. Dissociative electron attachment to ozone: rate constant

    International Nuclear Information System (INIS)

    Skalny, J.D.; Cicman, P.; Maerk, T.D.

    2002-01-01

    The rate constant for dissociative electron attachment to ozone has been derived over the energy range of 0-10 eV by using previously measured cross section data revisited here in regards to discrimination effect occurring during the extraction of ions. The obtained data for both possible channels exhibit the maximum at mean electron energies close to 1 eV. (author)

  6. Visuomotor Dissociation in Cerebral Scaling of Size

    NARCIS (Netherlands)

    Potgieser, Adriaan R. E.; de Jong, Bauke M.

    2016-01-01

    Estimating size and distance is crucial in effective visuomotor control. The concept of an internal coordinate system implies that visual and motor size parameters are scaled onto a common template. To dissociate perceptual and motor components in such scaling, we performed an fMRI experiment in

  7. Resonances in dissociative recombination: Trends and patterns

    Energy Technology Data Exchange (ETDEWEB)

    Orel, A E; Ngassam, V; Royal, J [Department of Applied Science, University of California, Davis (United States); Roos, J B; Larson, A, E-mail: aeorel@ucdavis.ed [Department of Theoretical Chemistry, Royal Institute of Technology, Stockholm (Sweden)

    2009-11-15

    In dissociative recombination, the kinetic energy of the incident electron is transferred into excitation of the electrons of the target ion and then into kinetic energy of the fragments. In general, this proceeds via a resonance where the electron is temporarily trapped by the ion, leading to efficient energy transfer. The study of dissociative recombination is the study of these resonances, Rydberg states converging to the ground and excited states of the ion. For a number of systems, we have studied the electronic states involved in dissociative recombination, including the ground and excited states of the ion, the resonant states and the bound Rydberg states of the system, by combining electron scattering calculations with multi-reference configuration interaction quantum chemistry calculations. We will report on trends and patterns in these resonance states. We will discuss studies of dissociative recombination of the rare-gas ions, moving down the periodic table from He{sup +}{sub 2} to Ne{sup +}{sub 2} to Ar{sup +}{sub 2}, where the ground electronic state of the ion is constant, but its polarizability increases. We will also present results on isoelectronic polyatomic systems, such as HCO{sup +} and HCNH{sup +}, as well as the effects of changing the electronic structure slightly such as HCN{sup +}/HNC{sup +} and H{sub 2}CO{sup +}.

  8. Dissociation in undergraduate students: disruptions in executive functioning.

    Science.gov (United States)

    Giesbrecht, Timo; Merckelbach, Harald; Geraerts, Elke; Smeets, Ellen

    2004-08-01

    The concept of dissociation refers to disruptions in attentional control. Attentional control is an executive function. Few studies have addressed the link between dissociation and executive functioning. Our study investigated this relationship in a sample of undergraduate students (N = 185) who completed the Dissociative Experiences Scale and the Random Number Generation Task. We found that minor disruptions in executive functioning were related to a subclass of dissociative experiences, notably dissociative amnesia and the Dissociative Experiences Scale Taxon. However, the two other subscales of the Dissociative Experiences Scale, measuring depersonalization and absorption, were unrelated to executive functioning. Our findings suggest that a failure to inhibit previous responses might contribute to the pathological memory manifestations of dissociation.

  9. Childhood Traumatic Experiences, Dissociative Symptoms, and Dissociative Disorder Comorbidity Among Patients With Panic Disorder: A Preliminary Study.

    Science.gov (United States)

    Ural, Cenk; Belli, Hasan; Akbudak, Mahir; Tabo, Abdulkadir

    2015-01-01

    This study assessed childhood trauma history, dissociative symptoms, and dissociative disorder comorbidity in patients with panic disorder (PD). A total of 92 psychotropic drug-naive patients with PD, recruited from outpatient clinics in the psychiatry department of a Turkish hospital, were involved in the study. Participants were assessed using the Structured Clinical Interview for DSM-IV Dissociative Disorders (SCID-D), Dissociation Questionnaire, Panic and Agoraphobia Scale, Panic Disorder Severity Scale, and Childhood Trauma Questionnaire. Of the patients with PD, 18 (19%) had a comorbid dissociative disorder diagnosis on screening with the SCID-D. The most prevalent disorders were dissociative disorder not otherwise specified, dissociative amnesia, and depersonalization disorders. Patients with a high degree of dissociation symptoms and dissociative disorder comorbidity had more severe PD than those without (p dissociation and PD. Among all of the subscales, the strongest relationship was with childhood emotional abuse. Logistic regression analysis showed that emotional abuse and severity of PD were independently associated with dissociative disorder. In our study, a significant proportion of the patients with PD had concurrent diagnoses of dissociative disorder. We conclude that the predominance of PD symptoms at admission should not lead the clinician to overlook the underlying dissociative process and associated traumatic experiences among these patients.

  10. Assessment of complex dissociative disorder patients and simulated dissociation in forensic contexts.

    Science.gov (United States)

    Brand, Bethany L; Webermann, Aliya R; Frankel, A Steven

    Few assessors receive training in assessing dissociation and complex dissociative disorders (DDs). Potential differential diagnoses include anxiety, mood, psychotic, substance use, and personality disorders, as well as exaggeration and malingering. Individuals with DDs typically elevate on many clinical and validity scales on psychological tests, yet research indicates that they can be distinguished from DD simulators. Becoming informed about the testing profiles of DD individuals and DD simulators can improve the accuracy of differential diagnoses in forensic settings. In this paper, we first review the testing profiles of individuals with complex DDs and contrast them with DD simulators on assessment measures used in forensic contexts, including the Minnesota Multiphasic Personality Inventory-2 (MMPI-2), Personality Assessment Inventory (PAI), and the Structured Inventory of Reported Symptoms (SIRS), as well as dissociation-specific measures such as the Dissociative Experiences Scale (DES) and Structured Clinical Interview for DSM-IV Dissociative Disorders (SCID-D-R). We then provide recommendations for assessing complex trauma and dissociation through the aforementioned assessments. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Does phasic trauma treatment make patients with dissociative identity disorder treatment more dissociative?

    Science.gov (United States)

    Brand, Bethany; Loewenstein, Richard J

    2014-01-01

    Proponents of the iatrogenic model of the etiology of dissociative identity disorder (DID) have expressed concern that treatment focused on direct engagement and interaction with dissociated self-states harms DID patients. However, empirical data have shown that this type of DID treatment is beneficial. Analyzing data from the prospective Treatment of Patients With Dissociative Disorders (TOP DD) Study, we test empirically whether DID treatment is associated with clinically adverse manifestations of dissociated self-states: acting so differently that one feels like different people, hearing voices, and dissociative amnesia. We show that, over the course of the study, there were significant decreases in feeling like different people and hearing voices. These results indicate that this form of DID treatment does not lead to symptomatic worsening in these dimensions, as predicted by the iatrogenic model. Indeed, treatment provided by TOP DD therapists reduced, rather than increased, the extent to which patients experienced manifestations of pathological dissociation. Because severe symptomatology and impairment are associated with DID, iatrogenic harm may come from depriving DID patients of treatment that targets DID symptomatology.

  12. Dissociation of acetaldehyde in intense laser field: Coulomb explosion or field-assisted dissociation?

    Science.gov (United States)

    Elshakre, Mohamed E.; Gao, Lirong; Tang, Xiaoping; Wang, Sufan; Shu, Yafei; Kong, Fanao

    2003-09-01

    Dissociation of acetaldehyde in moderate strong laser field of 1013-1014W/cm2 was investigated. Singly charged parent ion CH3CHO+ and fragmental ions CH3+, CHO+, C2H4+, O+, CH2CHO+, and H+ were produced by 800 nm laser of 100 fs pulse duration and recorded by time-of-flight mass spectrometer. The CH3+ fragment further dissociated to CH2+, CH+, and C+ ions at higher intensity. Ab initio calculated results show that the singly-, doubly-, and triply charged parent ions are stable. So, the dissociation mechanism was not due to Coulomb explosion of multicharged ion. A field-assisted dissociation (FAD) theory, which assumes that only one bond undergoes dissociation while the rest of the molecular geometry stays unchanged, was employed to treat the dissociation dynamics. Accordingly, the dressed potential energy surfaces of the ground state for the parent and the fragment ions were calculated. Corresponding quasiclassical trajectory calculations show that the bond ruptures take place in the order of C-C, C-O, and C-H, agreeing with the observation. The observed angular dependence and charge distribution of the product ions can also be interpreted by the FAD theory.

  13. Predictors of trait dissociation and peritraumatic dissociation induced via cold pressor.

    Science.gov (United States)

    Gómez-Pérez, Lydia; López-Martínez, Alicia Eva; Asmundson, Gordon John Glenn

    2013-11-30

    Understanding which factors predict individual dissociative response during stressful situations is important to clarify the nature of dissociation and the mechanisms associated to its use as a coping strategy. The present study examined (1) whether experiential avoidance (EA), anxiety sensitivity (AS), depressive symptoms, and state anxiety concurrently predicted trait dissociation (TD)-absorption, amnesia, depersonalization, and total TD scores-and laboratory induced dissociation (LID); and (2) whether TD and catastrophizing predicted LID. We also examined whether catastrophizing mediated the relationships between both AS and depressive symptoms and LID. A total of 101 female undergraduate students participated in a cold pressor task, which significantly induced dissociation. Results of hierarchical regression analyses showed that AS at Time 1 (9 months before the experimental session), as well as depressive symptoms and catastrophizing at the time of the experiment (Time 2), predicted LID at Time 2. Depressive symptoms at Time 2 predicted total TD, absorption, and amnesia scores. AS at Time 1 and depressive symptoms at Time 2 predicted depersonalization. AS, depressive symptoms, and catastrophizing seem to facilitate the use of dissociative strategies by healthy individuals, even in response to non-traumatic but discomforting stress. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  14. Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

    International Nuclear Information System (INIS)

    Melchior, G.W.; Castle, C.K.

    1989-01-01

    Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

  15. The Contribution of Art Therapy to the Dissociative Disorders.

    Science.gov (United States)

    Murphy, Patricia S.

    1994-01-01

    Explored concepts of brain hemispheric lateralization and distinct right brain functioning in extensive dissociation by administering Dissociative Experiences Scale to 114 engineering students and 92 university drawing students. Chi-square calculation found differences in dissociative scoring levels between groups that approached significance at…

  16. The Parenting Experiences of Mothers with Dissociative Disorders.

    Science.gov (United States)

    Benjamin, Lynn R.; Benjamin, Robert; Rind, Bruce

    1998-01-01

    Presents a qualitative analysis of the experience of parenting of mothers with dissociative disorders. Using the mothers' words, describes how the five symptom areas of dissociation impeded their parenting efforts. Discusses the necessity of addressing parenting in the treatment of client-mothers with dissociative disorders. (Author/MKA)

  17. Development, Reliability, and Validity of a Child Dissociation Scale.

    Science.gov (United States)

    Putnam, Frank W.; And Others

    1993-01-01

    Evaluation of the Child Dissociative Checklist found it to be a reliable and valid observer report measure of dissociation in children, including sexually abused girls and children with dissociative disorder and with multiple personality disorder. The checklist, which is appended, is intended as a clinical screening instrument and research measure…

  18. Cognitive Processes in Dissociation: Comment on Giesbrecht et al. (2008)

    Science.gov (United States)

    Bremner, J. Douglas

    2010-01-01

    In their recent review "Cognitive Processes in Dissociation: An Analysis of Core Theoretical Assumptions," published in "Psychological Bulletin", Giesbrecht, Lynn, Lilienfeld, and Merckelbach (2008) have challenged the widely accepted trauma theory of dissociation, which holds that dissociative symptoms are caused by traumatic stress. In doing so,…

  19. Speech-Language Dissociations, Distractibility, and Childhood Stuttering

    Science.gov (United States)

    Conture, Edward G.; Walden, Tedra A.; Lambert, Warren E.

