WorldWideScience

Sample records for captivity rattlesnakes crotalus

  1. Perfil eletroforético das proteínas séricas de serpentes Crotalus durissus terrificus (cascavel criadas em cativeiro Serum protein electrophoresis profile of the rattlesnake Crotalus durissus terrificus kept in captivity

    Directory of Open Access Journals (Sweden)

    Joandes Henrique Fonteque

    2009-06-01

    Full Text Available As serpentes peçonhentas dos gêneros Bothrops e Crotalus têm sido mantidas em cativeiro visando à extração de venenos para a produção de imunobiológicos. O conhecimento da fisiologia desses animais e as alterações na concentração de proteínas e suas frações séricas são importantes para a identificação precoce de importantes enfermidades que cursam com estados de hipoproteinemia e hiperproteinemia. O objetivo do trabalho foi determinar a concentração de proteína total e o perfil eletroforético das proteínas séricas de serpentes Crotalus durissus terrificus (cascavel criadas em cativeiro. Foram colhidas amostras de sangue da veia coccígea ventral de 21 serpentes adultas e sadias, divididas em dois grupos: Grupo 1 de 12 machos com peso médio de 588,89±193,55g, e Grupo 2 de nove fêmeas com peso médio de 708,33±194,04g. A proteína total sérica foi determinada pelo método de refratometria e a eletroforese em gel de agarose. Obtiveram-se valores da proteína total sérica (g/dL de 4,51±0,50 para machos e de 4,82±0,72 para fêmeas, e para machos e fêmeas de 4,64±0,61. Foram identificadas pela eletroforese quatro frações protéicas (g/dL: albumina, a, b, g-globulinas e calculada a relação albumina:globulina. As serpentes fêmeas apresentaram maiores valores para as variáveis, albumina e para a relação albumina/globulina (AG diferindo significativamente (PThe poisonous snakes of the genera Crotalus and Bothrops have been kept in captivity with the purpose of extracting poison for the production of immunobiological. Knowledge of the physiology of these animals and serum proteins concentration changes are important for early identification of major diseases which lead to states of hypoproteinemia and hyperproteinemia. The objective was to determine the concentration of total protein and serum protein electrophoresis profile of Crotalus durissus terrificus (rattlesnake in captivity. Blood samples were taken from

  2. Comparison of wildlife and captivity rattlesnakes (Crotalus durissus terrificus microbiota Comparação da microbiota de cascavéis (Crotalus durissus terrificus de vida-livre e cativeiro

    Directory of Open Access Journals (Sweden)

    Rui S. Ferreira Junior

    2009-12-01

    Full Text Available The study evaluated and compared the aerobic microbiota from the oral cavity, cloaca and venom of Crotalus durissus terrificus snakes, recently caught from the wild and kept under quarantine (WQ, individual captivity (IC and collective captivity (CC. Antimicrobial drug effectiveness on isolated agents also was assayed. From group I, II and III were isolated, respectively, 29 (63.04%, 38 (90.48% and 21 (42.86% microorganisms from the cloaca; 15 (32.61%, 3 (7.14% and 25 (51.02% microorganisms from the oral cavity; and, 2 (4.35%, 1 (2.38% and 3 (6.12% microorganisms from venom. The most frequent bacteria were Pseudomonas aeruginosa, Proteus vulgaris and Morganella morganii, with sensitivity to amikacin, gentamicin, norfloxacin, sulfazotrin and tobramycin. Snakes kept in semi-open captivity exhibited the fewest microorganisms in oral cavities, perhaps due to the environment in captivity, with different temperature gradients, running water, absence of daily handling, circulating air, possibility of moving around, daily cleaning, and sunlight access.Este estudo avaliou e comparou a microflora aeróbica da cavidade oral, cloaca e veneno de serpentes Crotalus durissus terrificus recém-capturadas da natureza e mantidas sob quarentena (WQ, mantidas em cativeiro coletivo (CC e em cativeiro individual (IC. A eficácia de drogas antimicrobianas de agentes isolados foi também avaliada. Foram isolados microorganismos dos grupos I, II e III respectivamente: 29 (63.04%, 38 (90.48% e 21 (42.86% da cloaca; 15 (32.61%, 3 (7.14% e 25 (51.02% da cavidade oral, e finalmente 2 (4.35%, 1 (2.38% e 3 (6.12% do veneno. As bactérias mais frequentes foram Pseudomonas aeruginosa, Proteus vulgaris e Morganella morganii, com sensibilidade para amikacina, gentamicina, norfloxacina, sulfazotrina e tobramicina. Serpentes mantidas no cativeiro semi-aberto mostraram menor número de agentes infecciosos em cavidade oral, talvez devido ao ambiente de cativeiro com diferentes

  3. Gross and histologic features of gastritis due to Ophidascaris arndti in tropical rattlesnakes ( Crotalus durissus

    Directory of Open Access Journals (Sweden)

    É.M. Mello

    Full Text Available ABSTRACT The tropical rattlesnake (Crotalus durissus is a snake of great importance for biomedical industry since its poison is used for the production of antiophidic serum and researches. Several conditions related to animal health, such as diseases and parasites, which can promote the reduction of poison production by these snakes should be investigated. Accordingly, the aim of this study was to characterize the gross and microscopic lesions related to the presence of Ophidascaris arndti in stomachs of tropical rattlesnakes. The gastrointestinal tract of thirty-five South American rattlesnakes captured in Southeastern region of Brazil were analyzed and nineteen animals showed infestation by the parasites, found in the small intestine and, especially, in the stomach of the hosts. Grossly, lesions were characterized by mucosal ulcers occasionally associated with hemorrhage. Microscopic alterations included histiocytic granulomas, fibrosis, necrosis, and hemorrhage. Based on these findings, the diagnosis of a parasitic granulomatous disease was made. The lesions may be related to the cause of death in captivity snakes, since the lesions can promote secondary infections by opportunistic bacteria. Moreover, the intense inflammatory response accompanied by fibrosis may be related to poor functioning of the gastric snakes, which it may exhibit frequent regurgitation of the food.

  4. Body size evolution in insular speckled rattlesnakes (Viperidae: Crotalus mitchellii.

    Directory of Open Access Journals (Sweden)

    Jesse M Meik

    2010-03-01

    Full Text Available Speckled rattlesnakes (Crotalus mitchellii inhabit multiple islands off the coast of Baja California, Mexico. Two of the 14 known insular populations have been recognized as subspecies based primarily on body size divergence from putative mainland ancestral populations; however, a survey of body size variation from other islands occupied by these snakes has not been previously reported. We examined body size variation between island and mainland speckled rattlesnakes, and the relationship between body size and various island physical variables among 12 island populations. We also examined relative head size among giant, dwarfed, and mainland speckled rattlesnakes to determine whether allometric differences conformed to predictions of gape size (and indirectly body size evolving in response to shifts in prey size.Insular speckled rattlesnakes show considerable variation in body size when compared to mainland source subspecies. In addition to previously known instances of gigantism on Angel de la Guarda and dwarfism on El Muerto, various degrees of body size decrease have occurred frequently in this taxon, with dwarfed rattlesnakes occurring mostly on small, recently isolated, land-bridge islands. Regression models using the Akaike information criterion (AIC showed that mean SVL of insular populations was most strongly correlated with island area, suggesting the influence of selection for different body size optima for islands of different size. Allometric differences in head size of giant and dwarf rattlesnakes revealed patterns consistent with shifts to larger and smaller prey, respectively.Our data provide the first example of a clear relationship between body size and island area in a squamate reptile species; among vertebrates this pattern has been previously documented in few insular mammals. This finding suggests that selection for body size is influenced by changes in community dynamics that are related to graded differences in area over

  5. Genetic Basis for Variation of Metalloproteinase-Associated Biochemical Activity in Venom of the Mojave Rattlesnake (Crotalus scutulatus scutulatus

    Directory of Open Access Journals (Sweden)

    Ruben K. Dagda

    2013-01-01

    Full Text Available The metalloproteinase composition and biochemical profiles of rattlesnake venom can be highly variable among rattlesnakes of the same species. We have previously shown that the neurotoxic properties of the Mojave rattlesnake (Crotalus scutulatus scutulatus are associated with the presence of the Mojave toxin A subunit suggesting the existence of a genetic basis for rattlesnake venom composition. In this report, we hypothesized the existence of a genetic basis for intraspecies variation in metalloproteinase-associated biochemical properties of rattlesnake venom of the Mojave rattlesnake. To address this question, we PCR-amplified and compared the genomic DNA nucleotide sequences that code for the mature metalloproteinase domain of fourteen Mojave rattlesnakes captured from different geographical locations across the southwest region of the United States. In addition, the venoms from the same rattlesnakes were tested for their ability to hydrolyze fibrinogen, fibrin, casein, and hide powder azure and for induction of hemorrhage in mice. Overall, based on genomic sequencing and biochemical data, we classified Mojave rattlesnake venom into four distinct groups of metalloproteinases. These findings indicate that differences in nucleotide sequences encoding the mature proteinase domain and noncoding regions contribute to differences in venom metalloproteinase activities among rattlesnakes of the same species.

  6. Partial characterization of the venom of the Peruvian rattlesnake Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    César Remuzgo

    2014-06-01

    Full Text Available The venom of the rattlesnake Crotalus durissus terrificus from the region of Sandia, Puno, has been investigated for its protein content and some enzymatic activities, using for it the whole venom as well as the fractions obtained by gel filtration chromatography in Sephadex G-100. The protein percentage calculated by the method of Lowry was of 68,6% for the whole venom; 3 peaks were obtained during the fractionation; the first showed proteolytic activity, the second, amidolytic, clotting and phospholipase A2 activities, while the third, another proteolytic activity. Acetylcholinesterase activity was not found while L-aminoacid oxidase activity was found only in the whole venom.

  7. Shallow phylogeographic structure in the declining Mexican Lance-headed Rattlesnake, Crotalus polystictus (Serpentes: Viperidae

    Directory of Open Access Journals (Sweden)

    Jesse M. Meik

    2012-06-01

    Full Text Available We investigated matrilineal relationships among populations of the Mexican lance-headed rattlesnake (Crotalus polystictus, a pitviper inhabiting high-elevation valleys of the densely populated southernMexican Plateau. A fragment of the mitochondrial ATPase 8 and 6 genes (589 base pairs revealed comparatively low levels of genetic diversity, with few nucleotide polymorphisms across the portion of the geographic distribution sampled. The shallow intraspecificsequence divergence (1.0% in C. polystictus ATPase 8 and 6 genes contrasts with deep divergences (~1.0–14.1% observed within other montane rattlesnake lineages from the Mexican highlands, and is more typical of intraspecific variation observed in lowland rattlesnake species with similar distributional extents (e.g., C. tigris. We posit that the low genetic diversity in C. polystictus relative to that of other highland rattlesnakes may reflect ecological differences resulting in a different evolutionary response to Pleistocene climatic events. Our finding of apparently low genetic diversity in C. polystictus highlights the importance of conservation initiatives to protect high elevation grasslands in central Mexico.

  8. Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom

    NARCIS (Netherlands)

    Da Silva, S.L.; Dias-Junior, C.A.; Baldasso, P.A.; Damico, D.C.; Carvalho, B.M.; Garanto, A.; Acosta, G.; Oliveira, E.; Albericio, F.; Soares, A.M.; Marangoni, S.; Resende, R.R.

    2012-01-01

    Crotalus oreganus abyssus is a rattlesnake that is usually found in the Grand Canyon, United States of America. Knowledge regarding the composition of C. o. abyssus venom is scarce. New natriuretic peptides (NPs) have been isolated and characterized from the venoms of members of the Crotalinae

  9. Ecology and behavior of the Midget Faded Rattlesnake (Crotalus oreganus concolor) in Wyoming

    Science.gov (United States)

    Parker, J.M.; Anderson, S.H.

    2007-01-01

    We conducted a three-year study to describe the ecology and behavior of the Midget Faded Rattlesnake, Crotalus organus concolor. We encountered 426 and telemetered 50 C. o. concolor between 2000 and 2002. We found that their primary diet was lizards (associated with rock outcrops), though they will consume small mammals and birds. They den in aggregations, although in low numbers when compared to other subspecies. Movements and activity ranges were among the largest reported for rattlesnakes. Minimum convex polygon area was 117.8 ha for males, 63.9 ha for nongravid females, and 4.8 ha for gravid females. Mean distances traveled per year were 2122.0 m for males, 1956.0 m for nongravid females, and 296.7 m for gravid and postpartum females. Following emergence from hibernation, they spent several weeks shedding, often in aggregations before migration, and migrations occurred in early summer. Most snakes made straight-line movements to and from discrete summer activity ranges where short, multidirectional movements ensued, although others made multidirectional movements throughout the active season. We observed mating behavior between 21 July and 12 August. Gravid females gave birth during the third week of August. Mean clutch size was 4.17 (range 2-7). We found that the sex ratio was skewed favoring females 1:1.24, and they were sexually dimorphic in size (males SVL = 44.1 cm; females SVL = 40.8 cm). Our data further illustrate the diversity within the large group of Western Rattlesnakes (Crotalus viridis). Copyright 2007 Society for the Study of Amphibians and Reptiles.

  10. Seasonal variation in hormonal responses of timber rattlesnakes (Crotalus horridus) to reproductive and environmental stressors.

    Science.gov (United States)

    Lutterschmidt, William I; Lutterschmidt, Deborah I; Mason, Robert T; Reinert, Howard K

    2009-08-01

    Data addressing adrenocortical modulation across taxonomic groups are limited, especially with regard to how female reproductive condition influences the sensitivity of the hypothalamus-pituitary-adrenal axis. We investigated seasonal and reproductive variation in basal and stress-induced hormone profiles in a population of free-ranging timber rattlesnakes (Crotalus horridus) in north-central Pennsylvania during spring (i.e., May), summer (i.e., July), and early fall (i.e., September). Baseline corticosterone concentrations varied seasonally and were significantly lower during the summer sampling period in July. We observed a significant negative relationship between baseline corticosterone and testosterone in male snakes, while baseline corticosterone and estradiol tended to be positively correlated in females. Treatment of snakes with 1 h of capture stress significantly increased corticosterone across all seasons. However, there was a significant interaction between corticosterone responses to capture stress and season, suggesting that adrenocortical function is modulated seasonally. Because elevated corticosterone may be associated with reproduction, we asked whether hormonal stress responses vary with female reproductive condition. Although sample sizes are low, reproductive snakes had significantly higher baseline and stress-induced corticosterone concentrations than non-reproductive or post-parturient females. Further, despite similar baseline corticosterone concentrations between non-reproductive and post-parturient rattlesnakes, post-parturient females responded to capture stress with a significantly higher increase in corticosterone. Collectively, these data suggest that the sensitivity of the hypothalamus-pituitary-adrenal axis varies both seasonally and with changing reproductive states.

  11. Ontogenetic shift in response to prey-derived chemical cues in prairie rattlesnakes Crotalus viridis viridis

    Directory of Open Access Journals (Sweden)

    Anthony J. SAVIOLA, David CHISZAR, Stephen P. MACKESSY

    2012-08-01

    Full Text Available Snakes often have specialized diets that undergo a shift from one prey type to another depending on the life stage of the snake. Crotalus viridis viridis (prairie rattlesnake takes different prey at different life stages, and neonates typically prey on ectotherms, while adults feed almost entirely on small endotherms. We hypothesized that elevated rates of tongue flicking to chemical stimuli should correlate with particular prey consumed, and that this response shifts from one prey type to another as individuals age. To examine if an ontogenetic shift in response to chemical cues occurred, we recorded the rate of tongue flicking for 25 neonate, 20 subadult, and 20 adult (average SVL = 280.9, 552, 789.5 mm, respectively wild-caught C. v. viridis to chemical stimuli presented on a cotton-tipped applicator; water-soluble cues from two ectotherms (prairie lizard, Sceloporus undulatus, and house gecko, Hemidactylus frenatus, two endotherms (deer mouse, Peromyscus maniculatus and lab mouse, Mus musculus, and water controls were used. Neonates tongue flicked significantly more to chemical cues of their common prey, S. undulatus, than to all other chemical cues; however, the response to this lizard’s chemical cues decreased in adult rattlesnakes. Subadults tongue flicked with a higher rate of tongue flicking to both S. undulatus and P. maniculatus than to all other treatments, and adults tongue flicked significantly more to P. maniculatus than to all other chemical cues. In addition, all three sub-classes demonstrated a greater response for natural prey chemical cues over chemical stimuli of prey not encountered in the wild (M. musculus and H. frenatus. This shift in chemosensory response correlated with the previously described ontogenetic shifts in C. v. viridis diet. Because many vipers show a similar ontogenetic shift in diet and venom composition, we suggest that this shift in prey cue discrimination is likely a general phenomenon among viperid

  12. Natural history of a northern population of twin-spotted rattlesnakes, Crotalus pricei

    Science.gov (United States)

    Prival, D.B.; Goode, M.J.; Swann, D.E.; Schwalbe, C.R.; Schroff, M.J.

    2002-01-01

    The twin-spotted rattlesnake (Crotalus pricei) is a small-bodied pitviper that has received little attention in the literature to date. The species reaches the northern limit of its range in southeastern Arizona, where it inhabits higher elevations than any of the state's 10 other rattlesnake species. During 1997-2000, we captured, measured, and marked 127 C. pricei in Arizona's Chiricahua Mountains between 2530 and 2900 m elevation. We also used radiotelemetry to track the movements of 16 C. pricei in the study area during 1997-1998. Mean (?? SE) snout-vent length of C. pricei was 387.8 ?? 8.3 mm (range = 168-572), and mean mass was 53.5 ?? 3.3 g (range = 3.6-188.5). Based on fecal analyses, lizards constituted the bulk of prey (74%), but the diet of C. pricei also included mammals, birds, and a conspecific. Mating was concentrated in August and early September and parturition took place during late July and August. Mean number of embryos was 3.94 ?? 0.34 (range = 1-6) and female reproduction appeared biennial or less frequent. Based on shed and growth rates, female C. pricei develop embryos at 4-5 years of age. Gravid females maintained warmer body temperatures relative to substrate temperature than nongravid females or males, presumably by spending more time basking than other snakes. Radiotelemetry revealed that movement patterns varied from year to year, as males moved over six times farther per week during the 1998 monsoon season (July to September) than during the 1997 monsoon season. Additionally, use of talus slopes by males decreased during 1998. During dry years, such as 1998, males may be forced off talus into cooler microclimates where resources are less concentrated than on talus.

  13. Parasites of prairie rattlesnakes (Crotalus viridis viridis) and gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico.

    Science.gov (United States)

    Pfaffenberger, G S; Jorgensen, N M; Woody, D D

    1989-04-01

    Three prairie rattlesnakes (Crotalus viridis viridis) and two gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico (USA) were examined for parasites. One cestode (Oochoristica osheroffi), and two nematode (Kalicephalus inermis and Physoloptera retusa) species were recovered from two infected rattlesnakes. One female gopher snake was infected with two nematode (K. inermis and Rhabdias spp.) and one mite (Entonyssus halli) species.

  14. The adrenergic retulation of the cardiovascular system in the South American rattlesnake, Crotalus durissus

    DEFF Research Database (Denmark)

    Galli, G.L.J.; Jensen, Nini Skovgaard; Abe, A.S.

    2007-01-01

    The present study investigates adrenergic regulation of the systemic and pulmonary circulations of the anaesthetised South American rattlesnake, Crotalus durissus. Haemodynamic measurements were made following bolus injections of adrenaline and adrenergic antagonists administered through a systemic...... arterial catheter. Adrenaline caused a marked systemic vasoconstriction that was abolished by phentolamine, indicating this response was mediated through α-adrenergic receptors. Injection of phentolamine gave rise to a pronounced vasodilatation (systemic conductance (Gsys) more than doubled), while...... injection of propranolol caused a systemic vasoconstriction, pointing to a potent α-adrenergic, and a weaker β-adrenergic tone in the systemic vasculature of Crotalus. Overall, the pulmonary vasculature was far less responsive to adrenergic stimulation than the systemic circulation. Adrenaline caused...

  15. Phylogeographic structure and historical demography of the western diamondback rattlesnake (Crotalus atrox): A perspective on North American desert biogeography.

    Science.gov (United States)

    Castoe, Todd A; Spencer, Carol L; Parkinson, Christopher L

    2007-01-01

    The western diamondback rattlesnake (Crotalus atrox) is a prominent member of North American desert and semi-arid ecosystems, and its importance extends from its impact on the region's ecology and imagery, to its medical relevance as a large deadly venomous snake. We used mtDNA sequences to identify population genetic structure and historical demographic patterns across the range of this species, and relate these to broader patterns of historical biogeography of desert and semi-arid regions of the southwestern USA and adjacent Mexico. We inferred a Late Pliocene divergence between peninsular and continental lineages of Crotalus, followed by an Early Mid Pleistocene divergence across the continental divide within C. atrox. Within desert regions (Sonoran and Chihuahuan Deserts, Southern Plains, and Tamaulipan Plain) we observed population structure indicating isolation of populations in multiple Pleistocene refugia on either side of the continental divide, which we attempt to identify. Evidence of post-glacial population growth and range expansion was inferred, particularly in populations east of the continental divide. We observed clear evidence of (probably recent) gene flow across the continental divide and secondary contact of haplotype lineages. This recent gene flow appears to be particularly strong in the West-to-East direction. Our results also suggest that Crotalus tortugensis (Tortuga Island rattlesnake) and a population of 'C. atrox' inhabiting Santa Cruz Island (in the Gulf of California) previously suggested to be an unnamed species, are in fact deeply phylogenetically nested within continental lineages of C. atrox. Accordingly, we suggest C. tortugensis and 'C. atrox' from Santa Cruz Island be placed in the synonymy of C. atrox.

  16. Sexual size dimorphism and growth plasticity in snakes: an experiment on the Western Diamond-backed Rattlesnake (Crotalus atrox).

    Science.gov (United States)

    Taylor, Emily N; Denardo, Dale F

    2005-07-01

    We conducted an experiment to examine the effects of sex and food intake on growth, mass gain, and attainment of sexual maturity in Western Diamond-backed Rattlesnakes (Crotalus atrox). We also measured testosterone levels to determine whether testosterone might be involved in the male-biased sexual size dimorphism observed in this species. We collected neonate rattlesnakes and raised them in the laboratory for 2 years on either a high-intake diet (fed one mouse per week) or a low-intake diet (fed one mouse every 3 weeks). High-intake snakes grew and gained mass more rapidly than low-intake snakes, but males did not grow or gain mass more rapidly than females in either treatment group. High-intake snakes attained reproductive maturity earlier than low-intake snakes, indicating that size, not age, is the critical determinant of reproductive maturity. Males had higher levels of testosterone than females but did not grow more quickly, suggesting that testosterone may not affect growth in this species and may therefore not be the proximate determinant of sexual size dimorphism.

  17. Evolution of rattlesnakes (Viperidae; Crotalus) in the warm deserts of western North America shaped by Neogene vicariance and Quaternary climate change.

    Science.gov (United States)

    Douglas, Michael E; Douglas, Marlis R; Schuett, Gordon W; Porras, Louis W

    2006-10-01

    During Pleistocene, the Laurentide ice sheet rearranged and diversified biotic distributions in eastern North America, yet had minimal physical impact in western North America where lineage diversification is instead hypothesized to result from climatic changes. If Pleistocene climatic fluctuations impacted desert species, the latter would reflect patterns of restricted gene flow concomitant with indications of demographic bottlenecks. Accordingly, molecular evidence for refugia should be present within these distributions and for subsequent range expansions as conditions improved. We sought answers to these questions by evaluating mitochondrial DNA (mtDNA) sequences from four species of rattlesnakes [Crotalus mitchellii (speckled rattlesnake), Crotalus cerastes (sidewinder), Crotalus tigris (tiger rattlesnake), Crotalus ruber (red diamond rattlesnake)] with distributions restricted to desert regions of southwestern North America. We inferred relationships using parsimony and maximum likelihood, tested intraspecific clades for population expansions, applied an isolation-with-migration model to determine bi-directional migration rates (m) among regions, and inferred divergence times for species and clades by applying a semiparametric penalized likelihood approach to our molecular data. Evidence for significant range expansion was present in two of eight regions in two species (Crotalus mitchellii pyrrhus, C. tigris region north). Two species (C. cerastes, C. mitchellii) showed a distribution concomitant with northward displacement of Baja California from mainland México, followed by vicariant separation into subclades. Effects of Pleistocene climate fluctuations were found in the distributions of all four species. Three regional diversification patterns were identified: (i) shallow genetic diversity that resulted from Pleistocene climatic events (C. tigris, C. ruber); (ii) deep Pleistocene divisions indicating allopatric segregation of subclades within refugia (C

  18. Gopherus agassizii (desert tortoise) and Crotalus ruber (red diamond rattlesnake). Burrow co-occupancy

    Science.gov (United States)

    Lovich, Jeffrey E.

    2011-01-01

    I observed an adult Desert Tortoise and an adult Red Diamond Rattlesnake (sexes unknown) in a shallow tortoise burrow on 6 January 1997 at a wind energy generation facility near Palm Springs, Riverside Co., California, USA (33.9599°N, 116.6613°W).

  19. Crotoxin, the major toxin from the rattlesnake Crotalus durissus terrificus, inhibits ³H-choline uptake in guinea pig ileum

    Directory of Open Access Journals (Sweden)

    L.S. Kattah

    2000-09-01

    Full Text Available We examined the effect of crotoxin, the neurotoxic complex from the venom of the South American rattlesnake Crotalus durissus terrificus, on the uptake of ³H-choline in minces of smooth muscle myenteric plexus from guinea pig ileum. In the concentration range used (0.03-1 µM and up to 10 min of treatment, crotoxin decreased ³H-choline uptake by 50-75% compared to control. This inhibition was time dependent and did not seem to be associated with the disruption of the neuronal membrane, because at least for the first 20 min of tissue exposure to the toxin (up to 1 µM the levels of lactate dehydrogenase (LDH released into the supernatant were similar to those of controls. Higher concentrations of crotoxin or more extensive incubation times with this toxin resulted in elevation of LDH activity detected in the assay supernatant. The inhibitory effect of crotoxin on ³H-choline uptake seems to be associated with its phospholipase activity since the equimolar substitution of Sr2+ for Ca2+ in the incubation medium or the modification of the toxin with p-bromophenacyl bromide substantially decreased this effect. Our results show that crotoxin inhibits ³H-choline uptake with high affinity (EC25 = 10 ± 5 nM. We suggest that this inhibition could explain, at least in part, the blocking effect of crotoxin on neurotransmission.

  20. Is Hybridization a Source of Adaptive Venom Variation in Rattlesnakes? A Test, Using a Crotalus scutulatus × viridis Hybrid Zone in Southwestern New Mexico

    Directory of Open Access Journals (Sweden)

    Giulia Zancolli

    2016-06-01

    Full Text Available Venomous snakes often display extensive variation in venom composition both between and within species. However, the mechanisms underlying the distribution of different toxins and venom types among populations and taxa remain insufficiently known. Rattlesnakes (Crotalus, Sistrurus display extreme inter- and intraspecific variation in venom composition, centered particularly on the presence or absence of presynaptically neurotoxic phospholipases A2 such as Mojave toxin (MTX. Interspecific hybridization has been invoked as a mechanism to explain the distribution of these toxins across rattlesnakes, with the implicit assumption that they are adaptively advantageous. Here, we test the potential of adaptive hybridization as a mechanism for venom evolution by assessing the distribution of genes encoding the acidic and basic subunits of Mojave toxin across a hybrid zone between MTX-positive Crotalus scutulatus and MTX-negative C. viridis in southwestern New Mexico, USA. Analyses of morphology, mitochondrial and single copy-nuclear genes document extensive admixture within a narrow hybrid zone. The genes encoding the two MTX subunits are strictly linked, and found in most hybrids and backcrossed individuals, but not in C. viridis away from the hybrid zone. Presence of the genes is invariably associated with presence of the corresponding toxin in the venom. We conclude that introgression of highly lethal neurotoxins through hybridization is not necessarily favored by natural selection in rattlesnakes, and that even extensive hybridization may not lead to introgression of these genes into another species.

  1. Snake venomics of Crotalus tigris: the minimalist toxin arsenal of the deadliest Nearctic rattlesnake venom. Evolutionary Clues for generating a pan-specific antivenom against crotalid type II venoms [corrected].

    Science.gov (United States)

    Calvete, Juan J; Pérez, Alicia; Lomonte, Bruno; Sánchez, Elda E; Sanz, Libia

    2012-02-03

    We report the proteomic and antivenomic characterization of Crotalus tigris venom. This venom exhibits the highest lethality for mice among rattlesnakes and the simplest toxin proteome reported to date. The venom proteome of C. tigris comprises 7-8 gene products from 6 toxin families; the presynaptic β-neurotoxic heterodimeric PLA(2), Mojave toxin, and two serine proteinases comprise, respectively, 66 and 27% of the C. tigris toxin arsenal, whereas a VEGF-like protein, a CRISP molecule, a medium-sized disintegrin, and 1-2 PIII-SVMPs each represent 0.1-5% of the total venom proteome. This toxin profile really explains the systemic neuro- and myotoxic effects observed in envenomated animals. In addition, we found that venom lethality of C. tigris and other North American rattlesnake type II venoms correlates with the concentration of Mojave toxin A-subunit, supporting the view that the neurotoxic venom phenotype of crotalid type II venoms may be described as a single-allele adaptation. Our data suggest that the evolutionary trend toward neurotoxicity, which has been also reported for the South American rattlesnakes, may have resulted by pedomorphism. The ability of an experimental antivenom to effectively immunodeplete proteins from the type II venoms of C. tigris, Crotalus horridus , Crotalus oreganus helleri, Crotalus scutulatus scutulatus, and Sistrurus catenatus catenatus indicated the feasibility of generating a pan-American anti-Crotalus type II antivenom, suggested by the identification of shared evolutionary trends among South and North American Crotalus species.

  2. Avaliação da resposta inflamatória hematológica em cascavéis (Crotalus durissus Linnaeus, 1758 inoculadas com BCG Assessment of blood inflammatory response in BCG stimulated rattlesnakes (Crotalus durissus Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Wellington Bandeira da Silva

    2009-12-01

    grandes vacúolos. De forma geral, a inoculação de BCG em cascavéis desencadeia respostas inflamatórias hematológicas caracterizadas pela participação de trombócitos, granulócitos e azurófilos.The high demand for anti-venom production in response to the increased number of cases of snakebite envenomation highlights the importance of raising and breeding venomous snakes in captivity. Knowledge of types of venoms and anti-venoms is of great interest to public health. The maintenance of venomous serpents in captivity started in the early twentieth century, but still nowadays it is a challenge to manage and prevent diseases in captive fauna. Hematology is commonly used for general health assessment and illness detection. However, data on serpent blood analysis are still scarce. Alterations in hematological parameters were experimentally induced in rattlesnakes by the inoculation of BCG. Based on this, hemograms can be used as a health auxiliary diagnosis method for bacterial diseases in this species. In this study, blood samples were taken from 10 healthy specimens of rattlesnakes (Crotalus durissus born and bred in captivity in the Herpetological Division of Vital Brazil Institute. Animals were divided into two groups (group 1 and 2 with similar live weight and sex proportion, and were then inoculated subcutaneously with BCG (Bacillus Calmette-Guérin. Blood samples were taken before and after inoculation at three experimental times (days 3, 5 and 7 for group 1 and days 11, 17 and 21 for group 2. Hematological analysis was performed through semi-direct technique, blood samples were diluted in Natt and Herrick solution and smears were stained by Giemsa. Serpents from group 1 developed discrete anemia due to the inflammatory syndrome, and showed significant decrease of MCH and MCHC. Granulocytes were characterized by the presence of rough granules. The azurophils varied in shape and size and showed large amount of cytoplasmic vacuoles. The thrombocytopenia observed

  3. Effects of food supplementation on the physiological ecology of female Western diamond-backed rattlesnakes (Crotalus atrox).

    Science.gov (United States)

    Taylor, Emily N; Malawy, Michael A; Browning, Dawn M; Lemar, Shea V; DeNardo, Dale F

    2005-06-01

    Food availability is an important factor in the life histories of organisms because it is often limiting and thus can affect growth, mass change, reproduction, and behaviors such as thermoregulation, locomotion, and mating. Experimental studies in natural settings allow researchers to examine the effects of food on these parameters while animals are free to behave naturally. The wide variation among organisms in energy demands and among environmental food resources suggest that responses to changes in food availability may vary among organisms. Since most supplemental feeding field experiments have been conducted on species with high energy demands, we conducted a supplemental feeding study on free-ranging, female Western diamond-backed rattlesnakes (Crotalus atrox), a species with low energy demands and infrequent reproductive investment. Snakes were offered thawed rodents 1-4 times per week. Over two active seasons, we collected data on surface activity, home range size, growth, mass change, and reproduction of supplementally fed and control snakes. Fed and control snakes did not differ in surface activity levels (proportion of time encountered above versus below ground) or home range size. Fed snakes grew and gained mass faster, and had a dramatically higher occurrence of reproduction than control snakes. Also, fed snakes were in better body condition following reproduction than snakes that were not fed. However, litter characteristics such as offspring number and size were not increased by feeding, suggesting that these characteristics may be fixed. These data experimentally demonstrate that food availability can directly impact some life history traits (i.e., growth and reproduction for C. atrox), but not others (i.e., surface activity and home range size for C. atrox). The relationship between food availability and life history traits is affected in a complex way by ecological traits and physiological constraints, and thus interspecific variation in this

  4. The relationship between plasma steroid hormone concentrations and the reproductive cycle in the Northern Pacific rattlesnake, Crotalus oreganus.

    Science.gov (United States)

    Lind, Craig M; Husak, Jerry F; Eikenaar, Cas; Moore, Ignacio T; Taylor, Emily N

    2010-05-01

    We describe the reproductive cycle of Northern Pacific rattlesnakes (Crotalus oreganus) by quantifying steroid hormone concentrations and observing reproductive behaviors in free-ranging individuals. Additionally, we examined reproductive tissues from museum specimens. Plasma steroid hormone concentrations were quantified for both male and female snakes throughout the active season (March-October). We measured testosterone (T), 5alpha-dihydrotestosterone (DHT), and corticosterone (B) concentrations in both sexes and 17beta-estradiol (E2) and progesterone (P) in females only. We observed reproductive behaviors (e.g., consortship, courtship, and copulation) in the field and measured testis and follicle size in male and female snakes from museum collections to relate steroid hormone concentrations to the timing of reproductive events. Our study revealed that C. oreganus in central California exhibits a bimodal pattern of breeding, with most mating behavior occurring in the spring and some incidences of mating behavior observed in late summer/fall. Each breeding period corresponded with elevated androgen (T or DHT) levels in males. Testes were regressed in the spring when the majority of reproductive behavior was observed in this population, and they reached peak volume in August and September during spermatogenesis. Although we did not detect seasonal variation in female hormone concentrations, some females had high E2 in the spring and fall, coincident with mating and with increased follicle size (indicating vitellogenesis) in museum specimens. Females with high E2 concentrations also had high T and DHT concentrations. Corticosterone concentrations in males and females were not related either to time of year or to concentrations of any other hormones quantified. Progesterone concentrations in females also did not vary seasonally, but this likely reflected sampling bias as females tended to be underground, and thus unobtainable, in summer months when P would be

  5. Isolation and characterization of two disintegrins inhibiting ADP-induced human platelet aggregation from the venom of Crotalus scutulatus scutulatus (Mohave Rattlesnake)

    International Nuclear Information System (INIS)

    Sanchez, Elda E.; Galan, Jacob A.; Russell, William K.; Soto, Julio G.; Russell, David H.; Perez, John C.

    2006-01-01

    Disintegrins and disintegrin-like proteins are molecules found in the venom of four snake families (Atractaspididae, Elapidae, Viperidae, and Colubridae). The disintegrins are nonenzymatic proteins that inhibit cell-cell interactions, cell-matrix interactions, and signal transduction, and may have potential in the treatment of strokes, heart attacks, cancers, and osteoporosis. Prior to 1983, the venom of Crotalus scutulatus scutulatus (Mohave Rattlesnake) was known to be only neurotoxic; however, now there is evidence that these snakes can contain venom with: (1) neurotoxins; (2) hemorrhagins; and (3) both neurotoxins and hemorrhagins. In this study, two disintegrins, mojastin 1 and mojastin 2, from the venom of a Mohave rattlesnake collected in central Arizona (Pinal County), were isolated and characterized. The disintegrins in these venoms were identified by mass-analyzed laser desorption ionization/time-of-flight/time-of-flight (MALDI/TOF/TOF) mass spectrometry as having masses of 7.436 and 7.636 kDa. Their amino acid sequences are similar to crotratroxin, a disintegrin isolated from the venom of the western diamondback rattlesnake (C. atrox). The amino acid sequence of mojastin 1 was identical to the amino acid sequence of a disintegrin isolated from the venom of the Timber rattlesnake (C. horridus). The disintegrins from the Mohave rattlesnake venom were able to inhibit ADP-induced platelet aggregation in whole human blood both having IC 5 s of 13.8 nM, but were not effective in inhibiting the binding of human urinary bladder carcinoma cells (T24) to fibronectin

  6. Genetic diversity and genetic structure of an endemic Mexican Dusky Rattlesnake (Crotalus triseriatus) in a highly modified agricultural landscape: implications for conservation.

    Science.gov (United States)

    Sunny, Armando; Monroy-Vilchis, Octavio; Zarco-González, Martha M; Mendoza-Martínez, Germán David; Martínez-Gómez, Daniel

    2015-12-01

    It is necessary to determine genetic diversity of fragmented populations in highly modified landscapes to understand how populations respond to land-use change. This information will help guide future conservation and management strategies. We conducted a population genetic study on an endemic Mexican Dusky Rattlesnake (Crotalus triseriatus) in a highly modified landscape near the Toluca metropolitan area, in order to provide crucial information for the conservation of this species. There was medium levels of genetic diversity, with a few alleles and genotypes. We identified three genetically differentiated clusters, likely as a result of different habitat cover type. We also found evidence of an ancestral genetic bottleneck and medium values of effective population size. Inbreeding coefficients were low and there was a moderate gene flow. Our results can be used as a basis for future research and C. triseriatus conservation efforts, particularly considering that the Trans-Mexican Volcanic Belt is heavily impacted by destructive land-use practices.

  7. Cytoskeleton, endoplasmic reticulum and nucleus alterations in CHO-K1 cell line after Crotalus durissus terrificus (South American rattlesnake venom treatment

    Directory of Open Access Journals (Sweden)

    B. P. Tamieti

    2007-01-01

    Full Text Available Snake venoms are toxic to a variety of cell types. However, the intracellular damages and the cell death fate induced by venom are unclear. In the present work, the action of the South American rattlesnake Crotalus durissus terrificus venom on CHO-K1 cell line was analyzed. The cells CHO-K1 were incubated with C. d. terrificus venom (10, 50 and 100g/ml for 1 and 24 hours, and structural alterations of actin filaments, endoplasmic reticulum and nucleus were assessed using specific fluorescent probes and agarose gel electrophoresis for DNA fragmentation. Significant structural changes were observed in all analyzed structures. DNA fragmentation was detected suggesting that, at the concentrations used, the venom induced apoptosis.

  8. Influência da temperatura corporal de cascavéis (Crotalus durissus submetidas à anestesia com cetamina Influence of body temperature on rattlesnakes (Crotalus durissus anesthetized with ketamine

    Directory of Open Access Journals (Sweden)

    Adriano B. Carregaro

    2009-12-01

    Full Text Available O estudo objetivou verificar a influência da temperatura corporal nos parâmetros fisiológicos e nos períodos de indução e recuperação anestésicos de cascavéis (Crotalus durissus anestesiadas com cetamina. Os animais foram previamente submetidos à hipotermia (HIPO (The aim of the study was to verify the influence of the body temperature under physiological values and latency and recovery times on rattlesnakes anesthetized with ketamine. The animals were previously submitted to hypothermia (HYPO (<22°C and normothermia (30°C (NORMO and then, anesthetized with 80 mg/kg IM of ketamine. Latency and recovery times were evaluated by head tonus, muscular tonus and righting reflex. Heart rate (HR, time of apnea and body temperature were measured before and 5, 10, 15, 30, 60, 90 and 120 minutes after ketamine administration. Blood gases parameters were measured before, 30 and 60 minutes. It was not observed difference on latency time in both groups. The recovery time was higher on HYPO (5,5 hours compared to NORMO (3,5 hours. HR was higher on NORMO compared to HYPO. Time of apnea was the same pattern on both groups. Compared to basal levels, time of apnea was shorter between 5 to 30 min on both groups. Respiratory acidosis was observed only at 0 min in NORMO. SvO2 was higher after 30 min, the same as with PvO2 in both groups. PvCO2 reduced after 30 min in both groups. It was evident that body temperature exerts intense influence on the recovery time on rattlesnakes anesthetized with ketamine.

  9. Intraspecies variation in the venom of the rattlesnake Crotalus simus from Mexico: different expression of crotoxin results in highly variable toxicity in the venoms of three subspecies.

    Science.gov (United States)

    Castro, Edgar Neri; Lomonte, Bruno; del Carmen Gutiérrez, María; Alagón, Alejandro; Gutiérrez, José María

    2013-07-11

    The composition and toxicological profile of the venom of the rattlesnake Crotalus simus in Mexico was analyzed at the subspecies and individual levels. Venoms of the subspecies C. s. simus, C. s. culminatus and C. s. tzabcan greatly differ in the expression of the heterodimeric neurotoxin complex 'crotoxin', with highest concentrations in C. s. simus, followed by C. s. tzabcan, whereas the venom of C. s. culminatus is almost devoid of this neurotoxic PLA2. This explains the large variation in lethality (highest in C. s. simus, which also exerts higher myotoxicity). Coagulant activity on plasma and fibrinogen occurs with the venoms of C. s. simus and C. s. tzabcan, being absent in C. s. culminatus which, in turn, presents higher crotamine-like activity. Proteomic analysis closely correlates with toxicological profiles, since the venom of C. s. simus has high amounts of crotoxin and of serine proteinases, whereas the venom of C. s. culminatus presents higher amounts of metalloproteinases and crotamine. This complex pattern of intraspecies venom variation provides valuable information for the diagnosis and clinical management of envenoming by this species in Mexico, as well as for the preparation of venom pools for the production and quality control of antivenoms. This study describes the variation in venom composition and activities of the three subspecies of Crotalus simus from Mexico. Results demonstrate that there is a notorious difference in these venoms, particularly regarding the content of the potent neurotoxic phospholipase A2 complex 'crotoxin'. In addition, other differences were observed regarding myotoxic and coagulant activities, and expression of the myotoxin 'crotamine'. These findings have implications in, at least, three levels: (a) the adaptive role of variations in venom composition; (b) the possible differences in the clinical manifestations of envenomings by these subspecies in Mexico; and (c) the design of venom mixtures for the preparation of

  10. Mating systems, reproductive success, and sexual selection in secretive species: a case study of the western diamond-backed rattlesnake, Crotalus atrox.

    Science.gov (United States)

    Clark, Rulon W; Schuett, Gordon W; Repp, Roger A; Amarello, Melissa; Smith, Charles F; Herrmann, Hans-Werner

    2014-01-01

    Long-term studies of individual animals in nature contribute disproportionately to our understanding of the principles of ecology and evolution. Such field studies can benefit greatly from integrating the methods of molecular genetics with traditional approaches. Even though molecular genetic tools are particularly valuable for species that are difficult to observe directly, they have not been widely adopted. Here, we used molecular genetic techniques in a 10-year radio-telemetric investigation of the western diamond-backed rattlesnake (Crotalus atrox) for an analysis of its mating system and to measure sexual selection. Specifically, we used microsatellite markers to genotype 299 individuals, including neonates from litters of focal females to ascertain parentage using full-pedigree likelihood methods. We detected high levels of multiple paternity within litters, yet found little concordance between paternity and observations of courtship and mating behavior. Larger males did not father significantly more offspring, but we found evidence for size-specific male-mating strategies, with larger males guarding females for longer periods in the mating seasons. Moreover, the spatial proximity of males to mothers was significantly associated with reproductive success. Overall, our field observations alone would have been insufficient to quantitatively measure the mating system of this population of C. atrox, and we thus urge more widespread adoption of molecular tools by field researchers studying the mating systems and sexual selection of snakes and other secretive taxa.

  11. Functional characterizations of venom phenotypes in the eastern diamondback rattlesnake (Crotalus adamanteus) and evidence for expression-driven divergence in toxic activities among populations

    Science.gov (United States)

    Margres, Mark J.; Walls, Robert; Suntravat, Montamas; Lucena, Sara; Sánchez, Elda E.; Rokyta, Darin R.

    2016-01-01

    Phenotypes frequently vary across and within species. The connection between specific phenotypic effects and function, however, is less understood despite being essential to our understanding of the adaptive process. Snake venoms are ideal for identifying functionally important phenotypic variation because venom variation is common, and venoms can be functionally characterized through simple assays and toxicity measurements. Previous work with the eastern diamondback rattlesnake (Crotalus adamanteus) used multivariate statistical approaches to identify six unique venom phenotypes. We functionally characterized hemolytic, gelatinase, fibrinogenolytic, and coagulant activity for all six phenotypes, as well as one additional venom, to determine if the statistically significant differences in toxin expression levels previously documented corresponded to differences in venom activity. In general, statistical differences in toxin expression predicted the identified functional differences, or lack thereof, in toxic activity, demonstrating that the statistical approach used to characterize C. adamanteus venoms was a fair representation of biologically meaningful differences. Minor differences in activity not accounted for by the statistical model may be the result of amino-acid differences and/or post-translational modifications, but overall we were able to link variation in protein expression levels to variation in function as predicted by multivariate statistical approaches. PMID:27179420

  12. Mating systems, reproductive success, and sexual selection in secretive species: a case study of the western diamond-backed rattlesnake, Crotalus atrox.

    Directory of Open Access Journals (Sweden)

    Rulon W Clark

    Full Text Available Long-term studies of individual animals in nature contribute disproportionately to our understanding of the principles of ecology and evolution. Such field studies can benefit greatly from integrating the methods of molecular genetics with traditional approaches. Even though molecular genetic tools are particularly valuable for species that are difficult to observe directly, they have not been widely adopted. Here, we used molecular genetic techniques in a 10-year radio-telemetric investigation of the western diamond-backed rattlesnake (Crotalus atrox for an analysis of its mating system and to measure sexual selection. Specifically, we used microsatellite markers to genotype 299 individuals, including neonates from litters of focal females to ascertain parentage using full-pedigree likelihood methods. We detected high levels of multiple paternity within litters, yet found little concordance between paternity and observations of courtship and mating behavior. Larger males did not father significantly more offspring, but we found evidence for size-specific male-mating strategies, with larger males guarding females for longer periods in the mating seasons. Moreover, the spatial proximity of males to mothers was significantly associated with reproductive success. Overall, our field observations alone would have been insufficient to quantitatively measure the mating system of this population of C. atrox, and we thus urge more widespread adoption of molecular tools by field researchers studying the mating systems and sexual selection of snakes and other secretive taxa.

  13. Mating Systems, Reproductive Success, and Sexual Selection in Secretive Species: A Case Study of the Western Diamond-Backed Rattlesnake, Crotalus atrox

    Science.gov (United States)

    Clark, Rulon W.; Schuett, Gordon W.; Repp, Roger A.; Amarello, Melissa; Smith, Charles F.; Herrmann, Hans-Werner

    2014-01-01

    Long-term studies of individual animals in nature contribute disproportionately to our understanding of the principles of ecology and evolution. Such field studies can benefit greatly from integrating the methods of molecular genetics with traditional approaches. Even though molecular genetic tools are particularly valuable for species that are difficult to observe directly, they have not been widely adopted. Here, we used molecular genetic techniques in a 10-year radio-telemetric investigation of the western diamond-backed rattlesnake (Crotalus atrox) for an analysis of its mating system and to measure sexual selection. Specifically, we used microsatellite markers to genotype 299 individuals, including neonates from litters of focal females to ascertain parentage using full-pedigree likelihood methods. We detected high levels of multiple paternity within litters, yet found little concordance between paternity and observations of courtship and mating behavior. Larger males did not father significantly more offspring, but we found evidence for size-specific male-mating strategies, with larger males guarding females for longer periods in the mating seasons. Moreover, the spatial proximity of males to mothers was significantly associated with reproductive success. Overall, our field observations alone would have been insufficient to quantitatively measure the mating system of this population of C. atrox, and we thus urge more widespread adoption of molecular tools by field researchers studying the mating systems and sexual selection of snakes and other secretive taxa. PMID:24598810

  14. Hepatozoon spp. (Apicomplexa: Hepatozoidae) infection and selected hematological values of the neotropical rattlesnake, Crotalus durissus collilineatus (Linnaeus, 1758) (Serpentes: Viperidae), from Brazil.

    Science.gov (United States)

    Motta, Rafael Otávio Cançado; Cunha, Lucas Maciel; Leite, Romário Cerqueira; da Silva, Israel José; Pinto, Ana Cristina Araújo; Braga, Erika Martins; da Cunha, Arildo Pinto; de Oliveira, Paulo Roberto

    2011-09-01

    This study aims to establish the hematological values of Crotalus durissus collilineatus snakes captured in Brazil as well as to verify the effects of hematozoan infection on these snakes. Eighty-three blood samples were drawn from C. d. collilineatus specimens for analysis. The sample set was composed of 30 males and 30 females, recently caught from the wild, and 11 males and 12 females bred in captivity. Blood samples were used to determine red blood cell counts, white blood cell counts, thrombocyte counts, hematocrit values, hemoglobin concentration, and total plasma protein. Blood smears were used to diagnose Hepatozoon spp. infection and to calculate the parasitic load in the sample as well as the percentage of immature red cells. Results obtained for the wild-caught animals, with and without parasites, were compared among themselves and with the values obtained for the captive-bred animals. Hematological values for C. durissus were established. Wild-caught snakes had an infection rate of 38.3%, while no Hepatozoon sp. infection was detected in the captive-bred animals. The snakes which were not infected by the Hepatozoon sp. exhibited average weight, length, and weight-length ratios higher than those of the infected animals. An increase in immature red cells was noted in the Hepatozoon-infected snakes.

  15. cDNA cloning of a snake venom metalloproteinase from the eastern diamondback rattlesnake (Crotalus adamanteus), and the expression of its disintegrin domain with anti-platelet effects

    Science.gov (United States)

    Suntravat, Montamas; Jia, Ying; Lucena, Sara E.; Sánchez, Elda E.; Pérez, John C.