    2015-01-01

    Purpose This study investigated the relation among speech-language dissociations, attentional distractibility, and childhood stuttering. Method Participants were 82 preschool-age children who stutter (CWS) and 120 who do not stutter (CWNS). Correlation-based statistics (Bates, Appelbaum, Salcedo, Saygin, & Pizzamiglio, 2003) identified dissociations across 5 norm-based speech-language subtests. The Behavioral Style Questionnaire Distractibility subscale measured attentional distractibility. Analyses addressed (a) between-groups differences in the number of children exhibiting speech-language dissociations; (b) between-groups distractibility differences; (c) the relation between distractibility and speech-language dissociations; and (d) whether interactions between distractibility and dissociations predicted the frequency of total, stuttered, and nonstuttered disfluencies. Results More preschool-age CWS exhibited speech-language dissociations compared with CWNS, and more boys exhibited dissociations compared with girls. In addition, male CWS were less distractible than female CWS and female CWNS. For CWS, but not CWNS, less distractibility (i.e., greater attention) was associated with more speech-language dissociations. Last, interactions between distractibility and dissociations did not predict speech disfluencies in CWS or CWNS. Conclusions The present findings suggest that for preschool-age CWS, attentional processes are associated with speech-language dissociations. Future investigations are warranted to better understand the directionality of effect of this association (e.g., inefficient attentional processes → speech-language dissociations vs. inefficient attentional processes ← speech-language dissociations). PMID:26126203

  20. Motion Capturing Emotions

    Directory of Open Access Journals (Sweden)

    Wood Karen

    2017-12-01

    Full Text Available The paper explores the activities conducted as part of WhoLoDancE: Whole Body Interaction Learning for Dance Education which is an EU-funded Horizon 2020 project. In particular, we discuss the motion capture sessions that took place at Motek, Amsterdam as well as the dancers’ experience of being captured and watching themselves or others as varying visual representations through the HoloLens. HoloLens is Microsoft’s first holographic computer that you wear as you would a pair of glasses. The study embraced four dance genres: Ballet, Contemporary, Flamenco and Greek Folk dance. We are specifically interested in the kinesthetic and emotional engagement with the moving body and what new corporeal awareness may be experienced. Positioning the moving, dancing body as fundamental to technological advancements, we discuss the importance of considering the dancer’s experience in the real and virtual space. Some of the artists involved in the project have offered their experiences, which are included, and they form the basis of the discussion. In addition, we discuss the affect of immersive environments, how these environments expand reality and what effect (emotionally and otherwise that has on the body. The research reveals insights into relationships between emotion, movement and technology and what new sensorial knowledge this evokes for the dancer.

  1. Synovectomy by Neutron capture

    International Nuclear Information System (INIS)

    Vega C, H.R.; Torres M, C.

    1998-01-01

    The Synovectomy by Neutron capture has as purpose the treatment of the rheumatoid arthritis, illness which at present does not have a definitive curing. This therapy requires a neutron source for irradiating the articulation affected. The energy spectra and the intensity of these neutrons are fundamental since these neutrons induce nuclear reactions of capture with Boron-10 inside the articulation and the freely energy of these reactions is transferred at the productive tissue of synovial liquid, annihilating it. In this work it is presented the neutron spectra results obtained with moderator packings of spherical geometry which contains in its center a Pu 239 Be source. The calculations were realized through Monte Carlo method. The moderators assayed were light water, heavy water base and the both combination of them. The spectra obtained, the average energy, the neutron total number by neutron emitted by source, the thermal neutron percentage and the dose equivalent allow us to suggest that the moderator packing more adequate is what has a light water thickness 0.5 cm (radius 2 cm) and 24.5 cm heavy water (radius 26.5 cm). (Author)

  2. Rate coefficients for dissociative attachment and resonant electron-impact dissociation involving vibrationally excited O{sub 2} molecules

    Energy Technology Data Exchange (ETDEWEB)

    Laporta, V. [Istituto di Metodologie Inorganiche e dei Plasmi, CNR, Bari, Italy and Department of Physics and Astronomy, University College London, London WC1E 6BT (United Kingdom); Celiberto, R. [Dipartimento di Ingegneria Civile, Ambientale, del Territorio, Edile e di Chimica, Politecnico di Bari, Italy and Istituto di Metodologie Inorganiche e dei Plasmi, CNR, Bari (Italy); Tennyson, J. [Department of Physics and Astronomy, University College London, London WC1E 6BT (United Kingdom)

    2014-12-09

    Rate coefficients for dissociative electron attachment and electron-impact dissociation processes, involving vibrationally excited molecular oxygen, are presented. Analytical fits of the calculated numerical data, useful in the applications, are also provided.

  3. Classical-quantal coupling in the capture of muons by hydrogen atoms

    International Nuclear Information System (INIS)

    Kwong, N.H.; Garcia, J.D.

    1989-01-01

    We describe a self-consistent semiclassical approach to the problem of muon capture by hydrogen atoms. The dynamics of the heavier muon and proton are treated classically, and the electron quantally, with the potentials for both being self-consistently determined. Our numerical results are compared to classical-trajectory Monte Carlo (CTMC) and adiabatic ionisation (AI) results. Our capture cross sections are larger at low energy but fall more rapidly to zero. Our results provide the corrections to the dynamics beyond the adiabatic picture, which were missing in other approaches; interesting questions concerning the quantal nature of the events are discussed. (author)

  4. Resonant electron capture by aspartame and aspartic acid molecules.

    Science.gov (United States)

    Muftakhov, M V; Shchukin, P V

    2016-12-30

    The processes for dissociative electron capture are the key mechanisms for decomposition of biomolecules, proteins in particular, under interaction with low-energy electrons. Molecules of aspartic acid and aspartame, i.e. modified dipeptides, were studied herein to define the impact of the side functional groups on peptide chain decomposition in resonant electron-molecular reactions. The processes of formation and decomposition of negative ions of both aspartame and aspartic acid were studied by mass spectrometry of negative ions under resonant electron capture. The obtained mass spectra were interpreted under thermochemical analysis by quantum chemical calculations. Main channels of negative molecular ions fragmentation were found and characteristic fragment ions were identified. The СООН fragment of the side chain in aspartic acid is shown to play a key role like the carboxyl group in amino acids and aliphatic oligopeptides. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  5. Doped phosphorene for hydrogen capture: A DFT study

    Science.gov (United States)

    Zhang, Hong-ping; Hu, Wei; Du, Aijun; Lu, Xiong; Zhang, Ya-ping; Zhou, Jian; Lin, Xiaoyan; Tang, Youhong

    2018-03-01

    Hydrogen capture and storage is the core of hydrogen energy application. With its high specific surface area, direct bandgap, and variety of potential applications, phosphorene has attracted much research interest. In this study, density functional theory (DFT) is utilized to study the interactions between doped phosphorenes and hydrogen molecules. The effects of different dopants and metallic or nonmetallic atoms on phosphorene/hydrogen interactions is systematically studied by adsorption energy, electron density difference, partial density of states analysis, and Hirshfeld population. Our results indicate that the metallic dopants Pt, Co, and Ni can help to improve the hydrogen capture ability of phosphorene, whereas the nonmetallic dopants have no effect on it. Among the various metallic dopants, Pt performs very differently, such that it can help to dissociate H2 on phosphorene. Specified doped phosphorene could be a promising candidate for hydrogen storage, with behaviors superior to those of intrinsic graphene sheet.

  6. Study of the 17Ne Coulomb dissociation process and its role for the rp process of nucleosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Marganiec, Justyna [TU Darmstadt (Germany); EMMI, GSI Darmstadt (Germany); Wamers, Felix [EMMI, GSI Darmstadt (Germany); TU Darmstadt (Germany); GSI Darmstadt (Germany); FIAS, Frankfurt am Main (Germany); Aumann, Thomas [TU Darmstadt (Germany); GSI Darmstadt (Germany); Egorova, Irina [BLTP JINR Dubna (Russian Federation); Grigorenko, Leonid [FLNR JINR Dubna (Russian Federation); RRC KI, Moscow (Russian Federation); Heil, Michael [GSI Darmstadt (Germany); Perfenova, Yuliya [FLNR JINR Dubna (Russian Federation); INP, Moscow (Russian Federation); Plag, Ralf [GSI Darmstadt (Germany); Goethe-Universitaet, Frankfurt am Main (Germany); Collaboration: R3B-Collaboration

    2014-07-01

    The study of {sup 17}Ne Coulomb dissociation process gives us a possibility to study the time-reversed reaction {sup 15}O(2p,γ){sup 17}Ne, with the detailed balance theorem. This reaction could serve as a bypass of {sup 15}O waiting point during the rp process, and move the initial CNO material towards heavier nuclei. The two-proton capture can proceed sequentially or directly from the three-body continuum. And the reaction rate can be enhanced by a few orders of magnitude by taking the three-body continuum into account. The Coulomb dissociation method is the one way to experimentally determine the three-body radiative capture cross section, which is needed to verify theoretical calculations, and which was not experimentally determined yet. The experiment has been performed at the LAND/R3B setup at GSI.

  7. Use of Computed X-ray Tomographic Data for Analyzing the Thermodynamics of a Dissociating Porous Sand/Hydrate Mixture

    Science.gov (United States)

    Freifeld, Barry M.; Kneafsey, Timothy J.; Tomutsa, Liviu; Stern, Laura A.; Kirby, Stephen H.

    2002-02-28

    X-ray computed tomography (CT) is a method that has been used extensively in laboratory experiments for measuring rock properties and fluid transport behavior. More recently, CT scanning has been applied successfully to detect the presence and study the behavior of naturally occurring hydrates. In this study, we used a modified medical CT scanner to image and analyze the progression of a dissociation front in a synthetic methane hydrate/sand mixture. The sample was initially scanned under conditions at which the hydrate is stable (atmospheric pressure and liquid nitrogen temperature, 77 K). The end of the sample holder was then exposed to the ambient air, and the core was continuously scanned as dissociation occurred in response to the rising temperature. CT imaging captured the advancing dissociation front clearly and accurately. The evolved gas volume was monitored as a function of time. Measured by CT, the advancing hydrate dissociation front was modeled as a thermal conduction problem explicitly incorporating the enthalpy of dissociation, using the Stefan moving-boundary-value approach. The assumptions needed to perform the analysis consisted of temperatures at the model boundaries. The estimated value for thermal conductivity of 2.6 W/m K for the remaining water ice/sand mixture is higher than expected based on conduction alone; this high value may represent a lumped parameter that incorporates the processes of heat conduction, methane gas convection, and any kinetic effects that occur during dissociation. The technique presented here has broad implications for future laboratory and field testing that incorporates geophysical techniques to monitor gas hydrate dissociation.

  8. Use of computed X-ray tomographic data for analyzing the thermodynamics of a dissociating porous sand/hydrate mixture

    International Nuclear Information System (INIS)

    Freifeld, Barry M.; Kneafsey, Timothy J.; Tomutsa, Liviu; Stern, Laura A.; Kirby, Stephen H.

    2002-01-01

    X-ray computed tomography (CT) is a method that has been used extensively in laboratory experiments for measuring rock properties and fluid transport behavior. More recently, CT scanning has been applied successfully to detect the presence and study the behavior of naturally occurring hydrates. In this study, we used a modified medical CT scanner to image and analyze the progression of a dissociation front in a synthetic methane hydrate/sand mixture. The sample was initially scanned under conditions at which the hydrate is stable (atmospheric pressure and liquid nitrogen temperature, 77 K). The end of the sample holder was then exposed to the ambient air, and the core was continuously scanned as dissociation occurred in response to the rising temperature. CT imaging captured the advancing dissociation front clearly and accurately. The evolved gas volume was monitored as a function of time. Measured by CT, the advancing hydrate dissociation front was modeled as a thermal conduction problem explicitly incorporating the enthalpy of dissociation, using the Stefan moving-boundary-value approach. The assumptions needed to perform the analysis consisted of temperatures at the model boundaries. The estimated value for thermal conductivity of 2.6 W/m K for the remaining water ice/sand mixture is higher than expected based on conduction alone; this high value may represent a lumped parameter that incorporates the processes of heat conduction, methane gas convection, and any kinetic effects that occur during dissociation. The technique presented here has broad implications for future laboratory and field testing that incorporates geophysical techniques to monitor gas hydrate dissociation

  9. Squeeze Casting Method Of AI-Si Alloy For Piston Material

    International Nuclear Information System (INIS)

    Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

    2001-01-01

    The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

  10. Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

    DEFF Research Database (Denmark)

    Gori, Klaus; Jespersen, Lene

    2007-01-01

    ). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

  11. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  12. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  13. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  14. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  15. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  16. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  17. Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

    Institute of Scientific and Technical Information of China (English)

    李雪; 何芳; 卢金霞; 管翠萍; 周学章

    2017-01-01

    [Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2信号分子的活性;用荧光定量PCR法检测luxS基因的转录水平;用苦参碱

  18. Robust automated knowledge capture.

    Energy Technology Data Exchange (ETDEWEB)

    Stevens-Adams, Susan Marie; Abbott, Robert G.; Forsythe, James Chris; Trumbo, Michael Christopher Stefan; Haass, Michael Joseph; Hendrickson, Stacey M. Langfitt

    2011-10-01

    This report summarizes research conducted through the Sandia National Laboratories Robust Automated Knowledge Capture Laboratory Directed Research and Development project. The objective of this project was to advance scientific understanding of the influence of individual cognitive attributes on decision making. The project has developed a quantitative model known as RumRunner that has proven effective in predicting the propensity of an individual to shift strategies on the basis of task and experience related parameters. Three separate studies are described which have validated the basic RumRunner model. This work provides a basis for better understanding human decision making in high consequent national security applications, and in particular, the individual characteristics that underlie adaptive thinking.