    2013-01-01

    A 5′ truncated snake venom metalloproteinase was identified from a cDNA library constructed from venom glands of an eastern diamondback rattlesnake (Crotalus adamanteus). The 5′-rapid amplification of cDNA ends (RACE) was used to obtain the 1865 bp full-length cDNA sequence of a snake venom metalloproteinase (CamVMPII). CamVMPII encodes an open reading frame of 488 amino acids, which includes a signal peptide, a pro-domain, a metalloproteinase domain, a spacer, and an RGD-disintegrin domain. The predicted amino acid sequence of CamVMPII showed a 91%, 90%, 83%, and 82% sequence homology to the P-II class enzymes of C. adamanteus metalloproteinase 2, C. atrox CaVMP-II, Gloydius halys agkistin, and Protobothrops jerdonii jerdonitin, respectively. Disintegrins are potent inhibitors of both platelet aggregation and integrin-dependent cell adhesion. Therefore, the disintegrin domain (Cam-dis) of CamVMPII was amplified by PCR, cloned into a pET-43.1a vector, and expressed in Escherichia coli BL21. Affinity purified recombinantly modified Cam-dis (r-Cam-dis) with a yield of 8.5 mg/L culture medium was cleaved from the fusion tags by enterokinase cleavage. r-Cam-dis was further purified by two-step chromatography consisting of HiTrap™ Benzamidine FF column, followed by Talon Metal affinity column with a final yield of 1 mg/L culture. r-Cam-dis was able to inhibit all three processes of platelet thrombus formation including platelet adhesion with an estimated IC50 of 1 nM, collagen- and ADP-induced platelet aggregation with the estimated IC50s of 18 and 6 nM, respectively, and platelet function on clot retraction. It is a potent anti-platelet inhibitor, which should be further investigated for drug discovery to treat stroke patients or patients with thrombotic disorders. PMID:23313448

  16. Wound healing activity and mechanisms of action of an antibacterial protein from the venom of the eastern diamondback rattlesnake (Crotalus adamanteus.

    Directory of Open Access Journals (Sweden)

    Ramar Perumal Samy

    Full Text Available Basic phospholipase A2 was identified from the venom of the eastern diamondback rattlesnake. The Crotalus adamanteus toxin-II (CaTx-II induced bactericidal effects (7.8 µg/ml on Staphylococcus aureus, while on Burkholderia pseudomallei (KHW, and Enterobacter aerogenes were killed at 15.6 µg/ml. CaTx-II caused pore formation and membrane damaging effects on the bacterial cell wall. CaTx-II was not cytotoxic on lung (MRC-5, skin fibroblast (HEPK cells and in mice. CaTx-II-treated mice showed significant wound closure and complete healing by 16 days as compared to untreated controls (**P<0.01. Histological examination revealed enhanced collagen synthesis and neovascularization after treatment with CaTx-II versus 2% Fusidic Acid ointment (FAO treated controls. Measurement of tissue cytokines revealed that interleukin-1 beta (IL-1β expression in CaTx-II treated mice was significantly suppressed versus untreated controls. In contrast, cytokines involved in wound healing and cell migration i.e., monocyte chemotactic protein-1 (MCP-1, fibroblast growth factor-basic (FGF-b, chemokine (KC, granulocyte-macrophage colony-stimulating factor (GM-CSF were significantly enhanced in CaTx-II treated mice, but not in the controls. CaTx-II also modulated nuclear factor-kappa B (NF-κB activation during skin wound healing. The CaTx-II protein highlights distinct snake proteins as a potential source of novel antimicrobial agents with significant therapeutic application for bacterial skin infections.

  17. Comparative venomics of the Prairie Rattlesnake (Crotalus viridis viridis) from Colorado: Identification of a novel pattern of ontogenetic changes in venom composition and assessment of the immunoreactivity of the commercial antivenom CroFab®.

    Science.gov (United States)

    Saviola, Anthony J; Pla, Davinia; Sanz, Libia; Castoe, Todd A; Calvete, Juan J; Mackessy, Stephen P

    2015-05-21

    Here we describe and compare the venomic and antivenomic characteristics of both neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) venoms. Although both neonate and adult venoms contain unique components, similarities among protein family content were seen. Both neonate and adult venoms consisted of myotoxin, bradykinin-potentiating peptide (BPP), phospholipase A2 (PLA2), Zn(2+)-dependent metalloproteinase (SVMP), serine proteinase, L-amino acid oxidase (LAAO), cysteine-rich secretory protein (CRISP) and disintegrin families. Quantitative differences, however, were observed, with venoms of adults containing significantly higher concentrations of the non-enzymatic toxic compounds and venoms of neonates containing higher concentrations of pre-digestive enzymatic proteins such as SVMPs. To assess the relevance of this venom variation in the context of snakebite and snakebite treatment, we tested the efficacy of the common antivenom CroFab® for recognition of both adult and neonate venoms in vitro. This comparison revealed that many of the major protein families (SVMPs, CRISP, PLA2, serine proteases, and LAAO) in both neonate and adult venoms were immunodepleted by the antivenom, whereas myotoxins, one of the major toxic components of C. v. viridis venom, in addition to many of the small peptides, were not efficiently depleted by CroFab®. These results therefore provide a comprehensive catalog of the venom compounds present in C. v. viridis venom and new molecular insight into the potential efficacy of CroFab® against human envenomations by one of the most widely distributed rattlesnake species in North America. Comparative proteomic analysis of venoms of neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) from a discrete population in Colorado revealed a novel pattern of ontogenetic shifts in toxin composition for viperid snakes. The observed stage-dependent decrease of the relative content of disintegrins, catalytically active D49-PLA2s

  18. Rattlesnake Envenomation in Three Dairy Goats

    Directory of Open Access Journals (Sweden)

    Joseph Smith

    2015-01-01

    Full Text Available Cases of rattlesnake envenomation in dairy goats are lacking. These cases present three dairy goats presented to a veterinary referral hospital for envenomation of Northern Pacific Rattlesnake (Crotalus oreganus. Treatments and clinical characteristics reported are similar to those for llamas, alpacas, and horses. These cases suggest that quick treatment in the event of a bite may have a more favorable clinical response. Existing rattlesnake bite scoring systems applicable to other species may be applicable to goats, and existing respiratory pathology may predispose goats to a less favorable outcome.

  19. cDNA and deduced primary structure of basic phospholipase A2 with neurotoxic activity from the venom secretion of the Crotalus durissus collilineatus rattlesnake

    Directory of Open Access Journals (Sweden)

    F.H.R. Fagundes

    2010-03-01

    Full Text Available To illustrate the construction of precursor complementary DNAs, we isolated mRNAs from whole venom samples. After reverse transcription polymerase chain reaction (RT-PCR, we amplified the cDNA coding for a neurotoxic protein, phospholipase A2 D49 (PLA2 D49, from the venom of Crotalus durissus collilineatus (Cdc PLA2. The cDNA encoding Cdc PLA2 from whole venom was sequenced. The deduced amino acid sequence of this cDNA has high overall sequence identity with the group II PLA2 protein family. Cdc PLA2 has 14 cysteine residues capable of forming seven disulfide bonds that characterize this group of PLA2 enzymes. Cdc PLA2 was isolated using conventional Sephadex G75 column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC. The molecular mass was estimated using matrix-assisted laser desorption ionization-time-of-flight (MALDI-TOF mass spectrometry. We tested the neuromuscular blocking activities on chick biventer cervicis neuromuscular tissue. Phylogenetic analysis of Cdc PLA2 showed the existence of two lines of N6-PLA2, denominated F24 and S24. Apparently, the sequences of the New World’s N6-F24-PLA2 are similar to those of the agkistrodotoxin from the Asian genus Gloydius. The sequences of N6-S24-PLA2 are similar to the sequence of trimucrotoxin from the genus Protobothrops, found in the Old World.

  20. Male Snakes Allocate Time and Energy according to Individual Energetic Status: Body Condition, Steroid Hormones, and Reproductive Behavior in Timber Rattlesnakes, Crotalus horridus.

    Science.gov (United States)

    Lind, Craig M; Beaupre, Steven J

    2015-01-01

    Life-history theory predicts that organisms will hedge current reproductive investment against potential costs in terms of survivorship and future fecundity. However, little is known regarding the endocrine mechanisms underlying bet-hedging strategies in free-ranging male vertebrates. We examined the relationships among individual energetic status, steroid hormones, mate search, and reproductive behavior in free-ranging male timber rattlesnakes. Snakes were monitored over four active seasons in order to test two hypotheses: (1) males adjust the amount of time and energy allocated toward reproduction according to the level of individual energy stores, and (2) observed condition-dependent reproductive allocation is associated with circulating concentrations of steroid hormones (testosterone and corticosterone) thought to regulate reproductive behaviors in vertebrates. A positive relationship between body condition and testosterone was observed in both the field and the laboratory. Male mate search effort was positively correlated with both body condition and testosterone. Body condition and testosterone concentrations were negatively related to time allocated toward foraging during the breeding season. A strong effect of year was observed in the analysis of testosterone and search effort, suggesting that multiple environmental factors impact hormone production and reproductive investment. Corticosterone was not related to any measured variable. Therefore, our results did not indicate a clear role of corticosterone in mediating observed relationships between energetic status and behavior. Observed relationships are consistent with the hypothesis that males allocate time and energy toward reproduction according to individual energetic status and that testosterone plays a role in mediating the trade-off between current reproductive investment and residual reproductive value.

  1. A study of bacterial contamination of rattlesnake venom

    Directory of Open Access Journals (Sweden)

    E. Garcia-Lima

    1987-03-01

    Full Text Available The authors studied the bacterial contamination of rattlesnake venom isolated from snakes in captivity and wild snakes caught recently. The captive snakes showed a relatively high incidence of bacterial contamination of their venom.

  2. Prairie rattlesnake envenomation in 27 New World camelids.

    Science.gov (United States)

    Sonis, J M; Hackett, E S; Callan, R J; Holt, T N; Hackett, T B

    2013-01-01

    Morbidity and case fatality from rattlesnake envenomation is regionally specific because of variability in relative toxicity of the species of snake encountered. A previous report of rattlesnake envenomation in New World camelids (NWC) from the western coastal United States documented high case fatality rates and guarded prognosis for survival. To describe clinical findings, treatments, and outcome of NWC with prairie rattlesnake (Crotalus viridis viridis) envenomation in the Rocky Mountain region of the United States. Twenty-seven NWC admitted to the Colorado State University Veterinary Teaching Hospital for evaluation of acute rattlesnake envenomation between 1992 and 2012. Medical records of NWC evaluated for rattlesnake envenomation as coded by the attending clinician and identified by a database search were reviewed retrospectively. Month of admission, signalment, area of bite, clinical and clinicopathologic data, treatments, and outcome were recorded. Twenty-five llamas and 2 alpacas were admitted for envenomation. Llamas were overrepresented compared to hospital caseload. The face was the most common site of envenomation, observed in 96% of recorded cases. Presenting clinical signs included fever, tachypnea, tachycardia, and respiratory distress. Nine animals required a tracheotomy. Median hospitalization time was 3 days and overall survival rate was 69%. Case fatality rate for prairie rattlesnake envenomation in NWC was lower than that reported in the Western coastal region of the United States and similar to that reported for prairie rattlesnake envenomation in horses. Copyright © 2013 by the American College of Veterinary Internal Medicine.

  3. A comparative analysis of hemolithic activity between Cortalus molossus and Crotalus molossus nigrescens subespecies

    Directory of Open Access Journals (Sweden)

    Martínez-Martínez, A.

    2014-01-01

    Full Text Available Blacktailed rattlesnake (Crotalus molossus has four subspecies distributed in México; two of them are distributed in Chihuahua. Literature shows that few studies have been done in order to analyze the composition of their venom. Therefore, this study was carried out to evaluate protein content and hemolytic damage by agarose-human erythrocyte substrate between the Crotalus molossus nigrescens and Crotalus molossus molossus subspecies. Mann Whitney’s nonparanteric test was used in order to get the statistics analysis at an IC95. Protein concentration of Crotalus m. nigrescens was 466 ± 35.0 mg mL-1 and Crotalus m. molossus of 449 ± 90.0 mg mL-1 there was no statistical difference detected at IC95 (p>0.05. The protein profile of the venom of Crotalus m. nigrescens showed two protein bands with elevated masses approximately 230 kDa in comparison with Crotalus m. molossus that was of 16 kDa approximately. Crotalus m. nigrescens’s venom was 18 % more hemolytic (156.7±23.33 UHD than Crotalus m. molossus’s (128±23.32 UHD at the first hour and 20 % more hemolytic at the second hour, with UHD values of 116.7 ± 12.3 and 94 ± 9.8, respectively. The venom of the two subspecies did not show differences statistically at an IC95 at the first hour (p>0.05 and second hour (p>0.05. It could be concluded that two subspecies samples showed iqual proteomic characteristics. These differences can be attributed to the different eating habits due to the altitude, geographical distribution and the season. It can also be concluded that more investigation regarding venom of rattlesnakes is needed.

  4. Immunohistochemical changes in kidney glomerular and tubular proteins caused by rattlesnake (Crotalus vegrandis venom Cambios inmunohistoquímicos en proteínas de túbulo y glomérulo renal causadas por el veneno de la serpiente de cascabel (Crotalus vegrandis

    Directory of Open Access Journals (Sweden)

    María E. Girón

    2003-10-01

    Full Text Available Renal damage is an important cause of death in patients who have survived the early effects of severe crotalid envenomation. Extracellular matrix of renal tissue is altered by Crotalus toxin activities. The aim of this study was to describe how cytoskeletal proteins and basal membrane components undergo substantial alterations under the action of Crotalus vegrandis crude venom and its hemorrhagic fraction (Uracoina-1 in mice. To detect the proteins in question, the immunoperoxidase method with monoclonal and polyclonal antibodies was used. Cell types within renal lesions were characterized by phenotypic identification, by means of immunohistologic analysis of marker proteins using different primary antibodies against mesangial cells, endothelial cells, cytoskeletal proteins (intermediate filament, extracellular matrix and basal membranes. Samples for morphological study by standard procedures (biotin-streptavidin-peroxidase technique using light microscopy were processed. Positive and negative controls for each antigen tested in the staining assay were included. After crude venom and hemorrhagic fraction inoculation of mice, the disappearance of cytoskeletal vimentin and desmin and collagen proteins in the kidney was observed. In extracellular matrix and basal membranes, collagen type IV from envenomed animals tends to disappear from 24 h to 120 h after venom injection.El daño renal es una causa importante de muerte en pacientes que sobreviven a los efectos iniciales de los severos envenenamientos crotálicos. El objetivo de este estudio ha sido el describir como las proteínas del citoesqueleto y los componentes de membrana basal muestran alteraciones importantes en su manifestación, bajo la acción del veneno crudo de Crotalus vegrandis y una fracción hemorrágica (Uracoina-1 del mismo veneno ya que, la matriz extracelular del tejido renal es alterada por la actividad de estas toxinas. Para detectar las proteínas en cuestión se utiliz

  5. A Comparison of the Crystal Structures of Phospholipase A2 from Bovine Pancreas and Crotalus atrox Venom

    NARCIS (Netherlands)

    RENETSEDER, R; BRUNIE, S; DRENTH, J; SIGLER, PB

    1985-01-01

    The refined high resolution crystal structure of the bovine phospholipase A2 was compared with its counterpart from the venom of Crotalus atrox, the western diamondbacked rattlesnake. The strong similarity in their backbone conformations forms the basis of a common numbering system for the amino

  6. Assessing the influence of mechanical ventilation on blood gases and blood pressure in rattlesnakes

    DEFF Research Database (Denmark)

    Bertelsen, Mads Frost; Buchanan, Rasmus; Jensen, Heidi Meldgaard

    2014-01-01

    OBJECTIVE: To characterize the impact of mechanical positive pressure ventilation on heart rate (HR), arterial blood pressure, blood gases, lactate, glucose, sodium, potassium and calcium concentrations in rattlesnakes during anesthesia and the subsequent recovery period. STUDY DESIGN: Prospective......, randomized trial. ANIMALS: Twenty one fasted adult South American rattlesnakes (Crotalus durissus terrificus). METHODS: Snakes were anesthetized with propofol (15 mg kg(-1) ) intravenously, endotracheally intubated and assigned to one of four ventilation regimens: Spontaneous ventilation, or mechanical...... with significantly elevated glucose, lactate and potassium concentrations compared to values at 24 hours (p ventilation frequency (p Mechanical ventilation had a profound impact...

  7. Preliminary Fractionation of Tiger Rattlesnake (Crotalus tigris) Venom

    Science.gov (United States)

    1990-01-31

    yield (average 10 mg per snake ), the venom is highly toxiL and contains high concentrations of several neurotoxic isotoxins. K,, . , S 20. DIST BUTION...has a low venom yield (average 10 mg per snake ), the venom is highly toxic and contains high concentrations of several neurotoxic isotoxins. AcCe,o...sciluatus, f mitchelLrnitcbheli and c! lrirUS tenatu.5, all of which secruled distinc.lively polent venon s when compared with other North American

  8. Is the population of Crotalus durissus (Serpentes, Viperidae) expanding in Brazil?

    Science.gov (United States)

    2013-01-01

    Crotalus durissus are found from Mexico to northern Argentina in a highly disjunct distribution. According to some studies, this species is prone to occupy areas disturbed by human activities and floods comprise a plausible method of dispersal as inferred for some North American rattlesnakes. Based on the literature, it seems plausible that Crotalus durissus expanded their natural distribution in Brazil due to floods, but only in a few municipalities in Rio de Janeiro State. Data entries of Butantan Institute, in São Paulo, Brazil, from 1998 to 2012 show a declining tendency of snakes brought by donors. In addition, research shows no evidence of Crotalus durissus being an expanding species in the Brazilian territory. PMID:24314146

  9. Facial diplegia, pharyngeal paralysis, and ophthalmoplegia after a timber rattlesnake envenomation.

    Science.gov (United States)

    Madey, Jason J; Price, Amanda B; Dobson, Joseph V; Stickler, David E; McSwain, S David

    2013-11-01

    The timber rattlesnake, also known as Crotalus horridus, is well known to cause significant injury from toxins stored within its venom. During envenomation, toxic systemic effects immediately begin to cause damage to many organ systems including cardiovascular, hematologic, musculoskeletal, respiratory, and neurologic. One defining characteristic of the timber rattlesnake is a specific neurotoxin called crotoxin, or the "canebrake toxin," which is a potent β-neurotoxin affecting presynaptic nerves that can cause paralysis by inhibiting appropriate neuromuscular transmission. We present an unusual case of an 8-year-old boy bitten twice on his calf by a timber rattlesnake, who presented with a life-threatening envenomation and suffered multisystem organ failure as well as a prominent presynaptic neurotoxicity resulting in facial diplegia, pharyngeal paralysis, and ophthalmoplegia.

  10. Bioquímica plasmática de cascavéis (Caudisona durissa LINNAEUS, 1758 em cativeiro Blood biochemical parameters from captivity rattlesnake (Caudisona durissa LINNAEUS, 1758

    Directory of Open Access Journals (Sweden)

    Wellington Bandeira da Silva

    2010-12-01

    Full Text Available Acidentes com seres humanos envolvendo a espécie Caudisona durissa possuem a mais alta taxa de letalidade dentre os viperídeos brasileiros. Ressalta-se então a importância para a saúde pública da criação dessa espécie em cativeiro para produção de soro antiofídico. No entanto, essa atividade ainda hoje encontra alguns desafios como a instalação de doenças no plantel, evidenciando a importância de estudos sobre a fisiologia de serpentes. Dessa forma, foram realizadas análises de bioquímica plasmática em 53 serpentes da espécie Caudisona durissa, mantidas em cativeiro. Foram utilizadas amostras de plasma com heparina e as dosagens bioquímicas realizadas em aparelho automatizado (Ciba Corning - Express Plus®. Os resultados e seus respectivos desvios-padrões foram: uréia -1,32mg dL-1 (±1,1; ácido úrico - 2,08mg dL-1 (±1,4; creatinina - 0,52mg dL-1 (±0,2; proteína total - 3,7g dL-1 (±0,7; albumina - 1,62g dL-1 (±0,4; globulinas - 2,08g dL-1 (±0,5; cálcio - 15,25mg dL-1 (±2,8; fósforo - 4,61mg dL-1 (±1,9; colesterol - 171,58mg dL-1 (±52,7; triglicerídeos - 19,29mg dL-1 (±14,3; fosfatase alcalina - 31,04U L-1 (±12,4; aspartato aminotransferase (AST - 22,25U L-1 (±11,4; alanina aminotransferase (ALT - 7,11U L-1 (±5,4 e Amilase - 1385,23U L-1 (±568,7. Foram calculados os seguintes índices: relação uréia/creatinina - 2,5 e relação cálcio/fósforo - 3,3. O conjunto de resultados das análises bioquímicas do sangue das cascavéis em cativeiro pode servir como referência para apoio diagnóstico na espécie estudada e para outros trabalhos com o mesmo caráter de observação.Human accidents involving rattlesnake Caudisona durissa have the highest fatality rate among the Brazilian Viperidae family. Breeding this specie in captivity in order to produce antivenoms is very important to public health. Nevertheless, there are some challenges that this activity must face, like the onset of diseases on the

  11. A study of bacterial contamination of rattlesnake venom

    Directory of Open Access Journals (Sweden)

    E. Garcia-Lima

    1987-03-01

    Full Text Available The authors studied the bacterial contamination of rattlesnake venom isolated from snakes in captivity and wild snakes caught recently. The captive snakes showed a relatively high incidence of bacterial contamination of their venom.Os autores estudaram a contaminação bacteriana do veneno dë cascavéis mantidas em cativeiro e das recentemente capturadas. Verificaram que os venenos dos animais cativos apresentaram alta incidência de contaminação e os tidos como recentemente capturados estavam com baixa contaminação aparente.

  12. The effects of hybridization on divergent venom phenotypes: Characterization of venom from Crotalus scutulatus scutulatus × Crotalus oreganus helleri hybrids.

    Science.gov (United States)

    Smith, Cara Francesca; Mackessy, Stephen P

    2016-09-15

    Hybridization between divergent species can be analyzed to elucidate expression patterns of distinct parental characteristics, as well as to provide information about the extent of reproductive isolation between species. A known hybrid cross between two rattlesnakes with highly divergent venom phenotypes provided the opportunity to examine occurrence of parental venom characteristics in the F1 hybrids as well as ontogenetic shifts in the expression of these characters as the hybrids aged. Although venom phenotypes of adult rattlesnake venoms are known for many species, the effect of hybridization on phenotype inheritance is not well understood, and effects of hybridization on venom ontogeny have not yet been investigated. The current study investigates both phenomena resulting from the hybridization of a male snake with type I degradative venom, Crotalus oreganus helleri (Southern Pacific Rattlesnake), and a female snake with type II highly toxic venom, Crotalus scutulatus scutulatus (Mojave Rattlesnake). SDS-PAGE, enzymology, Western blot and reversed phase HPLC (RP-HPLC) were used to characterize the venom of the C. o. helleri male, the C. s. scutulatus female and their two hybrid offspring as they aged. In general, Crotalus o. helleri × C. s. scutulatus hybrid venoms appeared to exhibit overlapping parental venom profiles, and several different enzyme activity patterns. Both hybrids expressed C. o. helleri father-specific myotoxins as well as C. s. scutulatus mother-specific Mojave toxin. Snake venom metalloprotease activity displayed apparent sex-influenced expression patterns, while hybrid serine protease activities were intermediate to parental activities. The C. s. scutulatus × C. o. helleri hybrid male's venom profile provided the strongest evidence that type I and type II venom characteristics are expressed simultaneously in hybrid venoms, as this snake contained distinctive characteristics of both parental species. However, the possibility of

  13. Molecular exclusion chromatographic analysis on 60Co irradiated rattlesnake

    International Nuclear Information System (INIS)

    Murata, Y.; Rogero, J.R.

    1988-07-01

    Ionizing radiations are sufficiently energetic to be able of breaking chemical bonds and as result of that molecules of substances present in the irradiated will be chemically changed and their biological properties affected also. In this paper the effects of gamma radiation of Co-60 on the rattlesnake venom were studied. A pool of positive crotamina Crotalus durissus terrificus venom was dissolved in 0,15 M NaCl and irradiated with Co-60. Doses of 100, 250, 500, 750, 1500 and 2000 Gy were applied at the dose rate of 1190 Gy/h. With doses over 500 Gy the solutions became turbid, suggesting the presence of aggregates and structural changes of the proteins. The concentration of proteins from the filtered solution was measured by the Lowry method. One ml samples were measured at 230 nm. The partition coefficients and the areas of the three main fraction obtained were calculated. (author) [pt

  14. Ground squirrels use an infrared signal to deter rattlesnake predation.

    Science.gov (United States)

    Rundus, Aaron S; Owings, Donald H; Joshi, Sanjay S; Chinn, Erin; Giannini, Nicolas

    2007-09-04

    The evolution of communicative signals involves a major hurdle; signals need to effectively stimulate the sensory systems of their targets. Therefore, sensory specializations of target animals are important sources of selection on signal structure. Here we report the discovery of an animal signal that uses a previously unknown communicative modality, infrared radiation or "radiant heat," which capitalizes on the infrared sensory capabilities of the signal's target. California ground squirrels (Spermophilus beecheyi) add an infrared component to their snake-directed tail-flagging signals when confronting infrared-sensitive rattlesnakes (Crotalus oreganus), but tail flag without augmenting infrared emission when confronting infrared-insensitive gopher snakes (Pituophis melanoleucus). Experimental playbacks with a biorobotic squirrel model reveal this signal's communicative function. When the infrared component was added to the tail flagging display of the robotic models, rattlesnakes exhibited a greater shift from predatory to defensive behavior than during control trials in which tail flagging included no infrared component. These findings provide exceptionally strong support for the hypothesis that the sensory systems of signal targets should, in general, channel the evolution of signal structure. Furthermore, the discovery of previously undescribed signaling modalities such as infrared radiation should encourage us to overcome our own human-centered sensory biases and more fully examine the form and diversity of signals in the repertoires of many animal species.

  15. Year End Progress Report on Rattlesnake Improvements

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yaqi [Idaho National Lab. (INL), Idaho Falls, ID (United States); DeHart, Mark David [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gleicher, Frederick Nathan [Idaho National Lab. (INL), Idaho Falls, ID (United States); Ortensi, Javier [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schunert, Sebastian [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    Rattlesnake is a MOOSE-based radiation transport application developed at INL to support modern multi-physics simulations. At the beginning of the last year, Rattlesnake was able to perform steady-state, transient and eigenvalue calculations for the multigroup radiation transport equations. Various discretization schemes, including continuous finite element method (FEM) with discrete ordinates method (SN) and spherical harmonics expansion method (PN) for the self-adjoint angular flux (SAAF) formulation, continuous FEM (CFEM) with SN for the least square (LS) formulation, diffusion approximation with CFEM and discontinuous FEM (DFEM), have been implemented. A separate toolkit, YAKXS, for multigroup cross section management was developed to support Rattlesnake calculations with feedback both from changes in the field variables, such as fuel temperature, coolant density, and etc., and in isotope inventory. The framework for doing nonlinear diffusion acceleration (NDA) within Rattlesnake has been set up, and both NDA calculations with SAAF-SN-CFEM scheme and Monte Carlo with OpenMC have been performed. It was also used for coupling BISON and RELAP-7 for the full-core multiphysics simulations. Within the last fiscal year, significant improvements have been made in Rattlesnake. Rattlesnake development was migrated into our internal GITLAB development environment at the end of year 2014. Since then total 369 merge requests has been accepted into Rattlesnake. It is noted that the MOOSE framework that Rattlesnake is based on is under continuous developments. Improvements made in MOOSE can improve the Rattlesnake. It is acknowledged that MOOSE developers spent efforts on patching Rattlesnake for the improvements made on the framework side. This report will not cover the code restructuring for better readability and modularity and documentation improvements, which we have spent tremendous effort on. It only details some of improvements in the following sections.

  16. A taxonomic bibliography of the South American snakes of the Crotalus durissus complex (Serpentes, Viperidae

    Directory of Open Access Journals (Sweden)

    VANZOLINI PAULO E.

    2002-01-01

    Full Text Available A survey is made of the taxonomic literature on South American rattlesnakes (genus Crotalus, family Viperidae. Two main areas are emphasized: the attribution of the names proposed in the eighteenth century by Linnaeus and Laurenti, and the current scheme of division in subspecies. The attribution of names is examined based on the original descriptions and on relevant previous and contemporary literature. The presently adopted scheme, proposed by Klauber (1941, 1972 is found not entirely satisfactory, but reasonable enough - besides being hallowed by use. The scheme of geographical differentiation, intrinsically important and with broad practical implications (differentiation of the venom is found to be the culmination of a long series of deficient analyses, and in urgent need of proper investigation.

  17. Structures and functions of crotoxin-like heterodimers and acidic phospholipases A2 from Gloydius intermedius venom: Insights into the origin of neurotoxic-type rattlesnakes.

    Science.gov (United States)

    Yang, Zhang-Min; Guo, Qian; Ma, Zhao-Rui; Chen, Yu; Wang, Zhe-Zhi; Wang, Xu-Min; Wang, Ying-Ming; Tsai, Inn-Ho

    2015-01-01

    The cDNAs encoding four major phospholipases A2 (PLA2s) were sequenced while the expressed sequence tags of Gloydius intermedius venom glands were constructed. These PLA2s were designated as Gintexin-A precursor, Gintexin-B, Gin-E6a and Gin-E6b, respectively. The deduced amino acid sequences of the former two PLA2s are 80% and 90% identical to those of crotoxin-A-precursor and crotoxin-B1, respectively. We also purified Gintexin-A, Gintexin-B, Gin-E6a and Gin-E6b like PLA2 from the venom. The latter three PLA2s are enzymatically active but not strongly anticoagulant for human plasma. Gin-E6a and E6b-like PLA2s induced mouse platelet aggregation but inhibited rabbit platelet aggregation. The isolated Gintexin, a 1:1 complex of Gintexin-A and Gintexin-B, blocked the twitch of chick biventer cervicis tissue presynaptically. Results of N-terminal sequencing and peptide mass fingerprinting reveal that Gintexin-A undergoes proteolytic processing similar to crotoxin-A. This is the first time heterodimeric β-neurotoxins are found in Asian pitviper venom, and incompatible neurotoxic- and hemorrhagic-type venoms are found to evolve in parallel within the genus Gloydius, like in Crotalus. Thus, G. intermedius probably is the ancestor of rattlesnakes with type-II venom, and characterization of its venomics helps us to understand the evolution of heterodimeric neurotoxic PLA2s and the paedomorphic trend observed in Neotropical rattlesnake venoms. For the first time, a heterodimeric neurotoxic PLA2 (designated as Gintexin) has been isolated from the venom of an Asian pitviper, which shows a characteristic venom gland transcriptome similar to those of the neurotoxic type rattlesnakes. The fact that the venom of G. intermedius is less hemorrhagic than those of other Gloydius species, reveals that incompatible neurotoxic- and hemorrhagic-type venoms have evolved in parallel within the genus Gloydius, like the genus Crotalus. Our findings suggest that G. intermedius is the most

  18. Inhibition of Lung Tumor Colonization and Cell Migration with the Disintegrin Crotatroxin 2 Isolated from the Venom of Crotalus atrox

    Science.gov (United States)

    Galán, Jacob A.; Sánchez, Elda E.; Rodríguez-Acosta, Alexis; Soto, Julio G.; Bashir, Sajid; McLane, Mary Ann; Paquette-Straub, Carrie; Pérez, John C.

    2009-01-01

    Disintegrins are low molecular weight proteins (4-15 kDa) with an RGD binding region at their binding loop. Disintegrin and disintegrin-like proteins are found in the venom of four families of snakes: Atractaspididae, Elapidae, Viperidae and Colubridae. This report describes the biological activity of a disintegrin, crotatroxin 2, isolated by a three-step chromatography procedure from the venom of the Western diamondback rattlesnake (Crotalus atrox). The intact molecular mass for crotatroxin 2 was 7.384 kDa and 71 amino acids. Crotatroxin 2 inhibited human whole blood platelet aggregation with an IC50 of 17.5 nM, inhibited cell (66.3p) migration by 63%, and inhibited experimental lung tumor colonization in BALB/c mice at 1000 μg/kg. Our data suggest that while crotatroxin 2 inhibits platelet aggregation, cancer cell migration, and lung tumor colonization it is done via different integrins. PMID:18387648

  19. Rattlesnake envenomation in 12 New World camelids.

    Science.gov (United States)

    Dykgraaf, Susanne; Pusterla, Nicola; Van Hoogmoed, Linda M

    2006-01-01

    Rattlesnake envenomation of New World camelids is a seasonal problem with often dramatic clinical signs. The purpose of this study was to identify the clinical signs, laboratory results, treatment methods, and outcome for rattlesnake envenomation in New World camelids. Medical records from 1988 to 2004 were searched for New World camelids presented for rattlesnake bite or clinical signs suspected to be related to recent envenomation. Twelve records were identified. From these records a retrospective study was performed. Nine camelids presented for acute disease (2/9 arrived dead), whereas 3 presented for subacute onset of disease. Swelling of the lips, head and neck, tachypnea, dyspnea, tachycardia, and lethargy were the most common presenting signs. Snake bites were most commonly located to the muzzle (10/12). Common complete blood count (CBC) and serum biochemical abnormalities were neutrophilia, lymphopenia, increased muscle enzyme activity, hypoalbuminemia, hyperglycemia, hypokalemia, and thrombocytopenia. Treatment included combinations of intravenous fluid therapy, antimicrobials, anti-inflammatory drugs, tetanus prophylaxis, tracheostomy, supplemental oxygen, antivenom, total parenteral nutrition, and nursing care. Five of the 10 animals with acute onset of clinical signs survived, and all animals with subacute presentation died. The mortality rate for New World camelids with severe local tissue reaction and systemic signs of envenomation was 58%. New World camelids that sustain rattlesnake envenomation and severe facial swelling precluding prehension and mastication have a guarded prognosis for survival. Aggressive treatment is recommended to optimize the chances of survival. Animals with less severe local tissue reaction and absence of systemic signs have a better prognosis.

  20. Biological and Proteolytic Variation in the Venom of Crotalus scutulatus scutulatus from Mexico

    Directory of Open Access Journals (Sweden)

    Miguel Borja

    2018-01-01

    Full Text Available Rattlesnake venoms may be classified according to the presence/absence and relative abundance of the neurotoxic phospholipases A 2 s (PLA 2 s, such as Mojave toxin, and snake venom metalloproteinases (SVMPs. In Mexico, studies to determine venom variation in Mojave Rattlesnakes (Crotalus scutulatus scutulatus are limited and little is known about the biological and proteolytic activities in this species. Tissue (34 and venom (29 samples were obtained from C. s. scutulatus from different locations within their distribution in Mexico. Mojave toxin detection was carried out at the genomic (by PCR and protein (by ELISA levels for all tissue and venom samples. Biological activity was tested on representative venoms by measuring LD 50 and hemorrhagic activity. To determine the approximate amount of SVMPs, 15 venoms were separated by RP-HPLC and variation in protein profile and proteolytic activity was evaluated by SDS-PAGE (n = 28 and Hide Powder Azure proteolytic analysis (n = 27. Three types of venom were identified in Mexico which is comparable to the intraspecific venom diversity observed in the Sonoran Desert of Arizona, USA: Venom Type A (∼Type II, with Mojave toxin, highly toxic, lacking hemorrhagic activity, and with scarce proteolytic activity; Type B (∼Type I, without Mojave toxin, less toxic than Type A, highly hemorrhagic and proteolytic; and Type A + B, containing Mojave toxin, as toxic as venom Type A, variable in hemorrhagic activity and with intermediate proteolytic activity. We also detected a positive correlation between SVMP abundance and hemorrhagic and proteolytic activities. Although more sampling is necessary, our results suggest that venoms containing Mojave toxin and venom lacking this toxin are distributed in the northwest and southeast portions of the distribution in Mexico, respectively, while an intergradation in the middle of both zones is present.

  1. Western diamondback rattlesnakes demonstrate physiological and biochemical strategies for tolerating prolonged starvation.

    Science.gov (United States)

    McCue, Marshall D

    2007-01-01

    Because of the uncertainty in food resources in nature, all animals face the possibility of imposed periods of fasting (i.e., starvation) at some point in their lives. I investigated physiological and biochemical responses to starvation that occur in a species of rattlesnake known to tolerate successfully prolonged periods of starvation in the wild. Sixteen subadult Crotalus atrox were fasted for up to 24 wk under controlled conditions simulating their active season. Snakes exhibited significant reductions in plasma glucose but increased circulating ketone bodies. Fasting snakes lost mass at a linear rate and increased their relative moisture content during the experiment. The bodies of fasting snakes demonstrated an increase in their fatty acid (FA) unsaturation index and were apparently able to "spare" essential FAs effectively from beta -oxidation. Endogenous essential and nonessential amino acids were used indiscriminately to fuel energetic requirements, suggesting that essential amino acids are not preferentially spared during starvation. The (15)N signature of excreted nitrogenous waste increased significantly, presumably as a result of shifting amino acid source pools during starvation. Because our comparative knowledge of starvation physiology contains large taxonomic gaps, particularly with respect to amphibians and reptiles, an understanding of the biological responses exhibited by these animals may offer insight into the evolution of physiological strategies animals employ to cope with the pressures of starvation.

  2. Envenomations by Bothrops and Crotalus snakes induce the release of mitochondrial alarmins.

    Science.gov (United States)

    Zornetta, Irene; Caccin, Paola; Fernandez, Julián; Lomonte, Bruno; Gutierrez, José María; Montecucco, Cesare

    2012-01-01

    Skeletal muscle necrosis is a common manifestation of viperid snakebite envenomations. Venoms from snakes of the genus Bothrops, such as that of B. asper, induce muscle tissue damage at the site of venom injection, provoking severe local pathology which often results in permanent sequelae. In contrast, the venom of the South American rattlesnake Crotalus durissus terrificus, induces a clinical picture of systemic myotoxicity, i.e., rhabdomyolysis, together with neurotoxicity. It is known that molecules released from damaged muscle might act as 'danger' signals. These are known as 'alarmins', and contribute to the inflammatory reaction by activating the innate immune system. Here we show that the venoms of B. asper and C. d. terrificus release the mitochondrial markers mtDNA (from the matrix) and cytochrome c (Cyt c) from the intermembrane space, from ex vivo mouse tibialis anterior muscles. Cyt c was released to a similar extent by the two venoms whereas B. asper venom induced the release of higher amounts of mtDNA, thus reflecting hitherto some differences in their pathological action on muscle mitochondria. At variance, injection of these venoms in mice resulted in a different time-course of mtDNA release, with B. asper venom inducing an early onset increment in plasma levels and C. d. terrificus venom provoking a delayed release. We suggest that the release of mitochondrial 'alarmins' might contribute to the local and systemic inflammatory events characteristic of snakebite envenomations.

  3. Envenomations by Bothrops and Crotalus snakes induce the release of mitochondrial alarmins.

    Directory of Open Access Journals (Sweden)

    Irene Zornetta

    Full Text Available Skeletal muscle necrosis is a common manifestation of viperid snakebite envenomations. Venoms from snakes of the genus Bothrops, such as that of B. asper, induce muscle tissue damage at the site of venom injection, provoking severe local pathology which often results in permanent sequelae. In contrast, the venom of the South American rattlesnake Crotalus durissus terrificus, induces a clinical picture of systemic myotoxicity, i.e., rhabdomyolysis, together with neurotoxicity. It is known that molecules released from damaged muscle might act as 'danger' signals. These are known as 'alarmins', and contribute to the inflammatory reaction by activating the innate immune system. Here we show that the venoms of B. asper and C. d. terrificus release the mitochondrial markers mtDNA (from the matrix and cytochrome c (Cyt c from the intermembrane space, from ex vivo mouse tibialis anterior muscles. Cyt c was released to a similar extent by the two venoms whereas B. asper venom induced the release of higher amounts of mtDNA, thus reflecting hitherto some differences in their pathological action on muscle mitochondria. At variance, injection of these venoms in mice resulted in a different time-course of mtDNA release, with B. asper venom inducing an early onset increment in plasma levels and C. d. terrificus venom provoking a delayed release. We suggest that the release of mitochondrial 'alarmins' might contribute to the local and systemic inflammatory events characteristic of snakebite envenomations.

  4. Crystal structure of the platelet activator convulxin, a disulfide-linked alpha4beta4 cyclic tetramer from the venom of Crotalus durissus terrificus.

    Science.gov (United States)

    Murakami, M T; Zela, S P; Gava, L M; Michelan-Duarte, S; Cintra, A C O; Arni, R K

    2003-10-17

    Convulxin (CVX), a C-type lectin, isolated from the venom of the South American rattlesnake Crotalus durissus terrificus, causes cardiovascular and respiratory disturbances and is a potent platelet activator which binds to platelet glycoprotein GPVI. The structure of CVX has been solved at 2.4A resolution to a crystallographic residual of 18.6% (R(free)=26.4%). CVX is a disulfide linked heterodimer consisting of homologous alpha and beta chains. The heterodimers are additionally linked by disulfide bridges to form cyclic alpha(4)beta(4)heterotetramers. These domains exhibit significant homology to the carbohydrate-binding domains of C-type lectins, to the factor IX-binding protein (IX-bp), and to flavocetin-A (Fl-A) but sequence and structural differences are observed in both the domains in the putative Ca(2+)and carbohydrate binding regions.

  5. Isolation and characterization of delta toxin from the venom of Crotalus durissus terrificus; Isolamento e caracterizacao da delta toxina do veneno de Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Campos, Lucelia de Almeida

    2006-07-01

    The Crotalus durissus terrificus venom has been so far described as being of low complexity, with four major components described: convulxin, gyroxin, crotoxin and crotamine. In recent studies, other components of this venom were characterized as, for example, an analgesic factor. In 1980, Vital Brazil predicted the existence of a toxin which could be involved in platelet aggregation, and named it delta toxin. However, this toxin has never been isolated or characterized. The aim of the present work was to purify and characterize this toxin. After FPLC size exclusion chromatography followed by reverse phase HPLC, an homogeneous fraction was obtained, with a molecular weight of 14,074.92 Da. When analyzed by SOS-PAGE, this toxin presented an anomalous behavior, with a molecular weight of 14 kDa, while in 2D gels, spots around 40 kDa and with an isoelectrical point between 4 and 5 were observed suggesting isoforms with glicosilation microheterogeneity. After trypsin digestion, the fragments were submitted to the swissprot databank showing high homology (43% coverage, 15 matching peptides) with trocarin, a prothrombin activator from Tropidechis carinatus. These data were further confirmed by aminoacid analysis. The toxin was tested for its ability to activate factor II and X using synthetic substrates. Our data indicate a direct activation of factor X. The same toxin also behaved as a potent direct platelet aggregation activator on washed platelets. Assays with specific inhibitors indicate that neither metalloproteinase, nor serinoproteinase or t lectin domains are involved in the aggregating activity, since EDTA, benzamidin and D-galactose did not inhibit the toxin. In the present work, we were able to identify, purify and characterize a new toxin from the brazilian rattlesnake. It behaved as predicted by Vital-Brazil and displayed direct factor X activating properties, also inducing platelet aggregation, even at low concentrations. Our data also indicate that it is

  6. Afibrinogenemia following snake bite (Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    C. F. S. Amaral

    1988-08-01

    Full Text Available This paper reports two cases of afibrinogenemia with normal platelet count following Crotalus durissus terrificus, snake bite Both patients presented high output acute renal failure and case two also had increased blood levels of CPK and LDH compatible with the diagnosis of rhabdomyolysis. Case one was given an unknown amount of antivenom and was treated with epsilonaminocaproic acid and a fresh whole blood transfusion and showed recovery of the coagulation disturbance 40 hours following these measures. Case two was given an adequate amount of crotalide antivenom and the coagulation tests performed 12 hours later showed a normal partial thromboplastin time and fibrinogen 86 mg/100ml. Case one presented no haemorrhagic disturbances. Case two presented persistent bleeding following venopuncture and after removal of impetigo crust in the legs. Acute renal failure was treated conservatively and both patients were discharged from the hospital with recovery of the renal function.

  7. Isolation and characterization of delta toxin from the venom of Crotalus durissus terrificus

    International Nuclear Information System (INIS)

    Campos, Lucelia de Almeida

    2006-01-01

    The Crotalus durissus terrificus venom has been so far described as being of low complexity, with four major components described: convulxin, gyroxin, crotoxin and crotamine. In recent studies, other components of this venom were characterized as, for example, an analgesic factor. In 1980, Vital Brazil predicted the existence of a toxin which could be involved in platelet aggregation, and named it delta toxin. However, this toxin has never been isolated or characterized. The aim of the present work was to purify and characterize this toxin. After FPLC size exclusion chromatography followed by reverse phase HPLC, an homogeneous fraction was obtained, with a molecular weight of 14,074.92 Da. When analyzed by SOS-PAGE, this toxin presented an anomalous behavior, with a molecular weight of 14 kDa, while in 2D gels, spots around 40 kDa and with an isoelectrical point between 4 and 5 were observed suggesting isoforms with glicosilation microheterogeneity. After trypsin digestion, the fragments were submitted to the swissprot databank showing high homology (43% coverage, 15 matching peptides) with trocarin, a prothrombin activator from Tropidechis carinatus. These data were further confirmed by aminoacid analysis. The toxin was tested for its ability to activate factor II and X using synthetic substrates. Our data indicate a direct activation of factor X. The same toxin also behaved as a potent direct platelet aggregation activator on washed platelets. Assays with specific inhibitors indicate that neither metalloproteinase, nor serinoproteinase or t lectin domains are involved in the aggregating activity, since EDTA, benzamidin and D-galactose did not inhibit the toxin. In the present work, we were able to identify, purify and characterize a new toxin from the brazilian rattlesnake. It behaved as predicted by Vital-Brazil and displayed direct factor X activating properties, also inducing platelet aggregation, even at low concentrations. Our data also indicate that it is

  8. PROVENANCE SNAKES OF GENUS Bothrops AND Crotalus (VIPERIDAE CATALOGED IN SERPENTARIUM ZOO UNIVERSITY OF CAXIAS DO SUL (UCS

    Directory of Open Access Journals (Sweden)

    Ezequiel Capeletti

    2016-09-01

    Full Text Available Snakes are reptiles that have large environmental adaptations, which favored it's distribution among the various ecosystems. In Brazil, there are found 392 species of snakes, while in Rio Grande do Sul (RS, this research field, 79 species have been described, of which there is the Viperidae family. The objective of this work is to verify the origin of snakes of genus Bothrops and Crotalus, according to the records of the last 15 years of the serpentarium the University of Caxias do Sul, representing the first survey in captivity of the northeastern region of RS. By extension, we seek to investigate whether there is a relationship between the amount of snakes records and abiotic factors: precipitation, temperature and humidity during the period. The research was developed at UCS's serpentarium, by documental analysis of notebook records describing serpents entries between the years 2000 and 2014, in addition to literature review that helped to understand the distribution of the species and gather of the environmental parameters at the Instituto Nacional de Metereologia for further analysis. It was found that the received species are distributed in 26 cities in the RS state, of which the highlights are the municities of Nova Petrópolis and Caxias do Sul, with 148 and 42 individuals respectively. Further, it was found that there was no relationship between the amount of animals and registered temperature, precipitation and humidity. Keywords: Geographic distribution; Bothrops; Crotalus; abiotic factors; northeastern RS.

  9. Toxins from Crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Rogero, J.R.

    1979-01-01

    Phospholipase A, crotapotin and crotamine were purified from the venom of crotalus durissus terrificus. Molecular weigths were respectively estimated in 13400, 8300 and 4880. By sephadex gel filtration, stable complex is formed by interaction (1:1 molar ratio) of Phospholipase A (LD=0,55mg/Kg, in mice) and crotapotin, obtaining an increase in the toxicity of Phospholipase A in 10 fold to LD 50 =0,05mg/Kg. These facts indicate crotoxin as a product of 1:1 molar ratio interaction of crotapotin and Phospholipase A. By sephadex gel filtration an unstable complex is formed by interaction of crotapotin and crotamine (LD 50 =0,8mg/Kg, in mice), increasing the toxicity of crotamine approximately 4 fold to LD 50 =0,2mg/Kg. In tritium-hydrogen exchange experiments, the back exchange kinetic of these tritium labelled proteins were measured in gel filtration columns of sephadex G 25 'coarse' showing for Phospholipase A two clearly distinguishable kinetic classes of exchangeable hydrogens. From the exchangeable hydrogens only 68% were rapidly exchanged and the occurrence of hydrogens envolved in alpha-helix was practically absent. Crotapotin has no hydrogens of alpha-helix and 83% of exchangeable hydrogens were rapidly exchanged with solvent. Crotamine, after a initial heating in tritiated water showed that 31% of exchangeable hydrogens were slowly exchanged with solvent. After 18 hours of heating, that number diminished for 11%. Crotoxin showed three exponential classes of exchangeable hydrogens and about 26 protons have alpha-helix characteristic exchange rate. A possible conformational change after Phospholipase A - crotapotin interaction is suggested. (Author) [pt

  10. Avaliação da interação de compostos ativos hidratantes com modelo de biomembrana de Crotalus durissus por meio de calorimetria exploratória diferencial e espectroscopia RAMAN

    Directory of Open Access Journals (Sweden)

    MICHELE TAKAOKA

    2010-06-01

    Full Text Available O objetivo foi verificar as alterações no estrato córneo em modelos alternativos de membrana após a aplicação de ativos hidratantes envolvendo métodos biofísicos. O modelo de biomembrana utilizado foi a muda de pele de Crotalus durissus e os ativos hidratantes foram: uréia, silício orgânico, extrato vegetal de Imperata cylindrica, reação de xilitol e glicose e componentes de NMF. Os resultados da avaliação das alterações do modelo por meio de Espectroscopia Raman com Transformada de Fourier sugerem que os ativos hidratantes confirmam segurança necessária, pois não alteraram de forma acentuada a estrutura do estrato córneo. Utilizando-se Calorimetria Exploratória Diferencial pode-se indicar que a solução de silício orgânico e o gel hidrofílico com uréia apresentaram melhor poder hidratante. Palavras-chave: Estrato córneo. Hidratação. Métodos biofísicos. Crotalus durissus. FT-Raman, DSC. ABSTRACT Study of the interaction of moisturizers with a Crotalus durissus biomembrane by differential scanning calorimetry and RAMAN spectroscopy The objective of this research was to use biophysical techniques to investigate the alterations induced in a biomembrane model of the stratum corneum by the application of moisturizers. The biomembrane was obtained from the skin shed by the rattlesnake Crotalus durissus and the active moisturizing compounds were: urea, dimethylsilanol hyaluronate, Imperata cylindrical plant extract, carbohydrates and natural moisturizing factors (NMF components. Results from FT-Raman spectroscopy suggested that the moisturizers were safe, since they did not promote modifications in the structure of the stratum corneum. Differential scanning calorimetry results indicated that the solution containing the organic silicon compound and the gel with urea showed the best hydrating effects on the stratum corneum. Keywords: Stratum corneum. Hydration. Biophysical techniques. Crotalus durissus

  11. Preliminary Results for the OECD/NEA Time Dependent Benchmark using Rattlesnake, Rattlesnake-IQS and TDKENO

    Energy Technology Data Exchange (ETDEWEB)

    DeHart, Mark D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mausolff, Zander [Univ. of Florida, Gainesville, FL (United States); Weems, Zach [Univ. of Florida, Gainesville, FL (United States); Popp, Dustin [Univ. of Florida, Gainesville, FL (United States); Smith, Kristin [Univ. of Florida, Gainesville, FL (United States); Shriver, Forrest [Univ. of Florida, Gainesville, FL (United States); Goluoglu, Sedat [Univ. of Florida, Gainesville, FL (United States); Prince, Zachary [Texas A & M Univ., College Station, TX (United States); Ragusa, Jean [Texas A & M Univ., College Station, TX (United States)

    2016-08-01

    One goal of the MAMMOTH M&S project is to validate the analysis capabilities within MAMMOTH. Historical data has shown limited value for validation of full three-dimensional (3D) multi-physics methods. Initial analysis considered the TREAT startup minimum critical core and one of the startup transient tests. At present, validation is focusing on measurements taken during the M8CAL test calibration series. These exercises will valuable in preliminary assessment of the ability of MAMMOTH to perform coupled multi-physics calculations; calculations performed to date are being used to validate the neutron transport solver Rattlesnake\\cite{Rattlesnake} and the fuels performance code BISON. Other validation projects outside of TREAT are available for single-physics benchmarking. Because the transient solution capability of Rattlesnake is one of the key attributes that makes it unique for TREAT transient simulations, validation of the transient solution of Rattlesnake using other time dependent kinetics benchmarks has considerable value. The Nuclear Energy Agency (NEA) of the Organization for Economic Cooperation and Development (OECD) has recently developed a computational benchmark for transient simulations. This benchmark considered both two-dimensional (2D) and 3D configurations for a total number of 26 different transients. All are negative reactivity insertions, typically returning to the critical state after some time.

  12. Timber rattlesnakes and Louisiana pine snakes of the West Gulf Coastal Plain: hypotheses of decline

    Science.gov (United States)

    D. Craig Rudolph; Shirley J. Burgdorf

    1997-01-01

    Timber rattlesnakes (Croatlus horridus) and Louisiana pine snakes (Pituophis melanoleucus ruthveni) are large-bodies snakes occurring on the West Gulf Coastal Plain. Both species are thoguht to be declining due to increasing habitat alteration. Timber rattlesnakes occur in closed canopy hardwood and pine-hardwood forests, and...

  13. Physiological importance of the coronary arterial blood supply to the rattlesnake heart

    DEFF Research Database (Denmark)

    Hagensen, Mette; Abe, Augusto S.; Falk, Erling

    2008-01-01

    Pa and 58.2±2.2 beats min-1, respectively, during activity and the ECG was not affected. This was not different from sham-operated snakes. Thus, while the outer compact layer of the rattlesnake heart clearly has an extensive coronary supply, rattlesnakes sustain a high blood pressure and heart rate during...

  14. Minimum area thresholds for rattlesnakes and colubrid snakes on islands in the Gulf of California, Mexico.

    Science.gov (United States)

    Meik, Jesse M; Makowsky, Robert

    2018-01-01

    We expand a framework for estimating minimum area thresholds to elaborate biogeographic patterns between two groups of snakes (rattlesnakes and colubrid snakes) on islands in the western Gulf of California, Mexico. The minimum area thresholds for supporting single species versus coexistence of two or more species relate to hypotheses of the relative importance of energetic efficiency and competitive interactions within groups, respectively. We used ordinal logistic regression probability functions to estimate minimum area thresholds after evaluating the influence of island area, isolation, and age on rattlesnake and colubrid occupancy patterns across 83 islands. Minimum area thresholds for islands supporting one species were nearly identical for rattlesnakes and colubrids (~1.7 km 2 ), suggesting that selective tradeoffs for distinctive life history traits between rattlesnakes and colubrids did not result in any clear advantage of one life history strategy over the other on islands. However, the minimum area threshold for supporting two or more species of rattlesnakes (37.1 km 2 ) was over five times greater than it was for supporting two or more species of colubrids (6.7 km 2 ). The great differences between rattlesnakes and colubrids in minimum area required to support more than one species imply that for islands in the Gulf of California relative extinction risks are higher for coexistence of multiple species of rattlesnakes and that competition within and between species of rattlesnakes is likely much more intense than it is within and between species of colubrids.

  15. Preliminary Results for the OECD/NEA Time Dependent Benchmark using Rattlesnake, Rattlesnake-IQS and TDKENO

    International Nuclear Information System (INIS)

    DeHart, Mark D.; Mausolff, Zander; Weems, Zach; Popp, Dustin; Smith, Kristin; Shriver, Forrest; Goluoglu, Sedat; Prince, Zachary; Ragusa, Jean

    2016-01-01

    One goal of the MAMMOTH M&S project is to validate the analysis capabilities within MAMMOTH. Historical data has shown limited value for validation of full three-dimensional (3D) multi-physics methods. Initial analysis considered the TREAT startup minimum critical core and one of the startup transient tests. At present, validation is focusing on measurements taken during the M8CAL test calibration series. These exercises will valuable in preliminary assessment of the ability of MAMMOTH to perform coupled multi-physics calculations; calculations performed to date are being used to validate the neutron transport solver Rattlesnake\\citelesnake) and the fuels performance code BISON. Other validation projects outside of TREAT are available for single-physics benchmarking. Because the transient solution capability of Rattlesnake is one of the key attributes that makes it unique for TREAT transient simulations, validation of the transient solution of Rattlesnake using other time dependent kinetics benchmarks has considerable value. The Nuclear Energy Agency (NEA) of the Organization for Economic Cooperation and Development (OECD) has recently developed a computational benchmark for transient simulations. This benchmark considered both two-dimensional (2D) and 3D configurations for a total number of 26 different transients. All are negative reactivity insertions, typically returning to the critical state after some time.

  16. A zygomycotic infection in captive snakes.

    Science.gov (United States)

    Kaplan, W; Chandler, F W; Padhye, A A; Hamm, T E

    1983-06-01

    We report disseminated, fatal fungal disease involving subcutaneous and visceral tissues in 4 captive snakes (1 Elaphe guttata, 2 Crotalus horridus, and 1 Pituophis melanoleucus). The etiologic agent, which was abundant in the lesion, had a rounded form in vivo with a prominent nucleus. These cells averaged 17 microns in diameter and reproduced by fission, forming clusters of two or four daughter cells. The etiologic agent was isolated on Sabouraud dextrose agar from one of the snakes. It also grew well on various mycologic media, forming soft, raised, glabrous, tannish colonies. The colonies were composed of large spherical cells with prominent nuclei that reproduced by fission like those seen in tissue. In addition, some of the cells were observed to germinate, forming rudimentary hyphal filaments that were up to 8 microns in diameter and 100 microns in length, with occasional septa and thick-walled structures regarded as azygospores. We consider the fungus to be a zygomycete that may belong to the order Entomophthorales.

  17. Effects of gamma radiation on Crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Murata, Y.

    1988-01-01

    A poll of crotomine positive Crotalus durissus terrificus venom was dissolved in 0.15 M NaCl and the supernatant irradiated using 60 CO. Doses of 100,250,750,1000,1500 and 2000 Cy were used at a dose rate of 1.190Gy/h. The presence of free SH, casein hydrolytic degradation, SDS-PAGE and molecular exclusion chromatography analysis together with LD 50 determination in mice were studied. The antigenic properties of samples were investigated by immunodiffision and immunoprecipitation. (M.A.C.) [pt

  18. Captive elephants - an overview

    Directory of Open Access Journals (Sweden)

    H.S. Riddle

    2011-06-01

    Full Text Available Currently a significant portion of the world’s elephant population is in captivity, mainly in Asia. Elephants have a long history of captivity in both Africa and Asia, and have adapted to many environments. Today, due to evolving needs and philosophies, some changes have occurred in the use of captive elephants, and debate about their welfare and management is increasing. To address this, several countries are developing higher standards of care via policies and guidelines; unfortunately most elephant range countries do not have a national strategy concerning their captive elephant population. Challenges in elephant medicine are always present, yet there is a lack of standardized requirements for veterinary care in elephant range countries, and the ability of veterinarians to treat elephant diseases is often limited. In recent years, much has been learned about elephant physiology, biology, and communication from captive elephants, and this knowledge supports management decisions affecting both captive and wild populations. Captive elephants present important educational and fundraising opportunities in support of conservation, but these are often not fully leveraged. Future considerations include implementing changes to improve staff support and training, establishing comprehensive registration of all captive populations, and ensuring that captive management does not negatively impact wild elephant populations.

  19. Microbiological evaluation of different strategies for management of snakes in captivity.

    Science.gov (United States)

    Campagner, M V; Bosco, S M G; Bagagli, E; Cunha, M L R S; Jeronimo, B C; Saad, E; Biscola, N P; Ferreira, R S; Barraviera, B

    2012-01-01

    Keeping snakes in captivity to produce venom for scientific research and production of inputs is now a worldwide practice. Maintaining snakes in captivity involves capture, infrastructure investments, management techniques, and appropriate qualified personnel. Further, the success of the project requires knowledge of habitat, nutrition, and reproduction, and control of opportunistic infections. This study evaluated the management of snakes in three types of captivity (quarantine, intensive, and semiextensive) and diagnosed bacterial and fungal contaminants. A bacteriological profile was obtained by swabbing the oral and cloacal cavities, scales, and venoms of healthy adult snakes from Bothrops jararaca (Bj) and Crotalus durissus terrificus (Cdt). There was predominance of Enterobacteriaceae, especially non-fermenting Gram-negative bacilli excluding Pseudomonas spp and Gram- positive bacteria. Statistically, intensive captivity resulted in the highest number of bacterial isolates, followed by recent capture (quarantine) and by semiextensive captivity. No statistical difference was found between Bj and Cdt bacterial frequency. In vitro bacterial susceptibility testing found the highest resistance against the semisynthetic penicillins (amoxicillin and ampicillin) and highest sensitivity to amicacin and tobramycin aminoglycosides. To evaluate mycological profile of snakes from intensive captivity, samples were obtained from two healthy Bj and one B. moojeni, one B. pauloensis, and one Cdt showing whitish lesions on the scales suggestive of ringworm. Using conventional methods and DNA-based molecular procedures, five samples of Trichosporon asahii were identified. Despite the traditional role of intense captivity in ophidian venom production, semiextensive captivity was more effective in the present study by virtue of presenting superior control of bacterial and fungal transmission, easier management, lowest cost, and decreased rate of mortality; therefore, it should be

  20. Nowhere to Go but Up: Impacts of Climate Change on Demographics of a Short-Range Endemic (Crotalus willardi obscurus) in the Sky-Islands of Southwestern North America.

    Science.gov (United States)

    Davis, Mark A; Douglas, Marlis R; Webb, Colleen T; Collyer, Michael L; Holycross, Andrew T; Painter, Charles W; Kamees, Larry K; Douglas, Michael E

    2015-01-01

    Biodiversity elements with narrow niches and restricted distributions (i.e., 'short range endemics,' SREs) are particularly vulnerable to climate change. The New Mexico Ridge-nosed Rattlesnake (Crotalus willardi obscurus, CWO), an SRE listed under the U.S. Endangered Species Act within three sky islands of southwestern North America, is constrained at low elevation by drought and at high elevation by wildfire. We combined long-term recapture and molecular data with demographic and niche modeling to gauge its climate-driven status, distribution, and projected longevity. The largest population (Animas) is numerically constricted (N = 151), with few breeding adults (Nb = 24) and an elevated inbreeding coefficient (ΔF = 0.77; 100 years). Mean home range (0.07 km2) is significantly smaller compared to other North American rattlesnakes, and movements are within, not among sky islands. Demographic values, when gauged against those displayed by other endangered/Red-Listed reptiles [e.g., Loggerhead Sea Turtle (Caretta caretta)], are either comparable or markedly lower. Survival rate differs significantly between genders (femaleclimate estimates. While survival is significantly impacted by wildfire at upper elevations, the extinction vortex is driven by small population demographics, a situation comparable to that of the European Adder (Vipera berus), a conservation icon in southern Sweden. Genetic rescue, a management approach successfully employed in similar situations, is ill advised in this situation due to climate-driven habitat change in the sky islands. CWO is a rare organism in a unique environment, with a conserved niche and a predisposition towards extinction. It is a bellwether for the eventual climate-driven collapse of the Madrean pine-oak ecosystem, one of Earth's three recognized megadiversity centers.

  1. Gamma radiation damage in crotamine (venom of Brazilian rattlesnake)

    International Nuclear Information System (INIS)

    Costa, T.A.; Rogero, J.R.

    1988-01-01

    Ionizing Radiations changes the molecular structure due to chemical bond destruction. These chemical alterations is able to change the biological properties of the macro-molecules. Crotamine was obtained from Crotalus durissus terrificus venom by molecular exclusion cromatography and irradiated in concentration of 2 mg/ml of NaCl 0,85% with gamma radiation produced by a 60 Co source. We used doses of 100 Gy, 250 Gy, 500 Gy, 1000 Gy and 2000 Gy (dose rate = 1,19.10 3 Gy/h). We performed the following experiments: presence of free SH groups, proteic concentration,SDS-PAGE and immunodifusion. Preliminary results showed an increase of the number of bands in SDS-PAGE suggesting the appearence of protein aggregates that proportional to the dose increasing. The immunodiffusion data showed no modification of the immunochemical activity against theButantan anti - sera. (author) [pt

  2. Rabies in Captive Deer

    Centers for Disease Control (CDC) Podcasts

    2012-04-30

    Dr. Brett Petersen, a medical officer at CDC, discusses rabies in captive deer.  Created: 4/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/30/2012.

  3. The effects of Western Diamondback Rattlesnake (Crotalus atrox) venom on the production of antihemorrhagins and/or antibodies in the Virginia opossum (Didelphis virginiana).

    Science.gov (United States)

    McKeller, Morgan R; Pérez, John C

    2002-04-01

    Opossums are animals that are naturally resistant to the proteolytic effects of Crotalid venoms. Opossums possess proteinase inhibitors in their sera that bind to and neutralize hemorrhagic and other proteolytic activity in many snake venoms. The proteinase inhibitors are not antibodies since they have different molecular weights (60kDa) and pI (4.2). The purpose of this study was to determine if opossums were capable of producing antibodies against venom and/or increasing the production of proteinase inhibitors (specifically antihemorrhagins). Five different venom immunization protocols were used to determine the effects of the venom in the opossums. The dosages ranged from 1mg of venom per immunization to 350mg/kg body weight of venom per immunization. The antihemorrhagic response was increased, but there is no evidence to suggest that an opossum can produce antibodies against venom. The lack of an antibody response is most likely due to the natural proteinase inhibitors clearing the venom from the opossum's body before an antibody response can occur.

  4. The unequal influences of the left and right vagi on the control of the heart and pulmonary artery in the rattlesnake, Crotalus durissus

    DEFF Research Database (Denmark)

    Taylor, E.W.; Andrade, Denis V.; Abe, Augusto A.

    2009-01-01

    the systemic and pulmonary circulations. Central stimulation of either vagus caused small (5–10%) reductions in systemic blood pressure but did not affect blood flows or fH. A bilateral differentiation between the vagi was confirmed by progressive vagotomy in recovered snakes. Transection of the left vagus......Autonomic control of the cardiovascular system in reptiles includes sympathetic components but heart rate (fH), pulmonary blood flow ( pul) and cardiac shunt patterns are primarily controlled by the parasympathetic nervous system. The vagus innervates both the heart and a sphincter on the pulmonary...... lung regresses during development. Stimulation of the left cervical vagus in anaesthetised snakes slowed the heart and markedly reduced blood flow in the pulmonary artery whereas stimulation of the right cervical vagus slowed the heart and caused a small increase in stroke volume (VS) in both...

  5. Mastering Adobe Captivate 7

    CERN Document Server

    Bruyndonckx, Damien

    2014-01-01

    A comprehensive tutorial packed with examples, which is divided into small subtopics that follows a clear and logical outline to help you get to grips with Adobe Captivate 7. Readers are also encouraged to develop their understanding of the tool through practical exercises and experimentations in every chapter. A lot of external references and tips and tricks from established e-Learning professionals are also included. If you are a designer, e-Learning developer, or webmaster who wants to construct an interactive and fun-filled e-Learning project using Adobe Captivate 7, this book is ideal for

  6. TB in Captive Elephants

    Centers for Disease Control (CDC) Podcasts

    2017-04-27

    Dr. Barry Kreiswirth, founding director of the Public Health Research Institute, TB Center, at Rutgers University, discusses TB in three captive elephants.  Created: 4/27/2017 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/27/2017.

  7. DSC analysis of irradiated proteins from Crotalus durissus terrificus

    International Nuclear Information System (INIS)

    Oliveira, Karina Corleto de; Silva, Monica Nascimento da; Goncalves, Karina de Oliveira; Spencer, Patrick Jack; Nascimento, Nanci do

    2011-01-01

    Full text: Snake bites are a serious public health problem, especially in subtropical countries. In Brazil, the serum, the only effective treatment in case of snake bites, is produced in horses which, despite the large size, have a reduced lifespan due to the high toxicity of the antigen. It is known that ionizing radiation effects - direct and indirect - can modify the molecular structure, affecting the biological properties of proteins. Ionizing radiation has been employed to attenuate the toxicity of snake venoms, aiming to generate an improved antigen with low toxicity. Two proteins, purified from Crotalus durissus terrificus (Cdt) venom were tested in this work: crotoxin and crotamine. Crotoxin, the main toxic compound of Cdt venom, is a heterodimeric protein composed of two subunits: crotapotin and phospholipase A2. Crotamine is a highly basic polypeptide (pI - 10.3), with myotoxic activity and molecular weight of 4882 Da. It is composed of 42 amino acids residues and reticulated by three disulfide bonds. This study aimed to investigate the effects of radiation on crotoxin and crotamine using Differential Scanning Calorimetry (DSC). After isolation of the toxins by chromatographic techniques, they were irradiated with 2.0 kGy from 60 Co source. The thermodynamics analysis, carried out in a METTLER TOLEDO, DSC 822e calorimeter, showed that irradiation promoted changes of the calorimetric profile. These changes suggest that, although radiation induced structural modifications of the protein, denaturation was only partial, since transition states could still be detected, suggesting that some structural elements were still present after irradiation. Taken together, our data suggest that following irradiation, the molecules underwent conformational changes, and that the remaining structural elements displayed a lower enthalpy, clearly indicating that the previously described loss of toxicity of irradiated toxins can be mostly ascribed to structural changes

  8. DSC analysis of irradiated proteins from Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Karina Corleto de; Silva, Monica Nascimento da; Goncalves, Karina de Oliveira; Spencer, Patrick Jack; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Full text: Snake bites are a serious public health problem, especially in subtropical countries. In Brazil, the serum, the only effective treatment in case of snake bites, is produced in horses which, despite the large size, have a reduced lifespan due to the high toxicity of the antigen. It is known that ionizing radiation effects - direct and indirect - can modify the molecular structure, affecting the biological properties of proteins. Ionizing radiation has been employed to attenuate the toxicity of snake venoms, aiming to generate an improved antigen with low toxicity. Two proteins, purified from Crotalus durissus terrificus (Cdt) venom were tested in this work: crotoxin and crotamine. Crotoxin, the main toxic compound of Cdt venom, is a heterodimeric protein composed of two subunits: crotapotin and phospholipase A2. Crotamine is a highly basic polypeptide (pI - 10.3), with myotoxic activity and molecular weight of 4882 Da. It is composed of 42 amino acids residues and reticulated by three disulfide bonds. This study aimed to investigate the effects of radiation on crotoxin and crotamine using Differential Scanning Calorimetry (DSC). After isolation of the toxins by chromatographic techniques, they were irradiated with 2.0 kGy from {sup 60}Co source. The thermodynamics analysis, carried out in a METTLER TOLEDO, DSC 822e calorimeter, showed that irradiation promoted changes of the calorimetric profile. These changes suggest that, although radiation induced structural modifications of the protein, denaturation was only partial, since transition states could still be detected, suggesting that some structural elements were still present after irradiation. Taken together, our data suggest that following irradiation, the molecules underwent conformational changes, and that the remaining structural elements displayed a lower enthalpy, clearly indicating that the previously described loss of toxicity of irradiated toxins can be mostly ascribed to structural changes

  9. Effects of the canine rattlesnake vaccine in moderate to severe cases of canine crotalid envenomation

    Directory of Open Access Journals (Sweden)

    Leonard MJ

    2014-10-01

    Full Text Available McGee J Leonard,1 Catherine Bresee,2 Andrew Cruikshank1 1Animal Specialty and Emergency Center, Los Angeles, CA, USA; 2The Biostatistics and Bioinformatics Research Center, Cedars-Sinai Medical Center, Los Angeles, CA, USA Abstract: This is a retrospective multicenter study (2006–2012 examining a population of dogs with moderate to severe crotalid envenomation for protective effects of the canine rattlesnake vaccine. Five nonacademic emergency and referral veterinary hospitals in Southern California were involved in the study and contributed records regarding a total of 82 client-owned dogs that were treated for naturally occurring rattlesnake envenomation. All dogs received antivenin (Crotalidae polyvalent, with dosages ranging from one to three vials (mean: 1.3±0.6. Fourteen dogs (17% had a history of prior vaccination against crotalid venom. In univariate logistic regression modeling, cases with lower body weight (P=0.0001 or higher snakebite severity scores (P<0.0001 were associated with greater morbidity. No statistically significant difference in morbidity or mortality between vaccinated and unvaccinated dogs was found. The findings of this study did not identify a significantly protective effect of previous vaccination in the cases of moderate to severe rattlesnake envenomation that require treatment with antivenin. Keywords: rattlesnake envenomation, vaccine, antivenin, canine

  10. Nowhere to Go but Up: Impacts of Climate Change on Demographics of a Short-Range Endemic (Crotalus willardi obscurus in the Sky-Islands of Southwestern North America.

    Directory of Open Access Journals (Sweden)

    Mark A Davis

    Full Text Available Biodiversity elements with narrow niches and restricted distributions (i.e., 'short range endemics,' SREs are particularly vulnerable to climate change. The New Mexico Ridge-nosed Rattlesnake (Crotalus willardi obscurus, CWO, an SRE listed under the U.S. Endangered Species Act within three sky islands of southwestern North America, is constrained at low elevation by drought and at high elevation by wildfire. We combined long-term recapture and molecular data with demographic and niche modeling to gauge its climate-driven status, distribution, and projected longevity. The largest population (Animas is numerically constricted (N = 151, with few breeding adults (Nb = 24 and an elevated inbreeding coefficient (ΔF = 0.77; 100 years. Mean home range (0.07 km2 is significantly smaller compared to other North American rattlesnakes, and movements are within, not among sky islands. Demographic values, when gauged against those displayed by other endangered/Red-Listed reptiles [e.g., Loggerhead Sea Turtle (Caretta caretta], are either comparable or markedly lower. Survival rate differs significantly between genders (female

  11. Snakebites by Crotalus durissus ssp in children in Campinas, São Paulo, Brazil Acidentes por serpentes Crotalus durisssus ssp em crianças em Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Fábio BUCARETCHI

    2002-01-01

    Full Text Available From January, 1984 to March, 1999, 31 children under 15 y old (ages 1-14 y, median 8 y were admitted after being bitten by rattlesnakes (Crotalus durissus ssp. One patient was classified as "dry-bite", 3 as mild envenoming, 9 as moderate envenoming and 18 as severe envenoming. Most patients had neuromuscular manifestations, such as palpebral ptosis (27/31, myalgia (23/31 and weakness (20/31. Laboratory tests suggesting rhabdomyolysis included an increase in total blood creatine kinase (CK, 28/29 and lactate dehydrogenase (LDH, 25/25 levels and myoglobinuria (14/15. The main local signs and symptoms were slight edema (20/31 and erythema (19/31. Before antivenom (AV administration, blood coagulation disorders were observed in 20/25 children that received AV only at our hospital (incoagulable blood in 17/25. AV early reactions were observed in 20 of these 25 cases (9/9 patients not pretreated and 11/16 patients pretreated with hydrocortisone and histamine H1 and H2 antagonists. There were no significant differences in the frequency of patients with AV early reactions between the groups that were and were not pretreated (Fisher's exact test, p = 0.12. Patients admitted less than and more than 6 h after the bite showed the same risk of developing severe envenoming (Fisher's exact test, p = 1. No children of the first group (De janeiro de 1984 a março de 1999, 31 crianças com menos de 15 anos de idade (1 a 14 anos, mediana = 8 anos foram admitidas após terem sido picadas por Crotalus durissus ssp. Uma criança não apresentou manifestações clínicas de envenenamento, enquanto 3 foram classificadas como acidente leve, 9 como moderado e 18 como grave. A maioria das crianças apresentou envolvimento neuromuscular, tais como ptose palpebral (27/31, mialgia (23/31 e fraqueza (20/31. Alterações laboratoriais sugerindo rabdomiólise também foram observadas, como aumento das enzimas séricas CK (28/29 e LDH (25/25 e mioglobinúria (14/15. As

  12. Convergence study of Rattlesnake solutions for the two-dimensional C5G7 MOX benchmark

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yaqi [Idaho National Laboratory; DeHart, Mark David [Idaho National Laboratory; Gaston, Derek Ray [Idaho National Laboratory; Gleicher, Frederick Nathan [Idaho National Laboratory; Martineau, Richard Charles [Idaho National Laboratory; Peterson, John William [Idaho National Laboratory; Schunert, Sebastian [Idaho National Laboratory

    2015-04-01

    This paper presents the convergence study of a specific transport scheme, self-adjoint angular flux (SAAF) formulation with the discrete ordinates (SN) method and continuous finite element method (CFEM), implemented with Rattlesnake, on solving the well known two-dimensional C5G7 MOX benchmark. Both the convergence in space and angle are studied. Numerical results show the convergence of the spatial and angular refinements.

  13. Initial RattleSnake Calculations of the Hot Zero Power BEAVRS

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, Matthew [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Ortensi, J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wang, Y. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Smith, Kord [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Martineau, R. C. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-01-01

    The validation of the Idaho National Laboratory's next generation of reactor physics analysis codes is an essential and ongoing task. The validation process requires a large undertaking and includes detailed, realistic models that can accurately predict the behavior of an operational nuclear reactor. Over the past few years the INL has developed the RattleSnake application and supporting tools on the MOOSE framework to perform these reactor physics calculations. RattleSnake solves the linearized Boltzmann transport equation with a variety of solution meth­ ods. Various traditional reactor physics benchmarks have already been performed, but a more realistic light water reactor comparison was needed to solidify the status of the code and deter­ mine its fidelity. The INL team decided to use the Benchmark for Evaluation and Validation of Reactor Simulations, which was made available in early 2013. This benchmark is a one­ of-a-kind document assembled by the Massachusetts Institute of Technology, which includes two cycles of detailed, measured PWR operational data. The results from this initial study of the hot zero power conditions show the current INL analysis procedure with DRAGON4 cross section preparation and using the low order diffusion solver in RattleSnake for the whole core calculations yield very encouraging results for PWR analysis. The radial assembly power distributions, radial detector measurements and control rod worths were computed with good accuracy. The computation of the isothermal temperature coefficients of reactivity require further study.

  14. Parasitological and immunological diagnoses from feces of captive-bred snakes at Vital Brazil Institute

    Directory of Open Access Journals (Sweden)

    Janaína Lima de Souza

    Full Text Available Fecal samples from 56 snakes at the Vital Brazil Institute, in the city of Niterói, Rio de Janeiro, were tested using the sedimentation and flotation techniques to investigate the evolutionary forms of parasites such as helminths and protozoa, and using enzyme immunoassay techniques to detect antigens of Cryptosporidium sp. and Giardiasp. Among the animals tested, 80.3% were positive for parasites. Out of these, there were 16 Bothrops jararaca, 16 B. jararacussu and 13 Crotalus durissus. The prevalence of parasitic nematodes was 41.1%, and nematodes were found in all three snake species. Among these, the most frequent finding was eggs of Kalicephalus sp., which were diagnosed in 25% of the snakes. The positivity for protozoa detected using parasite concentration techniques was 75%, including oocysts of Caryospora sp. in 75%, cysts with morphology similar to Giardia sp. 3.6%, amoeboid cysts in 41.1% and unsporulated coccidia oocysts in 8.9%. Immunoassays for Cryptosporidium sp. antigens produced positive findings in 60.7%. Pseudoparasites were detected in 64.3%. These results show that there is a need to improve the sanitary handling of captive-bred snakes, and also for the animal house that supplies rodents to feed them. The results also highlight that diagnostic tests should be performed periodically on stool specimens from captive-bred snakes.

  15. Parasitological and immunological diagnoses from feces of captive-bred snakes at Vital Brazil Institute.

    Science.gov (United States)

    Souza, Janaína Lima de; Barbosa, Alynne da Silva; Vazon, Adriana Prado; Uchôa, Claudia Maria Antunes; Nunes, Beatriz Coronato; Cortez, Myrian Bandeira Vianna; Silva, Valmir Laurentino da; Más, Leonora Brazil; Melgarejo, Aníbal Rafael; Bastos, Otilio Machado Pereira

    2014-01-01

    Fecal samples from 56 snakes at the Vital Brazil Institute, in the city of Niterói, Rio de Janeiro, were tested using the sedimentation and flotation techniques to investigate the evolutionary forms of parasites such as helminths and protozoa, and using enzyme immunoassay techniques to detect antigens of Cryptosporidium sp. and Giardia sp. Among the animals tested, 80.3% were positive for parasites. Out of these, there were 16 Bothrops jararaca, 16 B. jararacussu and 13 Crotalus durissus. The prevalence of parasitic nematodes was 41.1%, and nematodes were found in all three snake species. Among these, the most frequent finding was eggs of Kalicephalus sp., which were diagnosed in 25% of the snakes. The positivity for protozoa detected using parasite concentration techniques was 75%, including oocysts of Caryospora sp. in 75%, cysts with morphology similar to Giardia sp. 3.6%, amoeboid cysts in 41.1% and unsporulated coccidia oocysts in 8.9%. Immunoassays for Cryptosporidium sp. antigens produced positive findings in 60.7%. Pseudoparasites were detected in 64.3%. These results show that there is a need to improve the sanitary handling of captive-bred snakes, and also for the animal house that supplies rodents to feed them. The results also highlight that diagnostic tests should be performed periodically on stool specimens from captive-bred snakes.

  16. What captivates the subject?

    DEFF Research Database (Denmark)

    Porsgaard, Kasper

    What can Jacques Lacan tell us about relations of power and figures of authority? – That is the guiding question of "What Captivates the Subject?" The dissertation answers this question by providing a close study of Lacanian texts and seminars from 1953 to 1973, seeking to present not only...... for two concepts central to the technical psychoanalytical vocabulary: identification and the object. Identifications and the relation to libidinal objects were acknowledged by Freud as the most fundamental mechanisms in the social life of any human being, just as he regarded them as fundamental...... to the establishment and maintenance of power structures, not least within the psychoanalytic clinic itself. Yet his accounts of the concepts remain blurry and tentative throughout his career, and it took a Lacan to finally build a rigorous theoretical framework around these concepts. Throughout the dissertation...

  17. Rabbit IgG antibodies against Phospholipase A2 from Crotalus durissus terrificus neutralize the lethal activity of the venom Los anticuerpos IgG de conejos anti-fosfolipasa A2 de Crotalus durissus terrificus neutralizan la actividad letal del veneno

    Directory of Open Access Journals (Sweden)

    Juan P. Rodríguez

    2006-12-01

    Full Text Available Crotalus durissus terrificus (C.d.t. (South American rattlesnake venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. Crotoxin contains a basic phospholipase A2 (PLA2 and a non toxic acidic protein, crotapotin. We have produced and investigated the ability of IgG antibodies raised in rabbits against PLA2 to neutralize the lethality of the whole venom. PLA2 was isolated by gel filtration chromatography (Sephadex G-75. Specific antibodies were obtained by subcutaneous and intramuscular inoculation of PLA2 (700 µg with Freund adjuvant. Groups of six mice (20 + 2 g were inoculated with 0.5 ml i.p. of C. d. t. venom (4 µg or a mixture of venom that had been preincubated with the desired volume of IgG antibodies. Mortality, recorded 24 and 48 h after inoculation, showed that IgG anti-PLA2 were more effective than anticrotalic serum in neutralizing the lethal activity. These results demonstrate that it could be possible to obtain an anti-venom made by specific antibodies with a high level of protection against the lethal component of C.d.t. venom, and/or the inclusion of these antibodies as a supplement in heterologous anti-venoms.El veneno de Crotalus durissus terrificus (C.d.t. (Cascabel de Sud América posee actividad miotóxica y neurotóxica, actividades que también exhibe el complejo crotoxina, principal componente tóxico de este veneno. El complejo crotoxina está constituido por una fosfolipasa A2 básica (PLA2 y una proteína acídica no tóxica, el crotapotín. En este trabajo se estudió la capacidad neutralizante de anticuerpos IgG anti-PLA2 sobre la letalidad inducida por el veneno entero. El antígeno PLA2, fue aislado por cromatografía de filtración en gel (Sephadex G-75. Se inocularon conejos machos por vía subcutánea e intramuscular, con 700 µg de PLA2 y adyuvante para la obtención de anticuerpos específicos. La capacidad neutralizante del

  18. Aspectos clínico-patológicos e laboratoriais do envenenamento crotálico experimental em bovinos Clinical and pathological aspects of experimental Crotalus poisoning in cattle

    Directory of Open Access Journals (Sweden)

    Flávio A.S. Graça

    2008-06-01

    -americanas em bovinos não cursa com mioglobinúria e que o quadro marcado de paralisia flácida mimetiza o observado no botulismo. Adicionalmente foram feitas observações sobre o diagnóstico do envenenamento crotálico e sua diferenciação com enfermidades que cursam com paralisia e necrose muscular em bovinos do Brasil.Crotalus poisoning was experimentally reproduced by subcutaneous inoculation of Crotalus durissus terrificus (South American rattlesnake venom into 10 clinically healthy mixed bred 12 to 36-month-old cattle, weighing 125 to 449 kg. Two animals were used as controls. The animal that received a dose of 0.03mg/kg body weight died 7h40min after inoculation. A 0.015mg/kg dose provoked death in 4 out of 7 young oxen. Two animals given 0.0075mg/kg became slightly sick and recovered. Onset of symptoms occurred from 1h30min to 13h45min after inoculation. The clinical course varied from 5h25min to 45h for animals that died, and from 33h15min to 17 days for animals that recovered. The main nervous signs observed were diminished response to external stimuli, hypotonic reflexes, dragging of the hooves, apathy, difficulties in moving around obstacles, ocular globe paralysis, lateral and sternal decubitus, and tongue paralysis. Adipsia and sometimes petechiae in the conjunctival and vaginal mucosa were observed. A slight to moderate increase in bleeding time was noted in 6 animals, and a moderate increase in partial thromboplastin time was found in 7 others. Moderate leukocytosis with neutrophilia, relative lymphopenia, eosinopenia, and monocytosis was found. There was a significant increase in creatine kinase serum levels of a ten-fold order. No significant alterations were revealed by urinalysis. Necropsy revealed minimal edema at the inoculation site, few petechiae and equimoses in the epicardium, omentum, biliary vesicle and bladder mucosa of some animals. Histopathological examination revealed necrosis (hyalinization of groups or isolated myocytes in different

  19. Improved Quasi-Static Method: IQS Method Implementation for CFEM Diffusion in Rattlesnake

    Energy Technology Data Exchange (ETDEWEB)

    Prince, Zachary M. [Texas A & M Univ., College Station, TX (United States). Dept. of Nuclear Engineering; Ragusa, Jean C. [Texas A & M Univ., College Station, TX (United States). Dept. of Nuclear Engineering; Wang, Yaqi [Texas A & M Univ., College Station, TX (United States). Dept. of Nuclear Engineering

    2016-02-29

    The improved quasi-static (IQS) method is a transient spatial kinetics method that involves factorizing flux into space- and time-dependent components. These components include the flux’s power and shape. Power is time-dependent, while the shape is both space- and time-dependent. However, the impetus of the method is the assumption that the shape is only weakly dependent on time; therefore, the shape may not require computation at every time step, invoking the quasi-static nature. This paper describes the implementation and testing of IQS as an alternative kinetics solver within Rattlesnake to provide improved time performance with minimal reduction in accuracy.

  20. Improved Quasi-Static Method: IQS Method Implementation for CFEM Diffusion in Rattlesnake

    International Nuclear Information System (INIS)

    Prince, Zachary M.; M Univ., College Station, TX; Ragusa, Jean C.; M Univ., College Station, TX; Wang, Yaqi; M Univ., College Station, TX

    2016-01-01

    The improved quasi-static (IQS) method is a transient spatial kinetics method that involves factorizing flux into space- and time-dependent components. These components include the flux's power and shape. Power is time-dependent, while the shape is both space- and time-dependent. However, the impetus of the method is the assumption that the shape is only weakly dependent on time; therefore, the shape may not require computation at every time step, invoking the quasi-static nature. This paper describes the implementation and testing of IQS as an alternative kinetics solver within Rattlesnake to provide improved time performance with minimal reduction in accuracy.

  1. Hybrid PN-SN Calculations with SAAF for the Multiscale Transport Capability in Rattlesnake

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yaqi; Schunert, Sebastian; DeHart, Mark; Martineau, Richard

    2016-05-01

    Two interface conditions, the Lagrange multiplier method and the upwinding method, for hybrid \\pn-\\sn calculations is proposed for the self-adjoint angular flux (SAAF) formulation of the transport equation using the continuous finite element method (FEM) for spatial discretization. These interface conditions are implemented in Rattlesnake, the radiation transport application built on MOOSE, for the on-going multiscale transport simulation effort at INL. For smoothing the solution at the interface for the Lagrange multiplier method, a method based on \\sn Lagrange interpolation on the sphere is proposed. Numerical results indicate that the interface conditions give the expected convergence.

  2. The coupling of the neutron transport application RATTLESNAKE to the nuclear fuels performance application BISON under the MOOSE framework

    Energy Technology Data Exchange (ETDEWEB)

    Gleicher, Frederick N.; Williamson, Richard L.; Ortensi, Javier; Wang, Yaqi; Spencer, Benjamin W.; Novascone, Stephen R.; Hales, Jason D.; Martineau, Richard C.

    2014-10-01

    The MOOSE neutron transport application RATTLESNAKE was coupled to the fuels performance application BISON to provide a higher fidelity tool for fuel performance simulation. This project is motivated by the desire to couple a high fidelity core analysis program (based on the self-adjoint angular flux equations) to a high fidelity fuel performance program, both of which can simulate on unstructured meshes. RATTLESNAKE solves self-adjoint angular flux transport equation and provides a sub-pin level resolution of the multigroup neutron flux with resonance treatment during burnup or a fast transient. BISON solves the coupled thermomechanical equations for the fuel on a sub-millimeter scale. Both applications are able to solve their respective systems on aligned and unaligned unstructured finite element meshes. The power density and local burnup was transferred from RATTLESNAKE to BISON with the MOOSE Multiapp transfer system. Multiple depletion cases were run with one-way data transfer from RATTLESNAKE to BISON. The eigenvalues are shown to agree well with values obtained from the lattice physics code DRAGON. The one-way data transfer of power density is shown to agree with the power density obtained from an internal Lassman-style model in BISON.

  3. Studies of agregates produced during venom irradiation of Crotalus durissus terrificus with gamma ray

    International Nuclear Information System (INIS)

    Clissa, Patricia B.; Nascimento, Nanci do; Rogero, Jose R.

    1997-01-01

    Literature data show that 2.0 kGy dose of gamma radiation, generated by 60 Co source, reduces the toxic activity of Crotalus durissus terrificus venon, without altering its immunogenic capacity. When crotoxin, main toxin from crotalic venom, was irradiated with the same dose, toxicity was laos reduced and the immunogenicity was maintained. This fact was attributed to aggregates(compounds with high molecular weight generated during irradiation), that showed no toxicity but were able to induce the antibodies formation against native venom. Crotalus durissus terrificus venom was irradied with 2.0, 3.0, 5.0 and 10.0 kGy doses and submitted to molecular exclusion chromatography, in order to find an efficient dose that produces large amounts of non toxic but still immunogeneic aggregates. After being isolated, the products of irradiation were evaluated for the amount produced, molecular ateration, and toxic and immunogenic activities. The results from different doses irradiated venom were compared with native one, and 2.0 kGg dose was confirmed to be most efficient in the association of toxicity attenuation with maintenance of immunogenicity of the crotalic venom, while other doses, in spite of being efficient in the toxicity attenuation, they were not able to keep the immunogenicity property. So, the dose of 2.0 kGy could be used to immunize animals in order to improve anticrotalic sera production. (author). 14 refs., 6 figs., 4 tabs

  4. Uncollided Flux Techniques for Discrete-Ordinate Radiation Transport Solutions in Rattlesnake

    Energy Technology Data Exchange (ETDEWEB)

    Ragusa, Jean C. [Texas A & M Univ., College Station, TX (United States); DeHart, Mark D. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-08-01

    One of the only real-time-resolved measurement tools used at the Transient Test Reactor (TREAT) is the fast-neutron hodoscope. The hodoscope was used for monitoring and measuring fuel motion during a transient pulse. The hodoscope is a line of sight detection and imaging system that provides both temporal and spatial resolution of fuel motion during transients, and in-place measurement of fuel distribution during and after transient experiments. However, the hodoscope relies on fast neutron streaming out of the reactor core, which provides a challenge to transient modeling and simulation. However, use of a first collision source approach can be used to overcome this shortcoming. Hence, the TREAT modeling and simulation team has initiated research to implement such capabilities in the neutron transport code Rattlesnake. This report reviews uncollided flux techniques (first and last collision methods) to be implemented in the Rattlesnake SN code in order to mitigate ray effects in modeling the TREAT reactor+hodoscope system. Angular discretization techniques (SN and PN) for the transport equation are notoriously poor at capturing effectively streaming effects.

  5. Gamma radiation effects on crotoxin (toxin of crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Souza Filho, J.N.; Rogero, J.R.

    1988-01-01

    The crotoxin is a great neurotoxin found on Crotalus durissus terrificus venom. This protein was isolated using molecular exclusion cromatography with Sephadex G-75 and irradiated in a source of 60 Co GAMMA-CELL in the concentration of 2 mg/ml 0.85% NaCl with dose rate of 1.19 x 10 3 Gy/hr. The doses used were 250, 500, 1000 and 2000 Gy. It was determinated for this samples, the proteic concentration, the diffusion immunoassay using crotalic antiserum and eletrophoresis (SDS-PAGE). The results showed some changes on the irradiated toxin. Preliminary results with doses of radiation of 100, 250, 500 and 1000 Gy showed that the letal dose 50% (LD50) in mice increase greatly with the increase of radiation's dose. (author) [pt

  6. Purification and radiodination of gyroxin, toxin like trombin, of crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Camillo, Maria A.P.; Paes, Paulo C.A.; Ribela, Maria T.C.P.; Rogero, Jose R.

    1997-01-01

    Snake's venoms have attracted special interest in research because they are rich in bioactive compounds, which are scientific tools to study many physiological processes and are also important source of new therapeutic agents. Some thrombin-like enzymes are used as a reagent in laboratorial assays as well as in medical drugs. However, a neurotoxic syndrome called gyroxin syndrome or barrel rotation seems to be related to those enzymes. Pharmacokinetics and biodistribution studies of these toxins can contribute to clarifly this mechanisms and consequently, it will help to elaborate safer clinical prescriptions giving more information about possible nocive effects. This paper describes the first step of these studies with the thrombin-like enzyme (or gyroxin) from Crotalus durissus terrificus's venom. The purification and radioiodination methods as well as electrophoretic analysis and biological assay are presented. (author). 9 refs., 5 figs., 1 tab

  7. Interaction study of water radiolysis products with Crotalus durissus terrificus miotoxin

    International Nuclear Information System (INIS)

    Silva, Murilo Casare da

    2008-01-01

    Ionizing radiation has been satisfactorily employed for venoms detoxification. In this report, the radiation was employed to verify the effects caused by the radiolysis products of water on the Crotamine, toxin purified from Crotalus durissus terrificus venom. These effects were analyzed using some substances called 'scavengers', those substances competes for specific reactive species hindering them to act on the toxins molecules. In order to study the possible structural damages caused on the toxins, circular dichroism, fluorescence, nuclear magnetic resonance, amino acids analysis and intravital microscopy were employed. Our results indicate that ionizing radiation caused structure alterations, mainly, in secondary and tertiary structure of crotamine. In the irradiated crotamine, was not possible to determine tridimensional structure. And the crotamine toxic effect was removed by ionizing radiation. (author)

  8. Effects of radiolysis products on crotamine (toxin from Crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Costa, T.A. da; Rogero, J.R.

    1988-07-01

    Ionizing Radiations changes the molecular structure due to chemical bond destruction. These chemical alterations are able to change the biological properties of the biomolecules. Crotamine was obtained from Crotalus durissus terrificus venom by molecular exclusion cromatography and irradiated in a concentration of 1 mg/ml in aqueous solution with gamma radiation produced by a 60 Co source. We used doses of 100 Gy, 2000 Gy and 5000 Gy (dose rate = 1,14 x 10 3 Gy/h). We performed the following experiments: proteic concentration, SDS-PAGE and immunodiffusion. Preliminary results showed a reduction of 55% in proteic concentration; with dose of 5000 Gy; an increase of the number of bands in SDS-PAGE suggesting the appearance of protein aggregates that was proportional as the dose increases. The immunodifusion data showed a reduction of the immunochemical activity against the Butantan antisera. (author) [pt

  9. Effects of gamma radiation on crotoxin (toxin of Crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Souza Filho, J.N.; Rogero, J.R.

    1988-07-01

    The crotoxin in a great neurotoxin found on Crotalus durissus terrificus venom. This protein was isolated using molecular exclusion cromatrography with Sephadex G-75 and irradiated in a source of 60 Co GAMMACELL in the concentration of 2 mg/ml 0.85% NaCl with dose rate of 1.19 x 10 3 Gy/hr. The doses used were 250, 500, 1000 and 2000 Gy. It was determinated for this samples, the proteic concentration, the diffusion immunoassay using crotalic antiserum and eletrophoresis (SDS-PAGE). The results showed some changes on the irradiated toxin. Preliminary results with doses of radiation of 100, 250, 500 and 1000 Gy showed that the letal dose 50% (LD50) in mice increase greatly with the increase of radiation's dose. (author) [pt

  10. Rotary peening with captive shot

    International Nuclear Information System (INIS)

    1998-02-01

    Roto Peen with captive shot removes coatings and surface contamination from concrete floors. The objective of treating radioactively contaminated concrete floors during the Deactivation and Decommissioning (D and D) process is to reduce the surface contamination levels to meet regulatory criteria for unrestricted use. The US Department of Energy (DOE) Chicago Operations office and DOE's Federal Energy Technology Center (FETC) jointly sponsored a Large-Scale Demonstration Project (LSDP) at the Chicago Pile-5 Research Reactor (CP-5) at Argonne National Laboratory-East (ANL). The objective of the LSDP is to demonstrate potentially beneficial D and D technologies in comparison with current baseline technologies. As part of the LSDP, roto Peen with captive shot was demonstrated March 17--20, 1997, to treat a 20 x 25 ft area of radioactively contaminated concrete floor on the service level of the CP-5 building

  11. Multiscale Capability in Rattlesnake using Contiguous Discontinuous Discretization of Self-Adjoint Angular Flux Equation

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Weixiong [Texas A & M Univ., College Station, TX (United States); Wang, Yaqi [Idaho National Lab. (INL), Idaho Falls, ID (United States); DeHart, Mark D. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-09-01

    In this report, we present a new upwinding scheme for the multiscale capability in Rattlesnake, the MOOSE based radiation transport application. Comparing with the initial implementation of multiscale utilizing Lagrange multipliers to impose strong continuity of angular flux on interface of in-between subdomains, this scheme does not require the particular domain partitioning. This upwinding scheme introduces discontinuity of angular flux and resembles the classic upwinding technique developed for solving first order transport equation using discontinuous finite element method (DFEM) on the subdomain interfaces. Because this scheme restores the causality of radiation streaming on the interfaces, significant accuracy improvement can be observed with moderate increase of the degrees of freedom comparing with the continuous method over the entire solution domain. Hybrid SN-PN is implemented and tested with this upwinding scheme. Numerical results show that the angular smoothing required by Lagrange multiplier method is not necessary for the upwinding scheme.

  12. Full Core TREAT Kinetics Demonstration Using Rattlesnake/BISON Coupling Within MAMMOTH

    Energy Technology Data Exchange (ETDEWEB)

    Ortensi, Javier [Idaho National Lab. (INL), Idaho Falls, ID (United States); DeHart, Mark D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gleicher, Frederick N. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wang, Yaqi [Idaho National Lab. (INL), Idaho Falls, ID (United States); Alberti, Anthony L. [Oregon State Univ., Corvallis, OR (United States); Palmer, Todd S. [Oregon State Univ., Corvallis, OR (United States)

    2015-08-01

    This report summarizes key aspects of research in evaluation of modeling needs for TREAT transient simulation. Using a measured TREAT critical measurement and a transient for a small, experimentally simplified core, Rattlesnake and MAMMOTH simulations are performed building from simple infinite media to a full core model. Cross sections processing methods are evaluated, various homogenization approaches are assessed and the neutronic behavior of the core studied to determine key modeling aspects. The simulation of the minimum critical core with the diffusion solver shows very good agreement with the reference Monte Carlo simulation and the experiment. The full core transient simulation with thermal feedback shows a significantly lower power peak compared to the documented experimental measurement, which is not unexpected in the early stages of model development.

  13. Sensationalistic journalism and tales of snakebite: are rattlesnakes rapidly evolving more toxic venom?

    Science.gov (United States)

    Hayes, William K; Mackessy, Stephen P

    2010-03-01

    Recent reports in the lay press have suggested that bites by rattlesnakes in the last several years have been more severe than those in the past. The explanation, often citing physicians, is that rattlesnakes are evolving more toxic venom, perhaps in response to anthropogenic causes. We suggest that other explanations are more parsimonious, including factors dependent on the snake and factors associated with the bite victim's response to envenomation. Although bites could become more severe from an increased proportion of bites from larger or more provoked snakes (ie, more venom injected), the venom itself evolves much too slowly to explain the severe symptoms occasionally seen. Increased snakebite severity could also result from a number of demographic changes in the victim profile, including age and body size, behavior toward the snake (provocation), anatomical site of bite, clothing, and general health including asthma prevalence and sensitivity to foreign antigens. Clinical management of bites also changes perpetually, rendering comparisons of snakebite severity over time tenuous. Clearly, careful study taking into consideration many factors will be essential to document temporal changes in snakebite severity or venom toxicity. Presently, no published evidence for these changes exists. The sensationalistic coverage of these atypical bites and accompanying speculation is highly misleading and can produce many detrimental results, such as inappropriate fear of the outdoors and snakes, and distraction from proven snakebite management needs, including a consistent supply of antivenom, adequate health care, and training. We urge healthcare providers to avoid propagating misinformation about snakes and snakebites. Copyright (c) 2010 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.

  14. Comparison of the effect of Crotalus simus and Crotalus durissus ruruima venoms on the equine antibody response towards Bothrops asper venom: implications for the production of polyspecific snake antivenoms.

    Science.gov (United States)

    Dos-Santos, Maria Cristina; Arroyo, Cynthia; Solano, Sergio; Herrera, María; Villalta, Mauren; Segura, Alvaro; Estrada, Ricardo; Gutiérrez, José María; León, Guillermo

    2011-02-01

    Antivenoms are preparations of immunoglobulins purified from the plasma of animals immunized with snake venoms. Depending on the number of venoms used during the immunization, antivenoms can be monospecific (if venom from a single species is used) or polyspecific (if venoms from several species are used). In turn, polyspecific antivenoms can be prepared by purifying antibodies from the plasma of animals immunized with a mixture of venoms, or by mixing antibodies purified from the plasma of animals immunized separately with single venom. The suitability of these strategies to produce polyspecific antibothropic-crotalic antivenoms was assessed using as models the venoms of Bothrops asper, Crotalus simus and Crotalus durissus ruruima. It was demonstrated that, when used as co-immunogen, C. simus and C. durissus ruruima venoms exert a deleterious effect on the antibody response towards different components of B. asper venom and in the neutralization of hemorrhagic and coagulant effect of this venom when compared with a monospecific B. asper antivenom. Polyspecific antivenoms produced by purifying immunoglobulins from the plasma of animals immunized with venom mixtures showed higher antibody titers and neutralizing capacity than those produced by mixing antibodies purified from the plasma of animals immunized separately with single venom. Thus, despite the deleterious effect of Crotalus sp venoms on the immune response against B. asper venom, the use of venom mixtures is more effective than the immunization with separate venoms for the preparation of polyspecific bothropic-crotalic antivenoms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  15. Tooth damage in captive orcas (Orcinus orca).