  19. Fragment capture device

    Science.gov (United States)

    Payne, Lloyd R.; Cole, David L.

    2010-03-30

    A fragment capture device for use in explosive containment. The device comprises an assembly of at least two rows of bars positioned to eliminate line-of-sight trajectories between the generation point of fragments and a surrounding containment vessel or asset. The device comprises an array of at least two rows of bars, wherein each row is staggered with respect to the adjacent row, and wherein a lateral dimension of each bar and a relative position of each bar in combination provides blockage of a straight-line passage of a solid fragment through the adjacent rows of bars, wherein a generation point of the solid fragment is located within a cavity at least partially enclosed by the array of bars.

  20. Capturing the Daylight Dividend

    Energy Technology Data Exchange (ETDEWEB)

    Peter Boyce; Claudia Hunter; Owen Howlett

    2006-04-30

    Capturing the Daylight Dividend conducted activities to build market demand for daylight as a means of improving indoor environmental quality, overcoming technological barriers to effective daylighting, and informing and assisting state and regional market transformation and resource acquisition program implementation efforts. The program clarified the benefits of daylight by examining whole building systems energy interactions between windows, lighting, heating, and air conditioning in daylit buildings, and daylighting's effect on the human circadian system and productivity. The project undertook work to advance photosensors, dimming systems, and ballasts, and provided technical training in specifying and operating daylighting controls in buildings. Future daylighting work is recommended in metric development, technology development, testing, training, education, and outreach.

  1. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  2. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  3. Comparing the symptoms and mechanisms of "dissociation" in dissociative identity disorder and borderline personality disorder.

    Science.gov (United States)

    Laddis, Andreas; Dell, Paul F; Korzekwa, Marilyn

    2017-01-01

    A total of 75 patients were diagnosed with the Structured Clinical Interview for DSM-IV Dissociative Disorders-Revised as having dissociative identity disorder (DID), and 100 patients were diagnosed with the Structured Interview for DSM-IV Personality as having borderline personality disorder (BPD). Both groups were administered the Multidimensional Inventory of Dissociation (MID). DID patients had significantly higher MID scores than BPD patients, different distributions of MID scores, and different MID subscale profiles in 3 ranges of MID scores (0-15, 15-30, 30-45). The core MID symptoms-exhibited at all ranges of MID scores-for DID patients (the presence of alters, identity confusion, and memory problems) and BPD patients (flashbacks, identity confusion, and memory problems) were ostensibly similar but were considered to be mostly produced by different underlying processes. Multiple regression analyses showed that the core MID symptoms of DID patients had different predictors than did the core MID symptoms of BPD patients. Alter identities seemed to generate most-but not all-dissociative phenomena in DID patients, whereas only the 24% highest scoring BPD patients (MID ≥45) seemed to manifest alter-driven dissociative experiences. Most BPD dissociative experiences appeared to be due to 5 other mechanisms: (a) BPD-specific, stress-driven, rapid shifts of self-state; (b and c) nondefensive disruptions of the framework of perceptual organization with or without an accompanying BPD-specific, dissociation-like disintegration of affective/neurocognitive functioning; (d) a defensive distancing or detachment from distress (i.e., simple depersonalization); and (e) Allen, Console, and Lewis's (1999) severe absorptive detachment.

  4. Grammatical category dissociation in multilingual aphasia.

    Science.gov (United States)

    Faroqi-Shah, Yasmeen; Waked, Arifi N

    2010-03-01

    Word retrieval deficits for specific grammatical categories, such as verbs versus nouns, occur as a consequence of brain damage. Such deficits are informative about the nature of lexical organization in the human brain. This study examined retrieval of grammatical categories across three languages in a trilingual person with aphasia who spoke Arabic, French, and English. In order to delineate the nature of word production difficulty, comprehension was tested, and a variety of concomitant lexical-semantic variables were analysed. The patient demonstrated a consistent noun-verb dissociation in picture naming and narrative speech, with severely impaired production of verbs across all three languages. The cross-linguistically similar noun-verb dissociation, coupled with little evidence of semantic impairment, suggests that (a) the patient has a true "nonsemantic" grammatical category specific deficit, and (b) lexical organization in multilingual speakers shares grammatical class information between languages. The findings of this study contribute to our understanding of the architecture of lexical organization in bilinguals.

  5. P300 is attenuated during dissociative episodes.

    Science.gov (United States)

    Kirino, Eiji

    2006-02-01

    The present study examined the pathophysiology of dissociative phenomena using the P300 component of event-related potentials, quantitative electroencephalography (QEEG), and morphology measures of computed tomography scan. Event-related potentials during an auditory oddball paradigm and QEEG in resting state were recorded. Patients exhibited attenuation of P300 amplitudes compared with controls during dissociative episodes, but exhibited recovery to control levels in remission. Patients had a larger Sylvian fissure-brain ratio than did controls. QEEG findings revealed no significant differences between the patients and controls or between episodes and remission in the patient group. Attenuation of the P300 can be interpreted as the result of a negative feedback loop from the medial temporal lobe to the cortex, which decreases the amount of information flow, allocation of attentional resources, and updating of working memory to avoid both excessive long-term memory system activity in medial temporal lobe and resurgence of affect-laden memories.

  6. Dissociative Disorders: Between Neurosis and Psychosis

    Science.gov (United States)

    Devillé, C.; Moeglin, C.; Sentissi, O.

    2014-01-01

    Dissociative disorders are a set of disorders defined by a disturbance affecting functions that are normally integrated with a prevalence of 2.4 percent in industrialised countries. These disorders are often poorly diagnosed or misdiagnosed because of sharing common clinical features with psychotic disorders, but requiring a very different trajectory of care. Repeated clinical situations in a crisis centre in Geneva provided us with a critical overview of current evidence of knowledge in clinical and etiopathological field about dissociative disorders. Because of their multiple expressions and the overlap with psychotic disorders, we focused on the clinical aspects using three different situations to better understand their specificity and to extend our thinking to the relevance of terms “neurosis” and “psychosis.” Finally, we hope that this work might help physicians and psychiatrists to become more aware of this complex set of disorders while making a diagnosis. PMID:25405051

  7. Dissociative Disorders: Between Neurosis and Psychosis

    Directory of Open Access Journals (Sweden)

    C. Devillé

    2014-01-01

    Full Text Available Dissociative disorders are a set of disorders defined by a disturbance affecting functions that are normally integrated with a prevalence of 2.4 percent in industrialised countries. These disorders are often poorly diagnosed or misdiagnosed because of sharing common clinical features with psychotic disorders, but requiring a very different trajectory of care. Repeated clinical situations in a crisis centre in Geneva provided us with a critical overview of current evidence of knowledge in clinical and etiopathological field about dissociative disorders. Because of their multiple expressions and the overlap with psychotic disorders, we focused on the clinical aspects using three different situations to better understand their specificity and to extend our thinking to the relevance of terms “neurosis” and “psychosis.” Finally, we hope that this work might help physicians and psychiatrists to become more aware of this complex set of disorders while making a diagnosis.

  8. Critical superheats upon boiling of dissociating liquids

    International Nuclear Information System (INIS)

    Kolykhan, L.I.; Solov'ev, V.N.

    1985-01-01

    The experimental data on critical superheats of dissociating liquids, i.e. nitrogen tetroxide and nitrine are presented (nitrine is the solution of nitrogen oxide in nitrogen tetroxide). The experiments with boiling N 2 O 4 have been carried out in the pressure range 0.1-3.0 MPa and with boiling nitrine within the pressure range 0.2-9.0 MPa. The experiments have revealed an anomalous dependence of critical superheats on pressure P, thus at P>=2.5 MPa the critical superheat values exceed the limiting ones, and at P=4.5 MPa this excess amounts to more than 16 K, essentially exceeding the errors of the experiments. The results for N 2 O 4 critical superheats agree with experimental data of other authors. Complex phenomena observed upon boiling of dissociating liquids require further theoretical and experimental studies

  9. Photon diffractive dissociation in deep inelastic scattering

    International Nuclear Information System (INIS)

    Ryskin, M.G.

    1990-01-01

    The new ep-collider HERA gives us the possibility to study the diffractive dissociation of virtual photon in deep inelastic ep-collision. The process of photon dissociation in deep inelastic scattering is the most direct way to measure the value of triple-pomeron vertex G 3P . It was shown that the value of the correct bare vertex G 3P may more than 4 times exceeds its effective value measuring in the triple-reggeon region and reaches the value of about 40-50% of the elastic pp-pomeron vertex. On the contrary in deep inelastic processes the perpendicular momenta q t of the secondary particles are large enough. Thus in deep inelastic reactions one can measure the absolute value of G 3P vertex in the most direct way and compare its value and q t dependence with the leading log QCD predictions

  10. Dissociative Excitation of Thymine by Electron Impact

    Science.gov (United States)

    McConkey, William; Tiessen, Collin; Hein, Jeffrey; Trocchi, Joshuah; Kedzierski, Wladek

    2014-05-01

    A crossed electron-gas beam system coupled to a VUV spectrometer has been used to investigate the dissociation of thymine (C5H6N2O2) into excited atomic fragments in the electron-impact energy range from threshold to 375 eV. A special stainless steel oven is used to vaporize the thymine and form it into a beam where it is intersected by a magnetically collimated electron beam, typical current 50 μA. The main features in the spectrum are the H Lyman series lines. The probability of extracting excited C or N atoms from the ring is shown to be very small. In addition to spectral data, excitation probability curves as a function of electron energy will be presented for the main emission features. Possible dissociation channels and excitation mechanisms in the parent molecule will be discussed. The authors thank NSERC (Canada) for financial support.

  11. Dissociative Disorders Among Chinese Inpatients Diagnosed With Schizophrenia

    Science.gov (United States)

    Yu, Junhan; Ross, Colin A.; Keyes, Benjamin B.; Li, Ying; Dai, Yunfei; Zhang, Tianhong; Wang, Lanlan; Fan, Qing; Xiao, Zeping

    2010-01-01

    The purpose of the study was to assess the prevalence of dissociative disorders in a sample of Chinese psychiatric inpatients. Participants in the study consisted of 569 consecutively admitted inpatients at Shanghai Mental Health Center, China, of whom 84.9% had a clinical diagnosis of schizophrenia based on the Chinese Classification and Diagnostic Criteria for Mental Disorders, Version 3 (CCMD-3). All participants completed a self-report measure of dissociation, the Dissociative Experiences Scale (DES) and none had a prior diagnosis of a dissociative disorder. Ninety-six randomly selected participants were interviewed with a structured interview, the Dissociative Disorders Interview Schedule (DDIS) and a clinical interview. These 96 patients did not differ significantly from the 473 patients who were not interviewed on any demographic measures or on the self-report measure dissociation. A total of 28 (15.3%, after weighting of the data) patients received a clinical diagnosis of a dissociative disorder based on DSM-IV-TR criteria. Dissociative identity disorder was diagnosed in 2 (0.53%, after weighting) patients. Compared to the patients without a dissociative disorder, patients with dissociative disorders were significantly more likely to report childhood abuse (57.1% versus 22.1%), but the two groups did not differ significantly on any demographic measures. Dissociative disorders were readily identified in an inpatient psychiatric population in China. PMID:20603768

  12. LuxS-independent formation of AI-2 from ribulose-5-phosphate

    Directory of Open Access Journals (Sweden)

    Hardie Kim R

    2008-06-01

    Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

  13. Malingering dissociative identity disorder: objective and projective assessment.

    Science.gov (United States)

    Labott, Susan M; Wallach, Heather R

    2002-04-01

    Verification of dissociative identity disorder presents challenges given the complex nature of the illness. This study addressed the concern that this disorder can be successfully malingered on objective and projective psychological tests. 50 undergraduate women were assigned to a Malingering or a Control condition, then completed the Rorschach Inkblot Test and the Dissociative Experiences Scale II. The Malingering group were asked to simulate dissociative identity disorder; controls received instructions to answer all materials honestly. Analysis indicated that malingerers were significantly more likely to endorse dissociative experiences on the Dissociative Experiences Scale II in the range common to patients with diagnosed dissociative identity disorder. However, on the Rorschach there were no significant differences between the two groups. Results suggest that the assessment of dissociative identity disorder requires a multifaceted approach with both objective and projective assessment tools. Research is needed to assess these issues in clinical populations.

  14. Teaching Chinese psychiatrists to make reliable dissociative disorder diagnoses.

    Science.gov (United States)

    Fan, Qing; Yu, Junhan; Ross, Colin A; Keyes, Benjamin B; Dai, Yunfei; Zhang, Tianhong; Wang, Lanlan; Xiao, Zeping

    2011-09-01

    The aim of the study was to assess the outcome of an educational effort by two North American experts in dissociative disorders to teach Chinese psychiatrists to make reliable dissociative disorder diagnoses. In the final phase of the educational effort, 569 patients at Shanghai Mental Health Center completed the Chinese version of the Dissociative Experiences Scale (DES). Patients were then randomly selected in different proportions according to their DES scores: 96 selected patients were then assessed with the Dissociative Disorders Interview Schedule (DDIS) and clinical diagnostic interviews based on DSM-IV criteria. According to the clinical diagnostic interviews, 28 (4.9%) patients were diagnosed as having dissociative disorders. Agreement between the American experts and Chinese psychiatrists for presence or absence of a dissociative disorder was 0.75 using Cohen's kappa. Dissociative disorders can be diagnosed in China with good inter-rater reliability. The authors describe the steps taken to achieve this outcome.

  15. Total dissociation cross section of halo nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Formanek, J. [Karlova Univ., Prague (Czech Republic). Fakulta Matematicko-Fyzikalni; Lombard, R.J. [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire

    1996-10-01

    Calculations of the total dissociation cross section is performed in the impact parameter representation. The case of {sup 11}Be and {sup 11}Li loosing one and two neutron(s), respectively, by collision on a {sup 12}C target, which remains in its ground state are discussed. The results are found to depend essentially on the rms radius of the halo wave function. (author). 12 refs.

  16. Dressing effect in multiphoton unimolecular dissociation

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Diaz, P.F.; Garcia-Fernandez, P.

    1986-03-01

    On the basis of a quantum-statistical model recently discussed, we deal in this paper with the perturbations induced by the intense field of a CO/sub 2/ laser on the levels of the vibrational pattern of a molecule undergoing multiphoton unimolecular dissociation. This perturbational correction is investigated by using a displacement operator technique and the results are interpreted according to the statistical model.

  17. The AI&M procedure for learning from incomplete data

    DEFF Research Database (Denmark)

    Jaeger, Manfred

    2006-01-01

    We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main difficult......We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main...... by operations in the space of data completions, rather than directly in the parameter space of the profile likelihood. We apply the AI\\&M method to learning parameters for Bayesian networks. The method is compared against conservative inference, which takes into account each possible data completion......, and against EM. The results indicate that likelihood-based inference is still feasible in the case of unknown missingness mechanisms, and that conservative inference is unnecessarily weak. On the other hand, our results also provide evidence that the EM algorithm is still quite effective when the data...

  18. Building regional early flood warning systems by AI techniques

    Science.gov (United States)

    Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

    2017-12-01

    Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

  19. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  20. AI empowered context-aware smart system for medication adherence

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-06-01

    Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

  1. Dictionnaire étymologique du français

    CERN Document Server

    Picoche, Jacqueline

    1979-01-01

    Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).

  2. AI and simulation: What can they learn from each other

    Science.gov (United States)

    Colombano, Silvano P.

    1988-01-01

    Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

  3. CURRENT ISSUES IN OUTSOURCING: MIS, AIS AND BEYOND

    Directory of Open Access Journals (Sweden)

    AIDA SY

    2012-01-01

    Full Text Available En años recientes, el outsourcing se ha venido convirtiendo en una tendencia tanto en empresas de Europa y los Estados Unidos. Ni siquiera, trabajadores muy calificados se salvan de este asalto.La vanidad de los intelectuales y los profesionales que ejecutan tanto sistemas de información contable(AIS, como sistemas de información de gestión (MIS es su creencia de que están exentos de estosprocesos de outsourcing. Algunos creen que disfrutan de una vida de ensueño, que la demanda de sus servicios está asegurada. Se consuelan pensando que el aumento de su dominiotécnico les ofrece una defensa suficiente contra los ataques provenientes del mercado laboral y de productos.Una interpretación desde los estudios críticos indicará que esta posición es un acto dearrogancia, siendo esto el eje de la discusión de este documento. Tal actitud de los profesionales contables es una reminiscencia del Rey Canuto esperando que la marea retroceda.

  4. Laser ionization and dissociation of hydrogen

    International Nuclear Information System (INIS)

    Buck, J.D.

    1987-01-01

    Experiments undertaken to further characterize the spectroscopic and photophysical properties of some important excited singlet states of molecular hydrogen and its deuterium isotopes are described. Attention was centered on high vibrational levels of the B, C, and B' states within about 1000 cm -1 of the second dissociation limit. A double-resonance excitation scheme was needed to access levels with a large average bond distance from the ground state. Two-photon absorption of tunable uv-laser radiation-pumped ground-state hydrogen molecules into selected rovibronic levels of the metastable EF double-minimum electronic state. A second tunable near-IR probe laser was scanned to generate ions by resonant multiphoton ionization, where the resonant levels were provided by B, C, B', and other levels near the dissociation limit. New information was obtained regarding line shapes and intensities. Time-of-flight ion mass selection permitted observation of additional excitation channels with dissociation superimposed on the ionization process to produce protons

  5. How thioredoxin dissociates its mixed disulfide.

    Directory of Open Access Journals (Sweden)

    Goedele Roos

    2009-08-01

    Full Text Available The dissociation mechanism of the thioredoxin (Trx mixed disulfide complexes is unknown and has been debated for more than twenty years. Specifically, opposing arguments for the activation of the nucleophilic cysteine as a thiolate during the dissociation of the complex have been put forward. As a key model, the complex between Trx and its endogenous substrate, arsenate reductase (ArsC, was used. In this structure, a Cys29(Trx-Cys89(ArsC intermediate disulfide is formed by the nucleophilic attack of Cys29(Trx on the exposed Cys82(ArsC-Cys89(ArsC in oxidized ArsC. With theoretical reactivity analysis, molecular dynamics simulations, and biochemical complex formation experiments with Cys-mutants, Trx mixed disulfide dissociation was studied. We observed that the conformational changes around the intermediate disulfide bring Cys32(Trx in contact with Cys29(Trx. Cys32(Trx is activated for its nucleophilic attack by hydrogen bonds, and Cys32(Trx is found to be more reactive than Cys82(ArsC. Additionally, Cys32(Trx directs its nucleophilic attack on the more susceptible Cys29(Trx and not on Cys89(ArsC. This multidisciplinary approach provides fresh insights into a universal thiol/disulfide exchange reaction mechanism that results in reduced substrate and oxidized Trx.

  6. Dissociative recombination of small molecular ions

    International Nuclear Information System (INIS)

    Mul, P.M.

    1981-01-01

    In this thesis an analysis is given of merged electron-ion beam experiment and work on dissociative recombination of molecular ions and electrons is described. Chapter II covers a brief introduction of the theory of dissociative recombination. In chapter III, a description is given of the merged electron-ion beam experiment and a method is described which allows the determination of the mean angle between the electron and ion trajectories in a merged electron-ion beam experiment. In chapter IV a paper on the three dominant atmospheric diatomic ions NO + , O 2 + and N 2 + is presented and in chapter V the dissociative recombination for N 2 H + and N 2 D + is discussed. In chapter VI two papers on the polyatomic ions of the carbon-containing molecular ions are presented, and in chapter VII a letter with some results of the work presented in more detail in the chapters IV, V and VI is presented. The magnitude and the energy dependence of the cross-section measured by the merged beam technique and by other techniques is compared and discussed. (Auth.)

  7. Dissociated cultures of newborn mouse brain

    International Nuclear Information System (INIS)

    Wiesmann, U.N.; Hofmann, K.; Burkhart, T.; Herschkowitz, N.

    1975-01-01

    The metabolism of 35 SO 4 -sulfated lipids and mucopolysaccharides was studied in dissociated brain cell cultures from newborn albino mouse brains. The cultures were maintained under an atmosphere of 40% O 2 and 5% CO 2 in apparent good health up to 30 days. Early morphological examination of the dissociated cells demonstrated an initial partial reaggregation of the cells, which later settled and became confluent bilayered cultures. Cell proliferation measured by DNA and protein determination, morphological differentiation and biochemical differentiation took place in the dissociated brain cell cultures analogous in some respects to the in vivo situation. A timed increase in the synthesis of a myelin precursor, cerebroside 35 SO 4 , was observed after 6 to 8 days in culture (DIC). A peak of cerebroside sulfate was evident at 17 DIC. No stable sulfatide was observed at any time. Protein-bound macromolecular 35 SO 4 -MPS was synthetized and secreted from the cells into the culture medium. Maximal synthesis and secretion occurred at 8 DIC. This culture system proves to be a useful model for studying some aspects of differentiation of brain cells under external conditions. (author)

  8. [Questionnaire on dissociative symptoms. German adaptation, reliability and validity of the American Dissociative Experience Scale (DES)].

    Science.gov (United States)

    Freyberger, H J; Spitzer, C; Stieglitz, R D; Kuhn, G; Magdeburg, N; Bernstein-Carlson, E

    1998-06-01

    The "Fragebogen zu dissoziativen Symptomen (FDS)" represents the authorised German translation and adaptation of the "Dissociative Experience Scale" (DES; Bernstein and Putnam 1986). The original scale comprises 28 items covering dissociative experiences with regard to memory, identity, awareness and cognition according to DSM-III-R and DSM-IV. For the German version, 16 items were added to cover dissociative phenomena according to ICD-10, mainly pseudoneurological conversion symptoms. Reliability and validity of the German version were studied in a total sample of 813 persons and were compared to the results of the original version. Test-retest reliability of the FDS was rtt = 0.88 and Cronbach's consistency coefficient was alpha = 0.93, which is comparable to the results of the DES. The instrument differentiates between different samples (healthy control subjects, students, unselected neurological and psychiatric inpatients, neurological and psychiatric patients with a dissociative disorder and schizophrenics). The FDS is an easily applicable, reliable and valid measure to quantify dissociative experiences.

  9. Zero-Point Energy Constraint for Unimolecular Dissociation Reactions. Giving Trajectories Multiple Chances To Dissociate Correctly.

    Science.gov (United States)

    Paul, Amit K; Hase, William L

    2016-01-28

    A zero-point energy (ZPE) constraint model is proposed for classical trajectory simulations of unimolecular decomposition and applied to CH4* → H + CH3 decomposition. With this model trajectories are not allowed to dissociate unless they have ZPE in the CH3 product. If not, they are returned to the CH4* region of phase space and, if necessary, given additional opportunities to dissociate with ZPE. The lifetime for dissociation of an individual trajectory is the time it takes to dissociate with ZPE in CH3, including multiple possible returns to CH4*. With this ZPE constraint the dissociation of CH4* is exponential in time as expected for intrinsic RRKM dynamics and the resulting rate constant is in good agreement with the harmonic quantum value of RRKM theory. In contrast, a model that discards trajectories without ZPE in the reaction products gives a CH4* → H + CH3 rate constant that agrees with the classical and not quantum RRKM value. The rate constant for the purely classical simulation indicates that anharmonicity may be important and the rate constant from the ZPE constrained classical trajectory simulation may not represent the complete anharmonicity of the RRKM quantum dynamics. The ZPE constraint model proposed here is compared with previous models for restricting ZPE flow in intramolecular dynamics, and connecting product and reactant/product quantum energy levels in chemical dynamics simulations.