    Science.gov (United States)

    Jett, John; Visser, Ingrid N; Ventre, Jeffrey; Waltz, Jordan; Loch, Carolina

    2017-12-01

    Tooth damage as a result of oral stereotypies is evident in captive orca, yet little research on the topic exists. This study examines the associations between dental pathology, sex, facility, duration of captivity and other factors in captive orca. We evaluated mandibular and maxillary teeth from dental images of 29 captive orca owned by a US-based theme park. Each tooth was scored for coronal wear, wear at or below gum line and bore holes. Fractured and missing teeth were also noted. Summary statistics described the distribution and severity of pathologies; inferential statistics examined how pathologies differed between sexes, between wild-captured and captive-born orcas and between captive orca at four facilities. We also evaluated how dental pathology and duration of captivity were related. Approximately 24% of whales exhibited "major" to "extreme" mandibular coronal tooth wear, with coronal wear and wear at or below gum line highly correlated. More than 60% of mandibular teeth 2 and 3 exhibited fractures. Bore holes were observed primarily among anterior mandibular teeth, with more than 61% of teeth 2 and 3 bearing evidence of having been drilled. Four of five orca with the highest age-adjusted tooth pathology indices were captive-born. Various dental pathologies were observed across all whales, with pathologies beginning at a young age. Oral stereotypies exhibited by captive orca contributed to the observed dental damage. By making dental and health records of captive whales publicly available, the theme park industry is uniquely positioned to provide further insight into dental pathology and resultant health consequences in captive orca. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Assess Current and Potential Salmonid Production in Rattlesnake Creek Associated with Restoration Efforts; Underwood Conservation District, Annual Report 2002-2003.

    Energy Technology Data Exchange (ETDEWEB)

    White, Jim

    2004-02-01

    This project addresses existing habitat conditions, fish population status, and restoration priority sites within the Rattlesnake Creek watershed, a sub-basin of the White Salmon River. Our partners in this project are the United States Geological Service (USGS), and the Yakama Indian Nation (YIN). Underwood Conservation District (UCD) is involved in the project via accomplishment of water quality monitoring, sampling for stable isotopes, and characterization of the watershed geomorphology. These work items are part of an effort to characterize the stream and riparian habitat conditions in Rattlesnake Creek, to help guide habitat and fish restoration work. Water chemistry and temperature information is being collected both on Rattlesnake Creek, and on other tributaries and the main stem of the White Salmon River. Information on the entire system enables us to compare results obtained from Rattlesnake Creek with the rest of the White Salmon system. Water chemistry and temperature data have been collected in a manner that is comparable with data gathered in previous years. The results from data gathered in the 2001-2002 performance period are reported in appendix A at the end of this 2002-2003 report. Additional work being conducted as part of this study includes; an estimate of salmonid population abundance (YIN and USGS); a determination of fish species composition, distribution, and life history (YIN and USGS), and a determination of existing kinds, distribution, and severity of fish diseases (YIN and USGS). The overall objective is to utilize the above information to prioritize restoration efforts in Rattlesnake Creek.

  17. Isolation and characterization of a convulxin-like protein from Crotalus durissus collilineatus venom.

    Science.gov (United States)

    Toyama, M H; Carneiro, E M; Marangoni, S; Amaral MEC; Velloso, L A; Boschero, A C

    2001-10-01

    A convulxin (Cvx)-like protein was isolated from Crotalus durissus collilineatus venom by a combination of molecular exclusion and reversed-phase HPLC chromatographies. The molecular mass of the Cvx-like protein in the absence and presence of DTT was 78 kDa and 12-13 kDa, respectively. The Cvx-like protein consisted of two nonidentical polypeptide chains (alpha and beta). The N-terminal amino-acid sequences of the alpha and beta subunits were GLHCPSDWYAYDGHCYKIFNEEMNWED and GFCCPSHWSSYSRYCYKFFSQEMNWEDAEK, respectively, with both subunits having a high content of Glu, Ser, Cys, and Asp. The Cvx-like protein showed high homology with other venom C-type lectins, but had low hemagglutinating activity on intact and trypsinized erythrocytes. The Cvx-like protein stimulated insulin receptor phosphorylation and potentiated insulin secretion from isolated islets in the presence of sub- (2.8 mM) or supra-physiological (16.7 mM) glucose concentrations. These results suggest that the increase in insulin secretion induced by Cvx-like protein may be mediated by a protein tyrosine kinase-dependent pathway and may involve other membrane receptors, such as GP VI or Scr family proteins.

  18. Inflammatory Mediators Release in Urine from Mice Injected with Crotalus durissus terrificus Venom

    Science.gov (United States)

    Hernández Cruz, A.; Barbosa Navarro, L.; Mendonça, R. Z.; Petricevich, V. L.

    2011-01-01

    In this study, we investigated in groups of female BALB/c mice injected with Crotalus durissus terrificus venom (Cdt) the renal function based on creatinine clearance, percentage of fractional excretion cytokines and histological examination of renal tissue. Cdt caused renal alterations that induced proteinuria during the initial hours post-venom and reduced creatinine clearance 15 min. up to 2 hours post-venom administration. In urine from mice injected with Cdt induced a decrease in IL-4 levels. More pronounced increments of IL-5, IL-6 and IFN-γ were observed after 15 and 30 min, respectively. The highest levels of TNF and IL-10 were observed at 1 and 4 hs, respectively. The ratios of pro- and anti-inflammatory cytokines in animals injected with Cdt, which may be manifested in the inflammatory status during the envenoming. In groups of animals treated with Cdt were observed a decreasing in creatinine clearance and its effect on glomerular filtration rate was accompanied by decreased fractional excretion of cytokines and morphologic disturbances. This loss of change selectively in envenomation could thus explain why the relatively excretion of cytokines is reduced while of total proteins increases. In conclusion the fractional excretion of cytokines is significantly reduced in mice injected with Cdt, despite proteinuria. PMID:22174490

  19. Occurrence of Cryptosporidium (Apicomplexa, Cryptosporidiidae in Crotalus durissus terrificus (Serpentes, Viperidae in Brazil

    Directory of Open Access Journals (Sweden)

    Karasawa Andréa Satie Matsubara

    2002-01-01

    Full Text Available The objective of the present study was to investigate the prevalence of Cryptosporidium (Apicomplexa, Cryptosporidiidae in the snake Crotalus durissus terrificus (Serpentes, Viperidae. Fifty animals were evaluated for the presence of oocysts of Cryptosporidium sp. at the time of arrival and 30 and 60 days later. Intestinal washings with saline solution (1% body weight, fecal samples, and organ scrapings were collected during the study. Oocysts were concentrated by an ether-phosphate-buffered saline sedimentation technique and then separated by a density gradient centrifugation technique. Smears were made with the sediment and submitted to modified acid-fast and auramine-rhodamine staining. Cryptosporidium-positive smears were used as controls for the experimental findings. The overall prevalence of Cryptosporidium sp. oocysts was 14%. Among the positive snakes, oocysts were detected only in the intestinal washing in two specimens, only in the feces in four specimens, and in both materials at least once in one specimen. The positive snakes were predominantly from Santa Maria da Serra city State of São Paulo (57.1%. We also observed that all of the examinations that presented positive results were obtained at least 27 days after the capture of the animals.

  20. Pro- and Anti-Inflammatory Cytokines Release in Mice Injected with Crotalus durissus terrificus Venom

    Directory of Open Access Journals (Sweden)

    A. Hernández Cruz

    2008-01-01

    Full Text Available The effects of Crotalus durissus terrificus venom (Cdt were analyzed with respect to the susceptibility and the inflammatory mediators in an experimental model of severe envenomation. BALB/c female mice injected intraperitoneally presented sensibility to Cdt, with changes in specific signs, blood biochemical and inflammatory mediators. The venom induced reduction of glucose and urea levels and an increment of creatinine levels in serum from mice. Significant differences were observed in the time-course of mediator levels in sera from mice injected with Cdt. The maximum levels of IL-6, NO, IL-5, TNF, IL-4 and IL-10 were observed 15 min, 30 min, 1, 2 and 4 hours post-injection, respectively. No difference was observed for levels of IFN-γ. Taken together, these data indicate that the envenomation by Cdt is regulated both pro- and anti-inflammatory cytokine responses at time-dependent manner. In serum from mice injected with Cdt at the two first hours revealed of pro-inflammatory dominance. However, with an increment of time an increase of anti-inflammatory cytokines was observed and the balance toward to anti-inflammatory dominance. In conclusion, the observation that Cdt affects the production of pro- and anti-inflammatory cytokines provides further evidence for the role played by Cdt in modulating pro/anti-inflammatory cytokine balance.

  1. Pulmonary mechanic and lung histology induced by Crotalus durissus cascavella snake venom.

    Science.gov (United States)

    Oliveira Neto, Joselito de; Silveira, João Alison de Moraes; Serra, Daniel Silveira; Viana, Daniel de Araújo; Borges-Nojosa, Diva Maria; Sampaio, Célia Maria Souza; Monteiro, Helena Serra Azul; Cavalcante, Francisco Sales Ávila; Evangelista, Janaina Serra Azul Monteiro

    2017-10-01

    This study have analyzed the pulmonary function in an experimental model of acute lung injury, induced by the Crotalus durissus cascavella venom (C. d. cascavella) (3.0 μg/kg - i.p), in pulmonary mechanic and histology at 1 h, 3 h, 6 h, 12 h and 24 h after inoculation. The C. d. cascavella venom led to an increase in Newtonian Resistance (R N ), Tissue Resistance (G) and Tissue Elastance (H) in all groups when compared to the control, particularly at 12 h and 24 h. The Histeresivity (η) increased 6 h, 12 h and 24 h after inoculation. There was a decrease in Static Compliance (C ST ) at 6 h, 12 h and 24 h and inspiratory capacity (IC) at 3 h, 6 h, 12 h and 24 h. C. d. cascavella venom showed significant morphological changes such as atelectasis, emphysema, hemorrhage, polymorphonuclear inflammatory infiltrate, edema and congestion. After a challenge with methacholine (MCh), R N demonstrated significant changes at 6, 12 and 24 h. This venom caused mechanical and histopathological changes in the lung tissue; however, its mechanisms of action need further studies in order to better elucidate the morphofunctional lesions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Biochemical and biological evaluation of gyroxin isolated from Crotalus durissus terrificus venom

    Directory of Open Access Journals (Sweden)

    LC Barros

    2011-01-01

    Full Text Available Gyroxin, a thrombin-like enzyme isolated from Crotalus durissus terrificus venom and capable of converting fibrinogen into fibrin, presents coagulant and neurotoxic activities. The aim of the present study was to evaluate such coagulant and toxic properties. Gyroxin was isolated using only two chromatographic steps - namely gel filtration (Sephadex G-75 and affinity (Benzamidine Sepharose 6B - resulting in a sample of high purity, as evaluated by RP-HPLC C2/C18 and electrophoretic analysis that showed a molecular mass of 30 kDa. Gyroxin hydrolyzed specific chromogenic substrates, which caused it to be classified as a serine proteinase and thrombin-like enzyme. It was stable from pH 5.5 to 8.5 and inhibited by Mn²+, Cu²+, PMSF and benzamidine. Human plasma coagulation was more efficient at pH 6.0. An in vivo toxicity test showed that only behavioral alterations occurred, with no barrel rotation. Gyroxin was not able to block neuromuscular contraction in vitro, which suggests that its action, at the studied concentrations, has no effect on the peripheral nervous system.

  3. Crotalus atrox Venom Exposed to Carbon Monoxide Has Decreased Fibrinogenolytic Activity In Vivo in Rabbits.

    Science.gov (United States)

    Nielsen, Vance G

    2018-01-01

    Envenomation by haemotoxic enzymes remains a significant source of human morbidity and mortality worldwide, with administration of long-acting or multiple doses of antivenom first-line therapy. However, coagulopathy can still occur and recur. Of interest, it has been recently demonstrated that direct, isolated exposure of snake venom enzymes with fibrinogenolytic activity to carbon monoxide (CO) abrogates venom-mediated loss of coagulation in human plasma. These observations of CO inhibition of venom fibrinogenolytic activity were subsequently repeated in rabbit whole blood. This study sought to translate these findings in an in vivo rabbit model of envenomation with fibrinogenolytic Crotalus atrox venom. Sedated rabbits were intravenously administered C. atrox venom (400 μg/kg) pre-exposed to 0 or 1000 μM carbon monoxide-releasing molecule-2 (CORM-2) in vitro. Arterial whole-blood samples demonstrated that compared to pre-envenomation values, the CORM-2-naïve venom significantly prolonged the onset of coagulation, decreased the velocity of clot growth and decreased clot strength as determined by thromboelastography an hour after venom injection. In contrast, CORM-2 pre-exposure prevented or attenuated C. atrox venom effects on coagulation kinetics. Future studies to determine whether rabbits injected with such venom subcutaneously/intramuscularly can have consequent coagulopathy abrogated by injection of carbon monoxide-releasing molecules into the 'bite site' are justified. © 2017 Nordic Association for the Publication of BCPT (former Nordic Pharmacological Society).

  4. Effects of gamma radiation on isolated toxin of Crotalus durissus terrificus

    International Nuclear Information System (INIS)

    Souza Filho, J.N.; Rogero, J.R.

    1988-07-01

    It is know that the ionizing radiation is able to change significantly the biological and antigenic behaviour of a toxin depending of the dose and radiation's conditions, probably by structural alterations caused by radiation. In this paper, the crotoxin, principal neurotoxin of the south american rattlesnake venom, was isolated using molecular exclusion cromatography with Sephadex G-75 and followed by precipitation of the isoeletric point. (pI 4.7.). Fractions in the concentration of 2 mg toxin/ml 0.85 % NaCl were irradiated in a source of 60 Co GAMMACELL with dose rate of 1100 Gy/hr using doses of 250,500, 1000, 1500 and 2000 Gy. It was determinated for this samples, the proteic concentration (Lowry's method), the antigenic capability using crotalic antiserum by the diffusion imunoassay (Ouch - terlony's method), the DL50 in mice and eletrophoresis (SDS-PAGE). The results showed that the antigenic capability seems to be intact until dose of 1000 Gy. By the other hand, the LD50 in the same radiation dose increases more than two times when compared with the native sample. As the radiation dose increases, the solutions became turbid showing loss of protein probably by the presence of aggregates as can be seen by the determination of the proteic concentration and the eletrophoretic control. Other important changs were observed with the irrdiated samples in comparison with the native crotoxin that can given us additional information about dose-effect event. (author) [pt

  5. Effects of ionizing radiation on crotoxin (toxin of Crotalus durissus terrificus venom): molecular studies

    International Nuclear Information System (INIS)

    Souza Filho, J.N. de.

    1988-01-01

    It is know that the ionizing radiation is able to change significantly the biological and antigenic response of a toxin depending of the dose and irradiation's conditions, probable by structural alterations caused by radiation. In this work, the crotoxin, principal neurotoxin of the South American rattlesnake venom, was isolated using molecular exclusion chromatography with Sephadex G-75 and follwed by precipitation on the isoelectric point. Fractions in the concentration of 2 mg of protein/m1 0.85% NaCl were irradiated in a source of sup(60)Co GAMMACELL with dose rate of 1100 Gy/h using doses of 250, 500, 1000, 1500 and 2000 Gy. It was determinated for these samples, the proteic concentration (Lowry's method), the content sulphydryl (Ellman's method), the profile electrophoretic (SDS-PAGE), the toxicity by lethal dose 50% in mice and the antigenic response using crotalic antiserum by the diffusion imunoassay (Ouchterlony's method). The results showed the formation of aggregates and loss of protein in solution by precipitation. In the dose of 1000 Gy and higher it was possible to observe the presence of sulphydryl groups indicating the breakage of S-S bridges. The lethal dose 50% increased 2 times for the dose of 1000 Gy and 3.5 times for 1500 Gy shoding a detoxication. By the other hand, the antigenic response seems to be still intact at doses up to 1000 Gy. (author)

  6. Comprometimento respiratório secundário a acidente ofídico crotálico (Crotalus durissus Respiratory abnormalities following Crotalus durissus snakebite

    Directory of Open Access Journals (Sweden)

    Carlos Faria Santos Amaral

    1991-08-01

    Full Text Available São analisados três pacientes que apresentaram comprometimento da função respiratória após acidente por Crotalus durissus. As manifestações respiratórias surgiram nas primeiras 48 horas após a picada do ofídio e consistiram de dispnéia, taquipnéia, uso da musculatura acessória da respiração (casos 1 e 2 e batimento das aletas nasais (caso 2. Dois pacientes (casos 1 e 2 apresentaram insuficiência respiratória aguda. O diagnóstico desta complicação no caso 1 foi clínico pois o paciente apresentou apnéia. O paciente do caso 2, 24 horas após o acidente ofídico apresentou dificuldade respiratória intensa e períodos de apnéia sendo intubado, permanecendo em respiração espontânea. Houve agravamento dos sinais clínicos de insuficiência respiratória e a determinação de pH e gases do sangue arterial mostrou em relação ao exame inicial elevação da pressão parcial de gás carbônico (40 mmHg para 50,3 mm Hg caracterizando insuficiência ventilatória aguda. Ambos foram tratados com emprego de ventilação artificial mecânica, tendo o paciente do caso 1 permanecido no ventilador durante 33 dias e o do caso 2 durante 15 dias. Ambos desenvolveram insuficiência renal aguda, necessitaram de diálise peritoneal e recuperaram a função renal. A paciente do caso 3, apesar dos sintomas e sinais de comprometimento respiratório não apresentou alterações do pH e gases arteriais. Espirometria realizada 58 horas após o acidente mostrou capacidade vital forçada (CVF e volume espirado no primeiro segundo (VEF1 abaixo do previsto (60 e 67% respectivamente. As espirometrias realizadas nos dias subseqüentes evidenciaram melhora progressiva destes parâmetros. No 10º dia após o acidente constatou-se aumento de 20% da CVF e de 17% do VEF1 comparativamente ao exame inicial. A relação entre VEF1 e a CVF manteve-se praticamente inalterada e em valores próximos ao previsto, caracterizando distúrbio ventilatório do tipo

  7. Liver dysfunction in patients bitten by Crotalus durissus terrificus (Laurenti, 1768 snakes in Botucatu (State of São Paulo, Brazil Alterações hepáticas em doentes picados por serpentes Crotalus durissus terrificus (Laurenti, 1768 na região de Botucatu, Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Benedito Barra Viera

    1995-02-01

    Full Text Available Thirty-two patients bitten by venomous snakes sixteen by Bothrops spp. and sixteen by Crotalus durissus terrificus were studied. The group comprised thirty males and two females, aged eight to sixty-three years (mean 33±15. Bromsulphalein tests were increased in the majority of patients bitten by Crotalus durissus terrificus. The correlation coefficient of Spearman was positive between bromsulphalein tests and alanine aminotransferase levels, and between alanine aminotransferase and aspartate aminotransferase levels only in the Crotalus group. The only patient who died was bitten by Crotalus durissus terrificus and showed hydropic degeneration and mitochondrial injury in the liver. It was concluded that the hepatic damage might have been caused by at least two possible mechanisms: venom effect on liver mitochondria and cytokine effects on hepatocyte, specially interleukin-6.Os autores estudaram 32 doentes picados por serpentes venenosas, sendo 16 picados por Bothrops spp. e 16 por Crotalus durissus terrificus. Trinta doentes eram do sexo masculino e dois do feminino com idades variando entre 8 e 63 anos (méda 33±15. A prova da retenção da bromosulfaleína apresentou-se aumentada na maioria dos doentes picados por serpentes Crotalus durissus terrificus. Houve correlação positiva entre a retenção da bromosulfaleína e os níveis séricos de alanina aminotransferase e entre alanina e aspartato aminotransferase apenas nos doentes do grupo Crotalus. Um dos doentes evoluiu para o óbito e apresentou no exame anatomopatológico do fígado degeneração hidrópica e lesões mitocondriais. Os autores concluem que as alterações hepáticas são causadas por pelo menos dois mecanismos a saber: lesão mitocondrial por efeito do veneno crotálico; efeito das citoquinas, especialmente a interleucina-6.

  8. [Leukosis in captive wild birds].

    Science.gov (United States)

    Loupal, G

    1984-10-01

    Among 2589 captive wild birds, examined between 1974 and 1983, we found leukosis in 26 birds belonging to 13 different species and five orders. We diagnosed lymphoid leukosis in 11 birds (two Melopsittacus undulatus, two Psittacus erithacus one Platycerus eximius, one Columba livia, one Streptopelia decaocto, one Polyplectron bicalcaratum, one Pavo cristatus, one Aptenodytes patachonia and one finch, species unknown), myeloid leukosis in 14 (nine Melopsittacus undulatus, two Agapomis personata fischeri, two Urgeainthus bengalus and one Neophemia pulchella) and stem cell leukosis in one bird (Serinus canaria). Among the cases with lymphoid leukosis we distinguished between lymphoblastic (four cases) and prolymphocytic forms (seven). Myeloid leukosis was subdivided into poorly differentiated (12 cases) and well differentiated myeloblastosis (two).

  9. Pox infection among captive peacocks.

    Science.gov (United States)

    Al Falluji, M M; Tantawi, H H; Al-Bana, A; Al-Sheikhly, S

    1979-10-01

    An outbreak of avian pox was detected among captive peacocks (Pavo cristatus) at Baghdad Zoological Park during spring, 1978. A total of 45 of the 60 birds in the aviary developed pox lesions around the beaks and eyes. Morbidity was 75% and mortality was 13%. A virus isolated from the skin lesions produced large plaques on the chorioallantoic membrane of developing chicken embryos and induced cytopathic effect characteristic for pox viruses in chicken embryo cell cultures. The virus neither haemagglutinated nor haemadsorbed to chicken erythrocytes. It was ether resistant and chloroform sensitive. Chickens inoculated with the virus by scarification developed localized pox-like lesions, while turkeys had only transient swelling of feather follicles at the site of inoculation. Virus partially purified with Genetron 113 was precipitated by antisera to fowlpox and pigeon pox viruses.

  10. Cloning of subunits of convulxin, a collagen-like platelet-aggregating protein from Crotalus durissus terrificus venom.

    OpenAIRE

    Leduc, M; Bon, C

    1998-01-01

    Convulxin (CVX) is a potent platelet-aggregating glycoprotein from the venom of the snake Crotalus durissus terrificus. It consists of two subunits, alpha and beta, joined by disulphide bridges in a hexameric structure. A cDNA library from venom gland was constructed in the vector pT3T7. The cloned cDNAs encoding the two chains of CVX were sequenced. Both are preceded by an identical 23-amino acid peptide signal sequence and encode sequences of 135 amino acids for the alpha chain and 125 amin...

  11. Behavioral aspects of captive birds of prey.

    Science.gov (United States)

    Jones, M P

    2001-09-01

    This article describes concepts of raptor behavior in captive birds of prey with inferences from the behavior of their wild counterparts that will assist the veterinarian in understanding the causes of managing abnormal behaviors.

  12. Hydrologic test results for the Rattlesnake Ridge interbed and Pomona basalt flow top at Borehole DB-15

    International Nuclear Information System (INIS)

    Strait, S.R.; Brown, W.R.

    1983-07-01

    This report presents results and description of hydrologic test activities for the Rattlesnake Ridge interbed and Pomona basalt flow top at Borehole DB-15. Hydrologic tests conducted include constant discharge air-lift and constant discharge submersible pumping tests. An observed hydraulic head for the test interval was 409 ± 1 feet above mean sea level. Transmissivity values determined from hydrologic tests performed, ranged between 493 and 469 ft 2 /day. The best estimate of transmissivity is 480 ft 2 /day. The best estimate of equivalent hydraulic conductivity, based on an effective test thickness of 56 feet is 8.6 ft/day. 4 refs., 7 figs., 2 tabs

  13. Thrombelastographic characterization of the thrombin-like activity of Crotalus simus and Bothrops asper venoms.

    Science.gov (United States)

    Nielsen, Vance G; Boyer, Leslie V; Redford, Daniel T; Ford, Paul

    2017-04-01

    : Annually, thousands suffer venomous snake-bite from Crotalus simus and Bothrops asper vipers in central and South America. The goals of the present study were to generally characterize the thrombin-like effects of venom from these snakes in human plasma with viscoelastic methods. Human plasma was exposed to the venom of three different C. simus subspecies and venoms obtained from B. asper vipers located in three different locations in Mexico. To characterize the factor X-activating and thrombin-like activity of these venoms, plasma (normal or factor XIII deficient) was pretreated with a variety of additives (e.g., heparin) in the absence or presence of calcium prior to exposure to 2.0 μg/ml of each viper's venom. These profiles were compared with plasma without venom that had contact activation of coagulation. Coagulation kinetics were determined with thrombelastography. All venoms had thrombin-like activity, with C. s. simus creating a slow growing, weak clot that was likely mediated by metalloproteinases. In contrast, B. asper venoms had rapid onset of coagulation and a high velocity of thrombus growth. Further, B. asper venom activity was calcium-independent, activated prothrombin, activated factor XIII, and independently polymerized fibrinogen. The viscoelastic methods used were able to differentiate subspecies of C. simus and specimens of B. asper, and provide insight into the mechanisms by which the venoms acted on plasma. These methods may be useful in the profiling of similar venoms and perhaps can assist in the assessment of interventions designed to treat envenomation (e.g., antivenom).

  14. NO production and potassium channels activation induced by Crotalus durissus cascavella underlie mesenteric artery relaxation.

    Science.gov (United States)

    Santos, S S; Jesus, R L C; Simões, L O; Vasconcelos, W P; Medeiros, I A; Veras, R C; Casais-E-Silva, L L; Silva, D F

    2017-07-01

    Animal toxins are natural resources for pharmacological studies. The venom of Crotalus durissus cascavella (C.d. cascavella) may be a source in the bio-prospecting of new anti-hypertensive agents. The aim of this study was to investigate vascular effects of the venom of C.d. cascavella in normotensive rats. Studies were performed using isolated mesenteric artery segments and aortic endothelial cells. The cumulative administration of the venom of C.d. cascavella (0.001-30 μg/mL) on phenylephrine (Phe; 10 μM) pre-contracted rings induced a concentration-dependent vasorelaxation in the presence of vascular endothelium (E max  = 47.9 ± 5.0% n = 8), and its effect was almost abolished in the absence of endothelium (E max  = 5.8± 2.4% n = 5 ( ∗∗∗ p stable radical scavenger for nitric oxide (E max  = 10.77± 3.6%, n = 6). Moreover, the venom induced the release of NO by isolated aortic endothelial cells through amperometric studies. When assessing the participation of K + channels on the vasodilatory response of the venom, tyrode solution with 20 mM of KCl caused a significant reduction in the relaxation response (p channels (4-amynopiridine 1 mM; E max  = 9.5 ± 1.3, %, n = 5, ***p channels. These data illustrate that C.d. cascavella is a source of bioactive molecules and therefore has therapeutic potential in the treatment of cardiovascular diseases such as hypertension. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. The Compartment Syndrome Associated with Deep Vein Thrombosis due to Rattlesnake Bite: A Case Report

    Directory of Open Access Journals (Sweden)

    Radu Ciprian Tincu

    2017-08-01

    Full Text Available Background: Snakebite is a health issue specific to some parts of the world, especially in the tropical area, where it produces many victims. The main clinical damage caused by snake bite involves hemotoxic, neurotoxic and myotoxic reactions. It is also established that the importance of systemic impairment varies according to individual factors and are related to organ dysfunction, shock or hypotension. We report the case of a young woman suffering from snakebite who developed deep vein thrombosis and compartment syndrome. Case Report: We present the case of a 32-year-old Romanian woman who was injured by her own Crotalinae snake (also known as pit viper or rattlesnake on her left forearm. When admitted to our Emergency Department, she was conscious with a Glasgow coma scale of 12/15, somnolent, febrile, suffering of headache, tachypnea; the marks of the snakebite were located in the distal part of the anterior left forearm; she had pain and bleeding at the bite site and swelling of the left upper limb with lymphangitis up to the axilla. She experienced fasciotomy-requiring compartment syndrome of the upper limb and required unfractionated heparin and closed monitored using activated partial thromboplastin time evolution due micro-thrombosis in the brachial vein. Local improvement was achieved in the next 4 days with progressive diminish of local tenderness and swelling. Conclusion: Limb deep vein thrombosis might be induced by snakebite, despite pro-hemorrhagic general condition induced by the envenomation. High index of clinical suspicion is needed for early diagnosis and timely management which can improve survival of these patients

  16. Dendrogeomorphic Assessment of the Rattlesnake Gulf Landslide in the Tully Valley, Onondaga County, New York

    Science.gov (United States)

    Tamulonis, Kathryn L.; Kappel, William M.

    2009-01-01

    Dendrogeomorphic techniques were used to assess soil movement within the Rattlesnake Gulf landslide in the Tully Valley of central New York during the last century. This landslide is a postglacial, slow-moving earth slide that covers 23 acres and consists primarily of rotated, laminated, glaciolacustrine silt and clay. Sixty-two increment cores were obtained from 30 hemlock (Tsuga canadensis) trees across the active part of the landslide and from 3 control sites to interpret the soil-displacement history. Annual growth rings were measured and reaction wood was identified to indicate years in which ring growth changed from concentric to eccentric, on the premise that soil movement triggered compensatory growth in displaced trees. These data provided a basis for an 'event index' to identify years of landslide activity over the 108 years of record represented by the oldest trees. Event-index values and total annual precipitation increased during this time, but years with sudden event-index increases did not necessarily correspond to years with above-average precipitation. Multiple-regression and residual-values analyses indicated a possible correlation between precipitation and movement within the landslide and a possible cyclic (decades-long) tree-ring response to displacement within the landslide area from the toe upward to, and possibly beyond, previously formed landslide features. The soil movement is triggered by a sequence of factors that include (1) periods of several months with below-average precipitation followed by persistent above-average precipitation, (2) the attendant increase in streamflow, which erodes the landslide toe and results in an upslope propagation of slumping, and (3) the harvesting of mature trees within this landslide during the last century and continuing to the present.

  17. Assess Current and Potential Salmonid Production in Rattlesnake Creek in Association with Restoration Efforts, US Geological Survey Report, 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Allen, M. Brady; Connolly, Patrick J.; Jezorek, Ian G. (US Geological Survey, Western Fisheries Research Center, Columbia River Research Laboratory, Cook, WA)

    2006-06-01

    This project was designed to document existing habitat conditions and fish populations within the Rattlesnake Creek watershed (White Salmon River subbasin, Washington) before major habitat restoration activities are implemented and prior to the reintroduction of salmon and steelhead above Condit Dam. Returning adult salmon Oncorhynchus spp. and steelhead O. mykiss have not had access to Rattlesnake Creek since 1913. An assessment of resident trout populations should serve as a good surrogate for evaluation of factors that would limit salmon and steelhead production in the watershed. Personnel from United States Geological Survey's Columbia River Research Laboratory (USGS-CRRL) attended to three main objectives of the Rattlesnake Creek project. The first objective was to characterize stream and riparian habitat conditions. This effort included measures of water quality, water quantity, stream habitat, and riparian conditions. The second objective was to determine the status of fish populations in the Rattlesnake Creek drainage. To accomplish this, we derived estimates of salmonid population abundance, determined fish species composition, assessed distribution and life history attributes, obtained tissue samples for genetic analysis, and assessed fish diseases in the watershed. The third objective was to use the collected habitat and fisheries information to help identify and prioritize areas in need of restoration. As this report covers the fourth year of a five-year study, it is largely restricted to describing our efforts and findings for the first two objectives.

  18. Assess Current and Potential Salmonid Production in Rattlesnake Creek in Association with Restoration Effors; US Geological Survey Reports, 2003-2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Allen, M. Brady; Connolly, Patrick J.; Munz, Carrie S. (US Geological Survey, Western Fisheries Research Center, Columbia River Research Laboratory, Cook, WA)

    2006-02-01

    This project was designed to document existing habitat conditions and fish populations within the Rattlesnake Creek watershed (White Salmon River subbasin, Washington) before major habitat restoration activities are implemented and prior to the reintroduction of salmon and steelhead above Condit Dam. Returning adult salmon Oncorhynchus spp. and steelhead O. mykiss have not had access to Rattlesnake Creek since 1913. An assessment of resident trout populations should serve as a good surrogate for evaluation of factors that would limit salmon and steelhead production in the watershed. Personnel from United States Geological Survey's Columbia River Research Laboratory (USGS-CRRL) attend to three main objectives of the Rattlesnake Creek project. The first is to characterize stream and riparian habitat conditions. This effort includes measures of water quality, water quantity, stream habitat, and riparian conditions. The second objective is to determine the status of fish populations in the Rattlesnake Creek drainage. To accomplish this, we derived estimates of salmonid population abundance, determined fish species composition, assessed distribution and life history attributes, obtained tissue samples for genetic analysis, and assessed fish diseases in the watershed. The third objective was to use the collected habitat and fisheries information to help identify and prioritize areas in need of restoration. As this report covers the third year of at least a five-year study, it is largely restricted to describing our efforts and findings for the first two objectives.

  19. Assess Current and Potential Salmonid Production in Rattlesnake Creek Associated with Restoration Efforts; US Geological Survey Reports, 2002-2003 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Patrick J. (US Geological Survey, Columbia River Research Laboratory, Western Fisheries Research Center, Cook, WA)

    2003-12-01

    This project was designed to document existing habitat conditions and fish populations within the Rattlesnake Creek watershed (White Salmon River subbasin, Washington) before major habitat restoration activities are implemented and prior to the reintroduction of salmon and steelhead above Condit Dam. Returning adult salmon Oncorhynchus spp. and steelhead O. mykiss have not had access to Rattlesnake Creek since 1913. An assessment of resident trout populations should serve as a good surrogate for evaluation of factors that would limit salmon and steelhead production in the watershed. Personnel from United States Geological Survey's Columbia River Research Laboratory (USGS-CRRL) attend to three main objectives of the Rattlesnake Creek project. The first is to characterize stream and riparian habitat conditions. This effort includes measures of water quality, water quantity, stream habitat, and riparian conditions. The second objective is to determine the status of fish populations in the Rattlesnake Creek drainage. To accomplish this, we derived estimates of salmonid population abundance, determined fish species composition, assessed distribution and life history attributes, obtained tissue samples for genetic analysis, and assessed fish diseases in the watershed. The third objective is to use the collected habitat and fisheries information to help identify and prioritize areas in need of restoration. As this report covers the second year of at least a three-year study, it is largely restricted to describing our efforts and findings for the first two objectives.

  20. An outbreak of fungal dermatitis and stomatitis in a free-ranging population of pigmy rattlesnakes (Sistrurus miliarius barbouri) in Florida.

    Science.gov (United States)

    Cheatwood, Joseph L; Jacobson, Elliott R; May, Peter G; Farrell, Terence M; Homer, Bruce L; Samuelson, Don A; Kimbrough, James W

    2003-04-01

    Between September 1997 and March 1998, a severe skin, eye, and mouth disease was observed in a population of dusky pigmy rattlesnakes (Sistrurus miliarius barbouri), at the Lake Woodruff National Wildlife Refuge in Volusia County, Florida (USA). Three affected pigmy rattlesnakes were submitted for necropsy. All snakes had severe necrotizing and predominantly granulomatous dermatitis, stomatitis, and ophthalmitis, with involvement of the subadjacent musculature and other soft tissues. Numerous fungal hyphae were seen throughout tissue sections stained with periodic acid Schiff and Gomori's methenamine silver. Samples of lesions were cultured for bacteria and fungi. Based on hyphae and spore characteristics, four species of fungi were identified from culture: Sporothrix schenckii, Pestalotia pezizoides, Geotrichum candidum (Galactomyces geotrichum), and Paecilomyces sp. While no additional severely affected pigmy rattlesnakes were seen at the study site, a garter snake (Thamnophis sirtalis) and a ribbon snake (Thamnophis sauritis) with similar lesions were found. In 1998 and 1999, 42 pigmy rattlesnakes with multifocal minimal to moderate subcutaneous masses were seen at the study site. Masses from six of these snakes were biopsied in the field. Hyphae morphologically similar to those seen in the severe cases were observed with fungal stains. Analysis of a database representing 10,727 captures in previous years was performed after the 1998 outbreak was recognized. From this analysis we determined that 59 snakes with clinical signs similar to those seen during the 1998 outbreak were documented between 1992 and 1997. This study represents the first documented report of a mycotic disease of free-ranging snakes.

  1. Laboratory evaluation of young ovines inoculated with natural or 60co-irradiated Crotalus durissus terrificus venom during hyperimmunization process

    Directory of Open Access Journals (Sweden)

    R. S. Ferreira Junior

    2006-01-01

    Full Text Available Laboratory profile of young ovines was studied in order to evaluate and compare their antiserum production from natural and Cobalt-60 irradiated Crotalus durissus terrificus (C.d.t. venoms. The parameters analyzed included complete blood count, and urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin serum measurements. Three groups of six animals each were used. Group 1 (G1 received natural C.d.t. venom; Group 2 (G2 received irradiated C.d.t. venom; and Group 3 (G3 was used as control and did not receive venom, only adjuvants, using seven venom inoculations. During the experimental period, animals were fortnightly weighed. According to clinical and weight evaluation, sheep in post-weaning phase showed no changes in their physiological profiles but had excellent weight gain. The parameters analyzed were not statistically different (p<5% among the groups tested. The hyperimmunization process was successfully accomplished with the production of specific antibodies against Crotalus durissus terrificus venom. Results bring a new possibility of utilizing ovines in the commercial production of anticrotalic serum, which may be used to treat human and animal envenomation. Its production cost may be reduced by subsequent use of hyperimmunized sheep for human consumption.

  2. ACUTE KIDNEY INJURY CAUSED BY Crotalus AND Bothrops SNAKE VENOM: A REVIEW OF EPIDEMIOLOGY, CLINICAL MANIFESTATIONS AND TREATMENT

    Directory of Open Access Journals (Sweden)

    Polianna L.M.M. Albuquerque

    2013-09-01

    Full Text Available SUMMARY Ophidic accidents are an important public health problem due to their incidence, morbidity and mortality. An increasing number of cases have been registered in Brazil in the last few years. Several studies point to the importance of knowing the clinical complications and adequate approach in these accidents. However, knowledge about the risk factors is not enough and there are an increasing number of deaths due to these accidents in Brazil. In this context, acute kidney injury (AKI appears as one of the main causes of death and consequences for these victims, which are mainly young males working in rural areas. Snakes of the Bothrops and Crotalus genera are the main responsible for renal involvement in ophidic accidents in South America. The present study is a literature review of AKI caused by Bothrops and Crotalus snake venom regarding diverse characteristics, emphasizing the most appropriate therapeutic approach for these cases. Recent studies have been carried out searching for complementary therapies for the treatment of ophidic accidents, including the use of lipoic acid, simvastatin and allopurinol. Some plants, such as Apocynaceae, Lamiaceae and Rubiaceae seem to have a beneficial role in the treatment of this type of envenomation. Future studies will certainly find new therapeutic measures for ophidic accidents.

  3. ACUTE KIDNEY INJURY CAUSED BY Crotalus AND Bothrops SNAKE VENOM: A REVIEW OF EPIDEMIOLOGY, CLINICAL MANIFESTATIONS AND TREATMENT

    Science.gov (United States)

    Albuquerque, Polianna L.M.M.; Jacinto, Camilla N.; Silva, Geraldo B.; Lima, Juliana B.; Veras, Maria do Socorro B.; Daher, Elizabeth F.

    2013-01-01

    SUMMARY Ophidic accidents are an important public health problem due to their incidence, morbidity and mortality. An increasing number of cases have been registered in Brazil in the last few years. Several studies point to the importance of knowing the clinical complications and adequate approach in these accidents. However, knowledge about the risk factors is not enough and there are an increasing number of deaths due to these accidents in Brazil. In this context, acute kidney injury (AKI) appears as one of the main causes of death and consequences for these victims, which are mainly young males working in rural areas. Snakes of the Bothrops and Crotalus genera are the main responsible for renal involvement in ophidic accidents in South America. The present study is a literature review of AKI caused by Bothrops and Crotalus snake venom regarding diverse characteristics, emphasizing the most appropriate therapeutic approach for these cases. Recent studies have been carried out searching for complementary therapies for the treatment of ophidic accidents, including the use of lipoic acid, simvastatin and allopurinol. Some plants, such as Apocynaceae, Lamiaceae and Rubiaceae seem to have a beneficial role in the treatment of this type of envenomation. Future studies will certainly find new therapeutic measures for ophidic accidents. PMID:24037282

  4. Captive Conditions of Pet Lemurs in Madagascar.

    Science.gov (United States)

    Reuter, Kim E; Schaefer, Melissa S

    2016-01-01

    Live extraction of wildlife is a threat to biodiversity and can compromise animal welfare standards. Studies of the captive environments and welfare of pet primates are known, but none has focused on Madagascar. We aimed to expand knowledge about the captive conditions of pet lemurs in Madagascar. We hypothesized that captive lemurs would often be kept in restrictive settings, including small cages, would be fed foods inconsistent with their natural diets and, as a result, would be in bad physical or psychological health. Data were collected via a web-based survey (n = 253 reports) and from the websites and social media pages of 25 hotels. Most lemurs seen by respondents were either kept on a rope/leash/chain or in a cage (67%), though some lemurs were habituated and were not restrained (28%). Most of the time (72%) cages were considered small, and lemurs were rarely kept in captivity together with other lemurs (81% of lemurs were caged alone). Pet lemurs were often fed foods inconsistent with their natural diets, and most (53%) were described as being in bad health. These findings point to a need to undertake outreach to pet lemur owners in Madagascar about the captivity requirements of primates. © 2016 S. Karger AG, Basel.

  5. Genetic adaptation to captivity can occur in a single generation

    OpenAIRE

    Christie, Mark R.; Marine, Melanie L.; French, Rod A.; Blouin, Michael S.

    2011-01-01

    Captive breeding programs are widely used for the conservation and restoration of threatened and endangered species. Nevertheless, captive-born individuals frequently have reduced fitness when reintroduced into the wild. The mechanism for these fitness declines has remained elusive, but hypotheses include environmental effects of captive rearing, inbreeding among close relatives, relaxed natural selection, and unintentional domestication selection (adaptation to captivity). We used a multigen...

  6. Adobe Captivate 7 for mobile learning

    CERN Document Server

    Bruyndonckx, Damien

    2013-01-01

    A tutorial-based approach to learning the basics of Adobe Captivate to help bring your existing eLearning content to mobile platforms. The book will help readers to learn at their own pace with practical examples and step-by-step instructions.This book has been primarily written for teachers, course designers, professors, curriculum experts, subject matter experts, and eLearning developers who want to provide mobile-friendly content to their students.A basic knowledge of your operating system is required to follow the exercises of this book. No prior knowledge of Captivate is required, althoug

  7. Genetic composition of captive panda population.

    Science.gov (United States)

    Yang, Jiandong; Shen, Fujun; Hou, Rong; Da, Yang

    2016-10-03

    A major function of the captive panda population is to preserve the genetic diversity of wild panda populations in their natural habitats. Understanding the genetic composition of the captive panda population in terms of genetic contributions from the wild panda populations provides necessary knowledge for breeding plans to preserve the genetic diversity of the wild panda populations. The genetic contributions from different wild populations to the captive panda population were highly unbalanced, with Qionglai accounting for 52.2 % of the captive panda gene pool, followed by Minshan with 21.5 %, Qinling with 10.6 %, Liangshan with 8.2 %, and Xiaoxiangling with 3.6 %, whereas Daxiangling, which had similar population size as Xiaoxiangling, had no genetic representation in the captive population. The current breeding recommendations may increase the contribution of some small wild populations at the expense of decreasing the contributions of other small wild populations, i.e., increasing the Xiaoxiangling contribution while decreasing the contribution of Liangshan, or sharply increasing the Qinling contribution while decreasing the contributions of Xiaoxiangling and Liangshan, which were two of the three smallest wild populations and were already severely under-represented in the captive population. We developed three habitat-controlled breeding plans that could increase the genetic contributions from the smallest wild populations to 6.7-11.2 % for Xiaoxiangling, 11.5-12.3 % for Liangshan and 12.9-20.0 % for Qinling among the offspring of one breeding season while reducing the risk of hidden inbreeding due to related founders from the same habitat undetectable by pedigree data. The three smallest wild panda populations of Daxiangling, Xiaoxiangling and Liangshan either had no representation or were severely unrepresented in the current captive panda population. By incorporating the breeding goal of increasing the genetic contributions from the smallest wild

  8. Mycobacterium tuberculosis Infection among Asian Elephants in Captivity.

    Science.gov (United States)

    Simpson, Gary; Zimmerman, Ralph; Shashkina, Elena; Chen, Liang; Richard, Michael; Bradford, Carol M; Dragoo, Gwen A; Saiers, Rhonda L; Peloquin, Charles A; Daley, Charles L; Planet, Paul; Narachenia, Apurva; Mathema, Barun; Kreiswirth, Barry N

    2017-03-01

    Although awareness of tuberculosis among captive elephants is increasing, antituberculosis therapy for these animals is not standardized. We describe Mycobacterium tuberculosis transmission between captive elephants based on whole genome analysis and report a successful combination treatment. Infection control protocols and careful monitoring of treatment of captive elephants with tuberculosis are warranted.

  9. 22 CFR 192.42 - Applicable benefits for captives.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits for captives. 192.42 Section 192.42 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF VICTIMS OF TERRORISM COMPENSATION Educational Benefits for Captive Situations § 192.42 Applicable benefits for captives. (a) When authorized by...

  10. Interaction study of water radiolysis products with Crotalus durissus terrificus miotoxin; Estudo das interacoes dos produtos de radiolise da agua com a miotoxina do veneno de Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Murilo Casare da

    2008-07-01

    Ionizing radiation has been satisfactorily employed for venoms detoxification. In this report, the radiation was employed to verify the effects caused by the radiolysis products of water on the Crotamine, toxin purified from Crotalus durissus terrificus venom. These effects were analyzed using some substances called 'scavengers', those substances competes for specific reactive species hindering them to act on the toxins molecules. In order to study the possible structural damages caused on the toxins, circular dichroism, fluorescence, nuclear magnetic resonance, amino acids analysis and intravital microscopy were employed. Our results indicate that ionizing radiation caused structure alterations, mainly, in secondary and tertiary structure of crotamine. In the irradiated crotamine, was not possible to determine tridimensional structure. And the crotamine toxic effect was removed by ionizing radiation. (author)

  11. Preparation of crotalus venom radiolabeled with technetium{sup 99m} as a tool for biodistribution study

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli; Santos, Raquel Gouvea dos [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN), Belo Horizonte, MG (Brazil)]. E-mail: santosr@cdtn.br; Simal, Carlos Jorge Rodrigues [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Faculdade de Medicina

    2005-10-15

    Technetium-{sup 99m} ({sup 99m} Tc) has been the radionuclide of choice for nuclear medicine procedures and experimental research. Because of its optimal nuclear properties, {sup 99m} Tc is suitable for high efficiency detection with the advantage of reduced radiological waste. Crotalus venom (CV) has been shown to reduce tumors in clinical studies and tissue distribution studies are very important for clinical use. The goal of this work was to obtain CV labeled with {sup 99m} Tc which preserves its biological activity. After labeling, biological activity was assessed by hemolytic activity evaluation. Labeled and crude venom caused indirect hemolysis provided that the incubation medium contained an exogenous source of lecithin. High yield radiolabeled-CV was obtained and biological activity was preserved. The results suggest that {sup 99m} Tc-CV can be a useful tool for biodistribution studies. (author)

  12. Clinical and hematological alterations in dogs during experimental envenomation with Crotalus durissus terrificus venom and treated with antiophidic serum

    Directory of Open Access Journals (Sweden)

    R. M. B. Nogueira

    2006-04-01

    Full Text Available The present work aimed to evaluate the clinical and hematological aspects during experimental envenomation by Crotalus durissus terrificus in dogs treated with different antiophidic serum doses. Sixteen dogs were divided into two groups of eight animals each. Group I received 1mg/kg venom subcutaneously and 30mg antiophidic serum intravenously; Group II received 1mg/kg venom subcutaneously and 60mg antiophidic serum intravenously. In the clinical evaluation, we observed ataxia, moderate sedation, dilated pupils, sialorrhea, flaccid paralysis of mandibular muscles, and discreet edema at the site of venom inoculation. Evaluating red and white blood cells, we observed a decrease of hemoglobins, globular volume and erythrocytes, and an increase of plasmatic proteins, leukocytes, neutrophils, monocytes and lymphocytes. Clotting time increased and there was blood incoagulability with return to normal clotting time six hours after antiophidic serum administration. Animals treated with six antiophidic serum flasks had a faster recovery than the animals that received three serum flasks.

  13. Tapirs and Rhinoceroses in Captivity: An Examination of the North American Captive Populations and their Husbandry

    OpenAIRE

    Nordstrom, Lisa A.

    2006-01-01

    A..11 species of Tapiridae and Rhinocerotidae are threatened or endangered in the wild. Captive populations have been established for most of these species, but successful management has proved challenging. Effective ex situ conservation strategies, however, rely on the ability of zoological institutions to maintain and breed these endangered species. In this study, I examined the captive environment to identify the factors associated with reproduction, mortality, and health of rhinos and tap...

  14. IMPLEMENTATION OF THE IMPROVED QUASI-STATIC METHOD IN RATTLESNAKE/MOOSE FOR TIME-DEPENDENT RADIATION TRANSPORT MODELLING

    Energy Technology Data Exchange (ETDEWEB)

    Zachary M. Prince; Jean C. Ragusa; Yaqi Wang

    2016-02-01

    Because of the recent interest in reactor transient modeling and the restart of the Transient Reactor (TREAT) Facility, there has been a need for more efficient, robust methods in computation frameworks. This is the impetus of implementing the Improved Quasi-Static method (IQS) in the RATTLESNAKE/MOOSE framework. IQS has implemented with CFEM diffusion by factorizing flux into time-dependent amplitude and spacial- and weakly time-dependent shape. The shape evaluation is very similar to a flux diffusion solve and is computed at large (macro) time steps. While the amplitude evaluation is a PRKE solve where the parameters are dependent on the shape and is computed at small (micro) time steps. IQS has been tested with a custom one-dimensional example and the TWIGL ramp benchmark. These examples prove it to be a viable and effective method for highly transient cases. More complex cases are intended to be applied to further test the method and its implementation.

  15. Suckling behaviour in captive Dendrohyrax arboreus

    African Journals Online (AJOL)

    1980-11-06

    Nov 6, 1980 ... drohyrax dorsalis) Biologia Gabonica I. RUDNAI, J. 1984. Activity cycle and space utilization in a captive. Dendrohyrax arboreus group. S. Afr. J. Zool. 19: 124-128. SALE, J.B. 1 965a. Some aspects of the behaviour and ecology of the rock hyraces (Genera Procavia and Heterohyrax) Ph.D. thesis, Ju·.

  16. captive Chrysospa/ax treve/yani

    African Journals Online (AJOL)

    The locomotory activity of a free-ranging, male. Chrysospalax trevelyan; was monitored for five days in the. Amatola Forest, Ciskei, using radio telemetry. In addition, locomotory activity of a captive juvenile male and adult female C. trevelyan; was monitored in a speCial laboratory enclosure for 30 days. Preliminary results ...

  17. Oral microbiota of Brazilian captive snakes

    Directory of Open Access Journals (Sweden)

    MG Fonseca

    2009-01-01

    Full Text Available The present work aimed to determine the oral microbiotic composition of snakes from São José do Rio Preto city, São Paulo State, Brazil. Ten snake species, comprising the families Boidae, Colubridae, Elapidae and Viperidae, were submitted to microbiological examination of their oral cavity, which indicated positivity for all buccal samples. Gram-negative bacilli, gram-negative cocci bacilli, gram-positive bacilli and gram-positive cocci were isolated from the snakes. Among isolated bacterium species, the occurrence of coagulase-negative staphylococci in the buccal cavity of Crotalus durissus (Viperiade, Eunectes murinus (Boidae, Mastigodryas bifossatus (Colubridae and Bacillus subtilis, common to oral cavity of Bothrops alternatus (Viperidae and Phalotris mertensi (Colubridae, was detected. It was observed higher diversity of isolated bacteria from the oral cavity of Micrurus frontalis (Elapidae and Philodryas nattereri (Colubridae, as well as the prevalence of gram-positive baccillus and gram-positive cocci. The composition of the oral microbiota of the studied snakes, with or without inoculating fangs, is diverse and also related to the formation of abscesses at the bite site in the victims of the ophidian accidents, and to pathogenic processes in the snakes that host these microorganisms.

  18. Crotalus helleri venom preconditioning reduces postoperative cerebral edema and improves neurological outcomes after surgical brain injury.

    Science.gov (United States)

    Kim, Cherine H; McBride, Devin W; Sherchan, Prativa; Person, Carl E; Gren, Eric C K; Kelln, Wayne; Lekic, Tim; Hayes, William K; Tang, Jiping; Zhang, John H

    2017-11-01

    Postoperative cerebral edema is a devastating complication in neurosurgical patients. Loss of blood-brain barrier integrity has been shown to lead to the development of brain edema following neurosurgical procedures. The aim of this study was to evaluate preconditioning with Crotalus helleri venom (Cv-PC) as a potential preventive therapy for reducing postoperative brain edema in the rodent SBI model. C. helleri venom is known to contain phospholipase A2 (PLA2), an enzyme upstream to cyclooxygenase-2 (COX-2) in the inflammatory cascade, acts to increase the production of inflammatory mediators, such as prostaglandins. We hypothesize that Cv-PC will downregulate the response of the COX-2 pathway to injury, thereby reducing the inflammatory response and the development of brain edema after SBI. 75 male Sprague Dawley rats (280-330g) were divided to the following groups-naïve+vehicle, naïve+Cv-PC, sham, vehicle, Cv-PC, Cv-PC+NS398 (COX-2 inhibitor). Vehicle preconditioned and Cv-PC animals received either three daily subcutaneous doses of saline or C. helleri venom at 72h, 48h, and 24h prior to surgery. In Cv-PC+NS398 animals, NS398 was administered intraperitoneally 1h prior to each Cv-PC injection. Sham-operated animals received craniotomy only, whereas SBI animals received a partial right frontal lobectomy. Neurological testing and brain water content were assessed at 24h and 72h after SBI; COX-2 and PGE 2 expression was assessed at 24h postoperatively by Western blot and immunohistochemistry, respectively. At 24h after SBI, the vehicle-treated animals were observed to have increased brain water content (83.1±0.2%) compared to that of sham animals (80.2±0.1%). The brain water content of vehicle-treated animals at 72h post-SBI was elevated at 83.3±0.2%. Cv-PC-treated animals with doses of 10% LD 50 had significantly reduced brain water content of 81.92±0.7% and 81.82±0.3% at 24h and 72h, respectively, after SBI compared to that of vehicle-treated animals

  19. Type specimens of Crotalus scutulatus (Chordata: Reptilia: Squamata: Viperidae) re-examined, with new evidence after more than a century of confusion

    Science.gov (United States)

    Cardwell, Michael D.; Gotte, Steve W.; McDiarmid, Roy W.; Gilmore, Ned; Poindexter, James A.

    2013-01-01

    The original description of Crotalus scutulatus (Chordata: Reptilia: Squamata: Viperidae) was published in 1861 by Robert Kennicott, who did not identify a type specimen or a type locality. We review the history of specimens purported to be the type(s) and various designations of type locality. We provide evidence that ANSP 7069 (formerly one of two specimens of USNM 5027) is the holotype and that the appropriate type locality is Fort Buchanan, near present-day Sonoita, in Santa Cruz County, Arizona.

  20. A Study of the Effects of Gas Well Compressor Noise on Breeding Bird Populations of the Rattlesnake Canyon Habitat Management Area, San Juan County, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    LaGory, K.E.; Chang, Young-Soo; Chun, K.C.; Reeves, T.; Liebich, R.; Smith, K.

    2001-06-04

    This report, conducted from May through July 2000, addressed the potential effect of compressor noise on breeding birds in gas-production areas administered by the FFO, specifically in the Rattlesnake Canyon Habitat Management Area northeast of Farmington, New Mexico. The study was designed to quantify and characterize noise output from these compressors and to determine if compressor noise affected bird populations in adjacent habitat during the breeding season.

  1. Reproductive profile of captive Sumateran tiger (Panthera tigris sumatrae)

    OpenAIRE

    GONO SEMIADI; R. TAUFIQ PURNA NUGRAHA

    2006-01-01

    The Sumatran tiger (Panthera tigris sumatrae) is one of several endemic Indonesian wild cat groups which population is critically endangered. A program to increase the population size had been conducted in captivity, especially in the zoo. In order to monitor the captive population and for the means of management in captivity, a logbook data recording system had been developed for individual animals. A compilation data from the Tiger International Stud Book from 1942 to 2000 was analyzed. The...

  2. Allopurinol reduces the lethality associated with acute renal failure induced by Crotalus durissus terrificus snake venom: comparison with probenecid.

    Science.gov (United States)

    Frezzatti, Rodrigo; Silveira, Paulo Flavio

    2011-09-01

    Acute renal failure is one of the most serious complications of envenoming resulting from Crotalus durissus terrificus bites. This study evaluated the relevance of hyperuricemia and oxidative stress and the effects of allopurinol and probenecid in renal dysfunction caused by direct nephrotoxicity of C. d. terrificus venom. Hematocrit, protein, renal function and redox status were assessed in mice. High ratio of oxidized/reduced glutathione and hyperuricemia induced by C. d. terrificus venom were ameliorated by both, allopurinol or probenecid, but only allopurinol significantly reduced the lethality caused by C. d. terrificus venom. The effectiveness of probenecid is compromised probably because it promoted hypercreatinemia and hypocreatinuria and worsed the urinary hypo-osmolality in envenomed mice. In turn, the highest effectiveness of allopurinol might be due to its ability to diminish the intracellular formation of uric acid. Data provide consistent evidences linking uric acid with the acute renal failure induced by C. d. terrificus venom, as well as that this envenoming in mice constitutes an attractive animal model suitable for studying the hyperuricemia and that the allopurinol deserves to be clinically evaluated as an approach complementary to anti-snake venom serotherapy.

  3. Allopurinol reduces the lethality associated with acute renal failure induced by Crotalus durissus terrificus snake venom: comparison with probenecid.

    Directory of Open Access Journals (Sweden)

    Rodrigo Frezzatti

    2011-09-01

    Full Text Available BACKGROUND: Acute renal failure is one of the most serious complications of envenoming resulting from Crotalus durissus terrificus bites. This study evaluated the relevance of hyperuricemia and oxidative stress and the effects of allopurinol and probenecid in renal dysfunction caused by direct nephrotoxicity of C. d. terrificus venom. METHODOLOGY/PRINCIPAL FINDINGS: Hematocrit, protein, renal function and redox status were assessed in mice. High ratio of oxidized/reduced glutathione and hyperuricemia induced by C. d. terrificus venom were ameliorated by both, allopurinol or probenecid, but only allopurinol significantly reduced the lethality caused by C. d. terrificus venom. The effectiveness of probenecid is compromised probably because it promoted hypercreatinemia and hypocreatinuria and worsed the urinary hypo-osmolality in envenomed mice. In turn, the highest effectiveness of allopurinol might be due to its ability to diminish the intracellular formation of uric acid. CONCLUSIONS/SIGNIFICANCE: Data provide consistent evidences linking uric acid with the acute renal failure induced by C. d. terrificus venom, as well as that this envenoming in mice constitutes an attractive animal model suitable for studying the hyperuricemia and that the allopurinol deserves to be clinically evaluated as an approach complementary to anti-snake venom serotherapy.

  4. Cloning of subunits of convulxin, a collagen-like platelet-aggregating protein from Crotalus durissus terrificus venom.

    Science.gov (United States)

    Leduc, M; Bon, C

    1998-07-15

    Convulxin (CVX) is a potent platelet-aggregating glycoprotein from the venom of the snake Crotalus durissus terrificus. It consists of two subunits, alpha and beta, joined by disulphide bridges in a hexameric structure. A cDNA library from venom gland was constructed in the vector pT3T7. The cloned cDNAs encoding the two chains of CVX were sequenced. Both are preceded by an identical 23-amino acid peptide signal sequence and encode sequences of 135 amino acids for the alpha chain and 125 amino acids for the beta chain. These polypeptides include a carbohydrate-recognition domain (CRD) in which some of the specific amino acids required for binding Ca2+ and galactose or mannose are absent. The presence of such a domain means that CVX can be included in the family of C-type lectins along with other snake venom proteins, although it is not a true lectin. Assuming that the localization of intracatenary disulphide bridges of each CVX chain is similar to that of the CRD and that an intercatenary bridge between the alpha and beta chains is similar to that of the C-type lectin botrocetin, we postulate the existence of an additional intercatenary bridge, which explains the tridimeric structure (alphabeta)3 of CVX.

  5. Modulation of the Pharmacological Activities of Secretory Phospholipase A2 from Crotalus durissus cascavella Induced by Naringin

    Directory of Open Access Journals (Sweden)

    Marcos H. Toyama

    2011-01-01

    Full Text Available In this work we have characterized the action of the naringin, a flavonoid found in grapefruit and known for its various pharmacological effects, which include antioxidant blood lipid lowering and anticancer activity, on the structure and biochemical activities of a secretory phospholipase A (sPLA2 from Crotalus durissus cascavella, an important protein involved in the releasinge of arachidonic acid in phospholipid membranes. sPLA2 was incubated with naringin (mol:mol at 37 °C and a discrete reduction in the UV scanning signal and a modification of the circular dichroism spectra were observed after treatment with naringin, suggesting modifications of the secondary structure of the protein. This flavonoid was able to decrease enzymatic activity and some pharmacological effects, such as myonecrosis, platelet aggregation, and neurotoxic activity caused by sPLA2, however, the inflammatory effect was not affected by naringin. In addition, small angle X-ray scattering (SAXS data were collected for sPLA2 and naringin-treated sPLA2 to evaluate possible modifications of the protein structure. These structural investigations have shown that sPLA2 is an elongated dimer in solution and after treatment with naringin a conformational change in the dimeric configuration was observed. Our results suggest that structural modification may be correlated with the loss of enzymatic activity and alterations in pharmacological properties.

  6. Effects of purified human fibrinogen modified with carbon monoxide and iron on coagulation in rabbits injected with Crotalus atrox venom.

    Science.gov (United States)

    Nielsen, Vance G

    2017-11-01

    While snake venom derived enzymes, such as the thrombin-like activity possessing ancrod, have been used to treat thrombotic disease by defibrinogenating patients, the therapeutic potential of fibrinogenolytic snake venom enzymes, such as those derived from Crotalus atrox, have not been fully explored. However, one of the potential risks of administering fibrinogenolytic enzymes to effect defibrinogenation is hemorrhage secondary to hypofibrinogenemia. The present investigation sought to determine if human fibrinogen modified with carbon monoxide (CO) and iron (Fe) could resist degradation by C. atrox venom as has been seen in vitro in a recently developed rabbit model of envenomation. Compared with unmodified human fibrinogen, CO/Fe modified fibrinogen administered prior to envenomation had significantly shorter onset of coagulation and greater strength; however, when administered after envenomation, there was no differences between the two types of fibrinogen. Of interest, when administered after envenomation, both types of fibrinogen delayed the onset of coagulation while increasing plasma clot strength, a mixed effect likely secondary to formation of fibrinogen degradation products. Further preclinical investigations are needed to further define the benefits and risks of the use of fibrinogenolytic enzymes as defibrinogenating agents, as well as the risks of the "biochemical brakes" used to modulate the activity or substrate of the fibrinogenolytic enzyme.

  7. A Generalized Perturbation Theory Solver In Rattlesnake Based On PETSc With Application To TREAT Steady State Uncertainty Quantification

    Energy Technology Data Exchange (ETDEWEB)

    Schunert, Sebastian; Wang, Congjian; Wang, Yaqi; Kong, Fande; Ortensi, Javier; Baker, Benjamin; Gleicher, Frederick; DeHart, Mark; Martineau, Richard

    2017-04-01

    Rattlesnake and MAMMOTH are the designated TREAT analysis tools currently being developed at the Idaho National Laboratory. Concurrent with development of the multi-physics, multi-scale capabilities, sensitivity analysis and uncertainty quantification (SA/UQ) capabilities are required for predicitive modeling of the TREAT reactor. For steady-state SA/UQ, that is essential for setting initial conditions for the transients, generalized perturbation theory (GPT) will be used. This work describes the implementation of a PETSc based solver for the generalized adjoint equations that constitute a inhomogeneous, rank deficient problem. The standard approach is to use an outer iteration strategy with repeated removal of the fundamental mode contamination. The described GPT algorithm directly solves the GPT equations without the need of an outer iteration procedure by using Krylov subspaces that are orthogonal to the operator’s nullspace. Three test problems are solved and provide sufficient verification for the Rattlesnake’s GPT capability. We conclude with a preliminary example evaluating the impact of the Boron distribution in the TREAT reactor using perturbation theory.

  8. Environmental Assessment for a Commercial Vehicle Inspection Point at the Downs Road Gate

    Science.gov (United States)

    2013-02-01

    defense; information operations; precision aerospace fires; psychological operations; specialized air mobility; specialized refueling; and intelligence ...for Florida black bear (Ursus americanus floridanus), other mammals, amphibians and reptiles such as diamondback rattlesnakes (Crotalus adamanteus

  9. F-22 Operational Squadron and T-38 Detachment Beddown at Tyndall Air Force Base, Florida

    Science.gov (United States)

    2011-08-01

    Rattlesnake Crotalus adamanteus Bracken Fern Pteridium aquilinum Six-lined Racerunner Cnemidophorus sexlineatus Blueberry Vaccinium spp. Florida Black Bear...adamanteus Bracken Fern Pteridium aquilinum Pileated Woodpecker Dryocopus pileatus Blackberry Rubus cuneifolius Pine Siskin Carduelis pinus Flatwoods

  10. 9 CFR 313.15 - Mechanical; captive bolt.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION AND CERTIFICATION HUMANE SLAUGHTER OF LIVESTOCK § 313.15 Mechanical; captive bolt. The... under the Act. (a) Application of stunners, required effect; handling. (1) The captive bolt stunners shall be applied to the livestock in accordance with this section so as to produce immediate...

  11. Blood chemistry and hematocrit of captive and wild canvasbacks

    Science.gov (United States)

    Perry, M.C.; Obrecht, H.H.; Williams, B.K.; Kuenzel, W.J.

    1986-01-01

    Blood chemistry and packed cell volume (PCV) did not vary among groups of captive canvasbacks (Aythya valisineria) maintained ad libitum on 5 diets varying in metabolizable energy (ME) and protein. Ducks fed low quality diets increased their consumption so that all ducks were obtaining similar amounts of energy and protein. Some variables, including cholesterol, were found to differ between the sexes and ages of captive ducks. Seasonal differences were detected in the blood chemistry of captive canvasbacks. Four of the 5 enzyme values increased from October to January and then declined to April. PCV increased from 45 in October to 51 in April. Overall, blood chemistry values and PCV's were highly variable and did not appear to be good discriminators for age, sex, and diet of captive canvasbacks. Differences detected between captive and wild canvasbacks were attributed to increased stress of wild ducks during handling.

  12. Self-hypnosis training and captivity survival.

    Science.gov (United States)

    Wood, D P; Sexton, J L

    1997-01-01

    In February and March, 1973, 566 U.S. military prisoners (POWs) were released from North Vietnam. These men had been POWs for a period of time between 2 months and 9 years, with a mean incarceration of 4.44 years. They had faced physical and psychological stress similar to that experienced by POWs from previous wars: starvation, disease, inadequate shelter, lack of medical care, interrogations and torture (Deaton, Burge, Richlin & Latrownik, 1977; Mitchell, 1991). By definition, such prison conditions constituted a traumatic experience (Deaton et al., 1977). However, a unique stress for our POWs in North Vietnam was the additional trauma of solitary confinement. This paper reviews the coping and "time killing" activities of U.S. Navy Vietnam POWs who experienced solitary confinement and tortuous interrogation. This paper also reports the physical and psychological adjustment of our POWs following their release from captivity. Suggestions are made regarding the revision of the curriculum for captivity survival training programs such as Survival, Evasion, Resistance, and Escape (SERE) school.

  13. Study on reproduction of captive marine mammals.

    Science.gov (United States)

    Katsumata, Etsuko

    2010-02-01

    The reproductive endocrinological characteristics of beluga, killer whale, spotted seal and bottlenose dolphin were evaluated and used in conjunction with applied reproductive research to enhance captive breeding programs. Results from 8 y of biweekly serum progesterone determination in a female beluga indicated that sexual maturity occured at approximately age 13, two to seven estrous cycles, lasting 37 +/- 3.9 days, per yr began in April-May every year. Rectal temperature was positively correlated with serum progesterone levels and negatively associated with behavioral estrus. In five cases of pregnancy of two female killer whale, positive relationship was found between serum progesterone concentration and temperature during the first period of 18 month-gestation. In the normal parturitions (n=4), rectal temperature decreased 0.8 C lower than average rectal temperature during pregnancy. Sexual maturity of female killer whales occurred at age nine. Yearly contraception in the mono-estrus captive spotted seals (n=10) using a single dose of the progestagen (proligestone(TM); 5 or 10 mg/kg s.c.) was achieved in 94% (33/35) of the attempts over 5 yr when the hormone was administered two months prior to the breeding season. Artificial insemination trials (n=4) were conducted in female bottlenose dolphin (n=3) using fresh and frozen-thawed semen. Estrus synchronization using regumate (27 days) resulted in ovulation occurring 19 to 24 days post withdrawal. Conception was confirmed in 75% of the attempts, with two females successfully delivering calves.

  14. Are captive tortoises a reservoir for conservation? An assessment of genealogical affiliation of captive Gopherus agassizii to local, wild populations

    Science.gov (United States)

    Berry, Kristin H.; Edwards, Taylor

    2013-01-01

    The conservation of tortoises poses a unique situation because several threatened species are commonly kept as pets within their native ranges. Thus, there is potential for captive populations to be a reservoir for repatriation efforts. We assess the utility of captive populations of the threatened Agassiz’s desert tortoise (Gopherus agassizii) for recovery efforts based on genetic affinity to local areas. We collected samples from 130 captive desert tortoises from three desert communities: two in California (Ridgecrest and Joshua Tree) and the Desert Tortoise Conservation Center (Las Vegas) in Nevada. We tested all samples for 25 short tandem repeats and sequenced 1,109 bp of the mitochondrial genome. We compared captive genotypes to a database of 1,258 Gopherus samples, including 657 wild caught G. agassizii spanning the full range of the species. We conducted population assignment tests to determine the genetic origins of the captive individuals. For our total sample set, only 44 % of captive individuals were assigned to local populations based on genetic units derived from the reference database. One individual from Joshua Tree, California, was identified as being a Morafka’s desert tortoise, G. morafkai, a cryptic species which is not native to the Mojave Desert. Our data suggest that captive desert tortoises kept within the native range of G. agassizii cannot be presumed to have a genealogical affiliation to wild tortoises in their geographic proximity. Precautions should be taken before considering the release of captive tortoises into the wild as a management tool for recovery.

  15. Evaluating the performance of captive breeding techniques for conservation hatcheries: a case study of the delta smelt captive breeding program.

    Science.gov (United States)

    Fisch, Kathleen M; Ivy, Jamie A; Burton, Ronald S; May, Bernie

    2013-01-01

    The delta smelt, an endangered fish species endemic to the San Francisco Bay-Delta, California, United States, was recently brought into captivity for species preservation. This study retrospectively evaluates the implementation of a genetic management plan for the captive delta smelt population. The captive genetic management plan entails tagging fish, molecular data collection, pedigree reconstruction, relatedness estimation, and recommending fish crosses annually in an effort to minimize the average coancestry in the population and limit inbreeding. We employed 12 microsatellite DNA markers to examine temporal genetic diversity in consecutive, discrete generations to determine the effects of intensive genetic management on the population and to quantify the amount of wild genetic diversity present within each captive generation. Wild fish are incorporated into the captive population each generation to minimize genetic drift, and 91% of the original founders are still represented in the F(3) generation. The average mean kinship in the third generation in captivity was 0.0035. There was no evidence of significant genetic divergence of the captive population from the wild population. The results of this study yield management insights into the practical application of genetic management plans for captive populations and conservation hatcheries, in an attempt to preserve the genetic integrity of endangered species.

  16. Aspectos morfológicos e ultraestruturais de células sanguíneas de Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    Lívia M. Kindlovits

    Full Text Available RESUMO: A avaliação hematológica, de importância comprovada como um meio auxiliar de diagnóstico ao clínico de pequenos animais domésticos, vem se tornando comum em animais selvagens não apenas para a clínica, mas para a avaliação do manejo e como estudo auxiliar para a fisiologia das várias espécies. Tendo em vista o aumento da demanda para a produção de várias drogas de importância farmacêutica, a criação de serpentes peçonhentas vem se tornando comum a ponto destes animais já serem reconhecidos como sendo de produção. O conhecimento do manejo e da clínica destes animais ainda é escasso e a mortalidade é elevada nos criatórios, tornando urgente a ampliação destes. Embora alguns estudos hematológicos já tenham sido realizados em cascavéis (Crotalus durissus os dados analisados ainda são insipientes, notadamente em relação à caracterização das células do sangue e poucos estudos em microscopia eletrônica foram realizados em serpentes. Com o objetivo de caracterizar as células sanguíneas morfologicamente, sob microscopia óptica e ultraestrutural, foram coletadas amostras de sangue de 52 de indivíduos da subespécie Crotalus durissus terrificus para a realização de esfregaços sanguíneos e avaliação ultraestrutural. Concluiu-se que a coloração hematológica de Giemsa permite a avaliação morfológica e a diferenciação das células sanguíneas em serpentes assim como a visualização de hemoparasitos. A avaliação ultraestrutural permite evidenciar as organelas celulares e a diferenciação entre as células, inclusive entre os tipos leucocitários, porém ainda são necessários outros estudos para que seja elucidada a hipótese da existência dos eosinófilos na espécie estudada assim como é necessária melhor caracterização dos grânulos dos azurófilos para que se confirme uma possível diferença entre os monócitos típicos e os azurófilos.

  17. Flow cytometric characterization of peripheral blood leukocyte populations of 3 neotropical snake species: Boa constrictor, Bothrops jararaca, and Crotalus durissus.

    Science.gov (United States)

    Carvalho, Marcelo P N; Queiroz-Hazarbassanov, Nicolle G T; Massoco, Cristina O; Rossi, Silmara; Sant'Anna, Sávio S; Catão-Dias, José L; Grego, Kathleen F

    2016-06-01

    The reptilian immune system is represented by innate, humoral, and cell-mediated mechanisms, involving different types of blood leukocytes. The development of optimized methods for the advanced study of origin and function of reptilian blood leukocytes is needed. The purpose of the study was to optimize leukocyte density gradient isolation protocols from snake peripheral blood samples, and characterize recovered cells by flow cytometry based on size and internal complexity for a qualitative and semi-quantitative assessment of leukocyte populations in one boa (Boa constrictor), and 2 viper species (Bothrops jararaca, Crotalus durissus). Blood samples from 30 snakes (10 from each species, 5 males and 5 females) were collected in tubes with sodium heparin. Fresh blood was centrifuged with either ficoll-paque PLUS or percoll density gradients for leukocyte isolation. Flow cytometric leukocyte gates were defined based on size (forward scatter [FSC]) and internal complexity (side scatter [SSC]). Relative leukocyte differential counts after sorting the cells in these gates in one snake for each species were compared to conventional light microscopic differential counts on unsorted isolated leukocytes. There was no statistical difference in the relative leukocyte populations, including heterophils, azurophils, and small and large lymphocytes between samples isolated by ficoll or percoll. Four leukocyte gates were identified based on their location in FSC/SSC cytograms. The relative leukocyte differential counts after sorting in single animals showed some agreement with the light microscopy differential count on unsorted cells. Based on FSC and SSC, 4 distinct leukocyte populations were found in ficoll or percoll density gradient isolated leukocytes from peripheral blood from boa and viper species. Further optimization of the technique should allow the performance of functional assays. © 2016 American Society for Veterinary Clinical Pathology.

  18. Hematological changes in sheep inoculated with natural and Cobalt60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.; Alfieri, A.A.; Balarim, M.R.S.; Chiacchio, S.B.; Bicudo, P.L.; Nascimento, N.

    2004-01-01

    Natural (NV) and Cobalt 60 -irradiated (IrV) Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 m M, p H 3.0) and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV) and the other natural venom (NV). Three antigen doses (venom) were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD 50 for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/μl indicates that slight leucocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the N V group, showing its greater toxicity. (author)

  19. Hematological changes in sheep inoculated with natural and Cobalt60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768

    Directory of Open Access Journals (Sweden)

    D. P. Netto

    2004-01-01

    Full Text Available Natural (NV and Cobalto60-irradiated (IrV Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 mM, pH 3.0 and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV and the other natural venom (NV. Three antigen doses (venom were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count (CBC, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD50 for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/ml indicates that slight leukocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the NV group, showing its greater toxicity.

  20. Core Body Temperature as Adjunct to Endpoint Determination in Murine Median Lethal Dose Testing of Rattlesnake Venom

    Science.gov (United States)

    Cates, Charles C; McCabe, James G; Lawson, Gregory W; Couto, Marcelo A

    2014-01-01

    Median lethal dose (LD50) testing in mice is the ‘gold standard’ for evaluating the lethality of snake venoms and the effectiveness of interventions. As part of a study to determine the murine LD50 of the venom of 3 species of rattlesnake, temperature data were collected in an attempt to more precisely define humane endpoints. We used an ‘up-and-down’ methodology of estimating the LD50 that involved serial intraperitoneal injection of predetermined concentrations of venom. By using a rectal thermistor probe, body temperature was taken once before administration and at various times after venom exposure. All but one mouse showed a marked, immediate, dose-dependent drop in temperature of approximately 2 to 6 °C at 15 to 45 min after administration. The lowest temperature sustained by any surviving mouse was 33.2 °C. Surviving mice generally returned to near-baseline temperatures within 2 h after venom administration, whereas mice that did not survive continued to show a gradual decline in temperature until death or euthanasia. Logistic regression modeling controlling for the effects of baseline core body temperature and venom type showed that core body temperature was a significant predictor of survival. Linear regression of the interaction of time and survival was used to estimate temperatures predictive of death at the earliest time point and demonstrated that venom type had a significant influence on temperature values. Overall, our data suggest that core body temperature is a useful adjunct to monitoring for endpoints in LD50 studies and may be a valuable predictor of survival in venom studies. PMID:25527024

  1. The importance of historical land use in the maintenance of early successional habitat for a threatened rattlesnake

    Directory of Open Access Journals (Sweden)

    Eric M. McCluskey

    2018-01-01

    Full Text Available Understanding how historic habitat changes have impacted species and searching the past for clues to better understand the current plight of threatened species can help inform and improve future conservation efforts. We coupled species distribution modeling with historical imagery analysis to assess how changes in land use/land cover have influenced the distribution of eastern massasauga rattlesnake (Sistrurus catenatus, a federally threatened species, and its habitat in northeastern Ohio over the past ∼75 years. We also examined land use/land cover changes throughout southern Michigan for a broader perspective on the influence of historical processes on contemporary habitat. There was a pronounced shift in northeastern Ohio land cover from 1938 to 2011 with forest cover becoming the predominant land cover type as agricultural fields were abandoned and succession occurred. Most known eastern massasauga locations in the area were at some point used for agriculture and higher habitat suitability values were associated with agricultural fields that were eventually abandoned. We observed more stable habitat conditions across southern Michigan populations indicating agricultural abandonment was not as necessary for habitat creation in this part of their range. We present a new approach for linking historical landscapes to present day habitat suitability models; permitting inferences on how prior land use/land cover states have influenced the current distribution of species and their habitats. We demonstrate how agricultural abandonment was an important source of early successional habitat for a species that requires an open canopy, a finding applicable to a broad array of species with similar habitat requirements. Keywords: Eastern massasauga, Agriculture, Aerial photography, Maxent

  2. Subspecies genetic assignments of worldwide captive tigers increase conservation value of captive populations.

    Science.gov (United States)

    Luo, Shu-Jin; Johnson, Warren E; Martenson, Janice; Antunes, Agostinho; Martelli, Paolo; Uphyrkina, Olga; Traylor-Holzer, Kathy; Smith, James L D; O'Brien, Stephen J

    2008-04-22

    Tigers (Panthera tigris) are disappearing rapidly from the wild, from over 100,000 in the 1900s to as few as 3000. Javan (P.t. sondaica), Bali (P.t. balica), and Caspian (P.t. virgata) subspecies are extinct, whereas the South China tiger (P.t. amoyensis) persists only in zoos. By contrast, captive tigers are flourishing, with 15,000-20,000 individuals worldwide, outnumbering their wild relatives five to seven times. We assessed subspecies genetic ancestry of 105 captive tigers from 14 countries and regions by using Bayesian analysis and diagnostic genetic markers defined by a prior analysis of 134 voucher tigers of significant genetic distinctiveness. We assigned 49 tigers to one of five subspecies (Bengal P.t. tigris, Sumatran P.t. sumatrae, Indochinese P.t. corbetti, Amur P.t. altaica, and Malayan P.t. jacksoni tigers) and determined 52 had admixed subspecies origins. The tested captive tigers retain appreciable genomic diversity unobserved in their wild counterparts, perhaps a consequence of large population size, century-long introduction of new founders, and managed-breeding strategies to retain genetic variability. Assessment of verified subspecies ancestry offers a powerful tool that, if applied to tigers of uncertain background, may considerably increase the number of purebred tigers suitable for conservation management.

  3. Stress free oral medication in captive cervids

    Directory of Open Access Journals (Sweden)

    G.M. Das

    2009-09-01

    Full Text Available Efficacy of oral administration of fenbendazole was studied against gastrointestinal helminthes in captive Cheetal (Axis axis at Hisar Deer Park from November 2006- January 2007. A novel method of administration of oral medication that included acclimatizing cheetal to feed individually from specific containers and providing drugs in feed after habituation was developed. Efficacy of fenbendazole was assessed by egg per gram EPG count of faecal sample on day 11 and 19 post 1st treatment and 4 days after 2nd treatment i.e. on 22nd day and compared with pre-treatment counts. Fenbendazole was efficacious against Strongyles sp., Strongyloides sp., Ascaris sp., Trichuris sp. and Moniezia sp. and significantly reduced the mean EPG of faeces, decreasing p< 0.01 after provision of drug at doses of 7.5 mg/kg body weight. The method was efficacious and provided adequate dosage to individual animals irrespective of their social hierarchy.

  4. Serovars of Salmonella from captive reptiles

    DEFF Research Database (Denmark)

    Pedersen, Karl; Lassen-Nielsen, Anne Marie; Nordentoft, Steen

    2009-01-01

    The distribution on serovars of 60 Salmonella isolates from reptiles kept in captivity in Denmark during the period 1995–2006 was investigated. The isolates were all recovered from clinical specimens submitted to the National Veterinary Institute. A majority of the samples were from reptiles...... in zoological gardens or similar, while a minor number was from reptiles kept in private homes. A total of 43 serovars were detected, most of them being what is usually called exotic serotypes, and many not having a trivial name, while a few isolates belonged to well-known human pathogenic serovars, such as S....... Enteritidis, S. Typhimurium, S. Bovismorbificans. One isolate was rough and two were non-typeable. Isolates from turtles belonged to the subspecies enterica, while many isolates from both sauria and snakes belonged to other subspecies. The findings underline the potential zoonotic risk by handling reptiles...

  5. Hepatic capillariasis in two captive Callithrix penicillata

    Directory of Open Access Journals (Sweden)

    Washington Luiz Assunção Pereira

    2016-08-01

    Full Text Available This study aimed to describe the occurrence of hepatic capillariasis in two non-human primates of the species Callithrix penicillata that were kept in captivity. Case 1 was in a young female, whose liver presented pale coloring, softening due to autolysis and several noticeably whitish areas. Case 2 was in a male of unknown age, whose liver was slightly pale and brownish. Histological analysis on the samples revealed extensive interstitial fibrosis with hemosiderotic areas. Adult nematodes of Capillaria hepatica and numerous eggs, morphologically characterized by their non-embryonic ellipsoid shape, with bipolar plugs that did not protrude from the shell, thick and birefringent, with a porous layer, thus giving a striated appearance to the eggs. Some cystic formations presented nematode eggs surrounded by numerous foreign-body giant cells. The literature consulted made little reference to reports of Capillaria hepatica in non-human primates. However, similar infections have been extensively studied in domestic rodents.

  6. [The mental state of servicemen released from captivity].

    Science.gov (United States)

    Morozov, V M; Bulyko, V I; Rustanovich, A V; Kozachenko, V V

    1997-05-01

    The clinical and medico-psychological research of the servicemen, long time staying by hostages in captivity is lead. Boundary mental frustration, in particular neurotic reactions and the conditions, asthenodepressive syndrome, posttraumatic stress frustrations, are revealed in 45.8% surveyed. The most psychotraumatic is initial period of adaptation to conditions of captivity. The necessity to carry out the measures of medico-psychological rehabilitation and treatment of the servicemen, released from captivity, should be taken into account during planning of medical maintenance of the troops in local wars and armed conflicts.

  7. Endoparasites of lizards (Lacertilia from captive breeding and trade networks

    Directory of Open Access Journals (Sweden)

    Okulewicz A.

    2015-02-01

    Full Text Available Parasitic infections are widespread among exotic lizards and cause serious problems in both private captive breeding and trade networks. Among 168 lizards obtained from captive breeding (Zoological Garden in Wrocław and private owners and trade (pet shops and wholesale the total prevalence of endoparasites was 42.35 %. We detected species of Protozoa, Cestoda, Trematoda - Digenea and Nematoda as well as pseudoparasites. The prevalence of endoparasites was higher in the reptiles obtained from captive breeding (59.5 % than in those from trade network, however the parasite species spectrum was wider in the animals form pet shops and wholesales.

  8. Captivity, citizenship, and the ethics of otherwise in the society-of-captives thesis: a commentary on Arrigo.

    Science.gov (United States)

    Brown, Michelle

    2013-06-01

    In this engagement with Professor Bruce Arrigo's psychological jurisprudence model, I explore his critique of captivity and risk management. I am particularly interested in his claims that incarceration culminates in society's own captivity, that the most destructive aspect of captivity is its foreclosing of human difference and potentiality, and that a praxis that is both clinical and mindful might point a way out. By way of a case anecdote, I interrogate several of the key terms in Arrigo's formulation-citizenship, reform, revolution, and praxis-in an effort to further conjugate from the ground up such an innovative and important set of possibilities.

  9. Monthly morphometric data on captive loggerhead sea turtles 1995-present

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The database contains monthly measurements taken on captive reared sea turtles. Measurements include: straight carapace length nuchal notch to carapace tip, straight...

  10. Broodyear data - Snake River sockeye salmon captive propagation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gene rescue captive broodstock program was established for ESA-listed endangered Snake River sockeye salmon from Redfish Lake, Idaho. The program has consisted of...

  11. Growth data - Snake River sockeye salmon captive propagation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gene rescue captive broodstock program was established for ESA-listed endangered Snake River sockeye salmon from Redfish Lake, Idaho. The program has consisted of...

  12. Captive breeding of pangolins: current status, problems and future prospects.

    Science.gov (United States)

    Hua, Liushuai; Gong, Shiping; Wang, Fumin; Li, Weiye; Ge, Yan; Li, Xiaonan; Hou, Fanghui

    2015-01-01

    Pangolins are unique placental mammals with eight species existing in the world, which have adapted to a highly specialized diet of ants and termites, and are of significance in the control of forest termite disaster. Besides their ecological value, pangolins are extremely important economic animals with the value as medicine and food. At present, illegal hunting and habitat destruction have drastically decreased the wild population of pangolins, pushing them to the edge of extinction. Captive breeding is an important way to protect these species, but because of pangolin's specialized behaviors and high dependence on natural ecosystem, there still exist many technical barriers to successful captive breeding programs. In this paper, based on the literatures and our practical experience, we reviewed the status and existing problems in captive breeding of pangolins, including four aspects, the naturalistic habitat, dietary husbandry, reproduction and disease control. Some recommendations are presented for effective captive breeding and protection of pangolins.

  13. Production data - Snake River sockeye salmon captive propagation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gene rescue captive broodstock program was established for ESA-listed endangered Snake River sockeye salmon from Redfish Lake, Idaho. The program has consisted of...

  14. Fish Culture data - Snake River sockeye salmon captive propagation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gene rescue captive broodstock program was established for ESA-listed endangered Snake River sockeye salmon from Redfish Lake, Idaho. The program has consisted of...

  15. Spawning data - Snake River sockeye salmon captive propagation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gene rescue captive broodstock program was established for ESA-listed endangered Snake River sockeye salmon from Redfish Lake, Idaho. The program has consisted of...

  16. SISTEMA FIBRINOLÍTICO: MÉTODOS DE ESTUDIO Y HALLAZGOS EN VENENOS DE SERPIENTES DE LOS GENEROS Bothrops, Crotalus, Micrurus EN VENEZUELA | FIBRINOLYTIC SYSTEM: METHODS OF STUDY AND FINDINGS IN Bothrops, Crotalus, Micrurus SNAKE VENOMS IN VENEZUELA

    Directory of Open Access Journals (Sweden)

    Alexis Rodríguez-Acosta,

    2016-10-01

    Full Text Available En la presente revisión se muestran resultados relevantes de actividades hemostáticas, con especial énfasis a las relacionadas con la fibrinólisis, presentes en venenos de serpientes venezolanas de los géneros Bothrops, Crotalus y Micrurus, que existen en diversas localidades geográficas. Con esta descripción, se presenta además una revisión de diversos ensayos que se utilizan en investigación para estos estudios. Se han evidenciado importantes diferencias inter e intra-especies, e incluso entre ejemplares de distintos espacios geográficos, lo que debe influir en los mecanismos de acción de sus venenos y la sintomatología clínica. Estas diferencias en composición y concentración de componentes activos, deben estar asociadas a variaciones estacionales o geográficas, dieta, sexo, hábitat, edad, e inclusive variabilidades genéticas. Ello podría explicar las discrepancias en los cuadros clínicos de las víctimas y también ayudar a determinar mecanismos de acción que faciliten una mejor orientación a los médicos tratantes. Estas variables ayudarían al seguimiento y tratamiento de los pacientes, orientando a los especialistas en antivenenos, en la escogencia del inóculo, con una mezcla amplia de venenos de diferentes especies, géneros, edad, sexo y procedencia, así como con toxinas de relevancia, para la preparación y obtención de estos antivenenos con valores de gran eficacia y amplio espectro. Los componentes bioactivos aislados, como las colombienasas y la tenerplasminina-1, por sus características biológicas, representan asimismo moléculas con un uso potencial como trombolíticos y antifibrinolíticos, respectivamente.

  17. Behaviour of cockatiels (Nymphicus hollandicus) at two temperatures in captivity

    OpenAIRE

    Carvalho, T.S.G.; Zangeronimo, M.G.; Saad, C.E.P.; Alvarenga, R.R.; Assis, V.D.L.; Pereira, V.M.; Scalon, J.D.; Silva, J.P.

    2015-01-01

    Behavioural studies with cockatiels (Nymphicus hollandicus) in captivity are scarce. Due to the need for appropriate management of these animals, this study was performed to examine the behaviour of cockatiels kept in captivity at two temperatures. Sixteen cockatiels were individually housed in cages (62cm high x 43cm long x 27cm wide) and fed with a commercial ration and seed mixture for psittacids. Water was provided ad libitum. The eight-day experiment was divided into two stages of four d...

  18. Reproductive profile of captive Sumateran tiger (Panthera tigris sumatrae

    Directory of Open Access Journals (Sweden)

    GONO SEMIADI

    2006-10-01

    Full Text Available The Sumatran tiger (Panthera tigris sumatrae is one of several endemic Indonesian wild cat groups which population is critically endangered. A program to increase the population size had been conducted in captivity, especially in the zoo. In order to monitor the captive population and for the means of management in captivity, a logbook data recording system had been developed for individual animals. A compilation data from the Tiger International Stud Book from 1942 to 2000 was analyzed. The extraction data consisted of the reproduction performance of the animals, such as calving pattern, sex ratio, litter size etc. The results showed that mortality of cubs at ≤ 5 months old reached 59%, between 5 and 24 months old was 9.3% and above 24 months was 31.7%. Cubs were born all year round with concentration in July for Europe and North America regions. The mean of first reproductive age was at 4.6 years old (± 2.28, with the mean of the oldest reproductive age was at 8.3 years (± 3.63. Mean litter size was 2.21 cubs from dame born in captivity and 2.45 cubs from dame capture from the wild. Sex ratio of male to female was 53.8:46.2. The average lifespan of adult wild captive tiger was 5108.9 day (± 2365.4 day, while for adult (≥ 24 months of age captive tiger was 4417.4 day (± 1972.7.

  19. Social grooming network in captive chimpanzees: does the wild or captive origin of group members affect sociality?

    Science.gov (United States)

    Levé, Marine; Sueur, Cédric; Petit, Odile; Matsuzawa, Tetsuro; Hirata, Satoshi

    2016-01-01

    Many chimpanzees throughout the world are housed in captivity, and there is an increasing effort to recreate social groups by mixing individuals with captive origins with those with wild origins. Captive origins may entail restricted rearing conditions during early infant life, including, for example, no maternal rearing and a limited social life. Early rearing conditions have been linked with differences in tool-use behavior between captive- and wild-born chimpanzees. If physical cognition can be impaired by non-natural rearing, what might be the consequences for social capacities? This study describes the results of network analysis based on grooming interactions in chimpanzees with wild and captive origins living in the Kumamoto Sanctuary in Kumamoto, Japan. Grooming is a complex social activity occupying up to 25% of chimpanzees' waking hours and plays a role in the emergence and maintenance of social relationships. We assessed whether the social centralities and roles of chimpanzees might be affected by their origin (captive vs wild). We found that captive- and wild-origin chimpanzees did not differ in their grooming behavior, but that theoretical removal of individuals from the network had differing impacts depending on the origin of the individual. Contrary to findings that non-natural early rearing has long-term effects on physical cognition, living in social groups seems to compensate for the negative effects of non-natural early rearing. Social network analysis (SNA) and, in particular, theoretical removal analysis, were able to highlight differences between individuals that would have been impossible to show using classical methods. The social environment of captive animals is important to their well-being, and we are only beginning to understand how SNA might help to enhance animal welfare.

  20. Hematological changes in sheep inoculated with natural and Cobalt{sub 60}-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P.; Alfieri, A.A.; Balarim, M.R.S. [Universidade Estadual de Londrina, PR (Brazil). Faculdade de Medicina Veterinaria e Zootecnia. Dept. de Medicina Veterinaria Preventiva]. E-mail: rnetto@uel.br; Chiacchio, S.B.; Bicudo, P.L. [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia; Nascimento, N. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radiobiologia

    2004-07-01

    Natural (NV) and Cobalt{sub 60}-irradiated (IrV) Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 m M, p H 3.0) and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV) and the other natural venom (NV). Three antigen doses (venom) were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD{sub 50} for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/{mu}l indicates that slight leucocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the N V group, showing its greater toxicity. (author)

  1. Crotoxin from Crotalus durissus terrificus is able to down-modulate the acute intestinal inflammation in mice.

    Directory of Open Access Journals (Sweden)

    Caroline de Souza Almeida

    Full Text Available Inflammatory bowel diseases (IBD is the result of dysregulation of mucosal innate and adaptive immune responses. Factors such as genetic, microbial and environmental are involved in the development of these disorders. Accordingly, animal models that mimic human diseases are tools for the understanding the immunological processes of the IBD as well as to evaluate new therapeutic strategies. Crotoxin (CTX is the main component of Crotalus durissus terrificus snake venom and has an immunomodulatory effect. Thus, we aimed to evaluate the modulatory effect of CTX in a murine model of colitis induced by 2,4,6- trinitrobenzene sulfonic acid (TNBS. The CTX was administered intraperitoneally 18 hours after the TNBS intrarectal instillation in BALB/c mice. The CTX administration resulted in decreased weight loss, disease activity index (DAI, macroscopic tissue damage, histopathological score and myeloperoxidase (MPO activity analyzed after 4 days of acute TNBS colitis. Furthermore, the levels of TNF-α, IL-1β and IL-6 were lower in colon tissue homogenates of TNBS-mice that received the CTX when compared with untreated TNBS mice. The analysis of distinct cell populations obtained from the intestinal lamina propria showed that CTX reduced the number of group 3 innate lymphoid cells (ILC3 and Th17 population; CTX decreased IL-17 secretion but did not alter the frequency of CD4+Tbet+ T cells induced by TNBS instillation in mice. In contrast, increased CD4+FoxP3+ cell population as well as secretion of TGF-β, prostaglandin E2 (PGE2 and lipoxin A4 (LXA4 was observed in TNBS-colitis mice treated with CTX compared with untreated TNBS-colitis mice. In conclusion, the CTX is able to modulate the intestinal acute inflammatory response induced by TNBS, resulting in the improvement of clinical status of the mice. This effect of CTX is complex and involves the suppression of the pro-inflammatory environment elicited by intrarectal instillation of TNBS due to the

  2. CAPTIVE AS AN INSURANCE FORMULA FOR RISK MANAGEMENT: ADVANTAGES AND DISADVANTAGES

    Directory of Open Access Journals (Sweden)

    R. Holly

    2017-04-01

    Full Text Available This article introduces subject of an insurance captive entity, with focus on how it could be used as insurance formula for risk management. Captive might be the most appropriate insurance formula for risk management. However, the level of achieved success depends on many factors.Insurance captivesare understood as entities which are formed and owned by companies mostly for the purpose of insuring own risks (pure captive or single parent captive. More and more often captives are also formed by a group of companies (group captives to insure their properties and liabilities towards 3rd parties. Captives are widely used by many companies nowadays. However, many of them,are used solely for a purpose of a risk cession and premium transfer, with an intention to use captivesmore as a profit center in a low taxation country rather than for the purpose of risk management (i.e. a more appropriate role for captive would be to support their owners in enterprise risk management - ERM. This article touches on why captives are not used to their full potential. It may be toochallenging for many decision makers to embrace on captives as risk management formula and extend captives' roles to utilize all possible advantages resulting from owning a captive. Captive can deliver risk management in a more comprehensive way than most commercial insurers on the market. The article also presents advantages and disadvantages of owning an insurance captive.

  3. Nontuberculous mycobacteria in captive and pet reptiles

    Directory of Open Access Journals (Sweden)

    Irena Reil

    2017-01-01

    Full Text Available The aim of this study was to highlight the importance of nontuberculous mycobacteria species in the pathology of various reptilian pet species as well as their epidemiological significance of infection transmission to humans. Faeces samples from six living reptiles and organs from ten carcasses were submitted to bacteriological testing during the years 2003–2015. Positive colonies from one faeces sample and two organs showed the presence of a gene coding 65kDa antigen common for all mycobacteria. Further identification to the species level revealed that the isolates belong to Mycobacterium fortuitum and Mycobacterium avium subsp. hominissuis, later subjected to drug susceptibility testing which confirmed high resistance levels in both isolates. In conclusion, there is a great significance of the occurrence of nontuberculous mycobacteria in captive and pet reptiles, presenting reptiles as possible hosts representing a serious threat of transmission of high resistance mycobacterial isolates to humans. To our knowledge, this is the first report of M. avium subsp. hominissuis occurrence in reptiles.

  4. Response of captive skunks to microencapsulated tetracycline.

    Science.gov (United States)

    Schmit, Brandon S; Primus, Thomas M; Hurley, Jerome C; Kohler, Dennis J; Graves, Shawna F

    2010-07-01

    A captive striped skunk (Mephitis mephitis) study was conducted between February and June 2004 at the United States Department of Agriculture, Animal and Plant Health Inspection Service, Wildlife Services National Wildlife Research Center, Fort Collins, Colorado, USA. The main objective was to determine the percentage of adult striped skunks that were marked after consuming placebo oral rabies vaccine (ORV) baits containing 100 mg of an experimental microencapsulated (coated microparticle) tetracycline hydrochloride biomarker. Biomarkers were identified in the canine teeth and mandibles of five of five skunks that consumed an ORV bait. A second objective was to determine if the microencapsulated tetracycline was resistant to photochemical conversion from tetracycline to epitetracycline. After 15 days of exposure, conversion from tetracycline to epitetracycline concentration in the microencapsulated product (mean 1.9% conversion, SD=1.24) was significantly less (P=0.006) than the pure-grade tetracycline powder (mean 7.5% conversion, SD=1.37). Results support the use of microencapsulated tetracycline hydrochloride as a biomarker in circumstances where the use of conventional powdered tetracycline hydrochloride is not feasible due to ORV bait design constraints.

  5. Developments in amphibian captive breeding and reintroduction programs.

    Science.gov (United States)

    Harding, Gemma; Griffiths, Richard A; Pavajeau, Lissette

    2016-04-01

    Captive breeding and reintroduction remain high profile but controversial conservation interventions. It is important to understand how such programs develop and respond to strategic conservation initiatives. We analyzed the contribution to conservation made by amphibian captive breeding and reintroduction since the launch of the International Union for Conservation of Nature (IUCN) Amphibian Conservation Action Plan (ACAP) in 2007. We assembled data on amphibian captive breeding and reintroduction from a variety of sources including the Amphibian Ark database and the IUCN Red List. We also carried out systematic searches of Web of Science, JSTOR, and Google Scholar for relevant literature. Relative to data collected from 1966 to 2006, the number of species involved in captive breeding and reintroduction projects increased by 57% in the 7 years since release of the ACAP. However, there have been relatively few new reintroductions over this period; most programs have focused on securing captive-assurance populations (i.e., species taken into captivity as a precaution against extinctions in the wild) and conservation-related research. There has been a shift to a broader representation of frogs, salamanders, and caecilians within programs and an increasing emphasis on threatened species. There has been a relative increase of species in programs from Central and South America and the Caribbean, where amphibian biodiversity is high. About half of the programs involve zoos and aquaria with a similar proportion represented in specialist facilities run by governmental or nongovernmental agencies. Despite successful reintroduction often being regarded as the ultimate milestone for such programs, the irreversibility of many current threats to amphibians may make this an impractical goal. Instead, research on captive assurance populations may be needed to develop imaginative solutions to enable amphibians to survive alongside current, emerging, and future threats. © 2015

  6. The comparison between the humoral response and the neutralizing capacity of sheep serum inoculated with natural venom and Co60 irradiated venom from Crotalus durissus terrificus (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.