  10. Dissociative symptoms and dissociative disorders comorbidity in obsessive compulsive disorder: Symptom screening, diagnostic tools and reflections on treatment.

    Science.gov (United States)

    Belli, Hasan

    2014-08-16

    Borderline personality disorder, conversion disorder and obsessive compulsive disorder frequently have dissociative symptoms. The literature has demonstrated that the level of dissociation might be correlated with the severity of obsessive compulsive disorder (OCD) and that those not responding to treatment had high dissociative symptoms. The structured clinical interview for DSM-IV dissociative disorders, dissociation questionnaire, somatoform dissociation questionnaire and dissociative experiences scale can be used for screening dissociative symptoms and detecting dissociative disorders in patients with OCD. However, a history of neglect and abuse during childhood is linked to a risk factor in the pathogenesis of dissociative psychopathology in adults. The childhood trauma questionnaire-53 and childhood trauma questionnaire-40 can be used for this purpose. Clinicians should not fail to notice the hidden dissociative symptoms and childhood traumatic experiences in OCD cases with severe symptoms that are resistant to treatment. Symptom screening and diagnostic tools used for this purpose should be known. Knowing how to treat these pathologies in patients who are diagnosed with OCD can be crucial.

  11. Dissociation and memory fragmentation in post-traumatic stress disorder: an evaluation of the dissociative encoding hypothesis.

    Science.gov (United States)

    Bedard-Gilligan, Michele; Zoellner, Lori A

    2012-01-01

    Several prominent theories of post-traumatic stress disorder (PTSD) posit that peritraumatic dissociation results in insufficient encoding of the trauma memory and that persistent dissociation prevents memory elaboration, resulting in memory fragmentation and PTSD. In this review we summarise the empirical literature on peritraumatic and trait dissociation and trauma narrative fragmentation as measured by meta-memory and rater/objective coding. Across 16 studies to date, the association between dissociation and fragmentation was most prominent when examining peritraumatic dissociation and patient's own ratings of memory fragmentation. This relationship did not hold when examining trait dissociation or rater-coded or computer-generated measures of fragmentation. Thus initial evidence points more towards a strong self-reported association between constructs that is not supported on more objective fragmentation coding. Measurement overlap, construct ambiguity, and exclusion of potential confounds may underlie lack of a strong association between dissociation and objective-rated fragmentation.

  12. Neutron capture therapy

    International Nuclear Information System (INIS)

    Jun, B. J.

    1998-11-01

    The overall state of the art related with neutron capture therapy(NCT) is surveyed. Since the field related with NCT is very wide, it is not intended to survey all related subjects in depth. The primary objective of this report is to help those working for the installation of a NCT facility and a PGNAA(prompt gamma ray neutron activation analysis) system for the boron analysis understand overall NCT at Hanaro. Therefore, while the parts of reactor neutron source and PGNAA are dealt in detail, other parts are limited to the level necessary to understand related fields. For example, the subject of chemical compound which requires intensive knowledge on chemistry, is not dealt as a separated item. However, the requirement of a compound for NCT, currently available compounds, their characteristics, etc. could be understood through this report. Although the subject of cancer treated by NCT is out of the capability of the author, it is dealt focussing its characteristics related with the success of NCT. Each detailed subject is expected to be dealt more detail by specialists in future. This report would be helpful for the researchers working for the NCT to understand related fields. (author). 128 refs., 3 tabs., 12 figs

  13. Captured by Aliens

    Science.gov (United States)

    Achenbach, Joel

    2000-03-01

    Captured by Aliens is a long and twisted voyage from science to the supernatural and back again. I hung out in Roswell, N.M., spent time with the Mars Society, met a guy who was figuring out the best way to build a spaceship to go to Alpha Centauri. I visited the set of the X-Files and talked to Mulder and Scully. One day over breakfast I was told by NASA administrator Dan Goldin, We live in a fog, man! He wants the big answers to the big questions. I spent a night in the base of a huge radio telescope in the boondocks of West Virginia, awaiting the signal from the aliens. I was hypnotized in a hotel room by someone who suspected that I'd been abducted by aliens and that this had triggered my interest in the topic. In the last months of his life, I talked to Carl Sagan, who believed that the galaxy riots with intelligent civilizations. He's my hero, for his steadfast adherence to the scientific method. What I found in all this is that the big question that needs immediate attention is not what's out THERE, but what's going on HERE, on Earth, and why we think the way we do, and how we came to be here in the first place.

  14. Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

    Science.gov (United States)

    Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

    2005-10-05

    Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

  15. A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

    Directory of Open Access Journals (Sweden)

    Xing Zhang

    Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

  16. Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

    Science.gov (United States)

    Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

    2015-06-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

  17. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    Science.gov (United States)

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

  18. Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

    Science.gov (United States)

    Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

    2014-04-01

    The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. The Generic Data Capture Facility

    Science.gov (United States)

    Connell, Edward B.; Barnes, William P.; Stallings, William H.

    1987-01-01

    The Generic Data Capture Facility, which can provide data capture support for a variety of different types of spacecraft while enabling operations costs to be carefully controlled, is discussed. The data capture functions, data protection, isolation of users from data acquisition problems, data reconstruction, and quality and accounting are addressed. The TDM and packet data formats utilized by the system are described, and the development of generic facilities is considered.

  20. Carbon captured from the air

    Energy Technology Data Exchange (ETDEWEB)

    Keith, D. [Calgary Univ., AB (Canada)

    2008-10-15

    This article presented an innovative way to achieve the efficient capture of atmospheric carbon. A team of scientists from the University of Calgary's Institute for Sustainable Energy, Environment and Economy have shown that it is possible to reduce carbon dioxide (CO{sub 2}) using a simple machine that can capture the trace amount of CO{sub 2} present in ambient air at any place on the planet. The thermodynamics of capturing the small concentrations of CO{sub 2} from the air is only slightly more difficult than capturing much larger concentrations of CO{sub 2} from power plants. The research is significant because it offers a way to capture CO{sub 2} emissions from transportation sources such as vehicles and airplanes, which represent more than half of the greenhouse gases emitted on Earth. The energy efficient and cost effective air capture technology could complement other approaches for reducing emissions from the transportation sector, such as biofuels and electric vehicles. Air capture differs from carbon capture and storage (CCS) technology used at coal-fired power plants where CO{sub 2} is captured and pipelined for permanent storage underground. Air capture can capture the CO{sub 2} that is present in ambient air and store it wherever it is cheapest. The team at the University of Calgary showed that CO{sub 2} could be captured directly from the air with less than 100 kWhrs of electricity per tonne of CO{sub 2}. A custom-built tower was able to capture the equivalent of 20 tonnes per year of CO{sub 2} on a single square meter of scrubbing material. The team devised a way to use a chemical process from the pulp and paper industry to cut the energy cost of air capture in half. Although the technology is only in its early stage, it appears that CO{sub 2} could be captured from the air with an energy demand comparable to that needed for CO{sub 2} capture from conventional power plants, but costs will be higher. The simple, reliable and scalable technology

  1. Resource capture by single leaves

    Energy Technology Data Exchange (ETDEWEB)

    Long, S.P.

    1992-05-01

    Leaves show a variety of strategies for maximizing CO{sub 2} and light capture. These are more meaningfully explained if they are considered in the context of maximizing capture relative to the utilization of water, nutrients and carbohydrates reserves. There is considerable variation between crops in their efficiency of CO{sub 2} and light capture at the leaf level. Understanding of these mechanisms indicate some ways in which efficiency of resource capture could be level cannot be meaningfully considered without simultaneous understanding of implications at the canopy level. 36 refs., 5 figs., 1 tab.

  2. Carbon captured from the air

    International Nuclear Information System (INIS)

    Keith, D.

    2008-01-01

    This article presented an innovative way to achieve the efficient capture of atmospheric carbon. A team of scientists from the University of Calgary's Institute for Sustainable Energy, Environment and Economy have shown that it is possible to reduce carbon dioxide (CO 2 ) using a simple machine that can capture the trace amount of CO 2 present in ambient air at any place on the planet. The thermodynamics of capturing the small concentrations of CO 2 from the air is only slightly more difficult than capturing much larger concentrations of CO 2 from power plants. The research is significant because it offers a way to capture CO 2 emissions from transportation sources such as vehicles and airplanes, which represent more than half of the greenhouse gases emitted on Earth. The energy efficient and cost effective air capture technology could complement other approaches for reducing emissions from the transportation sector, such as biofuels and electric vehicles. Air capture differs from carbon capture and storage (CCS) technology used at coal-fired power plants where CO 2 is captured and pipelined for permanent storage underground. Air capture can capture the CO 2 that is present in ambient air and store it wherever it is cheapest. The team at the University of Calgary showed that CO 2 could be captured directly from the air with less than 100 kWhrs of electricity per tonne of CO 2 . A custom-built tower was able to capture the equivalent of 20 tonnes per year of CO 2 on a single square meter of scrubbing material. The team devised a way to use a chemical process from the pulp and paper industry to cut the energy cost of air capture in half. Although the technology is only in its early stage, it appears that CO 2 could be captured from the air with an energy demand comparable to that needed for CO 2 capture from conventional power plants, but costs will be higher. The simple, reliable and scalable technology offers an opportunity to build a commercial-scale plant. 1 fig

  3. Oxygen adsorption and dissociation during the oxidation of monolayer Ti2C

    KAUST Repository

    Gan, Liyong

    2013-08-20

    Exfoliated two-dimensional early transition metal carbides and carbonitrides are usually not terminated by metal atoms but saturated by O, OH, and/or F, thus making it difficult to understand the surface structure evolution and the induced electronic modifications. To fill this gap, density functional theory and molecular dynamics simulations are performed to capture the initial stage of the oxidation process of Ti2C, a prototypical example from the recently fabricated class of two-dimensional carbides and carbonitrides. It is shown that the unsaturated Ti 3d orbitals of the pristine Ti2C surface interact strongly with the approaching O2 molecules, resulting in barrierless O2 dissociation. The diffusion of the dissociated O atoms is also found to be very facile. Molecular dynamics simulations suggest that both dissociation and diffusion are enhanced as the O2 coverage increases to 0.25 monolayer. For a coverage of less than 0.11 monolayer, the adsorbates lead to a minor modification of the electronic properties of Ti2C, while the modification is remarkable at 0.25 monolayer. The formed Ti2CO2 after O saturation is an indirect narrow gap semiconductor (0.33 eV) with high intrinsic carrier concentration at room temperature and high thermodynamic stability at intermediate temperature (e.g., 550 °C).

  4. Oxygen adsorption and dissociation during the oxidation of monolayer Ti2C

    KAUST Repository

    Gan, Liyong; Huang, Dan; Schwingenschlö gl, Udo

    2013-01-01

    Exfoliated two-dimensional early transition metal carbides and carbonitrides are usually not terminated by metal atoms but saturated by O, OH, and/or F, thus making it difficult to understand the surface structure evolution and the induced electronic modifications. To fill this gap, density functional theory and molecular dynamics simulations are performed to capture the initial stage of the oxidation process of Ti2C, a prototypical example from the recently fabricated class of two-dimensional carbides and carbonitrides. It is shown that the unsaturated Ti 3d orbitals of the pristine Ti2C surface interact strongly with the approaching O2 molecules, resulting in barrierless O2 dissociation. The diffusion of the dissociated O atoms is also found to be very facile. Molecular dynamics simulations suggest that both dissociation and diffusion are enhanced as the O2 coverage increases to 0.25 monolayer. For a coverage of less than 0.11 monolayer, the adsorbates lead to a minor modification of the electronic properties of Ti2C, while the modification is remarkable at 0.25 monolayer. The formed Ti2CO2 after O saturation is an indirect narrow gap semiconductor (0.33 eV) with high intrinsic carrier concentration at room temperature and high thermodynamic stability at intermediate temperature (e.g., 550 °C).

  5. The Atomics International (AI) prototype large breeder reactor (PLBR)

    International Nuclear Information System (INIS)

    McDonald, J.S.; Campise, A.V.; Brunings, J.

    1978-01-01

    The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

  6. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.

    1987-01-01

    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  7. AI Techniques in a Context-Aware Ubiquitous Environment

    Science.gov (United States)

    Coppola, Paolo; Mea, Vincenzo Della; di Gaspero, Luca; Lomuscio, Raffaella; Mischis, Danny; Mizzaro, Stefano; Nazzi, Elena; Scagnetto, Ivan; Vassena, Luca

    Nowadays, the mobile computing paradigm and the widespread diffusion of mobile devices are quickly changing and replacing many common assumptions about software architectures and interaction/communication models. The environment, in particular, or more generally, the so-called user context is claiming a central role in everyday’s use of cellular phones, PDAs, etc. This is due to the huge amount of data “suggested” by the surrounding environment that can be helpful in many common tasks. For instance, the current context can help a search engine to refine the set of results in a useful way, providing the user with a more suitable and exploitable information. Moreover, we can take full advantage of this new data source by “pushing” active contents towards mobile devices, empowering the latter with new features (e.g., applications) that can allow the user to fruitfully interact with the current context. Following this vision, mobile devices become dynamic self-adapting tools, according to the user needs and the possibilities offered by the environment. The present work proposes MoBe: an approach for providing a basic infrastructure for pervasive context-aware applications on mobile devices, in which AI techniques (namely a principled combination of rule-based systems, Bayesian networks and ontologies) are applied to context inference. The aim is to devise a general inferential framework to make easier the development of context-aware applications by integrating the information coming from physical and logical sensors (e.g., position, agenda) and reasoning about this information in order to infer new and more abstract contexts.

  8. Data on ionization, excitation, dissociation and dissociative ionization of targets by helium ion bombardments, (1)

    International Nuclear Information System (INIS)

    Oda, Nobuo; Urakawa, Junji

    1984-03-01

    This report presents a compilation of the experimental data on cross sections for the ionization, excitation, dissociation and dissociative ionization processes of targets in helium ion impacts on atoms and molecules under a single collision condition. These measurements were carried out in the energy range from several keV to 3.5 MeV. A systematic survey has been made on the literatures from 1975 to the end of 1982. A list of references is also given, including relevant papers published before 1975. (author)

  9. Using experimental game theory to transit human values to ethical AI

    OpenAIRE

    Wang, Yijia; Wan, Yan; Wang, Zhijian

    2017-01-01

    Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

  10. How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

    DEFF Research Database (Denmark)

    Buchholz, Anke; Trapp, Stefan

    penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

  11. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    OpenAIRE

    Robin Baumgarten; Simon Colton; Mark Morris

    2009-01-01

    We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

  12. A Review of Future and Ethical Perspectives of Robotics and AI

    Directory of Open Access Journals (Sweden)

    Jim Torresen

    2018-01-01

    Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

  13. Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

    International Nuclear Information System (INIS)

    Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

    1998-01-01

    The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

  14. Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

    Science.gov (United States)

    Lukás, F; Gorenc, G; Kopecný, J

    2008-01-01

    The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

  15. 78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

    Science.gov (United States)

    2013-10-24

    ... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

  16. The responses of dissociative patients on the thematic apperception test.

    Science.gov (United States)

    Pica, M; Beere, D; Lovinger, S; Dush, D

    2001-07-01

    This study compared the responses of dissociative inpatients and general inpatient psychiatric controls on the Thematic Apperception Test (TAT; Murray, 1943). We found the stories of dissociative participants to be characterized by a greater interpersonal distance and more trauma and dissociation responses than those of the controls. No significant differences were found regarding total number of emotional references, although references to positive emotions were almost nonexistent for the dissociative group. A post hoc analysis of the data found the testing behaviors of dissociative participants to be characterized by switching, trance states, intrainterview amnesias, and affectively loaded card rejections. Questions were raised regarding the relevancy of the findings to clinical practice and how they might explain some of the controversies surrounding the diagnosis of dissociative identity disorder (DID). Copyright 2001 John Wiley & Sons, Inc.

  17. Dissociation energy of the ground state of NaH

    International Nuclear Information System (INIS)

    Huang, Hsien-Yu; Lu, Tsai-Lien; Whang, Thou-Jen; Chang, Yung-Yung; Tsai, Chin-Chun

    2010-01-01

    The dissociation energy of the ground state of NaH was determined by analyzing the observed near dissociation rovibrational levels. These levels were reached by stimulated emission pumping and fluorescence depletion spectroscopy. A total of 114 rovibrational levels in the ranges 9≤v '' ≤21 and 1≤J '' ≤14 were assigned to the X 1 Σ + state of NaH. The highest vibrational level observed was only about 40 cm -1 from the dissociation limit in the ground state. One quasibound state, above the dissociation limit and confined by the centrifugal barrier, was observed. Determining the vibrational quantum number at dissociation v D from the highest four vibrational levels yielded the dissociation energy D e =15 815±5 cm -1 . Based on new observations and available data, a set of Dunham coefficients and the rotationless Rydberg-Klein-Rees curve were constructed. The effective potential curve and the quasibound states were discussed.

  18. Iodine neutron capture therapy

    Science.gov (United States)

    Ahmed, Kazi Fariduddin

    A new technique, Iodine Neutron Capture Therapy (INCT) is proposed to treat hyperthyroidism in people. Present thyroid therapies, surgical removal and 131I treatment, result in hypothyroidism and, for 131I, involve protracted treatment times and excessive whole-body radiation doses. The new technique involves using a low energy neutron beam to convert a fraction of the natural iodine stored in the thyroid to radioactive 128I, which has a 24-minute half-life and decays by emitting 2.12-MeV beta particles. The beta particles are absorbed in and damage some thyroid tissue cells and consequently reduce the production and release of thyroid hormones to the blood stream. Treatment times and whole-body radiation doses are thus reduced substantially. This dissertation addresses the first of the several steps needed to obtain medical profession acceptance and regulatory approval to implement this therapy. As with other such programs, initial feasibility is established by performing experiments on suitable small mammals. Laboratory rats were used and their thyroids were exposed to the beta particles coming from small encapsulated amounts of 128I. Masses of 89.0 mg reagent-grade elemental iodine crystals have been activated in the ISU AGN-201 reactor to provide 0.033 mBq of 128I. This activity delivers 0.2 Gy to the thyroid gland of 300-g male rats having fresh thyroid tissue masses of ˜20 mg. Larger iodine masses are used to provide greater doses. The activated iodine is encapsulated to form a thin (0.16 cm 2/mg) patch that is then applied directly to the surgically exposed thyroid of an anesthetized rat. Direct neutron irradiation of a rat's thyroid was not possible due to its small size. Direct in-vivo exposure of the thyroid of the rat to the emitted radiation from 128I is allowed to continue for 2.5 hours (6 half-lives). Pre- and post-exposure blood samples are taken to quantify thyroid hormone levels. The serum T4 concentration is measured by radioimmunoassay at

  19. Dissociative Photoionization of the Elusive Vinoxy Radical.

    Science.gov (United States)

    Adams, Jonathan D; Scrape, Preston G; Lee, Shih-Huang; Butler, Laurie J

    2017-08-24

    These experiments report the dissociative photoionization of vinoxy radicals to m/z = 15 and 29. In a crossed laser-molecular beam scattering apparatus, we induce C-Cl bond fission in 2-chloroacetaldehyde by photoexcitation at 157 nm. Our velocity measurements, combined with conservation of angular momentum, show that 21% of the C-Cl photofission events form vinoxy radicals that are stable to subsequent dissociation to CH 3 + CO or H + ketene. Photoionization of these stable vinoxy radicals, identified by their velocities, which are momentum-matched with the higher-kinetic-energy Cl atom photofragments, shows that the vinoxy radicals dissociatively photoionize to give signal at m/z = 15 and 29. We calibrated the partial photoionization cross section of vinoxy to CH 3 + relative to the bandwidth-averaged photoionization cross section of the Cl atom at 13.68 eV to put the partial photoionization cross sections on an absolute scale. The resulting bandwidth-averaged partial cross sections are 0.63 and 1.3 Mb at 10.5 and 11.44 eV, respectively. These values are consistent with the upper limit to the cross section estimated from a study by Savee et al. on the O( 3 P) + propene bimolecular reaction. We note that the uncertainty in these values is primarily dependent on the signal attributed to C-Cl primary photofission in the m/z = 35 (Cl + ) time-of-flight data. While the value is a rough estimate, the bandwidth-averaged partial photoionization cross section of vinoxy to HCO + calculated from the signal at m/z = 29 at 11.53 eV is approximately half that of vinoxy to CH 3 + . We also present critical points on the potential energy surface of the vinoxy cation calculated at the G4//B3LYP/6-311++G(3df,2p) level of theory to support the observation of dissociative ionization of vinoxy to both CH 3 + and HCO + .

  20. Lebanon and Syria: between dissociation and spillover

    Directory of Open Access Journals (Sweden)

    Javier Lion Bustillo

    2014-12-01

    Full Text Available The risk of Syrian civil war violence spreading towards Lebanon is high. This can be explained by various factors deriving as much from the neighbouring conflict as from other existing factors in Lebanese politics, which have led to the significant collaboration of Lebanon’s Future Movement and Hezbollah with their respective allies in Syria, and to undermining Najib Mikati’s dissociation policies. However, the leaders of those parties tend to balance their will to preserve their confessional leadership with an image of being the defender of national interests. This limits the possibility of an openly sectarian conflict, but it does not totally eliminate it.

  1. Dissociative Excitation of Adenine by Electron Impact

    Science.gov (United States)

    McConkey, J. William; Trocchi, Joshuah; Dech, Jeffery; Kedzierski, Wladek

    2017-04-01

    Dissociative excitation of adenine (C6H5NH2) into excited atomic fragments has been studied in the electron impact energy range from threshold to 300 eV. A crossed beam system coupled to a vacuum ultraviolet (VUV) monochromator is used to study emissions in the wavelength range from 110 to 200 nm. The beam of adenine vapor from a stainless steel oven is crossed at right angles by the electron beam and the resultant UV radiation is detected in a mutually orthogonal direction. The strongest feature in the spectrum is H Lyman- α. Financial support from NSERC and CFI, Canada, is gratefully acknowledged.

  2. Dissociation of Vertical Semiconductor Diatomic Artificial Molecules

    International Nuclear Information System (INIS)

    Pi, M.; Emperador, A.; Barranco, M.; Garcias, F.; Muraki, K.; Tarucha, S.; Austing, D. G.

    2001-01-01

    We investigate the dissociation of few-electron circular vertical semiconductor double quantum dot artificial molecules at 0T as a function of interdot distance. A slight mismatch introduced in the fabrication of the artificial molecules from nominally identical constituent quantum wells induces localization by offsetting the energy levels in the quantum dots by up to 2meV, and this plays a crucial role in the appearance of the addition energy spectra as a function of coupling strength particularly in the weak coupling limit

  3. Fish welfare in capture fisheries

    NARCIS (Netherlands)

    Veldhuizen, L.J.L.; Berentsen, P.B.M.; Boer, de I.J.M.; Vis, van de J.W.; Bokkers, E.A.M.

    2018-01-01

    Concerns about the welfare of production animals have extended from farm animals to fish, but an overview of the impact of especially capture fisheries on fish welfare is lacking. This review provides a synthesis of 85 articles, which demonstrates that research interest in fish welfare in capture

  4. Cognitive Processes in Dissociation: Comment on Giesbrecht et al. (2008)

    OpenAIRE

    Bremner, J. Douglas

    2010-01-01

    In “Cognitive Processes in Dissociation: An Analysis of Core Theoretical Assumptions,” published in Psychological Bulletin, Giesbrecht, Lynn, Lilienfeld, and Merckelbach (2008) have challenged the widely accepted trauma theory of dissociation, which holds that dissociative symptoms are caused by traumatic stress. In doing so the authors outline a series of links between various constructs, such as fantasy proneness, cognitive failures, absorption, suggestibility, altered information-processin...

  5. Alkali promotion of N-2 dissociation over Ru(0001)

    DEFF Research Database (Denmark)

    Mortensen, Jens Jørgen; Hammer, Bjørk; Nørskov, Jens Kehlet

    1998-01-01

    Using self-consistent density functional calculations, we show that adsorbed Na and Cs lower the barrier for dissociation of N2 on Ru(0001). Since N2 dissociation is a crucial step in the ammonia synthesis reaction, we explain in this way the experimental observation that alkali metals promote th...... the ammonia synthesis reaction over Ru catalysts. We also show that the origin of this effect is predominantly a direct electrostatic attraction between the adsorbed alkali atoms and the dissociating molecule....