    2000-01-01

    Crotalus durissus terrificus venom was irradiated with Co 60 to investigate the effects of antigen-irradiation on antivenom production in sheep. Twelve sheep were divided in two groups of 6. One group received irradiated, while the other received natural venom. Three doses of antigen were given at monthly intervals. The toxic activity of the venom was assessed by LD 50 in mice. Weekly blood samples were obtained to evaluate anti-crotalic serum titers by indirect ELISA, neutralization capacity, and serum potency. A complete blood count, plasma protein and fibrinogen concentration, and serum albumin and globulin were also determined. At end of the experiment, the animals were challenged with ovine LD 50 , without clinical abnormalities. (author)

  7. Inhibition of proteases and phospholipases A2 from Bothrops atrox and Crotalus durissus terrificus snake venoms by ascorbic acid, vitamin E, and B-complex vitamins.

    Science.gov (United States)

    Oliveira, Carlos H M; Simão, Anderson A; Trento, Marcus V C; César, Pedro H S; Marcussi, Silvana

    2016-01-01

    The enzyme inhibition by natural and/ or low-cost compounds may represent a valuable adjunct to traditional serotherapy performed in cases of snakebite, mainly with a view to mitigate the local effects of envenoming. The objective of this study was to evaluate possible interactions between vitamins and enzymes that comprise Bothrops atrox and Crotalus durissus terrificus venoms, in vitro. Proteolysis inhibition assays (substrates: azocasein, collagen, gelatin and fibrinogen), hemolysis, coagulation, hemagglutination were carried out using different proportions of vitamins in face of to inhibit minimum effective dose of each venom. The vitamins were responsible for reducing 100% of breaking azocasein by C.d.t. venom, thrombolysis induced by B. atrox and fibrinogenolysis induced by both venoms. It is suggested the presence of interactions between vitamin and the active site of enzymes, for example the interactions between hydrophobic regions present in the enzymes and vitamin E, as well as the inhibitions exercised by antioxidant mechanism.

  8. Internal dosimetry of radiopharmaceuticals derived of antitumor polypeptide isolated from venoms: Crotalus durissus terrifucus and Scorpaena plumieri;Dosimetria interna de radiofarmacos derivados de polipeptideos antitumorais isolados dos venenos de: Crotalus durissus terrificus e Scorpaena plumieri

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Henrique Martins de

    2009-07-01

    The identification of new diagnostic and therapeutic agents capable of inhibiting tumor growth is essential for improving the prognosis of patients suffering from malignant tumors (glioma, breast and others). In this context, natural products (plants and animals) are a rich source of substances with potential antitumor. Despite knowledge of the etiology and pathology of tumors little progress has been observed in the area of diagnosis. Molecules of snake venoms have been shown to play an important role not only in the survival and proliferation of tumor cells but also in the process of tumor cell adhesion, migration and angiogenesis. Polypeptides isolated from the venom of the snake, Crotalus durissus terrificus, Crtx, and Scorpaena plumieri fish, SPGP, have antitumor activity against malignant tumors. It was shown that similar radio iodines Crtx and SPGP, {sup 125}I-Crtx and {sup 125}I-SPGP, can interact specifically with malignant tumors and induce cell death. Prototype-based radiopharmaceuticals Crtx and SPGP containing radioiodine 1311 were able to produce diagnostic images to accumulate specifically in the tumor site. The present study aimed at evaluating the potential radiological safety and diagnostic/therapeutic efficacy of {sup 131}I-Crtx {sup l31}I-SPGP and (evaluated from the biokinetic data in mice bearing Ehrlich tumor) were treated by the MIRD formalism to carry out internal dosimetry studies. Absorbed doses due to the uptake of {sup 131}I-Crtx and {sup 131}I-SPGP were determined in various organs of mice and implanted into the tumor. The results obtained for the animal model were extrapolated to humans by assuming a similar concentration ratio among the various tissues between mice and humans. In extrapolation, we used the masses of human organs of the phantom of Cristy/Eckerman. Both radiation penetrating and non penetrating of {sup 131}I on the tissue were considered in dose calculations. The absorbed dose in the bone marrow due to the

  9. Captives of the First World War in the Kurgan District

    Directory of Open Access Journals (Sweden)

    Nichkov Evgeniy

    2014-11-01

    Full Text Available The article deals with the process of locating foreign war prisoners in the Kurgan district from September 1914 to January 1917 and provides the data on their number and placement process. The author studies in detail the employment of captives in the economy of the district and characterizes the food, monetary and other regulations. The article also contains the information about companies and jobs where captives were involved and analyzes the legal rules applicable to captives and their practical implementation. The overview of the governance structure of captives is given. On the basis of extensive archival material, the author provides many early-unknown or little-studied historical facts about Trans-Urals in a given period. The conclusion is made about the importance of captives’ labor for the economic development of the Kurgan district during the First World War. The war prisoners were deeply involved in the economic development of the Kurgan district, their number was considerable, and they represented the major group of the population. It is also worth mentioning that the conditions of captives affected directly the military situation in the country – if at the beginning of the war, they were actually recognized by the Russian army, to its completion the allowance has been abbreviated in order to save the military.

  10. When captive customers bear the risk

    International Nuclear Information System (INIS)

    Michaels, R.J.

    1993-01-01

    Before open access, long-term contracts between gas producers, pipelines, and local distribution companies (LDCs) were the rule. Since then, spot trading has dominated the gas market. Spot prices govern short-term transactions and often determine adjustments in longer-term contracts. Experts have repeatedly predicted a return to long-term fixed-price (LTFP) contracts. (open-quotes Fixedclose quotes means unrelated to spot prices, but not necessarily frozen.) They have perceived spot dealing as a response to temporary chaos, or as the consequence of a open-quotes bubbleclose quotes of deliverable gas that would soon vanish. The Federal Energy Regulatory Commission staff's analysis of Order 636 anticipates that the order will foster long-term contracts. But as the dust settles, the reign of spot gas continues. LTFP gas contracts certainly appear superior to spot trades. In readily, LTFP contracts are inferior at almost every turn. Paradoxically, they are riskier than spot transactions. If LTFP contracts were worthwhile, most large gas buyers would use them. Instead, those buyers purchase spot gas and hedge it with futures and options. Electric utilities, nonutility generators, and LDCs are virtually the only users of LTFP contracts. Unlike other gas buyers, utilities can shift risk onto their customers through automatic adjustments in their regulated rates. If ratepayers were not captives, they would not bear the added risk of LTFP contracts without compensation. LTFP contracts are a thing of the past, a security blanket for utilities that is paid for by their customers. If regulators do not put an end to LTFP contracts, competition will. Customers with choices will not hold still for LTFP pass-throughs, as has become evident in LDC gas bypass

  11. Internal dosimetry of radiopharmaceuticals derived of antitumor polypeptide isolated from venoms: Crotalus durissus terrifucus and Scorpaena plumieri

    International Nuclear Information System (INIS)

    Andrade, Henrique Martins de

    2009-01-01

    The identification of new diagnostic and therapeutic agents capable of inhibiting tumor growth is essential for improving the prognosis of patients suffering from malignant tumors (glioma, breast and others). In this context, natural products (plants and animals) are a rich source of substances with potential antitumor. Despite knowledge of the etiology and pathology of tumors little progress has been observed in the area of diagnosis. Molecules of snake venoms have been shown to play an important role not only in the survival and proliferation of tumor cells but also in the process of tumor cell adhesion, migration and angiogenesis. Polypeptides isolated from the venom of the snake, Crotalus durissus terrificus, Crtx, and Scorpaena plumieri fish, SPGP, have antitumor activity against malignant tumors. It was shown that similar radio iodines Crtx and SPGP, 125 I-Crtx and 125 I-SPGP, can interact specifically with malignant tumors and induce cell death. Prototype-based radiopharmaceuticals Crtx and SPGP containing radioiodine 1311 were able to produce diagnostic images to accumulate specifically in the tumor site. The present study aimed at evaluating the potential radiological safety and diagnostic/therapeutic efficacy of 131 I-Crtx l31 I-SPGP and (evaluated from the biokinetic data in mice bearing Ehrlich tumor) were treated by the MIRD formalism to carry out internal dosimetry studies. Absorbed doses due to the uptake of 131 I-Crtx and 131 I-SPGP were determined in various organs of mice and implanted into the tumor. The results obtained for the animal model were extrapolated to humans by assuming a similar concentration ratio among the various tissues between mice and humans. In extrapolation, we used the masses of human organs of the phantom of Cristy/Eckerman. Both radiation penetrating and non penetrating of 131 I on the tissue were considered in dose calculations. The absorbed dose in the bone marrow due to the administration of 131 I-Crtx was 0.01 mGy/370

  12. Artificial insemination in captive Whooping Cranes: Results from genetic analyses

    Science.gov (United States)

    Jones, K.L.; Nicolich, Jane M.

    2001-01-01

    Artificial insemination has been used frequently in the captive whooping crane (Grus americana) population. In the 1980s, it was necessary at times to inseminate females with semen from several males during the breeding season or with semen from multiple males simultaneously due to unknown sperm viability of the breeding males. The goals of this study were to apply microsatellite DNA profiles to resolve uncertain paternities and to use these results to evaluate the current paternity assignment assumptions used by captive managers. Microsatellite DNA profiles were successful in resolving 20 of 23 paternity questions. When resolved paternities were coupled with data on insemination timing, substantial information was revealed on fertilization timing in captive whooping cranes. Delayed fertilization from inseminations 6+ days pre-oviposition suggests capability of sperm storage.

  13. Prevalência de Cryptosporidium serpentis em serpentes de cativeiro Prevalence of Cryptosporidium serpentis in captive snakes

    Directory of Open Access Journals (Sweden)

    Paulo Custório Ruggiero

    2011-11-01

    aspirate sediment obtained by centrifugation and stained by Kinyoun technique. Part of the pellet was submitted to RFLP-PCR technique for amplification of Cryptosporidium segment (833bp, CSP01 of SSU rRNA gene. The serpentarium was divided in three sections by species - the first housing eight Amaral´s Boa (Boa constrictor amarali, the second with ten jararacas (Bothropoides jararaca and the last one with seven south american rattlesnakes (Caudisona durissa. The prevalence of C. serpentis found in this study for the snakes C. durissa, B. jararaca and B. constrictor was 57.14% (04/07, 40% (04/10 and 37.5% (03/08, respectively, thus revealing the high occurrence of this protozoan among captive snakes. Despite the high prevalence found, only B. constrictor amarali presented symptoms as regurgitation and weight loss, probably due to a different sensibility of this species to C. serpentis.

  14. Update on common nutritional disorders of captive reptiles.

    Science.gov (United States)

    Mans, Christoph; Braun, Jana

    2014-09-01

    Nutritional disorders of captive reptiles remain very common despite the increasing knowledge about reptile husbandry and nutrition. Many nutritional disorders are diagnosed late in the disease process; often secondary complications, such as pathologic fractures in reptiles suffering from nutritional secondary hyperparathyroidism have occurred. Therefore, every attempt should be made to educate reptile owners and keepers about the proper care and dietary needs of reptiles under their care because all nutritional disorders seen in captive reptiles are preventable. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Neosporosis in a captive Parma wallaby (Macropus parma).

    Science.gov (United States)

    Cronstedt-Fell, A; Richter, B; Voracek, T; Kübber-Heiss, A

    2012-01-01

    Infection with Neospora caninum has been diagnosed in a variety of animal species; however, reports in marsupials are rare. A captive Parma wallaby (Macropus parma) died suddenly and was subjected to necropsy examination. The main finding was necrotizing myocarditis associated with protozoan parasites. The protozoa were identified as N. caninum by use of immunohistochemistry and partial gene sequence analysis. Neospora and Toxoplasma should be considered a possible cause of disease in captive marsupials. Further work is required to determine whether marsupials are an accidental or terminal host of this protozoan in order to better understand the host-parasite relationship. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Captive rearing initiative for Salmon River chinook salmon; Report period: January 1998-January 1999; Annual report

    International Nuclear Information System (INIS)

    Hassemer, Peter; Kline, Paul; Heindel, Jeff; Plaster, Kurtis

    1999-01-01

    The IDFG initiated a captive rearing program for populations at high risk of extinction to maintain metapopulation structure. Captive rearing is a short-term approach to species preservation. The main goal of the captive rearing approach is to avoid demographic and environmental risks of cohort extinction; maintaining the genetic identity of the breeding unit is an important but secondary objective

  17. Body growth of captive eland Taurotragus oryx in

    African Journals Online (AJOL)

    P.O. Box 2SS, Lusaka, Zambia. J. Hanks. Institute of Natural Resources, University of Natal, ..... Oxford University. Press. 212 pp. SKINNER, J.D. 1972. Eland vs. Beef. Afr. Wildl. 26(1): 4-9. STAINTHORPE, H.L. 1972. Observations on captive eland in the. Loteni Nature Reserve. Lammergeyer 15: 27 - 38. TAYLOR, C.R. ...

  18. The Economics of Captive Breeding and Endangered Species Conservation

    NARCIS (Netherlands)

    Damania, R.; Bulte, E.H.

    2007-01-01

    There is growing concern that the traditional ¿protectionist¿ approach to conservation is expensive and insufficient to deliver the desired environmental outcomes. ¿Supply side¿ policies to conserve endangered species have drawn support. By generating supplies from captive-bred animals, wildlife

  19. Haemangiosarcoma in a captive Asiatic lion ( Panthera leo persica ...

    African Journals Online (AJOL)

    A 2.7-year-old male captive Asiatic lion (Panthera leo persica) died unexpectedly without preceding symptoms. Gross necropsy revealed liver and lung tumours, which proved to be haemangiosarcomas by histopathology. Some of the liver tumours were ruptured, leading to massive intra-abdominal haemorrhage and death.

  20. A preliminary report on locomotory activity in wild and captive ...

    African Journals Online (AJOL)

    The locomotory activity of a free-ranging, male Chrysospalax trevelyani was monitored for five days in the Amatola Forest, Ciskei, using radio telemetry. In addition, locomotory activity of a captive juvenile male and adult female C. trevelyani was monitored in a special laboratory enclosure for 30 days. Preliminary results ...

  1. Serum Chemistry concentrations of captive Woolly Monkeys (Lagothrix Lagotricha)

    NARCIS (Netherlands)

    Ange-van Heugten, K.D.; Verstegen, M.W.A.; Ferket, P.; Stoskopf, M.; Heugten, van E.

    2008-01-01

    Woolly monkeys (Lagothrix sp.) are threatened species and numerous zoos have failed to sustain successful populations. The most common causes of death in captive woolly monkeys are related to pregnancy and hypertension. The objective of this retrospective study was to evaluate serum concentrations

  2. Ascaridosis in captive reticulated python( Python reticulatus ) | Taiwo ...

    African Journals Online (AJOL)

    Two captive reticulated pythons, Python reticulatus, in the Zoological Gardens, University of Ibadan, Ibadan, Nigeria died and were submitted for necropsy at the Diagnostic Laboratory of the Department of Veterinary Pathology, University of Ibadan. Both pythons had been infected with Ascaridia galli for a long period of time ...

  3. Prevalence of Gastrointestinal Parasites of Goats Fed to Captive ...

    African Journals Online (AJOL)

    Zoological gardens showcase wild animals for aesthetic, educational and conservation purposes. Parasitic diseases had been described to be a big threat to animals in captivity, leading to high mortality in some cases. This study was carried out to determine the prevalence of gastrointestinal parasites in goats fed to ...

  4. Emergent patterns of social organization in captive Cercocebus ...

    Indian Academy of Sciences (India)

    2012-07-18

    Jul 18, 2012 ... Emergent patterns of social organization in captive Cercocebus torquatus: Testing the GrooFiWorld agent-based model. R DOLADO. 1,* and FS BELTRAN. 2. 1Department of Behavioral Sciences Methods, 2Institute for Brain, Cognition and Behavior (IR3C), Adaptive Behavior and Interaction Research ...

  5. Parasites and associated packed cell volume changes of captive ...

    African Journals Online (AJOL)

    Parasites and associated packed cell volume changes of captive wild birds in the semi-arid region of north-eastern Nigeria. ... Eimeria oocysts (19.8%) were the most prevalent followed respectively by strongyle (7.9%), Ascaridia galli (4.8%) and Raillietina (1.6%) eggs. Egg and oocyst counts were generally low. Necropsy ...

  6. Genetic assessment of captive elephant (Elephas maximus) populations in Thailand

    NARCIS (Netherlands)

    Thitaram, Chatchote; Somgird, Chaleamchart; Mahasawangkul, Sittidet; Angkavanich, Taweepoke; Roongsri, Ronnachit; Thongtip, Nikorn; Colenbrander, Ben; van Steenbeek, Frank G.; Lenstra, Johannes A.

    2010-01-01

    The genetic diversity and population structure of 136 captive Thai elephants (Elephas maximus) with known region of origin were investigated by analysis of 14 highly polymorphic microsatellite loci. We did not detect significant indications of inbreeding and only a low differentiation of elephants

  7. TOXOPLASMOSIS IN CAPTIVE DOLPHINS (TURSIOPS TRUNCATUS) AND WALRUS (ODOBENUS ROSMRUS)

    Science.gov (United States)

    Toxoplasma gondii infection in marine mammals is intriguing and indicative of contamination of the ocean environment and coastal waters with oocysts. Toxoplasma gondii infection was detected in captive marine mammals at a seaquarium in Canada. Antibodies to T. gondii were found in all 7 bottlenose ...

  8. Assessment of Captive Management of Nile Crocodile, Crocodylus ...

    African Journals Online (AJOL)

    The number of crocodiles and the number of eggs were of the constraints faced in managing them in captivity. The constraints mentioned includes inadequate space (75%) and inadequate funds (62.5%). Others includes problems of water, fighting among the crocodiles, diseases and parasites. The main recommendation is ...

  9. An outbreak of leptospirosis in seals (Phoca vitulina) in captivity

    NARCIS (Netherlands)

    Kik, M. J. L.; Goris, M. G.; Bos, J. H.; Hartskeerl, R. A.; Dorrestein, G. M.

    2006-01-01

    An outbreak of leptospirosis in seals (Phoca vitulina) in captivity is described. In a zoo in The Netherlands 5 adult seals died within 12 days. At necropsy all animals showed signs of acute septicaemia, consistent with acute leptospirosis. Serological examination of one animal was positive for

  10. Pulmonary, microbiological and hematological changes in Crotalus durissus terrificus (Serpentes, Viperidae parasitized by nematodes of the genus Rhabdias (Nematoda, Rhabdiasidae Alterações Pulmonares, microbiológicas e hematológicas em Crotalus durissus terrificus (Serpentes, Viperidae parasitadas pelos nematódeos do gênero Rhabdias (Nematoda, Rhabdiasidae

    Directory of Open Access Journals (Sweden)

    K.R. Santos

    2008-06-01

    Full Text Available This study reported the pulmonary, microbiological, and hematological alterations in Crotalus durissus terrificus parasitized by nematodes of the genus Rhabdias. Histological, microbiological, and hematological analysis were performed on parasitized (n=6 and non-parasitized (n=6 snakes. Granulocytic and mononuclear cell infiltrates in the pulmonary parenchyma and epithelium were also observed during the histological analysis of parasitized snakes. Microbiological analysis of parasitized animals revealed the following Gram-negative bacteria: Citrobacter divergens, Burkholderia cepacia, Stenotrophomonas maltophilia, Proteus vulgaris, Enterobacter sakazakii, Enterobacter ammnigenus, Pseudomonas aeruginosa, Pantoea sp. and Providencia rettgeri. In non-parasitized snakes, the following species were identified: B. cepacia, Pseudomonas fluorescens, and Acinetobacter baumanii. Increased levels of plasmatic protein, decreased lymphocyte counts, and normal red blood cell values were observed in parasitized animals.Este trabalho relata as alterações pulmonares, microbiológicas e hematológicas em Crotalus durissus terrificus parasitadas pelo nematódeo do gênero Rhabdias. As análises histológicas, microbiológicas e hematológicas foram realizadas em serpentes parasitadas (n=6 e não parasitadas (n=6. Foram observados infiltrados de células granulocíticas e mononucleares no parênquima pulmonar durante a análise histopatológica das serpentes parasitadas. A análise microbiológica revelou as seguintes bactérias Gram-negativas; Citrobacter divergens, Burkholderia cepacia, Stenotrophomonas maltophilia, Proteus vulgaris, Enterobacter sakazakii, Enterobacter ammnigenus, Pseudomonas aeruginosa, Pantoea sp. e Providencia rettgeri. Nas serpentes não parasitadas foram identificadas: B. cepacia, Pseudomonas fluorescens e Acinetobacter baumanii. Nos animais parasitados observaram-se: aumento da concentração de proteína plasmática, diminuição da

  11. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, Annual Report 2001-2002.

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Deborah; McAuley, W.; Maynard, Desmond

    2003-04-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game and the Bonneville Power Administration, has established captive broodstock programs to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the U.S. Endangered Species Act (ESA). Captive broodstock and captive rearing programs are a form of artificial propagation that are emerging as an important component of restoration efforts for ESA-listed salmon populations that are at critically low numbers. Captive broodstocks, reared in captivity for the entire life cycle, couple the salmon's high fecundity with potentially high survival in protective culture to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS activities from 1 September 2001 to 31 August 2002 on the Redfish Lake sockeye salmon captive broodstock and captive rearing program. NMFS currently has broodstocks in culture from year classes 1997, 1998, 1999, 2000, and 2001 in both the captive breeding and captive rearing programs. Offspring from these programs are being returned to Idaho to aid recovery efforts for the species.

  12. Captivity influences immune responses, stress endocrinology, and organ size in house sparrows (Passer domesticus).

    Science.gov (United States)

    Love, Ashley C; Lovern, Matthew B; DuRant, Sarah E

    2017-10-01

    Studies using wild animals in laboratory-based research require bringing wild-captured organisms into a novel setting, which can have long-lasting impacts on physiology and behavior. In several species, captivity stimulates stress hormone production and can alter immune function. Despite this, there is little consensus on how captivity influences stress hormone regulation, or if captivity-induced changes in stress hormone production and regulation mediate changes in immune function. In this study, we investigate the influence of captivity on the physiology of a wild bird commonly-used in laboratory-based research, the house sparrow (Passer domesticus). We tested how captivity influences stress endocrinology, immune responses, and organ mass, and also investigated if the production or regulation of corticosterone, the main stress hormone in birds, correlated with changes in immunity. We found that baseline corticosterone concentrations and maximum capacity of the adrenals to secrete corticosterone increase following captivity and remain elevated after 9weeks of captivity. A measure of innate immune function, the bactericidal ability of plasma, also increased with time spent in captivity. Wound healing was also influenced by time spent in captivity, with birds taking almost 2days longer to heal if they were wounded after 3weeks in captivity when compared with birds that were wounded immediately upon capture. Additionally, captivity caused notable reductions in spleen and liver mass. Together, these results imply that captivity can have long-lasting effects on house sparrow corticosterone release and immune function, and suggest that even after 9weeks house sparrows do not acclimate physiologically to life in captivity. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Humoral response and neutralization capacity of sheep serum inoculated with natural and Cobalt 60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P.; Alfieri, A.A. [Universidade Estadual de Londrina, PR (Brazil). Centro de Ciencias Agrarias, Dept. de Medicina Veterinaria Preventiva; Chiacchio, S.B.; Bicudo, P.L. [UNESP, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia; Nascimento, N. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radiobiologia]. E-mail: rnetto@uel.br

    2002-07-01

    The aim of this work was to investigate antigen irradiation on crotalic antivenom and the capacity of sheep as serum producers. Twelve sheep in two groups of six were inoculated with Crotalus durissus terrificus venom. One group was inoculated with natural venom (N V) and the other with Cobalt 60 gamma-irradiated venom (Ir V). Three antigen doses were given to the animals at monthly intervals for immunization. The toxic activity of the venom was assessed by LD 50 determination in mice. Blood samples were collected weekly analyses of serum neutralization capacity and potency. At the end of the experiment, the animals were challenged with a LD 50 for sheep showed no signs of envenoming. These results showed that toxicity of the irradiated venom was 4.4 times less than the natural venom. The sera from the irradiated group neutralized LD 50 14.6 times, and the sera from the natural group 4.4 times. Sera from the irradiated group were five times more potent. The two groups did not present clinical alterations. The results of this study show the potential for using sheep in crotalic antivenom production. The use of irradiated venom in sheep immunization induces a powerful and lasting humoral immune response shown by both the in vitro neutralization and potency tests and by the indirect ELISA antibody level detection technique. (author)

  14. Phospholipase A2 isolated from the venom of Crotalus durissus terrificus inactivates dengue virus and other enveloped viruses by disrupting the viral envelope.

    Directory of Open Access Journals (Sweden)

    Vanessa Danielle Muller

    Full Text Available The Flaviviridae family includes several virus pathogens associated with human diseases worldwide. Within this family, Dengue virus is the most serious threat to public health, especially in tropical and sub-tropical regions of the world. Currently, there are no vaccines or specific antiviral drugs against Dengue virus or against most of the viruses of this family. Therefore, the development of vaccines and the discovery of therapeutic compounds against the medically most important flaviviruses remain a global public health priority. We previously showed that phospholipase A2 isolated from the venom of Crotalus durissus terrificus was able to inhibit Dengue virus and Yellow fever virus infection in Vero cells. Here, we present evidence that phospholipase A2 has a direct effect on Dengue virus particles, inducing a partial exposure of genomic RNA, which strongly suggests inhibition via the cleavage of glycerophospholipids at the virus lipid bilayer envelope. This cleavage might induce a disruption of the lipid bilayer that causes a destabilization of the E proteins on the virus surface, resulting in inactivation. We show by computational analysis that phospholipase A2 might gain access to the Dengue virus lipid bilayer through the pores found on each of the twenty 3-fold vertices of the E protein shell on the virus surface. In addition, phospholipase A2 is able to inactivate other enveloped viruses, highlighting its potential as a natural product lead for developing broad-spectrum antiviral drugs.

  15. Rabdomióilise secundária a acidente ofídico crotálico (Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    Renato Almeida Magalhães

    1986-08-01

    Full Text Available Relatam-se dois casos de rabdomiólise secundária a envenenamento produzido por Crotalus durissus terrificus. O diagnóstico da rabdomiólise baseou-se na mialgia intensa e generalizada apresentada pelos pacientes e na constatação de níveis séricos elevados de CPK, TGO e DHL. A confirmação do diagnóstico foi obtida no caso n.° 2 pela detecção de mioglobina no soro através de imunoeletroforese contra soro antimioglobina humana e por biópsia muscular. Esse paciente desenvolveu também, como complicação do envenenamento ofídico, quadro clínico e laboratorial de insuficiência renal aguda. Essa complicação foi atribuída à ação nefrotóxica e hemolítica do veneno crotálico e à hipotensão arterial apresentada pelo paciente, não se afastando a possibilidade de que a rabdomiólise tenha sido um fator contribuinte para a sua instalação. Foram constatadas hipocalcemla, hiperuricemia e hiperfosfatemia grave na fase oligúria da insuficiência renal aguda, alterações peculiares quando essa condição está associada à rabdomiólise.

  16. Humoral response and neutralization capacity of sheep serum inoculated with natural and Cobalt 60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.; Alfieri, A.A.; Chiacchio, S.B.; Bicudo, P.L.; Nascimento, N.

    2002-01-01

    The aim of this work was to investigate antigen irradiation on crotalic antivenom and the capacity of sheep as serum producers. Twelve sheep in two groups of six were inoculated with Crotalus durissus terrificus venom. One group was inoculated with natural venom (N V) and the other with Cobalt 60 gamma-irradiated venom (Ir V). Three antigen doses were given to the animals at monthly intervals for immunization. The toxic activity of the venom was assessed by LD 50 determination in mice. Blood samples were collected weekly analyses of serum neutralization capacity and potency. At the end of the experiment, the animals were challenged with a LD 50 for sheep showed no signs of envenoming. These results showed that toxicity of the irradiated venom was 4.4 times less than the natural venom. The sera from the irradiated group neutralized LD 50 14.6 times, and the sera from the natural group 4.4 times. Sera from the irradiated group were five times more potent. The two groups did not present clinical alterations. The results of this study show the potential for using sheep in crotalic antivenom production. The use of irradiated venom in sheep immunization induces a powerful and lasting humoral immune response shown by both the in vitro neutralization and potency tests and by the indirect ELISA antibody level detection technique. (author)

  17. Cerebrovascular accident (stroke) in captive, group-housed, female chimpanzees.

    Science.gov (United States)

    Jean, Sherrie M; Preuss, Todd M; Sharma, Prachi; Anderson, Daniel C; Provenzale, James M; Strobert, Elizabeth; Ross, Stephen R; Stroud, Fawn C

    2012-08-01

    Over a 5-y period, 3 chimpanzees at our institution experienced cerebrovascular accidents (strokes). In light of the increasing population of aged captive chimpanzees and lack of literature documenting the prevalence and effectiveness of various treatments for stroke in chimpanzees, we performed a retrospective review of the medical records and necropsy reports from our institution. A survey was sent to other facilities housing chimpanzees that participate in the Chimpanzee Species Survival Plan to inquire about their experience with diagnosing and treating stroke. This case report describes the presentation, clinical signs, and diagnosis of stroke in 3 recent cases and in historical cases at our institution. Predisposing factors, diagnosis, and treatment options of cerebral vascular accident in the captive chimpanzee population are discussed also.

  18. Liver iron overloading in captive muriquis (Brachyteles spp.).

    Science.gov (United States)

    Santos, Stéfanie V; Strefezzi, Ricardo De F; Pissinatti, Alcides; Catão-Dias, José L

    2011-04-01

    Iron accumulation was investigated qualitatively and quantitatively in the liver of 15 captive Brachyteles spp. Hepatic hemosiderosis index (HHI) was determined as the area percentage of the liver parenchyma occupied by hemosiderin and ferritin deposits, through computerized histomorphometric analysis of Prussian blue-stained histologic sections. All studied animals presented liver hemosiderosis, and HHI ranged from 0.2% to 41.7%. There were no significant differences in HHI between muriqui species or genders, and no correlations were detected among HHI and age, time in captivity or body mass. Iron deposits were accompanied by other hepatic disorders. This is the first study addressing the occurrence and consequences of iron overloading in the liver of muriquis. We propose that hemosiderosis may act as a contribute factor for the development of hepatic injuries. Further studies are advised to clarify the role of diet in the pathogenesis of hemosiderosis in these atelids. © 2010 John Wiley & Sons A/S.

  19. Spatial Memory in Captive Giant Anteaters (Myrmecophaga tridactyla

    Directory of Open Access Journals (Sweden)

    Stephanie M. Allard

    2014-08-01

    Full Text Available The type of learning exhibited during foraging has been studied in a large number of species. Species that feed on food sources that temporally vary in quality could be well suited for exhibiting evidence of spatial learning. The foraging strategies of captive giant anteaters were examined using an experimental foraging task. Two giant anteaters were exposed to a modified radial arm maze in order to determine whether or not they would demonstrate evidence of spatial learning. Both subjects demonstrated significant improvement in performance by visiting baited feeders more consistently across learning trials. A disruption in performance occurred when the task was reversed, indicating that giant anteaters may use spatial learning to locate food sources. Obtaining a more sound understanding of the cognitive abilities of giant anteaters may help to enhance their welfare in captive settings.

  20. Prevalence of salmonella in captive reptiles from Croatia

    DEFF Research Database (Denmark)

    Lukac, Maja; Pedersen, Karl; Prukner-Radovcic, Estella

    2015-01-01

    Salmonellosis transmitted by pet reptiles is an increasing public health issue worldwide. The aim of this study was to investigate the prevalence of Salmonella strains from captive reptiles in Croatia. From November 2009 to November 2011 a total of 292 skin, pharyngeal, cloacal, and fecal samples...... from 200 apparently healthy reptiles were tested for Salmonella excretions by bacteriologic culture and serotyping. These 200 individual reptiles included 31 lizards, 79 chelonians, and 90 snakes belonging to private owners or housed at the Zagreb Zoo, Croatia. Salmonella was detected in a total of 13...... of Salmonella is considerable in captive reptiles in Croatia, indicating that these animals may harbor serovars not commonly seen in veterinary or human microbiologic practice. This should be addressed in the prevention and diagnostics of human reptile-transmitted infections....

  1. CLINICOPATHOLOGIC FEATURES OF MAMMARY MASSES IN CAPTIVE LIONS (PANTHERA LEO).

    Science.gov (United States)

    Sadler, Ryan A; Craig, Linden E; Ramsay, Edward C; Helmick, Kelly; Collins, Darin; Garner, Michael M

    2016-03-01

    A multi-institutional retrospective analysis of 330 pathology accessions from 285 different lions found 15 captive, female African lions (Panthera leo) with confirmed mammary masses. Aside from the presence of a mammary mass, the most common initial clinical sign was inappetence. Histologic diagnoses were predominantly adenocarcinoma (n = 12), though two benign masses (mammary hyperplasia and a mammary cyst) and one squamous cell carcinoma were identified. Nine of 13 malignant tumors had metastasized to lymph nodes or viscera at the time of necropsy. Six lions with adenocarcinoma and two lions with benign mammary masses had received hormonal contraception, though little evidence of mammary lobular hyperplasia was seen in association with the adenocarcinomas. The most common concurrent disease processes found at necropsy were chronic urinary tract disease and other malignancies. These cases demonstrate that mammary malignancies occur in captive lions and frequently metastasize.

  2. Genetic assessment of captive red panda (Ailurus fulgens) population

    OpenAIRE

    Kumar, Arun; Rai, Upashna; Roka, Bhupen; Jha, Alankar K.; Reddy, P. Anuradha

    2016-01-01

    Red panda (Ailurus fulgens) is threatened across its range by detrimental human activities and rapid habitat changes necessitating captive breeding programs in various zoos globally to save this flagship species from extinction. One of the ultimate aims of ex situ conservation is reintroduction of endangered animals into their natural habitats while maintaining 90?% of the founder genetic diversity. Advances in molecular genetics and microsatellite genotyping techniques make it possible to ac...

  3. Calcinosis circumscripta in a captive African cheetah (Acinonyx jubatus

    Directory of Open Access Journals (Sweden)

    Chisoni Mumba

    2014-10-01

    Full Text Available This article reports a first case of calcinosis circumscripta in a captive African cheetah (Acinonyx jubatus. Histopathology demonstrated well defined multiple cystic structures containing granular, dark basophilic materials with peripheral granulomatous reaction, characterized by presence of multinucleated giant cells surrounded by a varying amounts of fibrous connective tissues. Special staining with von Kossa revealed black stained deposits confirming the presence of calcium salts.

  4. A review of 105 necropsies in captive baboons (Papio cynocephalus).

    Science.gov (United States)

    Kim, J C; Kalter, S S

    1975-07-01

    In contrast to the findings in newly caught babboons in Africa, the leading cause of death in captivity in America was a pneumonia and enteritis complex. Bacterial species such as Proteus morgani, Proteus mirabilis, Clostridium sp., Pseudomonas paracolon, pathogenic Escherichia coli and cocci have been isolated in association with a pneumoenteric syndrome of 35 newborn baboons, including neonates. The majority of these animals died with pulmonary factors such as anoxia and pneumonia.

  5. Stress Hormones and their Regulation in a Captive Dolphin Population

    Science.gov (United States)

    2015-09-30

    Dolphin Population Cory D Champagne & Dorian S. Houser National Marine Mammal Foundation 2240 Shelter Island Dr, Suite 200 San Diego, CA 92106 phone...understanding of how the stress response operates in marine mammals by evaluating markers of stress in a captive dolphin population. It determines...baseline levels of putative stress hormones and evaluates the functional consequences of increased stress in the bottlenose dolphin (Tursiops

  6. Parasitic fauna of captive snakes in Tamilnadu, India

    Directory of Open Access Journals (Sweden)

    Nakulan Valsala Rajesh

    2015-07-01

    Full Text Available Objective: To study the parasitic fauna on serpentines under captive condition in zoological park of Tamilnadu, India. Methods: Fecal samples were collected from (n = 247 serpentines, Arignar Anna Zoological Park (n = 22, Vandalur, Tamilnadu, India and Snake Park (n = 27, Guindy, Tamilnadu, India and screened for endoparasites using sedimentation techniques. Ectoparasites were also reported in this study. Results: Coprological examination (n = 247 from captive snakes (n = 49 on random analysis revealed strongyles were predominant in Arignar Anna Zoological Park, Vandalur and Snake Park, Guindy, however the parasites were absent in king cobras (Ophiophagus hannah. Eggs of Capillaria sp. showed less predominance in Vandalur and Gunidy. Rat snakes [Ptyas mucosus (P. mucosus] showed higher prevalence of strongyle infection in Vandalur, and Russell’s viper (Daboia russelii showed higher prevalence in Guindy. Study on ectoparasites revealed Aponomma gerviasii ticks in P. mucosus, Indian cobras (Naja naja, king cobras (Ophiophagus hannah, reticulated pythons (Python reticulates and Indian rock pythons (Python molurus, among them, the most heavy infestation was documented in P. mucosus (n = 9. Conclusions: Confinement favour stress and dysecdysis in captive condition affect the health status of snakes in zoological park.

  7. NEPHROPATHIES IN THE EUROPEAN CAPTIVE CHEETAH (ACINONYX JUBATUS) POPULATION.

    Science.gov (United States)

    Url, Angelika; Krutak, Verena; Kübber-Heiss, Anna; Chvala-Mannsberger, Sonja; Robert, Nadia; Dinhopl, Nora; Schmidt, Peter; Walzer, Chris

    2016-09-01

    According to previous studies in captive cheetah ( Acinonyx jubatus ) populations, one of the most threatening diseases besides amyloidosis, myelopathy, veno occlusive disease, and gastritis, is renal failure. Contrary to captive cheetahs in North America and South Africa, morphological data concerning renal lesions in the cheetah European Endangered Species Program (EEP) are lacking. This study details the histological characterization as well as immunohistochemical and morphometrical analysis of nephropathies in 35 captive cheetahs from the EEP, which were necropsied between 1985 and 2003. Examination of paraffin- and glycolmethacrylate-methylmethacrylate (GMA-MMA) embedded kidney samples by light microscopy revealed glomerulonephritis in 91%, with a high prevalence for glomerulosclerosis and glomerulonephritis with the histologic pattern of membranous glomerulonephritis (77%). Besides these predominating glomerulopathies, a wide range of other renal lesions, like acute tubular necrosis, interstitial nephritis, calcinosis, and amyloidosis, were present. Pathological expression of collagen type IV, complement C3, fibronectin, and IgG was demonstrated in the glomeruli of the cheetah kidneys with the use of the avidin-biotin complex method. Morphometrical analysis was performed on GMA-MMA embedded kidney samples to obtain glomerulosclerosis index and glomerulosclerosis incidence.

  8. Reproduction of Phylloderma stenops in captivity (Chiroptera, Phyllostomidae

    Directory of Open Access Journals (Sweden)

    CEL Esbérard

    Full Text Available A reproductive colony of Phylloderma stenops was established in captivity. The bats were maintained in 1/2" wired screen cages sized 90 × 60 × 80 cm in a room with cycles of 13 hours of light and 11 hours of dark and with temperature and humidity ranging from 27 to 31 °C and 75 to 90% respectively. Bats were fed with a semi-liquid diet composed of chopped fruits, raw eggs, bovine meat, dog food, honey, dehydrated shrimp, salt and a vitamin and mineral complex offered daily. In the first two years of confinement the diet was complemented with laboratory-raised cockroaches, mealworms, young mice and seasonal fruits. Nine births occurred from three wild caught females 770-1050 days after capture and two captive-born females. Births occurred in September, February and November-December. The neonate measured 15.0 g of weight and present 34.1 mm of forearm length. Two captive-born females gave birth for the first time at 402-445 days of age. Phylloderma stenops species presents postpartum oestrus, gestation of 5.5 months, lactation of 3.3 months and sexual maturity at 8.0-8.5 months. Fetuses are palpable around two months before birth and females may present synchronisation of births.

  9. Limits to captive breeding of mammals in zoos.

    Science.gov (United States)

    Alroy, John

    2015-06-01

    Captive breeding of mammals in zoos is the last hope for many of the best-known endangered species and has succeeded in saving some from certain extinction. However, the number of managed species selected is relatively small and focused on large-bodied, charismatic mammals that are not necessarily under strong threat and not always good candidates for reintroduction into the wild. Two interrelated and more fundamental questions go unanswered: have the major breeding programs succeeded at the basic level of maintaining and expanding populations, and is there room to expand them? I used published counts of births and deaths from 1970 to 2011 to quantify rates of growth of 118 captive-bred mammalian populations. These rates did not vary with body mass, contrary to strong predictions made in the ecological literature. Most of the larger managed mammalian populations expanded consistently and very few programs failed. However, growth rates have declined dramatically. The decline was predicted by changes in the ratio of the number of individuals within programs to the number of mammal populations held in major zoos. Rates decreased as the ratio of individuals in programs to populations increased. In other words, most of the programs that could exist already do exist. It therefore appears that debates over the general need for captive-breeding programs and the best selection of species are moot. Only a concerted effort could create room to manage a substantially larger number of endangered mammals. © 2015, Society for Conservation Biology.

  10. Haematological values for captive harpy eagle (Harpia harpyja

    Directory of Open Access Journals (Sweden)

    Marcos J. Oliveira

    2014-08-01

    Full Text Available Decreasing of harpy eagle (Harpia harpyja populations in natural environments, mainly in non-preserved areas, makes captive population management an important contribution to genetic diversity conservation. The aim of this study is to evaluate hematological parameters for captive harpy eagles maintained at the wild animals breeding center of Itaipu Binacional, Paraná State, Brazil. Fourteen blood samples from nine harpy eagles were collected from animals of both sexes, of different ages and with no clinical signs of disease. Significant variations were found in haematological values of hematocrit, hemoglobin, mean corpuscular hemoglobin (MCH, mean corpuscular hemoglobin concentration (MCHC, leukocyte, a relative number of heterophils, absolute and relative number of lymphocytes, monocytes, eosinophils, basophils and plasma protein between groups of young (less than six months old and adult birds. Comparing males and females there was variation in the values of erythrocytes, hemoglobin, mean corpuscular volume (MCV, mean corpuscular hemoglobin (MCH on heterophils, absolute and relative number of lymphocytes, eosinophils and basophils. There was also variation in the values of red blood cells, hematocrit, hemoglobin, mean corpuscular volume (MCV, mean corpuscular hemoglobin (MCH, mean corpuscular hemoglobin concentration (MCHC, leukocyte count, absolute number of lymphocytes, eosinophils and basophils among birds that study compared to another reference birds. Due to the limited information available on harpy eagle hematology, this study will be useful to the clinical assessment of birds maintained in captivity.

  11. Research on Captive Broodstock Programs for Pacific Salmon; Assessment of Captive Broodstock Technologies, Annual Report 2002-2003.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry

    2004-01-01

    The success of captive broodstock programs depends on high in-culture survival, appropriate development of the reproductive system, and the behavior and survival of cultured salmon after release, either as adults or juveniles. Continuing captive broodstock research designed to improve technology is being conducted to cover all major life history stages of Pacific salmon. Current velocity in rearing vessels had little if any effect on reproductive behavior of captively reared steelhead. However, males and females reared in high velocity vessels participated a greater number of spawning events than siblings reared in low velocity tanks. Observations of nesting females and associated males in a natural stream (Hamma Hamma River) were consistent with those observed in a controlled spawning channel. DNA pedigree analyses did not reveal significant differences in the numbers of fry produced by steelhead reared in high and low velocity vessels. To determine the critical period(s) for imprinting for sockeye salmon, juvenile salmon are being exposed to known odorants at key developmental stages. Subsequently they will be tested for development of long-term memories of these odorants. In 2002-2003, the efficacy of EOG analysis for assessing imprinting was demonstrated and will be applied in these and other behavioral and molecular tools in the current work plan. Results of these experiments will be important to determine the critical periods for imprinting for the offspring of captively-reared fish destined for release into natal rivers or lakes. By early August, the oocytes of all of Rapid River Hatchery chinook salmon females returning from the ocean had advanced to the tertiary yolk globule stage; whereas, only some of the captively reared Lemhi River females sampled had advanced to this stage, and the degree of advancement was not dependent on rearing temperature. The mean spawning time of captive Lemhi River females was 3-4 weeks after that of the Rapid River fish

  12. Comparative skull analysis suggests species-specific captivity-related malformation in lions (Panthera leo.

    Directory of Open Access Journals (Sweden)

    Joseph Saragusty

    Full Text Available Lion (Panthera leo populations have dramatically decreased worldwide with a surviving population estimated at 32,000 across the African savannah. Lions have been kept in captivity for centuries and, although they reproduce well, high rates of stillbirths as well as morbidity and mortality of neonate and young lions are reported. Many of these cases are associated with bone malformations, including foramen magnum (FM stenosis and thickened tentorium cerebelli. The precise causes of these malformations and whether they are unique to captive lions remain unclear. To test whether captivity is associated with FM stenosis, we evaluated 575 lion skulls of wild (N = 512 and captive (N = 63 origin. Tiger skulls (N = 276; 56 captive, 220 wild were measured for comparison. While no differences were found between males and females or between subadults and adults in FM height (FMH, FMH of captive lions (17.36±3.20 mm was significantly smaller and with greater variability when compared to that in wild lions (19.77±2.11 mm. There was no difference between wild (18.47±1.26 mm and captive (18.56±1.64 mm tigers in FMH. Birth origin (wild vs. captive as a factor for FMH remained significant in lions even after controlling for age and sex. Whereas only 20/473 wild lions (4.2% had FMH equal to or smaller than the 5th percentile of the wild population (16.60 mm, this was evident in 40.4% (23/57 of captive lion skulls. Similar comparison for tigers found no differences between the captive and wild populations. Lions with FMH equal to or smaller than the 5th percentile had wider skulls with smaller cranial volume. Cranial volume remained smaller in both male and female captive lions when controlled for skull size. These findings suggest species- and captivity-related predisposition for the pathology in lions.

  13. Comparative skull analysis suggests species-specific captivity-related malformation in lions (Panthera leo).

    Science.gov (United States)

    Saragusty, Joseph; Shavit-Meyrav, Anat; Yamaguchi, Nobuyuki; Nadler, Rona; Bdolah-Abram, Tali; Gibeon, Laura; Hildebrandt, Thomas B; Shamir, Merav H

    2014-01-01

    Lion (Panthera leo) populations have dramatically decreased worldwide with a surviving population estimated at 32,000 across the African savannah. Lions have been kept in captivity for centuries and, although they reproduce well, high rates of stillbirths as well as morbidity and mortality of neonate and young lions are reported. Many of these cases are associated with bone malformations, including foramen magnum (FM) stenosis and thickened tentorium cerebelli. The precise causes of these malformations and whether they are unique to captive lions remain unclear. To test whether captivity is associated with FM stenosis, we evaluated 575 lion skulls of wild (N = 512) and captive (N = 63) origin. Tiger skulls (N = 276; 56 captive, 220 wild) were measured for comparison. While no differences were found between males and females or between subadults and adults in FM height (FMH), FMH of captive lions (17.36±3.20 mm) was significantly smaller and with greater variability when compared to that in wild lions (19.77±2.11 mm). There was no difference between wild (18.47±1.26 mm) and captive (18.56±1.64 mm) tigers in FMH. Birth origin (wild vs. captive) as a factor for FMH remained significant in lions even after controlling for age and sex. Whereas only 20/473 wild lions (4.2%) had FMH equal to or smaller than the 5th percentile of the wild population (16.60 mm), this was evident in 40.4% (23/57) of captive lion skulls. Similar comparison for tigers found no differences between the captive and wild populations. Lions with FMH equal to or smaller than the 5th percentile had wider skulls with smaller cranial volume. Cranial volume remained smaller in both male and female captive lions when controlled for skull size. These findings suggest species- and captivity-related predisposition for the pathology in lions.

  14. Activation of southern white rhinoceros (Ceratotherium simum simum) estrogen receptors by phytoestrogens and their potential role in thereproductive failure of captive-born females

    Science.gov (United States)

    The captive southern white rhinoceros (SWR; Ceratotherium simum simum) population serves as an important genetic reservoir critical to the conservation of this vulnerable species. Unfortunately, captive populations are declining due to the poor reproductive success of captive-bor...

  15. Effect of Mikania glomerata (Asteraceae leaf extract combined with anti-venom serum on experimental Crotalus durissus (Squamata: Viperidae envenomation in rats

    Directory of Open Access Journals (Sweden)

    Rafael Stuani Floriano

    2009-12-01

    Full Text Available Crotalic envenomation represents the highest number of deaths when compared to other snakebite envenomations of medical interest. Crotalic venom has important characteristics such as neurotoxicity, myotoxicity, nephrotoxicity, and clotting and hemolytic action. We evaluated the clinical and laboratory aspects of Crotalus durissus terrificus experimental envenomation in Wistar rats treated with antivenom and the aqueous extract of the plant Mikania glomerata. The animals were divided into three groups: Group C (control; Group VS-venom and antivenom; Group VSM-venom, antivenom and aqueous extract of M. glomerata. Crotalic poison caused clinical and laboratory alterations in Wistar mice. Significant linical alterations were: temperature decrease, edema in the venom inoculated member, sedation and a locomotion decrease in groups VS and VSM when compared with group C. A faster recovery from sedation was observed only for animals of group VSM when compared to VS. There was an increase in the number of leukocytes, neutrophils and creatine kinase in the VS and VSM groups, compared to group C. Wistar rats showed a high resistance to crotalic venom. Additional studies with different doses, time of treatment, different administration methods and histopathological and immunological studies are necessary to understand the action of M. glomerata in crotalic accidents. Rev. Biol. Trop. 57 (4: 929-937. Epub 2009 December 01.El envenamiento crotálico representa el número más alto de muertes cuando es comparado con envenenamientos por mordeduras de otras serpientes de interés médico. El veneno crotálico tiene importantes características de acción neurotóxica, miotoxicidad, nefrotoxicidad, coagulación y acción hemolítica. Este trabajo evaluó los aspectos clínicos y de laboratorio del envenenamiento experimental con el veneno de la serpiente Crotalus durissus terrificus en las ratas Wistar tratadas con suero antiofídico y extracto acuoso de M

  16. Rattlesnake Phospholipase A2 Increases CFTR-Chloride Channel Current and Corrects ∆F508CFTR Dysfunction: Impact in Cystic Fibrosis.