  6. AI AND SAR APPROACHES FOR PREDICTING CHEMICAL CARCINOGENICITY: SURVEY AND STATUS REPORT

    Science.gov (United States)

    A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

  7. So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

    Directory of Open Access Journals (Sweden)

    Tania Becker

    2011-12-01

    Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

  8. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B

    2009-12-01

    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  9. Numerical prediction of CO2 capture process by a single droplet in alkaline spray

    International Nuclear Information System (INIS)

    Chen, Wei-Hsin; Tsai, Ming-Hang; Hung, Chen-I

    2013-01-01

    Highlights: • CO 2 capture by a single droplet is studied numerically. • Three different initial pH values of 10, 11, and 12 in the droplet are considered. • The initial pH value has a significant influence on the capture process. • The carbon capture rate is raised as the initial pH value rises. • The droplet with the initial pH value of 12 is feasible to perform CO 2 capture. - Abstract: Carbon dioxide captured by single droplets in sprays plays a fundamental role in reducing greenhouse gas emissions. This study focuses on CO 2 capture processes in single droplets in alkaline sprays using a numerical method. Three different initial pH values of 10, 11, and 12 in the droplet are considered. The capture behavior in the absence of chemical dissociation is also investigated for comparison. The predictions suggest that the chemical dissociation in the droplet substantially elongates the CO 2 capture process and the mass diffusion is the controlling mechanism of CO 2 capture process. For the chemical absorption, the final CO 2 capture amount by the droplet is mainly determined by HCO 3 - which is significantly influenced by the initial pH value. An increase in initial pH value raises the carbon capture amount by the droplet. The mean concentration of CO 3 2- is highly related to the variation of mean pH value, but its concentration is by far lower than those of H 2 O⋅CO 2 and HCO 3 - . Corresponding to the initial pH values of 10, 11, and 12, the times required for turning the basic droplet to the acidic one are in the orders of 10, 100, and 1000 ms. On account of larger carbon capture amount and shorter absorption period at a higher initial pH value, the carbon capture rate is lifted as the initial pH value rises, and CO 2 capture by droplets at the initial pH value of 12 is better than those at 10 and 11

  10. Dissociation: Defining the Concept in Criminal Forensic Psychiatry.

    Science.gov (United States)

    Bourget, Dominique; Gagné, Pierre; Wood, Stephen Floyd

    2017-06-01

    Claims of amnesia and dissociative experiences in association with a violent crime are not uncommon. Research has shown that dissociation is a risk factor for violence and is seen most often in crimes of extreme violence. The subject matter is most relevant to forensic psychiatry. Peritraumatic dissociation for instance, with or without a history of dissociative disorder, is quite frequently reported by offenders presenting for a forensic psychiatric examination. Dissociation or dissociative amnesia for serious offenses can have legal repercussions stemming from their relevance to the legal constructs of fitness to stand trial, criminal responsibility, and diminished capacity. The complexity in forensic psychiatric assessments often lies in the difficulty of connecting clinical symptomatology reported by violent offenders to a specific condition included in the Diagnostic and Statistical Manual of Mental Disorders (DSM). This article provides a review of diagnostic considerations with regard to dissociation across the DSM nomenclature, with a focus on the main clinical constructs related to dissociation. Forensic implications are discussed, along with some guides for the forensic evaluator of offenders presenting with dissociation. © 2017 American Academy of Psychiatry and the Law.

  11. Childhood maltreatment and intimate partner violence in dissociative disorder patients.

    Science.gov (United States)

    Webermann, Aliya R; Brand, Bethany L; Chasson, Gregory S

    2014-01-01

    Childhood maltreatment (CM) is a risk factor for subsequent intimate partner violence (IPV) in adulthood, with high rates of retrospectively reported CM among IPV victims and perpetrators. A theorized mechanism of the link between CM and IPV is dissociation. Dissociation may allow perpetrators of violence to remain emotionally distant from their behavior and minimize empathy toward those they victimize, enabling them to commit acts of violence similar to their own experiences. Indeed, elevated rates of dissociation and dissociative disorders (DD) have been found among IPV survivors and perpetrators. In addition, in pilot studies, DD clinicians have reported high levels of violent behavior among DD patients. The present study investigates IPV among DD patients with Dissociative Identity Disorder and Dissociative Disorder Not Otherwise Specified, a group with CM rates of 80-95% and severe dissociative symptoms. DD clinicians reported on rates of CM and IPV among 275 DD patients in outpatient treatment. DD patients also completed a self-report measure of dissociation. Analyses assessed the associations between CM typologies and IPV, as well as trait dissociation and IPV. Physical and emotional child abuse were associated with physical IPV, and childhood witnessing of domestic violence (DV) and childhood neglect were associated with emotional IPV. The present study is the first to provide empirical support for a possible CM to adult IPV developmental trajectory among DD patients. Future research is needed to better understand the link between CM and IPV among those with trauma and DD.

  12. Frontal and occipital perfusion changes in dissociative identity disorder.

    Science.gov (United States)

    Sar, Vedat; Unal, Seher N; Ozturk, Erdinc

    2007-12-15

    The aim of the study was to investigate if there were any characteristics of regional cerebral blood flow (rCBF) in dissociative identity disorder. Twenty-one drug-free patients with dissociative identity disorder and nine healthy volunteers participated in the study. In addition to a clinical evaluation, dissociative psychopathology was assessed using the Structured Clinical Interview for DSM-IV Dissociative Disorders, the Dissociative Experiences Scale and the Clinician-Administered Dissociative States Scale. A semi-structured interview for borderline personality disorder, the Hamilton Depression Rating Scale, and the Childhood Trauma Questionnaire were also administered to all patients. Normal controls had to be without a history of childhood trauma and without any depressive or dissociative disorder. Regional cerebral blood flow (rCBF) was studied with single photon emission computed tomography (SPECT) with Tc99m-hexamethylpropylenamine (HMPAO) as a tracer. Compared with findings in the control group, the rCBF ratio was decreased among patients with dissociative identity disorder in the orbitofrontal region bilaterally. It was increased in median and superior frontal regions and occipital regions bilaterally. There was no significant correlation between rCBF ratios of the regions of interest and any of the psychopathology scale scores. An explanation for the neurophysiology of dissociative psychopathology has to invoke a comprehensive model of interaction between anterior and posterior brain regions.

  13. Childhood maltreatment and intimate partner violence in dissociative disorder patients

    Directory of Open Access Journals (Sweden)

    Aliya R. Webermann

    2014-09-01

    Full Text Available Background: Childhood maltreatment (CM is a risk factor for subsequent intimate partner violence (IPV in adulthood, with high rates of retrospectively reported CM among IPV victims and perpetrators. A theorized mechanism of the link between CM and IPV is dissociation. Dissociation may allow perpetrators of violence to remain emotionally distant from their behavior and minimize empathy toward those they victimize, enabling them to commit acts of violence similar to their own experiences. Indeed, elevated rates of dissociation and dissociative disorders (DD have been found among IPV survivors and perpetrators. In addition, in pilot studies, DD clinicians have reported high levels of violent behavior among DD patients. Objective: The present study investigates IPV among DD patients with Dissociative Identity Disorder and Dissociative Disorder Not Otherwise Specified, a group with CM rates of 80–95% and severe dissociative symptoms. Methods: DD clinicians reported on rates of CM and IPV among 275 DD patients in outpatient treatment. DD patients also completed a self-report measure of dissociation. Analyses assessed the associations between CM typologies and IPV, as well as trait dissociation and IPV. Results: Physical and emotional child abuse were associated with physical IPV, and childhood witnessing of domestic violence (DV and childhood neglect were associated with emotional IPV. Conclusions: The present study is the first to provide empirical support for a possible CM to adult IPV developmental trajectory among DD patients. Future research is needed to better understand the link between CM and IPV among those with trauma and DD.

  14. Photo-dissociation of hydrogen passivated dopants in gallium arsenide

    International Nuclear Information System (INIS)

    Tong, L.; Larsson, J.A.; Nolan, M.; Murtagh, M.; Greer, J.C.; Barbe, M.; Bailly, F.; Chevallier, J.; Silvestre, F.S.; Loridant-Bernard, D.; Constant, E.; Constant, F.M.

    2002-01-01

    A theoretical and experimental study of the photo-dissociation mechanisms of hydrogen passivated n- and p-type dopants in gallium arsenide is presented. The photo-induced dissociation of the Si Ga -H complex has been observed for relatively low photon energies (3.48 eV), whereas the photo-dissociation of C As -H is not observed for photon energies up to 5.58 eV. This fundamental difference in the photo-dissociation behavior between the two dopants is explained in terms of the localized excitation energies about the Si-H and C-H bonds

  15. Dissociative features in posttraumatic stress disorder: A latent profile analysis.

    Science.gov (United States)

    Műllerová, Jana; Hansen, Maj; Contractor, Ateka A; Elhai, Jon D; Armour, Cherie

    2016-09-01

    The fifth edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5) characterizes the dissociative subtype of posttraumatic stress disorder (PTSD) in terms of the individual meeting the criteria for PTSD and additionally reporting symptoms of depersonalization and/or derealization. The current study aimed to examine whether a dissociative PTSD profile may include alternative features of dissociation and whether it could be differentiated from a nondissociative PTSD profile on certain psychopathologies and demographics. Data from 309 trauma-exposed participants, collected through Amazon Mechanical Turk, were subjected to latent profile analysis. Regression analyses were used to examine the predictors of latent classes. Three discrete profiles named Baseline, PTSD, and Dissociative profile were uncovered. All examined features of dissociation were significantly elevated in the Dissociative profile. Anxiety, male sex, being employed, and having a minority racial background significantly predicted the Dissociative profile relative to the PTSD profile. The study points to the importance of alternative symptoms of dissociation in the dissociative PTSD subtype beyond the symptoms of depersonalization and derealization. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  16. An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

    OpenAIRE

    Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

    2017-01-01

    In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

  17. PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

    OpenAIRE

    Savitri Paramita, Ni Made

    2014-01-01

    This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

  18. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    OpenAIRE

    Stephen Fox

    2017-01-01

    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  19. Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI

    OpenAIRE

    Chidambaram, Rajesh

    2017-01-01

    Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

  20. Do older t'ai chi practitioners have better attention and memory function?

    Science.gov (United States)

    Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

    2010-12-01

    Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

  1. Contextual Treatment of Dissociative Identity Disorder.

    Science.gov (United States)

    Gold, Steven N; Elhai, Jon D; Rea, Bayard D; Weiss, Donna; Masino, Theodore; Morris, Staci Leon; McIninch, Jessica

    2001-01-01

    Evidence for the effectiveness of contextual therapy, a new approach for treating adult survivors of prolonged child abuse (PCA), is provided via case studies of three women with Dissociative Identity Disorder (DID). Contextual therapy is based on the premise that it is not only traumatic experiences that account for PCA survivors' psychological difficulties. Even more fundamentally, many survivors grow up in an interpersonal context in which adequate resources for secure attachment and acquisition of adaptive living skills are not available. As a result, they are left with lasting deficits that undermine not only their current functioning, but also their ability to cope with reliving their traumatic memories in therapy. The primary focus of this treatment approach, therefore, is on developing capacities for feeling and functioning better in the present, rather than on extensive exploration and processing of the client's trauma history or, in the case of DID, of identity fragments. Treatment of the three cases presented ranged from eight months to two and one-half years' duration, and culminated in very positive outcomes. The women's reports of achievements, such as obtaining and maintaining gainful employment, greater self-sufficiency, and the establishment of more intimate and gratifying relationships, indicated marked improvements in daily functioning. Objective test data obtained at admission and discharge, and in one case, at follow-up, documented substantial reductions in dissociative, posttraumatic stress, depressive, and other symptoms.

  2. CO dissociation on magnetic Fen clusters

    KAUST Repository

    Jedidi, Abdesslem

    2014-01-01

    This work theoretically investigates the CO dissociation on Fen nanoparticles, for n in the range of 1-65, focusing on size dependence in the context of the initial step of the Fischer-Tropsch reaction. CO adsorbs molecularly through its C-end on a triangular facet of the nanoparticle. Dissociation becomes easier when the cluster size increases. Then, the C atom is bonded to a square facet that is generated as a result of the adsorption if it does not yet exist in the bare cluster, while the O atom is adsorbed on a triangular facet. In the most stable situation, the two adsorbed atoms remain close together, both having in common one shared first-neighbor iron atom. There is a partial spin quenching of the neighboring Fe atoms, which become more positively charged than the other Fe atoms. The shared surface iron atom resembles a metal-cation from a complex. Despite the small size of the iron cluster considered, fluctuations due to specific configurations do not influence properties for n > 25 and global trends seem significant.