    Science.gov (United States)

    Faure, Grazyna; Bakouh, Naziha; Lourdel, Stéphane; Odolczyk, Norbert; Premchandar, Aiswarya; Servel, Nathalie; Hatton, Aurélie; Ostrowski, Maciej K; Xu, Haijin; Saul, Frederick A; Moquereau, Christelle; Bitam, Sara; Pranke, Iwona; Planelles, Gabrielle; Teulon, Jacques; Herrmann, Harald; Roldan, Ariel; Zielenkiewicz, Piotr; Dadlez, Michal; Lukacs, Gergely L; Sermet-Gaudelus, Isabelle; Ollero, Mario; Corringer, Pierre-Jean; Edelman, Aleksander

    2016-07-17

    Deletion of Phe508 in the nucleotide binding domain (∆F508-NBD1) of the cystic fibrosis transmembrane regulator (CFTR; a cyclic AMP-regulated chloride channel) is the most frequent mutation associated with cystic fibrosis. This mutation affects the maturation and gating of CFTR protein. The search for new high-affinity ligands of CFTR acting as dual modulators (correctors/activators) presents a major challenge in the pharmacology of cystic fibrosis. Snake venoms are a rich source of natural multifunctional proteins, potential binders of ion channels. In this study, we identified the CB subunit of crotoxin from Crotalus durissus terrificus as a new ligand and allosteric modulator of CFTR. We showed that CB interacts with NBD1 of both wild type and ∆F508CFTR and increases their chloride channel currents. The potentiating effect of CB on CFTR activity was demonstrated using electrophysiological techniques in Xenopus laevis oocytes, in CFTR-HeLa cells, and ex vivo in mouse colon tissue. The correcting effect of CB was shown by functional rescue of CFTR activity after 24-h ΔF508CFTR treatments with CB. Moreover, the presence of fully glycosylated CFTR was observed. Molecular docking allowed us to propose a model of the complex involving of the ABCβ and F1-like ATP-binding subdomains of ΔF508-NBD1. Hydrogen-deuterium exchange analysis confirmed stabilization in these regions, also showing allosteric stabilization in two other distal regions. Surface plasmon resonance competition studies showed that CB disrupts the ∆F508CFTR-cytokeratin 8 complex, allowing for the escape of ∆F508CFTR from degradation. Therefore CB, as a dual modulator of ΔF508CFTR, constitutes a template for the development of new anti-CF agents. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Contributions of the snake venoms of Bothrops asper, Crotalus simus and Lachesis stenophrys to the paraspecificity of the Central American polyspecific antivenom (PoliVal-ICP).

    Science.gov (United States)

    Solano, Gabriela; Gómez, Aarón; Corrales, Greivin; Chacón, Danilo; Estrada, Ricardo; León, Guillermo

    2018-03-15

    PoliVal-ICP antivenom is produced from plasma of horses immunized toward the venoms of Bothrops asper, Crotalus simus and Lachesis stenophrys. The antibody response induced by these venoms confers PoliVal-ICP the capacity to neutralize the venoms of the most important Central American viperids, including not only homologous venoms (i.e., venoms used as immunogen), but many heterologous venoms (i.e., venoms not used as immunogen). In this work, the individual contributions of homologous venoms to the paraspecificity of PoliVal-ICP were inferred from the capacity of experimental monospecific antivenoms toward venoms of B. asper (anti-Ba), C. simus (anti-Cs) and L. stenophrys (anti-Ls), and an experimental polyspecific antivenom (anti-Ba/Cs/Ls) to neutralize the lethality induced by different venoms in mice. It was found that all antivenoms neutralized their corresponding homologous venoms. Moreover, the anti-Ba antivenom cross-neutralized the venoms of Agkistrodon howardgloydi, Atropoides picadoi, Bothriechis lateralis, Bothriechis supraciliaris and Porthidium ophryomegas; the anti-Cs antivenom cross-neutralized the venoms of B. lateralis, B. supraciliaris, Cerrophidion sasai and Porthidium nasutum; and the anti-Ls antivenom cross-neutralized the venoms of B. lateralis, B. supraciliaris, C. sasai and Lachesis melanocephala. All venoms neutralized by any monospecific antivenom were also neutralized by the anti-Ba/Cs/Ls antivenom. Venoms of Atropoides mexicanus, Bothriechis nigroviridis and Bothriechis schlegelii were not neutralized by any experimental antivenom, thus explaining the limitations of PoliVal-ICP to neutralize these venoms. Consequently, an enlargement of the neutralization scope of PoliVal-ICP could be achieved by including these venoms in the group of those used as immunogens. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Retrospective evaluation of the effect of antivenom administration on hospitalization duration and treatment cost for dogs envenomated by Crotalus viridis: 113 dogs (2004-2012).

    Science.gov (United States)

    Katzenbach, Julia E; Foy, Daniel S

    2015-01-01

    To compare the effect of antivenom administration on mortality, hospitalization duration, and cost of hospitalization for dogs envenomated by Crotalus viridis. Retrospective study (January 2004-December 2012). Private veterinary emergency and referral center. One hundred thirteen dogs with confirmed C. viridis envenomation. None. Dogs were divided into groups treated with either supportive care only (group 1) or supportive care plus antivenin crotalidae polyvalent (group 2). A modified snakebite severity score was used to compare patients from group 1 and group 2. Patients in group 2 received one 10 mL vial of antivenin crotalidae polyvalent over 4-6 hours. The mortality rate was 1.8% (2/113).  Group 1 had a median duration of hospitalization of 20 hours (range, 8-50 hours), while group 2 had a median duration of hospitalization of 24 hours (range, 1.5-74 hours). Group 1 had a median cost of hospitalization of 1050.00 USD (range, 423.52-2266.09 USD) while group 2 had a median cost of hospitalization of 2002.19 USD (range, 1139.91-6908.01 USD). Both the duration of hospitalization (P dogs receiving antivenom. Both the cost and the duration of hospitalization were significantly greater in the group of dogs that received antivenom. The difference in cost between the groups was approximately the cost of the antivenom vial and administration. Amongst the parameters evaluated, no significant benefit was associated with antivenom administered to dogs envenomated by C. viridis. © Veterinary Emergency and Critical Care Society 2015.

  19. A novel synthetic peptide inspired on Lys49 phospholipase A2from Crotalus oreganus abyssus snake venom active against multidrug-resistant clinical isolates.

    Science.gov (United States)

    Almeida, José R; Mendes, Bruno; Lancellotti, Marcelo; Marangoni, Sergio; Vale, Nuno; Passos, Óscar; Ramos, Maria J; Fernandes, Pedro A; Gomes, Paula; Da Silva, Saulo L

    2018-04-10

    Currently, the evolving and complex mechanisms of bacterial resistance to conventional antibiotics are increasing, while alternative medicines are drying up, which urges the need to discover novel agents able to kill antibiotic-resistant bacteria. Lys49 phospholipase A 2 s (PLA 2 s) from snake venoms are multifunctional toxins able to induce a huge variety of therapeutic effects and consequently serve as templates for new drug leads. Hence, the present study was aimed at the synthesis of oligopeptides mimicking regions of the antibacterial Lys49 PLA 2 toxin (CoaTx-II), recently isolated from Crotalus oreganus abyssus snake venom, to identify small peptides able to reproduce the therapeutic action of the toxin. Five peptides, representing major regions of interest within CoaTx-II, were synthesized and screened for their antibacterial properties. The 13-mer peptide pC-CoaTxII, corresponding to residues 115-129 of CoaTx-II, was able to reproduce the promising bactericidal effect of the toxin against multi-resistant clinical isolates. Peptide pC-CoaTxII is mainly composed by positively charged and hydrophobic amino acids, a typical trait in most antimicrobial peptides, and presented no defined secondary structure in aqueous environment. The physicochemical properties of pC-CoaTxII are favorable towards a strong interaction with anionic lipid membranes as those in bacteria. Additional in silico studies suggest formation of a water channel across the membrane upon peptide insertion, eventually leading to bacterial cell disruption and death. Overall, our findings confirm the valuable potential of snake venom toxins towards design and synthesis of novel antimicrobials, thus representing key insights towards development of alternative efficient antimicrobials to fight bacterial resistance to current antibiotics. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  20. Integrated numerical modeling for basin-wide water management: The case of the Rattlesnake Creek basin in south-central Kansas

    Science.gov (United States)

    Sophocleous, M.A.; Koelliker, J.K.; Govindaraju, R.S.; Birdie, T.; Ramireddygari, S.R.; Perkins, S.P.

    1999-01-01

    The objective of this article is to develop and implement a comprehensive computer model that is capable of simulating the surface-water, ground-water, and stream-aquifer interactions on a continuous basis for the Rattlesnake Creek basin in south-central Kansas. The model is to be used as a tool for evaluating long-term water-management strategies. The agriculturally-based watershed model SWAT and the ground-water model MODFLOW with stream-aquifer interaction routines, suitably modified, were linked into a comprehensive basin model known as SWATMOD. The hydrologic response unit concept was implemented to overcome the quasi-lumped nature of SWAT and represent the heterogeneity within each subbasin of the basin model. A graphical user-interface and a decision support system were also developed to evaluate scenarios involving manipulation of water fights and agricultural land uses on stream-aquifer system response. An extensive sensitivity analysis on model parameters was conducted, and model limitations and parameter uncertainties were emphasized. A combination of trial-and-error and inverse modeling techniques were employed to calibrate the model against multiple calibration targets of measured ground-water levels, streamflows, and reported irrigation amounts. The split-sample technique was employed for corroborating the calibrated model. The model was run for a 40 y historical simulation period, and a 40 y prediction period. A number of hypothetical management scenarios involving reductions and variations in withdrawal rates and patterns were simulated. The SWATMOD model was developed as a hydrologically rational low-flow model for analyzing, in a user-friendly manner, the conditions in the basin when there is a shortage of water.

  1. Rattlesnake Mountain Observator (46.4{degrees}N, 119.6{degrees}W) multispectral optical depth measurements, 1979--1994

    Energy Technology Data Exchange (ETDEWEB)

    Daniels, R.C. [ed.

    1995-09-22

    Surface measurements of solar irradiance of the atmosphere were made by a multipurpose computer-controlled scanning photometer at the Rattlesnake Mountain Observatory. The observatory is located at 46.4{degrees}N, 119.6{degrees}W at an elevation of 1088 m above mean sea level. The photometer measures the attenuation of direct solar radiation for different wavelengths using 12 filters. Five of these filters (ie., at 428 nm, 486 nm, 535 nm, 785 nm, and 1010 nm, with respective half-power widths of 2, 2, 3, 18, and 28 nm) are suitable for monitoring variations in the total optical depth of the atmosphere. Total optical depths for the five wavelength bands were derived from solar irradiance measurements taken at the observatory from August 5, 1979, to September 2, 1994; these total optical depth data are distributed with this numeric data package (NDP). To determine the contribution of atmospheric aerosols to the total optical depths, the effects of Rayleigh scattering and ozone absorption were subtracted (other molecular scattering was minimal for the five filters) to obtain total column aerosol optical depths. The total aerosol optical depths were further decomposed into tropospheric and stratospheric components by calculating a robustly smoothed mean background optical depth (tropospheric component) for each wavelength using data obtained during periods of low stratospheric aerosol loading. By subtracting the smoothed background tropospheric aerosol optical depths from the total aerosol optical depths, residual aerosol optical depths were obtained. These residuals are good estimates of the stratospheric aerosol optical depth at each wavelength and may be used to monitor the long-term effects of volcanic eruptions on the atmosphere. These data are available as an NDP from the Carbon Dioxide Information Analysis Center (CDIAC), and the NDP consists of this document and a set of computerized data files.

  2. Patterns of circulating corticosterone in a population of rattlesnakes afflicted with snake fungal disease: Stress hormones as a potential mediator of seasonal cycles in disease severity and outcomes

    Science.gov (United States)

    Lind, Craig M.; Moore, Ignacio T.; Akçay, Çağlar; Vernasco, Ben J.; Lorch, Jeffrey M.; Farrell, Terence M.

    2018-01-01

    Snake fungal disease (SFD) is an emerging threat to snake populations in the United States. Fungal pathogens are often associated with a physiological stress response mediated by the hypothalamo-pituitary-adrenal axis (HPA), and afflicted individuals may incur steep coping costs. The severity of SFD can vary seasonally; however, little is known regarding (1) how SFD infection relates to HPA activity and (2) how seasonal shifts in environment, life history, or HPA activity may interact to drive seasonal patterns of infection severity and outcomes. To test the hypothesis that SFD is associated with increased HPA activity and to identify potential environmental or physiological drivers of seasonal infection, we monitored baseline corticosterone, SFD infection severity, foraging success, body condition, and reproductive status in a field-active population of pigmy rattlesnakes. Both plasma corticosterone and the severity of clinical signs of SFD peaked in the winter. Corticosterone levels were also elevated in the fall before the seasonal rise in SFD severity. Severely symptomatic snakes were in low body condition and had elevated corticosterone levels compared to moderately infected and uninfected snakes. The monthly mean severity of SFD in the population was negatively related to population-wide estimates of body condition and temperature measured in the precedent month and positively correlated with corticosterone levels measured in the precedent month. Symptomatic females were less likely to enter reproductive bouts compared to asymptomatic females. We propose the hypothesis that the seasonal interplay among environment, host energetics, and HPA activity initiates trade-offs in the fall that drive the increase in SFD prevalence, symptom severity, and decline in condition observed in the population through winter.

  3. Dynamic pressure measurement of cartridge operated vole captive bolt devices.

    Science.gov (United States)

    Frank, M; Philipp, K P; Franke, E; Frank, N; Bockholdt, B; Grossjohann, R; Ekkernkamp, A

    2009-01-10

    Vole captive bolt devices are powder actuated spring guns that are used as a pest control mean. After having triggered the explosion of the blank cartridge by touching a metal ring around the muzzle, the vole is killed by the massive propulsion of the gas jet. Improper use and recklessness while handling these devices may cause severe injuries with the hand of the operator at particular risk. Currently, there are no experimental investigations on the ballistic background of these devices. An experimental test set-up was designed for measurement of the firing pressure and the dynamic force of the gas jet of a vole captive bolt device. Therefore, a vole captive bolt device was prepared with a pressure take-off channel and a piezoelectric transducer for measurement of the firing pressure. For measurement of the dynamic impact force of the gas jet an annular quartz force sensor was installed on a test bench. Each three simultaneous measurements of the cartridges' firing pressure and the dynamic force of the blast wave were taken at various distances between muzzle and load washer. The maximum gas pressure in the explosion chamber was up to 1100 bar. The shot development over time showed a typical gas pressure curve. Flow velocity of the gas jet was up to 2000 m/s. The maximum impact force of the gas jet at the target showed a strong inverse ratio to the muzzle's distance and was up to 11,500 N for the contact shot distance. Energy density of the gas jet for the close contact shot was far beyond the energy density required for skin penetration. The unique design features (short tube between cartridge mouth and muzzle and narrow diameter of the muzzle) of these gadgets are responsible for the high firing pressure, velocity and force of the gas jet. These findings explain the trauma mechanics of the extensive tissue damage observed in accidental shots of these devices.

  4. Effects of satellite transmitters on captive and wild mallards

    Science.gov (United States)

    Kesler, Dylan C.; Raedeke, Andrew H.; Foggia, Jennifer R.; Beatty, William S.; Webb, Elisabeth B.; Humburg, Dale D.; Naylor, Luke W.

    2014-01-01

    Satellite telemetry has become a leading method for studying large-scale movements and survival in birds, yet few have addressed potential effects of the larger and heavier tracking equipment on study subjects. We simultaneously evaluated effects of satellite telemetry equipment on captive and wild mallards (Anas platyrhynchos) to assess impacts on behavior, body mass, and movement. We randomly assigned 55 captive ducks to one of 3 treatment groups, including a standard body harness group, a modified harness group, and a control group. Ducks in the control group were not fitted with equipment, whereas individuals in the other 2 groups were fitted with dummy transmitters attached with a Teflon ribbon harness or with a similar harness constructed of nylon cord. At the conclusion of the 14-week captive study, mean body mass of birds in the control group was 40–105 g (95% CI) greater than birds with standard harnesses, and 28–99 g (95% CI) greater than birds with modified harnesses. Further, results of focal behavior observations indicated ducks with transmitters were less likely to be in water than control birds. We also tested whether movements of wild birds marked with a similar Teflon harness satellite transmitter aligned with population movements reported by on-the-ground observers who indexed local abundances of mid-continent mallards throughout the non-breeding period. Results indicated birds marked with satellite transmitters moved concurrently with the larger unmarked population. Our results have broad implications for field research and suggest that investigators should consider potential for physiological and behavioral effects brought about by tracking equipment. Nonetheless, results from wild ducks indicate satellite telemetry has the potential to provide useful movement data.

  5. The identification of Theileria bicornis in captive rhinoceros in Australia

    Directory of Open Access Journals (Sweden)

    Jerald Yam

    2018-04-01

    Full Text Available Poaching of both black (Diceros bicornis and white (Ceratotherium simum rhinoceros in Africa has increased significantly in recent years. In an effort to ensure the survival of these critically endangered species, breeding programs were established in the 1990s in Australia, where a similar climate and habitat is available. In this study we examined blood samples from two C. simum, including a 16 yr old female (Aluka who died in captivity, and a 17 yr old asymptomatic male (Umfana. Bloods from seven healthy D. bicornis housed at the zoo were also collected. All samples were tested for the presence of piroplasms via blood smear and PCR. A generic PCR for the 18S rRNA gene of the Piroplasmida revealed the presence of piroplasm infection in both dead and asymptomatic C. simum. Subsequent sequencing of these amplicons revealed the presence of Theileria bicornis. Blood smear indicated that this organism was present at low abundance in both affected and asymptomatic individuals and was not linked to the C. simum mortality. T. bicornis was also detected in the D. bicornis population (n = 7 housed at Taronga Western Plains Zoo using PCR and blood film examination; however only animals imported from Africa (n = 1 tested T. bicornis positive, while captive-born animals bred within Australia (n = 6 tested negative suggesting that transmission within the herd was unlikely. Phylogenetic analysis of the full length T. bicornis 18S rRNA genes classified this organism outside the clade of the transforming and non-transforming Theileria with a new haplotype, H4, identified from D. bicornis. This study revealed the presence of Theileria bicornis in Australian captive populations of both C. simum and D. bicornis and a new haplotype of the parasite was identified. Keywords: Piroplasm, Theileria bicornis, 18S rRNA, Rhinoceros, Translocation

  6. PTSD of rape after IS ("Islamic State") captivity.

    Science.gov (United States)

    Kizilhan, Jan Ilhan

    2018-03-10

    Research into the psychological consequences of rape on women in war and warlike situations is limited. The aims of this study were (a) to describe the prevalence and the nature of PTSD symptoms among Yazidi women reporting rape during IS captivity, (b) to describe comorbidity of other psychological disorders, and (c) to examine the risk factors associated with posttraumatic stress disorder.The study included 296 Yazidi women survivors of rape and has been conducted in Germany since January 2016 as part of a special-quota project in the German region of Baden-Wuerttemberg, designed to support the women and children who have escaped after being held hostage by IS.The survivors were recruited into a retrospective, cross-sectional study. Interviews in Germany were done through trained personnel to evaluate the mental health status of raped women.All the investigated women had been raped many times during IS captivity. About 82% of the women were also physically tortured. Of the sample, 67% suffered from somatoform disorder, 53% suffered from depression, 39% from anxiety, and 28% from dissociation. The prevalence of PTSD in those with rape events of more than 20 times was 57% (95% CI = 35.1-65.9%), less than 20 times was 41% (95%, CI = 28.7-4.8% and less than 10 times 39% [95% CI = 28.2-41.8%], respectively.The IS captivity and wartime rapes had deep immediate and long-term consequences on the mental health of women survivors. The high prevalence of PTSD emphasizes the need for culturally sensitive diagnostic and therapeutic services to address the intermediate and long-term consequences of wartime rape.

  7. Haemangiosarcoma in a captive Asiatic lion (Panthera leo persica

    Directory of Open Access Journals (Sweden)

    F. Vercammen

    2015-05-01

    Full Text Available A 2.7-year-old male captive Asiatic lion (Panthera leo persica died unexpectedly without preceding symptoms. Gross necropsy revealed liver and lung tumours, which proved to be haemangiosarcomas by histopathology. Some of the liver tumours were ruptured, leading to massive intra-abdominal haemorrhage and death. Haemangiosarcomas are rare in domestic and exotic felids, occurring in skin, thoracic-abdominal cavity and bones. Although these tumours mainly appear to be occurring in older cats, they are sometimes observed in younger animals, as in the present case. This is the first description of haemangiosarcoma in a young Asiatic lion.

  8. Virtual simulation of maneuvering captive tests for a surface vessel

    Directory of Open Access Journals (Sweden)

    Ahmad Hajivand

    2015-09-01

    Full Text Available Hydrodynamic derivatives or coefficients are required to predict the maneuvering characteristics of a marine vehicle. These derivatives are obtained numerically for a DTMB 5512 model ship by virtual simulating of captive model tests in a CFD environment. The computed coefficients are applied to predict the turning circle and zigzag maneuvers of the model ship. The comparison of the simulated results with the available experimental data shows a very good agreement among them. The simulations show that the CFD is precise and affordable tool at the preliminary design stage to obtain maneuverability performance of a marine vehicles.

  9. Cryptococcosis in captive cheetah (Acinonyx jubatus : two cases : case report

    Directory of Open Access Journals (Sweden)

    L.A. Bolton

    1999-07-01

    Full Text Available Cryptococcus neoformans is a yeast-like organism associated with pulmonary, meningoencephalitic, or systemic disease. This case report documents 2 cases of cryptococcosis with central nervous system involvement in captive cheetah (Acinonyx jubatus. In both cases the predominant post mortal lesions were pulmonary cryptococcomas and extensive meningoencephalomyelitis. Both cheetahs tested negative for feline immunodeficiency virus and feline leukaemia virus. The organism isolated in Case 2 was classified as Cryptococcus neoformans var. gattii, which is mainly associated with disease in immunocompetent hosts.

  10. ACTH stimulation test in the captive cheetah (Acinonyx jubatus).

    Science.gov (United States)

    Köster, L S; Schoeman, J P; Meltzer, D G A

    2007-09-01

    Serum cortisol response was assessed in 8 captive cheetahs, of varying ages, after the intravenous administration of 500 microg of tetracosactide (Synacthen Depot, Novartis, Kempton Park) while maintained under general anaesthesia. In addition, 8 cheetahs were anaesthetised and given an equal volume of saline in order to establish baseline cortisol concentrations at similar stages of anaesthesia. A significant difference in the median cortisol concentration measured over time was found following ACTH administration in the ACTH group (P cheetah. No statistically significant rise was seen in the anaesthetised control group following the injection of saline (P = 0.238).

  11. Flea (Pulex simulans) infestation in captive giant anteaters (Myrmecophaga tridactyla).

    Science.gov (United States)

    Mutlow, Adrian G; Dryden, Michael W; Payne, Patricia A

    2006-09-01

    A pair of captive adult giant anteaters (Myrmecophaga tridactyla) presented heavily infested with a flea species (Pulex simulans) commonly found on Virginia opossums (Didelphis virginiana) and raccoons (Procyon lotor) in the central United States. In this case, the flea was demonstrated to have completed its entire life cycle with the anteaters as the host. A single treatment of topical imidacloprid, coupled with removal and replacement of infested bedding, was rapidly effective at controlling the infestation and no adverse effects of the drug were noted. Control of the anteater infestation also removed the flea infestation of aardvarks in the same building.

  12. Circumscription: Proust's The Captive and the Problem of Other Minds

    Directory of Open Access Journals (Sweden)

    Carol de Dobay Rifelj

    1984-01-01

    Full Text Available Central to Proust's Remembrance as a whole and to The Captive in particular is Marcel's attempt to discover what other people think and feel. But, as reading the work in the light of modern analytic philosophy shows, his efforts are thwarted by the deceptions of others and by his own irreconcilable views. The other is radically inaccessible, yet the object of our search; the self is a stable entity, yet multiple, changing, and a fiction constituted by language; language is communication, yet the source of error. These are the problems which confront philosophy and literature when they try to come to terms with the otherness of others.

  13. A review of the diets of captive gorillas (Gorilla gorilla).

    Science.gov (United States)

    Cousins, D

    1976-12-01

    It is clear that most zoos feed their gorillas a principally frugivorous diet, while the diets of wild gorilla populations are undoubtedly basically herbivorous. The primary food plant of western and eastern lowland gorillas is Aframomum, and Blancou (1955) even maintains that these plants possess active parasiticidal qualities, but this subscription is not borne out by recent research. However, it is possible that another plant food, combretum, could have some propensities as a deparasitant. Many captive gorillas accept cooked or raw meat in their diets and there is some evidence that feral gorillas may also occasionally consume matter of animal origin.

  14. Maximum price paid in captive bush dogs (Speothos venaticus)

    OpenAIRE

    Thernström, Taina

    2012-01-01

    One way to investigate what animals in captivity   might need is to conduct preference and motivational tests. These types of   tests can help facilitate the animals to express different priorities. The   motivation can be assessed by having the animals “pay an entry cost” (e.g.   push a weighted door) that increases with time to get access to a resource.   The highest price that the animals are willing to pay for this resource is   called “the maximum price paid”. This study intends to test ...

  15. Ophthalmic patterns of captive brown brocket deer (Mazama gouazoubira).

    Science.gov (United States)

    Martins, Bianca C; Oriá, Arianne P; Souza, Ana L G; Campos, Carla F; Almeida, Denise E; Duarte, Roberta A; Soares, Christiane P; Zuanon, José A S; Neto, Carlos B; Duarte, José M B; Schocken-Iturrino, Rubén P; Laus, José L

    2007-12-01

    Captive brown brocket deer (Mazama gouazoubira) were manually restrained to assess tear production by the Schirmer tear test I to measure intraocular pressure by applanation tonometry, to examine ocular conjunctival epithelial cells via cytologic and histologic samples, and to survey ocular conjunctival microflora by microbiologic culture. The mean value for the Schirmer tear test I was 8.9 +/- 1.8 mm/min, and the mean intraocular pressure was 15.3 +/- 3.1 mm Hg. Conjunctival epithelium contained stratified pavimentous layers of cells, and the microflora consisted of predominantly gram-positive bacteria.

  16. Genetic evaluation of the captive breeding program of the Persian wild ass

    DEFF Research Database (Denmark)

    Nielsen, R.K.; Pertoldi, C.; Loeschcke, Volker

    2007-01-01

    During the last century, many species have become endangered and conservation in terms of captive breeding has been crucial for their survival. Classical management of captive species is based on recorded genealogies. However, if pedigrees are incomplete or inaccurate, it can bias...

  17. Czechs and Slovaks in Russian Captivity during World War I (1914-1918)

    OpenAIRE

    Oksana E. Dmitrieva

    2013-01-01

    The article is focused on the features of more than 250 000 Czechs and Slovaks in Russian captivity during World War I: the amount, quartering and supply benefits, work in various sectors of the Russian economy, military units formation, social and national organizations activities, charity support. The conditions of Czechs and Slovaks captivity are recollected. New sources are introduced into scientific use.

  18. Periodicals оn the Fate of Russian Captives During the First World War

    Directory of Open Access Journals (Sweden)

    Nazarova Tatyana

    2014-11-01

    Full Text Available The materials of periodicals represent an important source for studying public opinion and the executive policy regarding the fate of Russian captives. The analysis of the periodicals proves that despite the patriotic fervor that swept the press during the First World War, the plight of Russian captives was not widely highlighted. The article analyzes the nature of the publications on the Russian captives and identifies the reasons of journalists’ neglect of their problems. Among these reasons, the author calls an unprecedented scale of captivity – the millions of war prisoners from each warring sides. The government and their controlled press tried to forget the captives instead of analyzing the causes of mass captivity and correcting the command errors. The theme of captivity was not a separate issue in the national press, and it was used only as the material for the formation of the “image of enemy” to illustrate the violations of the international humanistic principles by the Germans. This was largely due to the attitude of the government and the military toward their captives – they were treated like traitors, they were blamed for the failures that have dogged the Russian army in the first years of the war.

  19. Reintroduction of captive-bred African Grass-Owls Tyto capensis ...

    African Journals Online (AJOL)

    This study represents the first attempt to determine post-release survival of a captive-bred owl in Africa. We released six captive-bred African Grass-Owls Tyto capensis into suitable habitat and, using radio telemetry, determined their daytime roost sites. One bird left the study area soon after release and did not yield data.

  20. Redfish Lake sockeye salmon captive broodstock rearing and research, 1994. Annual report

    International Nuclear Information System (INIS)

    Flagg, T.A.; McAuley, W.C.; Wastel, M.R.; Frost, D.A.; Mahnken, C.V.W.

    1996-03-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game (IDFG) and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are emerging as an important component of restoration efforts for ESA-listed salmon populations. Captive broodstock programs are a form of artificial propagation. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January to December 1994 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species

  1. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1994 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    1996-03-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game (IDFG) and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are emerging as an important component of restoration efforts for ESA-listed salmon populations. Captive broodstock programs are a form of artificial propagation. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January to December 1994 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species.

  2. Serum chemistry comparisons between captive and free-ranging giraffes (Giraffa camelopardalis).

    Science.gov (United States)

    Schmidt, Debra A; Barbiers, Robyn B; Ellersieck, Mark R; Ball, Ray L; Koutsos, Elizabeth A; Griffin, Mark E; Grobler, Douw; Citino, Scott B; Bush, Mitchell

    2011-03-01

    Serum chemistry analyses were compared between captive and free-ranging giraffes (Giraffa camelopardalis) in an attempt to better understand some of the medical issues seen with captive giraffes. Illnesses, including peracute mortality, energy malnutrition, pancreatic disease, urolithiasis, hoof disease, and severe intestinal parasitism, may be related to zoo nutrition and management issues. Serum samples were collected from 20 captive giraffes at 10 United States institutions. Thirteen of the captive animal samples were collected from animals trained for blood collection; seven were banked samples obtained from a previous serum collection. These samples were compared with serum samples collected from 24 free-ranging giraffes in South Africa. Differences between captive and free-ranging giraffes, males and females, and adults and subadults were analyzed by using a 2 x 2 x 2 factorial and Fisher's least significant difference for mean separation; when necessary variables were ranked and analyzed via analysis of variance. Potassium and bilirubin concentrations and alanine aminotransferase (ALT) activities were different between captive and free-ranging giraffes, but all fell within normal bovid reference ranges. The average glucose concentration was significantly elevated in free-ranging giraffes (161 mg/dl) compared with captive giraffes (113 mg/dl). All giraffes in this study had glucose concentrations higher than bovine (42-75 mg/ dl) and caprine (48-76 mg/dl) reference ranges. Differences were also seen in lipase, chloride, and magnesium though these findings are likely not clinically significant. There were no differences detected between sexes. Adults had higher concentrations of potassium, total protein, globulins, and chloride and higher gamma glutamyltransferase activities, whereas subadults had higher concentrations of phosphorus. Within the captive group, nonimmobilized animals had higher concentrations of total protein and globulins. Captive giraffe diets

  3. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1995-2000 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    2001-01-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are a form of artificial propagation and are emerging as an important component of restoration efforts for ESA-listed salmon populations. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January 1995 to August 2000 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Since initiating captive brood culture in 1991, NMFS has returned 742,000 eyed eggs, 181 pre-spawning adults, and over 90,000 smolts to Idaho for recovery efforts. The first adult returns to the Stanley Basin from the captive brood program began with 7 in 1999, and increased to about 250 in 2000. NMFS currently has broodstock in culture from year classes 1996, 1997, 1998, and 1999 in both the captive broodstock program, and an adult release program. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species.

  4. Spatial memory in captive American black bears (Ursus americanus).

    Science.gov (United States)

    Zamisch, Valeria; Vonk, Jennifer

    2012-11-01

    The spatial memory and foraging strategies of four adult captive-born American black bears (Ursus americanus) were explored in four experiments using a simulated foraging task. In the first three experiments, each session consisted of two phases separated by a delay: During the exploration phase, subjects foraged among a set of baited and unbaited sites. During the delay, the same locations were rebaited and subjects were released again and allowed to search the sites (search phase). In Experiments 1a and 1b, different sites were baited each day and the interval between exploration and search was short (4 hr or 15 min). Subjects were not accurate at recovering the food items in either experiment. In Experiment 2, an "informed forager" paradigm was used in which one subject was given privileged knowledge about the location of the food during the exploration phase and was later released with an "uninformed" competitor during the search phase. The bears did not achieve above-chance recovery accuracy even in the presence of a competitor. In Experiment 3, the same two of four sites were continually baited and the bears were released simultaneously over a period of 20 days, with each baiting separated by 2 or 3 days. As a group, the bears' foraging accuracy with repeated baiting and longer intervals approached greater than chance accuracy. Results suggest some limitations on bears' use of spatial memory in captive environments, but reveal the potential for use of spatial memory over longer delays.

  5. PREVALENCE OF SALMONELLA IN CAPTIVE REPTILES FROM CROATIA.

    Science.gov (United States)

    Lukac, Maja; Pedersen, Karl; Prukner-Radovcic, Estella

    2015-06-01

    Salmonellosis transmitted by pet reptiles is an increasing public health issue worldwide. The aim of this study was to investigate the prevalence of Salmonella strains from captive reptiles in Croatia. From November 2009 to November 2011 a total of 292 skin, pharyngeal, cloacal, and fecal samples from 200 apparently healthy reptiles were tested for Salmonella excretions by bacteriologic culture and serotyping. These 200 individual reptiles included 31 lizards, 79 chelonians, and 90 snakes belonging to private owners or housed at the Zagreb Zoo, Croatia. Salmonella was detected in a total of 13% of the animals, among them 48.4% lizards, 8.9% snakes, and 3.8% turtles. Representatives of five of the six Salmonella enterica subspecies were identified with the following proportions in the total number of isolates: Salmonella enterica enterica 34.6%, Salmonella enterica houtenae 23.1%, Salmonella enterica arizonae 23.1%, Salmonella enterica diarizonae 15.4%, and Salmonella enterica salamae 3.8%. The 14 different serovars isolated included several rarely occurring serovars such as Salmonella Apapa, Salmonella Halle, Salmonella Kisarawe, and Salmonella Potengi. These findings confirm that the prevalence of Salmonella is considerable in captive reptiles in Croatia, indicating that these animals may harbor serovars not commonly seen in veterinary or human microbiologic practice. This should be addressed in the prevention and diagnostics of human reptile-transmitted infections.

  6. Acquired umbilical hernias in four captive polar bears (Ursus maritimus).

    Science.gov (United States)

    Velguth, Karen E; Rochat, Mark C; Langan, Jennifer N; Backues, Kay

    2009-12-01

    Umbilical hernias are a common occurrence in domestic animals and humans but have not been well documented in polar bears. Surgical reduction and herniorrhaphies were performed to correct acquired hernias in the region of the umbilicus in four adult captive polar bears (Ursus maritimus) housed in North American zoos. Two of the four bears were clinically unaffected by their hernias prior to surgery. One bear showed signs of severe discomfort following acute enlargement of the hernia. In another bear, re-herniation led to acute abdominal pain due to gastric entrapment and strangulation. The hernias in three bears were surgically repaired by debridement of the hernia ring and direct apposition of the abdominal wall, while the large defect in the most severely affected bear was closed using polypropylene mesh to prevent excessive tension. The cases in this series demonstrate that while small hernias may remain clinically inconsequential for long periods of time, enlargement or recurrence of the defect can lead to incarceration and acute abdominal crisis. Umbilical herniation has not been reported in free-ranging polar bears, and it is suspected that factors such as body condition, limited exercise, or enclosure design potentially contribute to the development of umbilical hernias in captive polar bears.

  7. Neophobia and learning mechanisms: how captive orangutans discover medicinal plants.

    Science.gov (United States)

    Gustafsson, Erik; Krief, Sabrina; Saint Jalme, Michel

    2011-01-01

    Great apes sometimes feed on items of low nutritional value with bioactive secondary compounds. These molecules may be toxic and neophobia is presumed to be an essential factor in avoiding the ingestion of noxious items. The aim of this study is to investigate, in captive orangutans, individual and social learning involved in the discovery and ingestion of new items. We presented novel aromatic plants - 11 fresh plants and 4 infused plants - to 4 captive weaned Bornean orangutans, both under isolated and group conditions, and recorded their behaviour and interactions between group members. All animals tasted by nibbling or ingested most of the plants presented. Regardless of the experimental condition, individual responses did not vary visibly across the sessions, despite numerous close observations, and food transfers between individuals were observed. Our results suggest that a low level of neophobia and a strong propensity to look to conspecifics for information allow Bornean orangutans to expand their diet after weaning. Our results also provide some evidence that olfaction is a key sense in determining food edibility based on previous experience. Copyright © 2011 S. Karger AG, Basel.

  8. Genetic assessment of captive red panda (Ailurus fulgens) population.

    Science.gov (United States)

    Kumar, Arun; Rai, Upashna; Roka, Bhupen; Jha, Alankar K; Reddy, P Anuradha

    2016-01-01

    Red panda (Ailurus fulgens) is threatened across its range by detrimental human activities and rapid habitat changes necessitating captive breeding programs in various zoos globally to save this flagship species from extinction. One of the ultimate aims of ex situ conservation is reintroduction of endangered animals into their natural habitats while maintaining 90 % of the founder genetic diversity. Advances in molecular genetics and microsatellite genotyping techniques make it possible to accurately estimate genetic diversity of captive animals of unknown ancestry. Here we assess genetic diversity of the red panda population in Padmaja Naidu Himalayan Zoological Park, Darjeeling, which plays a pivotal role in ex situ conservation of red panda in India. We generated microsatellite genotypes of fifteen red pandas with a set of fourteen loci. This population is genetically diverse with 68 % observed heterozygosity (H O ) and mean inbreeding (F IS ) coefficient of 0.05. However population viability analysis reveals that this population has a very low survival probability (<2 %) and will rapidly loose its genetic diversity to 37 % mainly due to small population size and skewed male-biased sex ratio. Regular supplementation with a pair of adult individuals every five years will increase survival probability and genetic diversity to 99 and 61 % respectively and will also support future harvesting of individuals for reintroduction into the wild and exchange with other zoos.

  9. [Genetic diversity of microsatellite loci in captive Amur tigers].

    Science.gov (United States)

    Zhang, Yu-Gaung; Li, Di-Qiang; Xiao, Qi-Ming; Rao, Li-Qun; Zhang, Xue-Wen

    2004-09-01

    The tiger is one of the most threatened wildlife species since the abundance and distribution of tiger have decreased dramatically in the last century. The wild Amur tiger (Panthera tigris altaica) only distributed in northeast China, the far east area of Russia and the north Korea and its size of wild population is about 450 in the world and 20 in China. Several hundred captive populations of Amur tigers are the main source to protect gene library of tiger and the source of recovering the wild populations. The Breeding Center for Felidae at Hengdaohezi and Haoerbin Tiger Park in Heilongjiang Province is the biggest captive breeding base in China. How to make clear the genetic pedigree and establish reasonable breeding system is the urgent issues. So we use the microsatellite DNA markers and non-invasive technology to research on the genetic diversity of captive Amur tiger in this study. Ten microsatellite loci (Fca005, Fca075, Fca094, Fca152, Fca161, Fca294, Pti002, Pti003, Pti007 and Pti010), highly variable nuclear markers, were studied their genetic diversity in 113 captive Amur tigers. The PCR amplified products of microsatellite loci were detected by non-denatured polyacrylamide gel electrophoresis. Allele numbers, allelic frequency, gene heterozygosity(H(e)), polymorphism information content(PIC) and effective number of allele(N(e)) were calculated. 41 alleles were found and their size were ranged from 110bp to 250bp in ten microsatellite loci, Fca152 had 6 alleles, Fca075, Fca094 and Fca294 had 5 alleles, Fca005 and Pti002 had 4 alleles and the others had 3 alleles in all tiger samples, respectively. The allelic frequencies were from 0.009 to 0.767; The He ranged from 0.385 to 0.707, and Fca294 and Pti010 locus had the highest and lowest value; the PIC were from 0.353 to 0.658, Fca294 and Pti010 locus had the highest and lowest value; and N(e) were from 1.626 to 3.409, Fca294 and Pti010 locus had the highest and lowest value, which showed the ten

  10. Comparative analyses of tooth wear in free-ranging and captive wild equids.

    Science.gov (United States)

    Taylor, L A; Müller, D W H; Schwitzer, C; Kaiser, T M; Castell, J C; Clauss, M; Schulz-Kornas, E

    2016-03-01

    Captive breeding has played a crucial role in the conservation of threatened equid species. Grazing ruminants and rhinoceros in captivity have less abrasion-dominated tooth wear than their free-ranging conspecifics, with potential negative consequences for their health. However, a similar study on wild equids in captivity is missing. The aim was to establish if different tooth wear patterns are exhibited by free-ranging and captive equids. Cross-sectional study of museum specimens comparing free-ranging and captive equids. Dental casts of maxillary cheek teeth of 228 museum specimens (122 from free-ranging and 106 from captive individuals) of 7 wild equid species were analysed using the extended mesowear method. Although teeth showing specific abnormalities were not scored, the presence of focal overgrowths (hooks) of the rostral premolars (106, 206) was recorded. Captive Equus ferus przewalskii, E. grevyi, E. hemionus, E. quagga boehmi and E. zebra hartmannae have less abrasion-dominated tooth wear on their premolars than their free-ranging conspecifics (P<0.001). Fewer differences were exhibited between populations in the molars. No differences were exhibited in the distal cusp of the molars (110, 210) between populations, except in a small sample of E. kiang. Captive equids exhibited more homogeneous wear along the tooth row whereas free-ranging equids exhibited a tooth wear gradient, with more abrasion on premolars than molars. There were more rostral hooks on the premolars (106, 206) in the captive than the free-ranging population (P = 0.02). Captive equids did experience less abrasion-dominated tooth wear than their free-ranging conspecifics, but the differences in tooth wear were less pronounced than those between captive and free-ranging wild ruminant and rhinoceros species. This indicates that feeding regimes for captive equids deviate less from natural diets than those for captive ruminants and rhinoceros but that factors leading to hook

  11. Comparative Analysis of the Gut Microbiota Composition between Captive and Wild Forest Musk Deer.

    Science.gov (United States)

    Li, Yimeng; Hu, Xiaolong; Yang, Shuang; Zhou, Juntong; Zhang, Tianxiang; Qi, Lei; Sun, Xiaoning; Fan, Mengyuan; Xu, Shanghua; Cha, Muha; Zhang, Meishan; Lin, Shaobi; Liu, Shuqiang; Hu, Defu

    2017-01-01

    The large and complex gut microbiota in animals has profound effects on feed utilization and metabolism. Currently, gastrointestinal diseases due to dysregulated gut microbiota are considered important factors that limit growth of the captive forest musk deer population. Compared with captive forest musk deer, wild forest musk deer have a wider feeding range with no dietary limitations, and their gut microbiota are in a relatively natural state. However, no reports have compared the gut microbiota between wild and captive forest musk deer. To gain insight into the composition of gut microbiota in forest musk deer under different food-source conditions, we employed high-throughput 16S rRNA sequencing technology to investigate differences in the gut microbiota occurring between captive and wild forest musk deer. Both captive and wild forest musk deer showed similar microbiota at the phylum level, which consisted mainly of Firmicutes and Bacteroidetes, although significant differences were found in their relative abundances between both groups. α-Diversity results showed that no significant differences occurred in the microbiota between both groups, while β-diversity results showed that significant differences did occur in their microbiota compositions. In summary, our results provide important information for improving feed preparation for captive forest musk deer and implementing projects where captive forest musk deer are released into the wild.

  12. Comparative Analysis of the Gut Microbiota Composition between Captive and Wild Forest Musk Deer

    Directory of Open Access Journals (Sweden)

    Yimeng Li

    2017-09-01

    Full Text Available The large and complex gut microbiota in animals has profound effects on feed utilization and metabolism. Currently, gastrointestinal diseases due to dysregulated gut microbiota are considered important factors that limit growth of the captive forest musk deer population. Compared with captive forest musk deer, wild forest musk deer have a wider feeding range with no dietary limitations, and their gut microbiota are in a relatively natural state. However, no reports have compared the gut microbiota between wild and captive forest musk deer. To gain insight into the composition of gut microbiota in forest musk deer under different food-source conditions, we employed high-throughput 16S rRNA sequencing technology to investigate differences in the gut microbiota occurring between captive and wild forest musk deer. Both captive and wild forest musk deer showed similar microbiota at the phylum level, which consisted mainly of Firmicutes and Bacteroidetes, although significant differences were found in their relative abundances between both groups. α-Diversity results showed that no significant differences occurred in the microbiota between both groups, while β-diversity results showed that significant differences did occur in their microbiota compositions. In summary, our results provide important information for improving feed preparation for captive forest musk deer and implementing projects where captive forest musk deer are released into the wild.

  13. Captive power generation in Saudi Arabia—Overview and recommendations on policies

    International Nuclear Information System (INIS)

    Abdul-Majeed, Mohammed Arif; Al-Hadhrami, Luai M.; Al-Soufi, Khaled Y.; Ahmad, Firoz; Rehman, Shafiqur

    2013-01-01

    The power sector in the Kingdom of Saudi Arabia is undergoing the restructuring process. Moreover, during the last decade the Kingdom has witnessed a phenomenal growth in the load demand, consequently a huge amount of generation is added to the electric utilities to meet the load. Up to now only the electric utility generation was taken in the planning of the electrical sector. The data regarding the captive power generation was not readily available. A survey is conducted regarding the captive power generation in Saudi Arabia based on its utilization pattern, fuel used and amount of excess energy available to the grid. The existing regulatory framework and institutional structure of the Saudi power industry was also reviewed. Based on the information collected in the survey of captive power, key guidelines that may be considered in developing the policy for the captive power generators are presented. Furthermore, these guidelines and later the policies will help promote the investors to come forward in developing the captive power generation in Saudi Arabia. -- Highlights: •Database of captive power generation in the Kingdom of Saudi Arabia. •Historical perspective of electrical power industry in the Kingdom. •Saudi Arabia′s power requirements. •Regulatory framework and key guidelines regarding captive power generation. •It is first of its kind study in the region

  14. Fat soluble vitamins in blood and tissues of free-ranging and captive rhinoceros.

    Science.gov (United States)

    Clauss, Marcus; Jessup, David A; Norkus, Edward B; Chen, Tai C; Holick, Michael F; Streich, W Juergen; Dierenfeld, Ellen S

    2002-04-01

    Several disease syndromes in captive rhinoceroses have been linked to low vitamin status. Blood samples from captive and free-ranging black (Diceros bicornis) and white rhinoceros (Ceratotherium simum) and tissue samples of captive individuals from four rhinoceros species were analysed for vitamins A and E. Circulating vitamin A levels measured as retinol for free-ranging versus captive black and white rhinoceros were 0.04 (+/- 0.03 SD) vs. 0.08 (+/- 0.08) and 0.07 (+/- 0.04) vs. 0.06 (+/- 0.02) microgram/ml, respectively. Circulating vitamin E levels measured as alpha-tocopherol were 0.58 (+/- 0.30) vs. 0.84 (+/- 0.96) and 0.62 (+/- 0.48) vs. 0.77 (+/- 0.32) microgram/ml, respectively. In contrast to earlier findings, there was no significant difference in vitamin E concentration between captive and free-ranging black rhinoceros. When the samples of captive black rhinoceros were grouped into those taken before 1990 and after 1990, however, those collected before 1990 had significantly lower (P white rhinoceroses appear to be adequately supplemented in vitamin A and E. Captive Indian rhinoceroses (Rhinoceros unicornis) had significantly lower vitamin A concentrations in blood (P rhinoceros species. Equine requirements are not recommended as a model for rhinoceros vitamin requirements.

  15. Conservation efforts of captive golden takin (Budorcas taxicolor bedfordi) are potentially compromised by the elevated chemical elements exposure.

    Science.gov (United States)

    Liu, Qiang; Chen, Yi-Ping; Maltby, Lorraine; Ma, Qing-Yi

    2017-09-01

    Chemical elements exposure of endangered golden takins (Budorcas taxicolor bedfordi) living in the Qinling Mountains and in a captive breeding center was assessed by analyzing fecal samples. Concentrations of As, Co, Cr, Cu, Ni and Se were significantly higher in the feces of captive golden takins than the wild. There was no significant difference in the fecal concentrations of Cd, Mn, Hg, Pb or Zn for wild and captive animals. The element concentration of fecal samples collected from captive animals varied seasonally, with concentrations being lowest in spring and highest in winter and/or autumn. The food provided to captive animals varied both in the composition and the concentration of element present. Consumptions of feedstuff and additional foods such as D. sanguinalis and A. mangostanus for the captive golden takins were identified as the possible sources of chemical element exposure. The estimations of dietary intake of most elements by captive takins were below the oral reference dose, except for As and Pb, indicating that As and Pb were the key components which contributed to the potential non-carcinogenic risk for captive golden takins. In conclusion, captive golden takins were exposed to higher concentrations of chemical elements compared with the wild, which were likely due to their dietary difference. Conservation efforts of captive golden takin are potentially compromised by the elevated chemical element exposure and effort should focus on providing uncontaminated food for captive animals. Copyright © 2017. Published by Elsevier Inc.

  16. Parasitic nematode communities of the red kangaroo, Macropus rufus: richness and structuring in captive systems.

    Science.gov (United States)

    Lott, M J; Hose, G C; Power, M L

    2015-08-01

    Captive management practices have the potential to drastically alter pre-existing host-parasite relationships. This can have profound implications for the health and productivity of threatened species in captivity, even in the absence of clinical symptoms of disease. Maximising the success of captive breeding programmes requires a detailed knowledge of anthropogenic influences on the structure of parasite assemblages in captive systems. In this study, we employed two high-throughput molecular techniques to characterise the parasitic nematode (suborder Strongylida) communities of the red kangaroo, Macropus rufus, across seven captive sites. The first was terminal restriction fragment length polymorphism (T-RFLP) analysis of a region of rDNA encompassing the internal transcribed spacers 1 (ITS1), the 5.8S rRNA gene and the internal transcribed spacer 2 (ITS2). The second was Illumina MiSeq next-generation sequencing of the ITS2 region. The prevalence, intensity of infection, taxonomic composition and comparative structure of strongylid nematode assemblages was assessed at each location. Prevalence (P = <0.001) and mean infection intensity (df = 6, F = 17.494, P = <0.001) differed significantly between the seven captive sites. Significant levels of parasite community structure were observed (ANOSIM, P = 0.01), with most of the variation being distributed within, rather than between, captive sites. The range of nematode taxa that occurred in captive red kangaroos appeared to differ from that of wild conspecifics, with representatives of the genus Cloacina, a dominant nematode parasite of the macropodid forestomach, being detected at only two of the seven study sites. This study also provides the first evidence for the presence of the genus Trichostrongylus in a macropodid marsupial. Our results demonstrate that contemporary species management practices may exert a profound influence on the structure of parasite communities in captive systems.

  17. INTERACTION STRATEGIES GENERATED BY KIDNAPPER TOWARD THE VICTIM DURING CAPTIVITY

    Directory of Open Access Journals (Sweden)

    LEONARDO ALBERTO RODRÍGUEZ CELY

    2002-01-01

    Full Text Available This study intends to make a descriptive analysis of the interaction strategies used by the kidnapper withthe victim during captivity, based on information taken from selected documents containing the victim testimonies.Information was supplemented with data from bibliographic references, profound interviews to GAULAgroup members. Document content was analyzed by confronting the three information sources. The findingswere that there is not a single but a multiple type of kidnappers: kidnappers, persons taking care, commanders,negotiators and suppliers. Likewise, it was evident that the type of relationship that the kidnapper establisheswith the victim varies depending on his/her hierarchy in the group, the roll played, age, education, ideal-drivingmotivations and the empathy with the person kidnapped. Other important variables of the study were: kidnappingstage, location, duration and releasing aspects.

  18. Lumbar laminectomy in a captive, adult polar bear (Ursus maritimus).

    Science.gov (United States)

    Morrison, John F; Vakharia, Kunal; Moreland, Douglas B

    2017-01-01

    Animals held in captivity tend to live longer than do their wild counterparts, and as such, are prone to developing age-related degenerative injuries. Here, we present a case of an adult female polar bear with symptomatic lumbar stenosis. There is a paucity of literature on large mammalian spine surgery, and anatomical differences between humans and other vertebrates must be taken into consideration. A 24-year-old female polar bear residing at the zoo was found to have decreased motor function in her hind legs. Diagnostic myelography performed at the L7/S1 level demonstrated lumbar stenosis at L5/6 for which a laminectomy was performed. Postoperatively, she returned to premorbid functional level, with no apparent associated adverse sequelae. To our knowledge, this is the first reported case of spine surgery in a polar bear and demonstrates that neurosurgical diagnostic and operative techniques developed for humans can also be applied to large mammals with successful results.