  3. Autobiographical memory specificity in dissociative identity disorder.

    Science.gov (United States)

    Huntjens, Rafaële J C; Wessel, Ineke; Hermans, Dirk; van Minnen, Agnes

    2014-05-01

    A lack of adequate access to autobiographical knowledge has been related to psychopathology. More specifically, patients suffering from depression or a history of trauma have been found to be characterized by overgeneral memory, in other words, they show a relative difficulty in retrieving a specific event from memory located in time and place. Previous studies of overgeneral memory have not included patients with dissociative disorders. These patients are interesting to consider, as they are hypothesized to have the ability to selectively compartmentalize information linked to negative emotions. This study examined avoidance and overgeneral memory in patients with dissociative identity disorder (DID; n = 12). The patients completed the autobiographical memory test (AMT). Their performance was compared with control groups of posttraumatic stress disorder (PTSD) patients (n = 26), healthy controls (n = 29), and DID simulators (n = 26). Specifically, we compared the performance of separate identity states in DID hypothesized to diverge in the use of avoidance as a coping strategy to deal with negative affect. No significant differences in memory specificity were found between the separate identities in DID. Irrespective of identity state, DID patients were characterized by a lack of memory specificity, which was similar to the lack of memory specificity found in PTSD patients. The converging results for DID and PTSD patients add empirical evidence for the role of overgeneral memory involved in the maintenance of posttraumatic psychopathology.

  4. Fracture-dissociation of ceramic liner.

    Science.gov (United States)

    Hwang, Sung Kwan; Oh, Jin-Rok; Her, Man Seung; Shim, Young Jun; Cho, Tae Yeun; Kwon, Sung Min

    2008-08-01

    The use of BIOLOX delta ceramic (CeramTec AG, Plochingen, Germany) has been increasing. This ceramic prevents cracking by restraining the phase transformation due to the insertion of nano-sized, yttria-stabilized tetragonal zirconia into the alumina matrix. This restrains the progress of cracking through the formation of platelet-like crystal or whiskers due to the addition of an oxide additive. We observed a case of BIOLOX delta ceramic liner (CeramTec AG) rim fracture 4 months postoperatively. Radiographs showed that the ceramic liner was subluxated from the acetabular cup. Scratches on the acetabular cup and femoral neck were seen, and the fracture was visible on the rim of the liner. Under electron microscope, metal particle coatings from the ceramic liner were identified. The ceramic liner, fracture fragments, and adjacent tissues were removed and replaced with a ceramic liner and femoral head of the same size and design. We believe the mechanism of the fracture-dissociation of the ceramic liner in this case is similar to a case of separation of the ceramic liner from the polyethylene shell in a sandwich-type ceramic-ceramic joint. To prevent ceramic liner fracture-dissociation, the diameter of the femoral neck needs to be decreased in a new design, while the diameter of the femoral head needs to be increased to ensure an increase in range of motion.

  5. Mechanical Dissociation of Retinal Neurons with Vibration

    Science.gov (United States)

    Motomura, Tamami; Hayashida, Yuki; Murayama, Nobuki

    The neuromorphic device, which implements the functions of biological neural circuits by means of VLSI technology, has been collecting much attention in the engineering fields in the last decade. Concurrently, progress in neuroscience research has revealed the nonlinear computation in single neuron levels, suggesting that individual neurons are not merely the circuit elements but computational units. Thus, elucidating the properties of neuronal signal processing is thought to be an essential step for developing the next generation of neuromorphic devices. In the present study, we developed a method for dissociating single neurons from specific sublayers of mammalian retinas with using no proteolytic enzymes but rather combining tissue incubation in a low-Ca2+ medium and the vibro-dissociation technique developed for the slices of brains and spinal cords previously. Our method took shorter time of the procedure, and required less elaborated skill, than the conventional enzymatic method did; nevertheless it yielded enough number of the cells available for acute electrophysiological experiments. The isolated retinal neurons were useful for measuring the nonlinear membrane conductances as well as the spike firing properties under the perforated-patch whole-cell configuration. These neurons also enabled us to examine the effects of proteolytic enzymes on the membrane excitability in those cells.

  6. Dissociative identity disorder and pseudo-hysteria.

    Science.gov (United States)

    Foote, B

    1999-01-01

    The diagnostic validity of dissociative identity disorder (DID) continues to inspire controversy, with some commentators claiming that DID is a modern variant of "hysteria"; that is, attention-seeking behavior. The author asserts that DID is indeed a valid psychiatric disorder, and believes that this skeptical reaction can largely be attributed to a specific set of transference/countertransference interactions that these patients tend to inspire. The paper delineates several clinical features of DID that can easily be mistaken for hysterical phenomena, and attempts to find the roots of this confusion in the DID patients' experience of interpersonal powerlessness, which leads them to present their symptoms in an unconvincing, "hysterical" manner. Confusion between the vertical split seen in the dissociative disorders and the horizontal split characteristic of the classic hysterical personality is discussed, as is the powerful effect of observer bias in creating hysterical-appearing phenomena. The term "pseudo-hysteria" is used to denote a situation in which a genuine psychiatric disorder, DID, is perceived as an hysterical production.

  7. Dissociative Part-Dependent Resting-State Activity in Dissociative Identity Disorder: A Controlled fMRI Perfusion Study

    OpenAIRE

    Schlumpf, Yolanda R.; Reinders, Antje A. T. S.; Nijenhuis, Ellert R. S.; Luechinger, Roger; van Osch, Matthias J. P.; Jäncke, Lutz

    2014-01-01

    Background: In accordance with the Theory of Structural Dissociation of the Personality (TSDP), studies of dissociative identity disorder (DID) have documented that two prototypical dissociative subsystems of the personality, the "Emotional Part'' (EP) and the "Apparently Normal Part'' (ANP), have different biopsychosocial reactions to supraliminal and subliminal trauma-related cues and that these reactions cannot be mimicked by fantasy prone healthy controls nor by actors. Methods: Arterial ...

  8. Augmentation index (AI) in a dose–response relationship with smoking habits in males

    Science.gov (United States)

    Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

    2016-01-01

    Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

  9. Dry eyes and AIs: If you don't ask you won't find out.

    Science.gov (United States)

    Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

    2015-12-01

    Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    Directory of Open Access Journals (Sweden)

    Robin Baumgarten

    2009-01-01

    Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

  11. Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

    Science.gov (United States)

    Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

    2011-01-01

    Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

  12. Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

    Directory of Open Access Journals (Sweden)

    Bin Hong

    2012-06-01

    Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

  13. Materials For Gas Capture, Methods Of Making Materials For Gas Capture, And Methods Of Capturing Gas

    KAUST Repository

    Polshettiwar, Vivek

    2013-06-20

    In accordance with the purpose(s) of the present disclosure, as embodied and broadly described herein, embodiments of the present disclosure, in one aspect, relate to materials that can be used for gas (e.g., CO.sub.2) capture, methods of making materials, methods of capturing gas (e.g., CO.sub.2), and the like, and the like.

  14. Controls on Gas Hydrate Formation and Dissociation

    Energy Technology Data Exchange (ETDEWEB)

    Miriam Kastner; Ian MacDonald

    2006-03-03

    The main objectives of the project were to monitor, characterize, and quantify in situ the rates of formation and dissociation of methane hydrates at and near the seafloor in the northern Gulf of Mexico, with a focus on the Bush Hill seafloor hydrate mound; to record the linkages between physical and chemical parameters of the deposits over the course of one year, by emphasizing the response of the hydrate mound to temperature and chemical perturbations; and to document the seafloor and water column environmental impacts of hydrate formation and dissociation. For these, monitoring the dynamics of gas hydrate formation and dissociation was required. The objectives were achieved by an integrated field and laboratory scientific study, particularly by monitoring in situ formation and dissociation of the outcropping gas hydrate mound and of the associated gas-rich sediments. In addition to monitoring with the MOSQUITOs, fluid flow rates and temperature, continuously sampling in situ pore fluids for the chemistry, and imaging the hydrate mound, pore fluids from cores, peepers and gas hydrate samples from the mound were as well sampled and analyzed for chemical and isotopic compositions. In order to determine the impact of gas hydrate dissociation and/or methane venting across the seafloor on the ocean and atmosphere, the overlying seawater was sampled and thoroughly analyzed chemically and for methane C isotope ratios. At Bush hill the pore fluid chemistry varies significantly over short distances as well as within some of the specific sites monitored for 440 days, and gas venting is primarily focused. The pore fluid chemistry in the tub-warm and mussel shell fields clearly documented active gas hydrate and authigenic carbonate formation during the monitoring period. The advecting fluid is depleted in sulfate, Ca Mg, and Sr and is rich in methane; at the main vent sites the fluid is methane supersaturated, thus bubble plumes form. The subsurface hydrology exhibits both

  15. Electron capture and stellar collapse

    International Nuclear Information System (INIS)

    Chung, K.C.

    1979-01-01

    In order, to investigate the function of electron capture in the phenomenon of pre-supernovae gravitacional collapse, an hydrodynamic caculation was carried out, coupling capture, decay and nuclear reaction equation system. A star simplified model (homogeneous model) was adopted using fermi ideal gas approximation for tthe sea of free electrons and neutrons. The non simplified treatment from quasi-static evolution to collapse is presented. The capture and beta decay rates, as wellas neutron delayed emission, were calculated by beta decay crude theory, while the other reaction rates were determined by usual theories. The preliminary results are presented. (M.C.K.) [pt

  16. Proton capture by magnetic monopoles

    International Nuclear Information System (INIS)

    Olaussen, K.; Olsen, H.A.; Oeverboe, I.; Osland, P.

    1983-09-01

    In the Kazama-Yang approximation, the lowest monopole-proton bound states have binding energies of 938 MeV, 263 keV, 105 eV, and 0.04 eV. The cross section for radiative capture to these states is for velocities β = 10 -5 - 10 -3 found to be of the order of 10 -28 - 10 -26 cm 2 . For the state that has a binding energy of 263 keV, the capture length in water is 171 x (β/10 -4 )sup(0.48) m. Observation of photons from the capture process would indicate the presence of monopoles. (orig.)

  17. Carbon capture and sequestration (CCS)

    Science.gov (United States)

    2009-06-19

    Carbon capture and sequestration (or storage)known as CCShas attracted interest as a : measure for mitigating global climate change because large amounts of carbon dioxide (CO2) : emitted from fossil fuel use in the United States are potentiall...

  18. Enzymes in CO2 Capture

    DEFF Research Database (Denmark)

    Fosbøl, Philip Loldrup; Gladis, Arne; Thomsen, Kaj

    The enzyme Carbonic Anhydrase (CA) can accelerate the absorption rate of CO2 into aqueous solutions by several-fold. It exist in almost all living organisms and catalyses different important processes like CO2 transport, respiration and the acid-base balances. A new technology in the field...... of carbon capture is the application of enzymes for acceleration of typically slow ternary amines or inorganic carbonates. There is a hidden potential to revive currently infeasible amines which have an interesting low energy consumption for regeneration but too slow kinetics for viable CO2 capture. The aim...... of this work is to discuss the measurements of kinetic properties for CA promoted CO2 capture solvent systems. The development of a rate-based model for enzymes will be discussed showing the principles of implementation and the results on using a well-known ternary amine for CO2 capture. Conclusions...

  19. Dissociative style and individual differences in verbal working memory span.

    NARCIS (Netherlands)

    de Ruiter, M.B.; Phaf, R.H.; Elzinga, B.M.; van Dyck, R.

    2004-01-01

    Dissociative style is mostly studied as a risk factor for dissociative pathology, but it may also reflect a fundamental characteristic of healthy information processing. Due to the close link between attention and working memory and the previous finding of enhanced attentional abilities with a high

  20. Self-Destructive Behavior in People with Dissociative Disorders.

    Science.gov (United States)

    Saxe, Glenn N.; Chawla, Neharika; Van der Kolk, Bessel

    2002-01-01

    Study assesses self-destructive behavior in a group of inpatients who have dissociative disorders compared to those who report few dissociative symptoms. Results reveal that these patients more frequently engage in self-destructive behaviors, use more methods of self-injury, and begin to injure themselves at an earlier age then patients who do not…