  19. Omental torsion in a captive polar bear (Ursus maritimus).

    Science.gov (United States)

    Mendez-Angulo, Jose L; Funes, Francisco J; Trent, Ava M; Willette, Michelle; Woodhouse, Kerry; Renier, Anna C

    2014-03-01

    This is the first case report of an omental torsion in a polar bear (Ursus maritimus). A captive, 23-yr-old, 250-kg, intact female polar bear presented to the University of Minnesota Veterinary Medical Center with a 2-day history of lethargy, depression, and vomiting. Abdominal ultrasound identified large amounts of hyperechoic free peritoneal fluid. Ultrasound-guided abdominocentesis was performed and yielded thick serosanguinous fluid compatible with a hemoabdomen. An exploratory laparotomy revealed a large amount of malodorous, serosanguineous fluid and multiple necrotic blood clots associated with a torsion of the greater omentum and rupture of a branch of the omental artery. A partial omentectomy was performed to remove the necrotic tissue and the abdomen was copiously lavaged. The polar bear recovered successfully and is reported to be clinically well 6 mo later. This condition should be considered as a differential in bears with clinical signs of intestinal obstruction and hemoabdomen.

  20. Behavioural Descriptions of Indian Pangolins (Manis crassicaudata in Captivity

    Directory of Open Access Journals (Sweden)

    Rajesh Kumar Mohapatra

    2014-01-01

    Full Text Available Conservation breeding programmes as an essential tool for conservation of endangered species require a sound knowledge on behaviour of the species. At present time, knowledge of behaviour and biology of Indian pangolins is inadequate and inconsistent. During the present study, an ethogram was developed based on the behavioural observations of seven Indian pangolins (Manis crassicaudata at Pangolin Conservation Breeding Centre, Nandankanan Zoological Park, Odisha, India, between February 2012 and January 2013. A total of 27 behaviours of seven distinct behavioural categories (stationary body positions, locomotory patterns, maintenance behaviours, explorative behaviours, defensive behaviours, reproductive/social behaviours, and others were described and illustrated. The results offer a consistent frame of reference for further studies on behavioural patterns of Indian pangolins. Besides, these preliminary observations could be useful in management and breeding of the species in captivity.

  1. Ultrasonographic evaluation of the renal dimensions in captive tigers.

    Science.gov (United States)

    Huaijantug, Somkiat; Manatpreprem, Komsan; Manatpreprem, Sukhumarn; Yatmark, Paranee

    2017-01-10

    Ultrasonographic measurements of kidney size are useful in the practical diagnosis of kidney diseases in animals. In tigers, there is a lack of information regarding the ultrasonography methods used to measure the kidney size of the tiger. Thirty-three healthy captive tigers (Panthera tigris) were placed in lateral recumbency for ultrasonography. The measurements obtained from the ultrasonography were computed, and the results showed that there was a statistically significant difference between genders in terms of body weight and renal length. The length of the right kidney was significantly different from that of the left kidney (10.23 ± 0.76 cm in males versus 9.94 ± 0.80 cm in females; Ptigers. However, kidney size evaluation must be performed using not only ultrasound but other clinical forms of technology and parameters.

  2. EFFECT OF INBREEDING ON MORTALITY OF CAPTIVE TIGER

    Directory of Open Access Journals (Sweden)

    Sidharth Prasad Mishra

    2017-06-01

    Full Text Available A study was carried out on the captive tigers of Nandankanan zoo, Odisha, India, to conclude any deleterious effect of inbreeding on mortality. A pedigree path analysis of 342 tigers was done to estimate the inbreeding coefficient of each tiger from the available pedigree information since the inception of zoological park in 1964. Percentage of animal with different range of inbreeding coefficient was classified based on their normal and white body coat colour. The correlation values between sex, colour and inbreeding coefficient with mortality were also estimated. The colour and inbreeding coefficient was found to be significantly (p<0.05 correlated with the mortality. The inbreeding was found to be significant (p<0.05 with white colour of tiger.

  3. Semen collection and evaluation of captive coatis (Nasua nasua

    Directory of Open Access Journals (Sweden)

    R.C.R. Paz

    2012-04-01

    Full Text Available Semen samples (n=105 were collected through eletroejaculation from six adult male coatis (Nasua nasua between January 2007 and December 2008 at Universidade Federal de Mato Grosso Zoo, Cuiabá, Brazil. Mean values were: volume (mL; concentration (sperm/mL; total motility (%; progressive sperm motility (scale, 0-5; live spermatozoa (%; acrossome integrity (%; primary defects (%; and secondary defects (%. There was high correlation between total motility and live sperm; total motility and progressive sperm motility; total motility and acrossome integrity; live sperm and progressive motility; live sperm and acrossome integrity and volume and concentration. The method for semen collection was considered safe and efficient. It can be used for the evaluation of breeding potential of coati in captivity and for the establishment of new assisted reproductive technology (ART for threatened neotropical carnivores species.

  4. Incidence of gastrointestinal parasitism of captive wild pigeons at Nagpur

    Directory of Open Access Journals (Sweden)

    A. T. Borghare

    Full Text Available Present study was planned to investigate the helminthic infection in captive wild pigeons (Columba livia at Maharajbagh Zoo Nagpur. All the 30 samples examined were found positive either with single or mixed helminthic infections. The result showed that the incidence of Capillaria sp, Ascaridia sp and  Hetarakis sp. were 56.66%, 76.66%, 16.66% respectively. Mixed parasitic infection was recorded in around 17 samples with either Ascaridia sp. and Capillaria sp or with Ascaridia sp. and Heterakis sp. One of 30 samples examined were found with the cysts of Balantidium coli. [Vet World 2009; 2(9.000: 343-

  5. ACTH stimulation test in the captive cheetah (Acinonyx jubatus

    Directory of Open Access Journals (Sweden)

    L.S. Koster

    2007-06-01

    Full Text Available Serum cortisol response was assessed in 8 captive cheetahs, of varying ages, after the intravenous administration of 500 µg of tetracosactide (Synacthen Depot(R, Novartis, Kempton Park while maintained under general anaesthesia. In addition, 8 cheetahs were anaesthetised and given an equal volume of saline in order to establish baseline cortisol concentrations at similar stages of anaesthesia. A significant difference in the median cortisol concentration measured over time was found following ACTH administration in the ACTH group (P < 0.001. There was no difference between the median cortisol concentrations in the ACTH group at time-points 120, 150 and 180 min after ACTH stimulation (P = 0.867. Thus it appears appropriate to collect serum 120 to 180 min after tetracosactide administration to assess maximal stimulation of the adrenal in the cheetah. No statistically significant rise was seen in the anaesthetised control group following the injection of saline (P = 0.238.

  6. The use of a probiotic in captive cheetahs (Acinonyx jubatus

    Directory of Open Access Journals (Sweden)

    K.N. Koeppel

    2006-06-01

    Full Text Available Juvenile captive cheetahs (Acinonyx jubatus often present with diarrhoea that is commonly associated with bacterial infections. A species-specific probiotic containing Lactobacillus Group 2 and Enterococcus faecium was prepared from healthy adult cheetahs. Juvenile cheetahs (n = 27 between 8 and 13 months of age were included in the probiotic trial. The animals were observed prior to and after feeding of the probiotic which was made available for 28 days. Feeding of the probiotic resulted in a significantly increased body weight in the treatment group (P = 0.026, while there was no increase in the control group. A relative improvement in the faecal quality in the probiotic group during the treatment period compared with the pre-treatment (P = 0.0363 and post-treatment (P = 0.004 period was observed. This was accompanied by an absence of blood and mucus in the faeces during the treatment period in the probiotic group.

  7. MRSA carrying mecC in captive mara

    DEFF Research Database (Denmark)

    Gongora, Carmen Espinosa; Harrison, Ewan M; Moodley, Arshnee

    2015-01-01

    OBJECTIVES: To characterize the staphylococcal cassette chromosome mec (SCCmec), virulence and antimicrobial susceptibility of Staphylococcus aureus ST130 isolated from mara (Dolichotis patagonum), a large rodent species native to South America and kept in captivity at Copenhagen Zoo. METHODS......: The presence of mecC was confirmed by PCR in 15 S. aureus ST130 isolated from mara during a previous study. WGS was performed on two randomly selected isolates to characterize their genomes with respect to SCCmec, virulence and resistance gene content. Antimicrobial susceptibility was tested using commercial...... broth microdilution tests. RESULTS: All the isolates belonged to spa type t528 ST130 and carried mecC. Based on WGS, mecC was 100% identical to the prototype sequence of S. aureus strain LGA251. The sequence of SCCmec type XI in the mara isolates had 23 SNPs compared with the one described in LGA251...

  8. Clinical disorders observed in anteaters (Myrmecophagidae, Edentata) in captivity.

    Science.gov (United States)

    Diniz, L S; Costa, E O; Oliveira, P M

    1995-01-01

    The major health problems found in 103 captive lesser anteaters (Tamandua tetradactyla) and giant anteaters (Myrmecophaga tridactyla), family Myrmecophagidae, are presented and correlated with management. The most common of 200 recorded clinical disorders involved the digestive system (26%), nutritional deficiency (20%), injury (15.5%), respiratory system (10%), skin (7%) and circulatory system (4.5%), but 13% of the cases were inconclusive. Parasites were identified in 48.5% of faecal samples, mainly the eggs of nematodes (40%), of which the commonest were Trichuris spp (28%) and Strongyloides spp (11%); protozoa (16%), of which the commonest were Eimeria spp (10%), Entamoeba spp (5%) and Giardia spp (1%); and cestodes (8%) and acanthocephalids (1%). Bacteria cultured from the various materials included Salmonella enteritidis, S. cholerasuis, Escherichia coli, Enterobacter aerogenes, Streptococcus spp and Staphylococcus spp. The ectoparasites found were Amblyomma spp and Otodectis spp (Arthropoda, Acaridae).

  9. Recovery of Aeromonas hydrophila associated with bacteraemia in captive snakes.

    Science.gov (United States)

    Orozova, Petya; Sirakov, Ivo; Petkov, Iosko; Crumlish, Mags; Austin, Brian

    2012-09-01

    Captive snakes, that is, a Jamaican boa (Epicrates subflavus) a yellow anaconda (Eunectes notaeus) and a corn snake (Pantherophis guttatus guttatus), died with signs of bacteraemia including the presence of petechial haemorrhages in the mouth and gums and haemorrhages in the lung, spleen and intestines. The abdomen and anus were swollen with bloody-tinged mucus in the colon. Aeromonas hydrophila was recovered in dense virtually pure culture growth from the internal organs. Characterization of the isolates was by phenotyping and sequencing of the 16S rRNA gene (sequence homology of 99% with A. hydrophila) with outputs confirming the identity as A. hydrophila. Pathogenicity experiments confirmed virulence to frogs (Rana esculenta) and rainbow trout (Oncorhynchus mykiss). © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  10. Detection of Toxolasma gondii in captive wild felids.

    Science.gov (United States)

    Buddhirongawatr, Ruangrat; Tungsudjai, Siriporn; Chaichoune, Kridsada; Sangloung, Charoonluk; Tantawiwattananon, Nitipan; Phonaknguen, Rassameepen; Sukthana, Yaowalark

    2006-01-01

    Toxoplasma gondii can infect all species of warm-blooded animals, including humans, and causes serious diseases in immunocompromized hosts. Live tachyzoites derived from serial passage in HeLa culture were used in the Sabin-Feldman dye test for detection of Toxoplasma gondii antibody in serum samples of 21 captive wild felids including one fishing cat (Prion nailurus viverrina), one leopard (Panthera pardus), two flat-headed cats (Prion nailurus planiceps), 6 tigers (Panthera tigris), two leopard cats (Felis bengalensis), two clouded leopards (Felis nebulosa), 3 pumas (Puma concolor), and 4 jungle cats (Felis chaus). Antibodies to Toxoplasma gondii were founded in 9 of 21 felids (42.8%). This study revealed that cell culture-derived tachyzoites can be used successfully as a source of live organisms in a gold standard Sabin-Feldman dye test, which is simpler, cheaper and less ethically sensitive than in vivo inoculation.

  11. Chronic wasting disease of captive mule deer: a spongiform encephalopathy.

    Science.gov (United States)

    Williams, E S; Young, S

    1980-01-01

    In the past 12 years (1967-79) a syndrome we identify as chronic wasting disease has been observed in 53 mule deer (Odocoileus hemionus hemionus) and one black-tailed deer (Odocoileus hemionus columbianus) held in captivity in several wildlife facilities in Colorado and more recently in Wyoming. Clinical signs were seen in adult deer and included behavioral alterations, progressive weight loss and death in 2 weeks to 8 months. Gross necropsy findings included emaciation and excess rumen fluid admixed with sand and gravel. Consistent histopathologic change was limited to the central nervous system and characterized by widespread spongiform transformation of the neuropil, single of multiple intracytoplasmic vacuoles in neuronal perikaryons and intense astrocytic hypertrophy and hyperplasia. Presented is a clinical characterization of chronic wasting disease and pathologic evidence supporting the conclusion that the disease is a specific spontaneously occurring form of spongiform encephalopathy.

  12. Computed tomographic analysis of calvarial hyperostosis in captive lions.

    Science.gov (United States)

    Gross-Tsubery, Ruth; Chai, Orit; Shilo, Yael; Miara, Limor; Horowitz, Igal H; Shmueli, Ayelet; Aizenberg, Itzhak; Hoffman, Chen; Reifen, Ram; Shamir, Merav H

    2010-01-01

    Osseous malformations in the skull and cervical vertebrae of lions in captivity are believed to be caused by hypovitaminosis A. These often lead to severe neurologic abnormalities and may result in death. We describe the characterization of these abnormalities based on computed tomography (CT). CT images of two affected and three healthy lions were compared with define the normal anatomy of the skull and cervical vertebrae and provide information regarding the aforementioned osseous malformations. Because bone structure is influenced by various factors other than the aforementioned disease, all values were divided by the skull width that was not affected. The calculated ratios were compared and the most pronounced abnormalities in the affected lions were, narrowing of the foramen magnum, thickening of the tentorium osseus cerebelli and thickening of the dorsal arch of the atlas. CT is useful for detection of the calvarial abnormalities in lions and may be useful in further defining this syndrome.

  13. RADIOGRAPHIC ABDOMINAL ANATOMY IN CAPTIVE RED PANDAS ( AILURUS FULGENS).

    Science.gov (United States)

    Makungu, Modesta; du Plessis, Wencke M; Barrows, Michelle; Groenewald, Hermanus B; Koeppel, Katja N

    2018-03-01

    The red panda ( Ailurus fulgens) is classified as an endangered species by the International Union for Conservation of Nature and Natural Resources. The aim of this study was to describe the normal radiographic abdominal anatomy in red pandas to provide guidance for clinical use. Radiography of the abdomen was performed in nine captive red pandas during their annual health examinations. Seven of nine animals had six lumbar vertebrae. The sacrum consisted mainly (8/9) of three fused segments. Hypaxial muscles were easily seen in animals weighing 5 kg and above. The pylorus was located to the right of the midline and cranially to the fundus in 8/9 individuals. Bunching of small intestine in the right central abdomen occurred in animals weighing 6 kg and above. The spleen was prominent. Knowledge of the normal radiographic abdominal anatomy of red pandas is important in the diagnosis of diseases and in routine health examinations.

  14. Ultrasonographic abdominal anatomy of healthy captive caracals (Caracal caracal).

    Science.gov (United States)

    Makungu, Modesta; du Plessis, Wencke M; Barrows, Michelle; Koeppel, Katja N; Groenewald, Hermanus B

    2012-09-01

    Abdominal ultrasonography was performed in six adult captive caracals (Caracal caracal) to describe the normal abdominal ultrasonographic anatomy. Consistently, the splenic parenchyma was hyperechoic to the liver and kidneys. The relative echogenicity of the right kidney's cortex was inconsistent to the liver. The gall bladder was prominent in five animals and surrounded by a clearly visualized thin, smooth, regular echogenic wall. The wall thickness of the duodenum measured significantly greater compared with that of the jejunum and colon. The duodenum had a significantly thicker mucosal layer compared with that of the stomach. Such knowledge of the normal abdominal ultrasonographic anatomy of individual species is important for accurate diagnosis and interpretation of routine health examinations.

  15. Long term stability and individual distinctiveness in captive orca vocalizations

    Science.gov (United States)

    Noonan, Michael; Suchak, Malini

    2005-04-01

    With focus on the question of signature calling in killer whales, recordings from five captive orcas (of Icelandic origin) held at Marineland of Canada were compared. For the present analysis, samples of three different call syllables were selected from recordings made five years apart and from instances in which the identity of the calling whale was unambiguous due to temporary isolation, concomitant bubbling, and/or head nodding. The Raven software package was used to ascertain the frequency range, frequency (max), duration, and timing of maximum and minimum power within each sample. For two of the three call syllables, statistically significant differences were found among the five whales for call length and for the timing of maximums and minimums (porcas are distinct from one another in ways that are stable over the course of multiple years.

  16. Pathology in Captive Wild Felids at German Zoological Gardens.

    Directory of Open Access Journals (Sweden)

    Johannes Junginger

    Full Text Available This retrospective study provides an overview on spontaneous diseases occurring in 38 captive wild felids submitted for necropsy by German zoological gardens between 2004 and 2013. Species included 18 tigers, 8 leopards, 7 lions, 3 cheetahs and 2 cougars with an age ranging from 0.5 to 22 years. Renal lesions, predominantly tubular alterations (intra-tubular concrements, tubular degeneration, necrosis, intra-tubular cellular debris, proteinaceous casts, dilated tubuli followed by interstitial (lympho-plasmacytic inflammation, fibrosis, metastatic-suppurative inflammation, eosinophilic inflammation and glomerular lesions (glomerulonephritis, glomerulosclerosis, amyloidosis were detected in 33 out of 38 animals (87%. Tumors were found in 19 of 38 felids (50% with 12 animals showing more than one neoplasm. The tumor prevalence increased with age. Neoplasms originated from endocrine (11, genital (8, lympho-hematopoietic (5 and alimentary organs (4 as well as the mesothelium (3. Most common neoplasms comprised uterine/ovarian leiomyomas (5/2, thyroid adenomas/adenocarcinoma (5/1, pleural mesotheliomas (3, hemangiosarcomas (2 and glossal papillomas (2. Inflammatory changes were frequently encountered in the intestine and the lung. Two young animals displayed metastatic mineralization suggestive of a vitamin D- or calcium intoxication. One tiger exhibited degenerative white matter changes consistent with an entity termed large felid leukoencephalomyelopathy. Various hyperplastic, degenerative and inflammatory changes with minor clinical significance were found in several organs. Summarized, renal lesions followed by neoplastic changes as well as inflammatory changes in lung and gastrointestinal tract represent the most frequent findings in captive wild felids living in German zoological gardens.

  17. Effects of guest feeding programs on captive giraffe behavior.

    Science.gov (United States)

    Orban, David A; Siegford, Janice M; Snider, Richard J

    2016-01-01

    Zoological institutions develop human-animal interaction opportunities for visitors to advance missions of conservation, education, and recreation; however, the animal welfare implications largely have yet to be evaluated. This behavioral study was the first to quantify impacts of guest feeding programs on captive giraffe behavior and welfare, by documenting giraffe time budgets that included both normal and stereotypic behaviors. Thirty giraffes from nine zoos (six zoos with varying guest feeding programs and three without) were observed using both instantaneous scan sampling and continuous behavioral sampling techniques. All data were collected during summer 2012 and analyzed using linear mixed models. The degree of individual giraffe participation in guest feeding programs was positively associated with increased time spent idle and marginally associated with reduced time spent ruminating. Time spent participating in guest feeding programs had no effect on performance of stereotypic behaviors. When time spent eating routine diets was combined with time spent participating in guest feeding programs, individuals that spent more time engaged in total feeding behaviors tended to perform less oral stereotypic behavior such as object-licking and tongue-rolling. By extending foraging time and complexity, guest feeding programs have the potential to act as environmental enrichment and alleviate unfulfilled foraging motivations that may underlie oral stereotypic behaviors observed in many captive giraffes. However, management strategies may need to be adjusted to mitigate idleness and other program consequences. Further studies, especially pre-and-post-program implementation comparisons, are needed to better understand the influence of human-animal interactions on zoo animal behavior and welfare. © 2016 Wiley Periodicals, Inc.

  18. Reconciliation and consolation in captive bonobos (Pan paniscus).

    Science.gov (United States)

    Palagi, Elisabetta; Paoli, Tommaso; Tarli, Silvana Borgognini

    2004-01-01

    Although reconciliation in bonobos (Pan paniscus) has previously been described, it has not been analyzed heretofore by the postconflict (PC) match-control (MC) method. Furthermore, although reconciliation has been investigated before in this species, consolation has not. In this study we analyzed agonistic and affiliative contacts in all sex-class combinations to clarify and reevaluate the occurrence of reconciliation in bonobos via the PC-MC method. We also investigated the occurrence of consolation by analyzing the victims' triadic contact tendency (TCT), the influence of the sex of victims, and the relative occurrence of consolation and reconciliation. We collected 167 pairs of PC-MC observations in a captive group of bonobos (in Apeldoorn, The Netherlands). The conciliatory tendency (CCT) we obtained was tendentially lower than the mean value previously found for Yerkes captive chimpanzees. Close relationships, which were present in all female-female (FF) and some male-female (MF) dyads, positively affected reconciliation rates. When only adult PC-MC pairs (157) were considered, the mean TCTs and CCTs did not differ significantly. When we focused on types of PC affiliative contact, in the case of consolation we found a striking preference for sociosexual patterns. As to the relative occurrence of consolation and reconciliation, the highest level of the former was found in the absence of the latter. When reconciliation took place, consolation generally preceded it, suggesting that consolation may be a substitutive behavior. Our findings suggest that even if reconciliation remains the best option, consolation may be an alternative substitute for reconciliation that is used to buffer the tension originating from an unresolved conflict. Reconciliation and consolation are complex phenomena that are probably related to the life history of a group. Given that few studies have been conducted on this subject, we can not at this time make any generalizations regarding

  19. Mycoplasma ovis in captive cervids: prevalence, molecular characterization and phylogeny.

    Science.gov (United States)

    Grazziotin, Ana Laura; Santos, Andrea Pires; Guimaraes, Ana Marcia Sa; Mohamed, Ahmed; Cubas, Zalmir Silvino; de Oliveira, Marcos Jose; dos Santos, Leonilda Correia; de Moraes, Wanderlei; Vieira, Rafael Felipe da Costa; Donatti, Lucelia; de Barros Filho, Ivan Roque; Biondo, Alexander Welker; Messick, Joanne Belle

    2011-09-28

    Hemotrophic mycoplasmas (hemoplasmas) are bacteria that attach to red blood cells of mammals, leading to acute and/or subclinical disease in infected animals. It has been suggested that Mycoplasma ovis, a hemoplasma that infects sheep and goats worldwide, may also infect deer. The aim of this study was to evaluate whether South American deer are infected with M. ovis. EDTA-anticoagulated blood samples from a herd of 32 captive South American deer were collected. DNA extraction of blood samples was performed followed by PCR amplification of the 16S and 23S rRNA genes, and sequencing of products. Using M. ovis PCR, 27/31 (87%) were positive, including 21/22 Mazama nana; 2/3 Mazama americana and 4/6 Blastocerus dichotomus. Sequencing of the nearly entire 16S rRNA gene of 26/27 positive samples showed 98.2-98.8% identity to M. ovis of sheep (GenBank, AF338268) and 98.6-99.4% identity to M. ovis-like of a fawn (FJ824847); the 23S rRNA gene from one of these isolates and the fawn's had 97.6% identity. The remaining isolate had just 94.9% identity to the 16S rRNA gene of M. ovis and only 89.4% identity to the 23S rRNA gene of the fawn's M. ovis. This is the first report of M. ovis in captive South American deer, revealing a high prevalence of hemoplasma infection in these animals. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Reproduction of two-spotted goby, Gobiusculus flavescens, in captivity

    Directory of Open Access Journals (Sweden)

    Vera Teles

    2014-06-01

    Full Text Available The two-spotted goby, Gobiusculus flavescens, is a common fish species along rocky shores in northern European waters. It is a small (40-60 mm, semipelagic marine fish, forming loose shoals in association with microalgae vegetation and mussel beds growing on the rock surface. It is a short-lived species, with a life span of 1-2 years. Both sexes display courtship behaviour and have sexual ornamentation during the breeding season. Male ornaments consist of large dorsal fins with iridescent blue lines, and iridescent blue spots along the sides of the body. Females develop a conspicuous, bright orange belly at sexual maturity. Due to these characteristics this species could have a great interest for ornamental aquariums. In previous work the maintenance of G. flavescens at high temperatures (until 23°C was successful. The aim of this study was to test the reproduction in captivity of G. flavescens. Six replicates were used (18L aquariums at the temperature of 18°C. In each replicate, two males and four females were introduced to an aquarium, where the males chose between two nests and courted the females. During the 112 days of the experiment the females spawned five times but only three spawns had success. The eggs take approximately 8 days to become mature. On the three spawns have hatched 300, 361 and 510 larvae at a time. The larvae were kept in a separate container and fed with alive rotifers and survived a maximum of 21 days. The reproduction of the two-spotted goby in captivity is possible at 18°C, but it is necessary to improve the conditions to rearing the larvae.

  1. Enhancing Oceanography Classrooms with "Captive and Cultured" Ocean Experiences

    Science.gov (United States)

    Macko, S. A.; Tuite, M.; O'Connell, M.

    2012-04-01

    Students in oceanography classes often request more direct exposure to actual ocean situations or field trips. During regular session (13 week) or shorter term (4 week) summer classes such long trips are logistically difficult owing to large numbers of students involved or timing. This new approach to such a course supplement addresses the requests by utilizing local resources and short field trips for a limited number of students (20) to locations in which Ocean experiences are available, and are often supported through education and outreach components. The vision of the class was a mixture of classroom time, readings, along with paper and actual laboratories. In addition short day-long trips to locations where the ocean was "captured" were also used to supplement the experience as well as speakers involved with aquaculture ("cultivated") . Central Virginia is a fortunate location for such a class, with close access for "day travel" to the Chesapeake Bay and numerous field stations, museums with ocean-based exhibits (the Smithsonian and National Zoo) that address both extant and extinct Earth history, as well as national/state aquaria in Baltimore, Washington and Virginia Beach. Furthermore, visits to local seafood markets at local grocery stores, or larger city markets) enhance the exposure to productivity in the ocean, and viability of the fisheries sustainability. The course could then address not only the particulars of the marine science, but also aspects of ethics, including keeping animals in captivity or overfishing of particular species and the special difficulties that arise from captive or culturing ocean populations. In addition, the class was encouraged to post web-based journals of experiences in order to share opinions of observations in each of the settings.

  2. Noninvasive monitoring of adrenocortical function in captive jaguars (Panthera onca).

    Science.gov (United States)

    Conforti, Valéria A; Morato, Ronaldo G; Augusto, Anderson M; de Oliveira e Sousa, Lúcio; de Avila, David M; Brown, Janine L; Reeves, Jerry J

    2012-01-01

    Jaguars are threatened with extinction throughout their range. A sustainable captive population can serve as a hedge against extinction, but only if they are healthy and reproduce. Understanding how jaguars respond to stressors may help improve the captive environment and enhance their wellbeing. Thus, our objectives were to: (1) conduct an adrenocorticotrophic hormone (ACTH) challenge to validate a cortisol radioimmunoassay (RIA) for noninvasive monitoring of adrenocortical function in jaguars; (2) investigate the relationship between fecal corticoid (FCM) and androgen metabolite (FAM) concentrations in males during the ACTH challenge; and (3) establish a range of physiological concentrations of FCMs for the proposed protocol. Seven jaguars (3 M, 4 F) received 500 IU/animal of ACTH. Pre- and post-ACTH fecal samples were assayed for corticoid (M and F) and androgen metabolites (M) by RIA. Concentrations of FCMs increased (P80.01) after ACTH injection (pre-ACTH: 0.90 ± 0.12 µg/g dry feces; post-ACTH: 2.55 ± 0.25 µg/g). Considering pre- and post-ACTH samples, FCM concentrations were higher (P80.01) in males (2.15 ± 0.20 µg/g) than in females (1.30 ± 0.20 µg/g), but the magnitude of the response to ACTH was comparable (P>0.05) between genders. After ACTH injection, FAMs increased in two (of 3) males; in one male, FCMs and FAMs were positively correlated (0.60; P80.01). Excretion of FCMs was assessed in 16 jaguars (7 M, 9 F) and found to be highly variable (range, 80.11-1.56 µg/g). In conclusion, this study presents a cortisol RIA for monitoring adrenocortical function in jaguars noninvasively. © 2011 Wiley Periodicals, Inc.

  3. Molecular evidence of Sarcocystis species in captive snakes in Japan.

    Science.gov (United States)

    Abe, Niichiro; Matsubara, Katsuki; Tamukai, Kenichi; Miwa, Yasutsugu; Takami, Kazutoshi

    2015-08-01

    Sarcocystis nesbitti, using snakes as the definitive host, is a causative agent of acute human muscular sarcocystosis in Malaysia. Therefore, it is important to explore the distribution and prevalence of S. nesbitti in snakes. Nevertheless, epizootiological information of S. nesbitti in snakes remains insufficient because few surveys have assessed Sarcocystis infection in snakes in endemic countries. In Japan, snakes are popular exotic pet animals that are imported from overseas, but the degree of Sarcocystis infection in them remains unclear. The possibility exists that muscular sarcocystosis by S. nesbitti occurs in contact with captive snakes in non-endemic countries. For a total of 125 snake faecal samples from 67 snake species collected at animal hospitals, pet shops and a zoo, this study investigated the presence of Sarcocystis using polymerase chain reaction (PCR) for the 18S ribosomal RNA gene (18S rDNA). Four (3.2%) faecal samples were positive by PCR. Phylogenetic analysis of the 18S rDNA sequences obtained from four amplification products revealed one isolate from a beauty snake (Elaphe taeniura), Sarcocystis zuoi, which uses rat snakes as the definitive host. The isolate from a Macklot's python (Liasis mackloti) was closely related with unidentified Sarcocystis sp. from reticulated pythons in Malaysia. The remaining two isolates from tree boas (Corallus spp.) were closely related with Sarcocystis lacertae, Sarcocystis gallotiae and unidentified Sarcocystis sp. from smooth snakes, Tenerife lizards and European shrews, respectively. This report is the first of a study examining the distribution of Sarcocystis species in captive snakes in Japan.

  4. Longitudinal characterization of Escherichia coli in healthy captive nonhuman primates

    Directory of Open Access Journals (Sweden)

    Jonathan B Clayton

    2014-11-01

    Full Text Available The gastrointestinal (GI tracts of nonhuman primates are well known to harbor Escherichia coli, a known commensal of humans and animals. While E. coli is a normal inhabitant of the mammalian gut, it also exists in a number of pathogenic forms or pathotypes, including those with predisposition for the GI tract, as well the urogenital tract. Diarrhea in captive nonhuman primates (NHPs has long been a problem in both zoo settings and research colonies, including the Como Zoo. It is an animal welfare concern, as well as a public health concern. E. coli has not been extensively studied in correlation with diarrhea in captive primates; therefore, a study was performed during the summer of 2009 in collaboration with a zoo in Saint Paul, MN, which was experiencing an increased incidence and severity of diarrhea among their NHP collection. Fresh fecal samples were collected weekly from each member of the primate collection, between June and August of 2009, and E. coli were isolated. A total of 33 individuals were included in the study, representing eight species. E. coli isolates were examined for their genetic relatedness, phylogenetic relationships, plasmid replicon types, virulence gene profiles, and antimicrobial susceptibility profiles. A number of isolates were identified containing virulence genes commonly found in several different E. coli pathotypes, and there was evidence of clonal transmission of isolates between animals and over time. Overall, the manifestation of chronic diarrhea in the Como Zoo primate collection is a complex problem whose solution will require regular screening for microbial agents and consideration of environmental causes. This study provides some insight towards the sharing of enteric bacteria between such animals.

  5. A low-cost method to test cytotoxic effects of Crotalus vegrandis (Serpentes: Viperidae venom on kidney cell cultures Un método de bajo costo para probar los efectos citotóxicos del veneno de Crotalus vegrandis (Serpentes: Viperidae en cultivos de células renales

    Directory of Open Access Journals (Sweden)

    María E. Girón

    2005-06-01

    Full Text Available The pathogenesis of the renal lesion upon envenomation by snakebite has been related to myolysis, hemolysis, hypotension and/or direct venom nephrotoxicity caused by the venom. Both primary and continuous cell culture systems provide an in vitro alternative for quantitative evaluation of the toxicity of snake venoms. Crude Crotalus vegrandis venom was fractionated by molecular exclusion chromatography. The toxicity of C. vegrandis crude venom, hemorrhagic, and neurotoxic fractions were evaluated on mouse primary renal cells and a continuous cell line of Vero cells maintained in vitro. Cells were isolated from murine renal cortex and were grown in 96 well plates with Dulbecco's Modified Essential Medium (DMEM and challenged with crude and venom fractions. The murine renal cortex cells exhibited epithelial morphology and the majority showed smooth muscle actin determined by immune-staining. The cytotoxicity was evaluated by the tetrazolium colorimetric method. Cell viability was less for crude venom, followed by the hemorrhagic and neurotoxic fractions with a CT50 of 4.93, 18.41 and 50.22 µg/mL, respectively. The Vero cell cultures seemed to be more sensitive with a CT50 of 2.9 and 1.4 µg/mL for crude venom and the hemorrhagic peak, respectively. The results of this study show the potential of using cell culture system to evaluate venom toxicity.La patogénesis de la lesion renal ha sido relacionada a la miolisis, hemólisis, hipotensión y/o el efecto directo del veneno. Tanto el cultivo primario o el cultivo celular continuo proveen una alternativa in vitro para la evaluación cuantitativa de la toxicidad de venenos de serpiente. El veneno crudo de Crotalus vegrandis fue fraccionado por una cromatografía de exclusión molecular. La toxicidad del veneno crudo de C. vegrandis, sus fracciones hemorrágicas y neurotóxicas fueron evaluadas en células renales primarias de ratón y una línea continua de células Vero mantenidas in vitro. Las c

  6. The comparison between the humoral response and the neutralizing capacity of sheep serum inoculated with natural venom and Co{sup 60} irradiated venom from Crotalus durissus terrificus (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P. [Universidade Estadual de Londrina, PR (Brazil). Centro de Ciencias Agrarias. Dept. de Medicina Veterinaria Preventiva]. E-mail: mnetto@uel.br

    2000-07-01

    Crotalus durissus terrificus venom was irradiated with Co{sup 60} to investigate the effects of antigen-irradiation on antivenom production in sheep. Twelve sheep were divided in two groups of 6. One group received irradiated, while the other received natural venom. Three doses of antigen were given at monthly intervals. The toxic activity of the venom was assessed by LD{sub 50} in mice. Weekly blood samples were obtained to evaluate anti-crotalic serum titers by indirect ELISA, neutralization capacity, and serum potency. A complete blood count, plasma protein and fibrinogen concentration, and serum albumin and globulin were also determined. At end of the experiment, the animals were challenged with ovine LD{sub 50}, without clinical abnormalities. (author)

  7. Fish Health Data - Captive Broodstock Gene Rescue Program for Odd Year Class Elwha River Pink Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct captive brood stock gene rescue program for Elwha River odd-year class pink salmon. All fresh mortalities larger than 100 mm are sent to Fish Health for...

  8. Reproduction of rescued vespertilionid bats (Nyctalus noctula) in captivity: veterinary and physiologic aspects

    Czech Academy of Sciences Publication Activity Database

    Pikula, J.; Banďouchová, H.; Kováčová, V.; Linhart, P.; Piaček, V.; Zukal, Jan

    2017-01-01

    Roč. 20, č. 2 (2017), s. 665-677 ISSN 1094-9194 Institutional support: RVO:68081766 Keywords : Bat * Fertilization * Captive birth * Euthanasia * Ethics * Blood profile * Thermoregulation * Torpor Subject RIV: EG - Zoology OBOR OECD: Zoology

  9. Cutaneous Adenocarcinoma of sebaceous gland in a captive male jaguar (Panthera onca: A case report

    Directory of Open Access Journals (Sweden)

    Arnab K. Majie

    2014-02-01

    Full Text Available High incidence of neoplasia in captive jaguar (Panthera onca has been recorded but there have been no reports of cutaneous adenocarcinoma of the sebaceous gland. A high incidence of neoplasia has been detected in captive jaguars, possibly associated with longevity and husbandry practices in captivity. Neoplasm is a major cause of mortality in jaguar. Tumours of sebaceous gland are common in older domestic felids. A case of cutaneous adenocarcinoma of the sebaceous gland was diagnosed in a male captive jaguar in the Zoological Garden, Alipore, Kolkata, India and was managed successfully. The tumour was observed as a superficial, ulcerated, multilobulated intradermal mass. After preoperative haematological evaluation the tumour was excised through routine surgical procedure under chemical immobilisation. Post-operative management was uneventful. Local tumour recurrence was not noticed till one year after post-operation.

  10. exposure of growing and adult captive cheetahs (Acinony Jubatus) to dietary isoflavones: twenty years later

    NARCIS (Netherlands)

    Bell, K.M.; Rutherfurd, S.M.; Hendriks, W.H.

    2010-01-01

    Dietary isoflavones are associated with oestrogenic and anti-oestrogenic effects, and have been linked to infertility in cheetahs. This study aimed to determine the isoflavone content of commercially prepared diets consumed by captive cheetahs. Sixteen international zoological facilities provided

  11. Captive reared loggerhead sea turtles Hook and bait interaction trials From 2004-2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Hook and bait interaction feeding response data from experiments with captive reared loggerhead sea turtles ranging from 45 - 65 cm straight carapace length) were...

  12. (Forced Walks on the Wild Side: Precarious Borders in American Captivity Narratives

    Directory of Open Access Journals (Sweden)

    Alexander Starre

    2010-01-01

    Full Text Available Most readings of American captivity narratives have so far investigated their intercultural, psychological, and theological significances, while disregarding their ecological aspects. Despite its appropriation into US-American national literature, the captivity genre contains at its root a transcultural plot of an individual's confrontation with the environment and the unsettling forces of wilderness and animality. These personal memoirs indeed hold global value by pointing to our collective embeddedness and embodiedness.This essay surveys two early captivity narratives - the classical one by Mary Rowlandson (1682 and a lesser known text by John Gyles (1736 - alongside contemporary examples of the genre that relate the stories of American captives in Iraq and Colombia.

  13. Monthly morphometric data on captive Kemps ridley sea turtles 1995-2013

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The database contains monthly measurements taken on captive reared sea turtles. Measurements include: straight carapace length nuchal notch to carapace tip, straight...

  14. Monthly morphometric data on captive Kemps ridley sea turtles from 1998-2014 (NCEI Accession 0156880)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data contains monthly morphometric measurements on captive reared sea turtles at the Galveston, TX NOAA lab. Morphometric measurements are taken to track growth...

  15. First Care Area Logs for captive loggerhead and Kemps ridley sea turtles 2003-2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The database contains records pertaining to sick captive sea turtles, their daily behavior, medications, food offered, food consumed, and water quality.

  16. Fish Culture Data - Captive Broodstock Gene Rescue Program for Odd Year Class Elwha River Pink Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct captive brood stock gene rescue program for Elwha River odd-year class pink salmon. Raw data on rearing density, loading density, water temperature, ration,...

  17. Production Data - Captive Broodstock Gene Rescue Program for Odd Year Class Elwha River Pink Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct captive brood stock gene rescue program for Elwha River odd-year class pink salmon. Information on the number of smolts received into the program is...

  18. Broodyear Data - Captive Broodstock Gene Rescue Program for Odd Year Class Elwha River Pink Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct captive brood stock gene rescue program for Elwha River odd-year class pink salmon. Data is collected by broodyear on % survival to adult, % maturity as two...

  19. Growth Data - Captive Broodstock Gene Rescue Program for Odd Year Class Elwha River Pink Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct captive brood stock gene rescue program for Elwha River odd-year class pink salmon. The fork length to the nearest mm and weight to the nearest gram of a...

  20. Quadros clínico-patológicos do envenenamento ofídico por Crotalus durissus terrificus e Bothrops spp. em animais de produção

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    2014-04-01

    Full Text Available Foi realizada uma revisão dos quadros clínico-patológicos causados pelos venenos de Crotalus durissus terrificus e Bothrops spp. em bovinos, búfalos, ovinos equinos e suínos. Foram compilados os dados obtidos pela experimentação em animais de produção encontrados na literatura e os obtidos através de experimentação realizada por nossa equipe. Também foram revisados os casos naturais de envenenamento ofídico comunicados. Em dois Quadros foram lançados os mais importantes dados dessas revisões, que revelou diversos aspectos interessantes: 1 em nossos experimentos, o veneno de Crotalus durissus terrificus, quando injetado por via subcutânea em cavalos, causou um edema acentuado no local da aplicação, ao contrário do que tem sido observado em todas as outras espécies animais, aspecto não relatado na literatura; 2 em nossos experimentos, o veneno de diversas espécies de Bothrops, quando injetado por via subcutânea em bovinos, ovinos e equinos, não causou edema como em geral é relatado na literatura, e sim hemorragias subcutâneas acentuadas no local da aplicação. Nos casos não fatais este sangue era reabsorvido em poucos dias sem deixar sequelas. Exceção foi a reação ao veneno de Bothrops jararacussu, que causou edema nos ovinos experimentais, e tumefação acentuada que resultou em fístula com eliminação de líquido seroso nos equinos experimentais. O objetivo do presente estudo visa contribuir para o aperfeiçoamento do diagnóstico de acidentes ofídicos em animais de produção.

  1. The effects of captive versus wild rearing environments on long bone articular surfaces in common chimpanzees (Pan troglodytes

    Directory of Open Access Journals (Sweden)

    Kristi L. Lewton

    2017-08-01

    Full Text Available The physical environments of captive and wild animals frequently differ in substrate types and compliance. As a result, there is an assumption that differences in rearing environments between captive and wild individuals produce differences in skeletal morphology. Here, this hypothesis is tested using a sample of 42 captive and wild common chimpanzees (Pan troglodytes. Articular surface areas of the humerus, radius, ulna, femur, and tibia were calculated from linear breadth measurements, adjusted for size differences using Mosimann shape variables, and compared across sex and environmental groups using two-way ANOVA. Results indicate that the articular surfaces of the wrist and knee differ between captive and wild chimpanzees; captive individuals have significantly larger distal ulna and tibial plateau articular surfaces. In both captive and wild chimpanzees, males have significantly larger femoral condyles and distal radius surfaces than females. Finally, there is an interaction effect between sex and rearing in the articular surfaces of the femoral condyles and distal radius in which captive males have significantly larger surface areas than all other sex-rearing groups. These data suggest that long bone articular surfaces may be sensitive to differences experienced by captive and wild individuals, such as differences in diet, body mass, positional behaviors, and presumed loading environments. Importantly, these results only find differences due to rearing environment in some long bone articular surfaces. Thus, future work on skeletal morphology could cautiously incorporate data from captive individuals, but should first investigate potential intraspecific differences between captive and wild individuals.

  2. Czechs and Slovaks in Russian Captivity during World War I (1914-1918

    Directory of Open Access Journals (Sweden)

    Oksana E. Dmitrieva

    2013-01-01

    Full Text Available The article is focused on the features of more than 250 000 Czechs and Slovaks in Russian captivity during World War I: the amount, quartering and supply benefits, work in various sectors of the Russian economy, military units formation, social and national organizations activities, charity support. The conditions of Czechs and Slovaks captivity are recollected. New sources are introduced into scientific use.

  3. Comparative Analysis of the Gut Microbiota Composition between Captive and Wild Forest Musk Deer

    OpenAIRE

    Li, Yimeng; Hu, Xiaolong; Yang, Shuang; Zhou, Juntong; Zhang, Tianxiang; Qi, Lei; Sun, Xiaoning; Fan, Mengyuan; Xu, Shanghua; Cha, Muha; Zhang, Meishan; Lin, Shaobi; Liu, Shuqiang; Hu, Defu

    2017-01-01

    The large and complex gut microbiota in animals has profound effects on feed utilization and metabolism. Currently, gastrointestinal diseases due to dysregulated gut microbiota are considered important factors that limit growth of the captive forest musk deer population. Compared with captive forest musk deer, wild forest musk deer have a wider feeding range with no dietary limitations, and their gut microbiota are in a relatively natural state. However, no reports have compared the gut micro...

  4. Multiple births by a captive swellshark Cephaloscyllium ventriosum via facultative parthenogenesis.

    Science.gov (United States)

    Feldheim, K A; Clews, A; Henningsen, A; Todorov, L; McDermott, C; Meyers, M; Bradley, J; Pulver, A; Anderson, E; Marshall, A

    2017-03-01

    Using a novel set of 12 microsatellites, a captive, adult female swellshark Cephaloscyllium ventriosum that produced five pups via parthenogenesis is described; naturally occurring parthenogenesis has been observed in every vertebrate class with the exception of mammals. As demonstrated in this study, a captive environment is ideal for long-term monitoring of animals under controlled conditions, and easily allows the detection of particular facets of their biology. © 2016 The Fisheries Society of the British Isles.

  5. Focal palatine erosion in captive and free-living cheetahs (Acinonyx jubatus) and other felid species.

    Science.gov (United States)

    Zordan, Martýn; Deem, Sharon L; Sanchez, Carlos R

    2012-01-01

    We examined 1,092 skulls of captive and free-living individuals, representing 33 felid species, to determine the prevalence of focal palatine erosion (FPE). FPE was detected in 3.2% of cats evaluated, including cheetah (Acinonyx jubatus) and 14 other felid species. The prevalence of FPE between cheetah (9.4%; n = 64) and non-cheetah species (2.8%; n = 1,028) (χ(2) test; P = 0.004) and between captive (5.7%; n = 246) and free-living (2.4%; n = 824) individuals (χ(2) test; P = 0.010) were significantly different, with prevalence between captive (19%; n = 21) and free-living (2.9%; n = 34) cheetahs approaching significance (Fisher's exact test; P = 0.064). FPE was diagnosed with equal prevalence in skulls from individuals in which the lower molars did not meet the palatine bone (60.6%) and individuals in which it did (39.4%; n = 33) (χ(2) test; P = 0.139). In cheetahs with FPE, one was a captive animal in Germany, one a free-living cheetah from Mali, one captive cheetah from Kenya, and three captive cheetahs of unknown origin. Additionally, we evaluated the medical records of 49 captive cheetahs in Namibia. Of these cheetahs, 48 (98.0%) had clinical signs consistent with FPE, although only 16 of these 48 (39.6%) had perforation of the palatine bone. Based on physical examinations, FPE was diagnosed in two caracals (Caracal caracal) and one fishing cat (Prionailurus viverrinus) from a North American Zoo. Results from this study confirm FPE in cheetahs outside of Namibia, in a minimum of 15 felid species, and a higher FPE prevalence in captive individuals than free-living ones. Clinical implications of these findings and recommendations for future studies are provided. © 2011 Wiley Periodicals, Inc.

  6. Behavior and diet supply of Latrodectus group Mactans (Araneae, Theridiidae) in captivity

    OpenAIRE

    Dias, Maria de Fátima da Rocha; Brazil, Tania Kobler

    1999-01-01

    Latrodectus gr. mactans is responsible for 28% of ali accidents provoked by spiders in state of Bahia, Brazil (1980-1990), which makes necessary the study of its manejament. The spiders were captured in Ondina, Salvador, and in Baxio, Esplanada (Bahia, Brazil); they were mantained in captivity, with food supply weekly (Atta sp., larva of Tenebrio sp. and Drosophila melanogaster) with three hours/ offers observation time, during march/95 to april/96. In captivity, the spiders accepted two kind...

  7. PBDEs (polybrominated diphenyl ethers) pose a risk to captive giant pandas.

    Science.gov (United States)

    Chen, Yi-Ping; Zheng, Ying-Juan; Liu, Qiang; Ellison, Aaron M; Zhao, Yan; Ma, Qing-Yi

    2017-07-01

    The Qinling subspecies of giant panda (Ailuropoda melanoleuca qinlingensis), is highly endangered; fewer than 350 individuals still inhabit Qinling Mountains. Previous research revealed captive pandas were exposed to bromine, so we hypothesized that captive pandas were exposed to and affected by polybrominated diphenyl ethers (PBDEs). To test this hypothesis, we tested blood and feces of captive and wild pandas, their drinking water, food (bamboo leaves) from SWARC (Shaanxi Wild Animal Research Center)and FNNR (Foping National Nature Reserve) and supplemental feedstuff given to captive panda at SWARC. We found 13 congeners of PBDEs in fecal samples, of which BDE47, BDE66, BDE71, BDE99, and BDE154 were the dominant, total PBDE concentration in feces of captive pandas was 255% higher than in wild pandas. We found nine PBDEs congeners in blood samples: BDE153 and BDE183 were the predominant congers. PBDEs in blood from captive pandas were significantly higher than in wild pandas. The total concentration of PBDEs were 5473 and 4835 (pg.g) in Fargesia qinlingensis, were 2192 and 1414 (pg.g) in Bashannia fargesii (2192, 1414 pg g), 0.066, 0.038 (pg/ml) in drinking water, and 28.8 (pg.g) in supplemental feedstuff for captive and wild pandas, which indicate that the PBDEs came from its bamboo feed, especially from Bashannia fargesii. Our results demonstrate that BDE99 and BDE47 could be threatening the pandas' health especially for captive panda and there are potential health risks from PBDEs for pandas. In the short term, this risk may be ameliorated by strict control of food quality. In the long term, however, reducing air, water and soil contamination so as to improve environmental quality can best reduce these risks to meet the international standard such as Stockholm Convention. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Proteomic comparisons of venoms of long-term captive and recently wild-caught Eastern brown snakes (Pseudonaja textilis) indicate venom does not change due to captivity.

    Science.gov (United States)

    McCleary, Ryan J R; Sridharan, Sindhuja; Dunstan, Nathan L; Mirtschin, Peter J; Kini, R Manjunatha

    2016-07-20

    Snake venom is a highly variable phenotypic character, and its variation and rapid evolution are important because of human health implications. Because much snake antivenom is produced from captive animals, understanding the effects of captivity on venom composition is important. Here, we have evaluated toxin profiles from six long-term (LT) captive and six recently wild-caught (RC) eastern brown snakes, Pseudonaja textilis, utilizing gel electrophoresis, HPLC-MS, and shotgun proteomics. We identified proteins belonging to the three-finger toxins, group C prothrombin activators, Kunitz-type serine protease inhibitors, and phospholipases A2, among others. Although crude venom HPLC analysis showed LT snakes to be higher in some small molecular weight toxins, presence/absence patterns showed no correlation with time in captivity. Shotgun proteomics indicated the presence of similar toxin families among individuals but with variation in protein species. Although no venom sample contained all the phospholipase A2 subunits that form the textilotoxin, all did contain both prothrombin activator subunits. This study indicates that captivity has limited effects on venom composition, that venom variation is high, and that venom composition may be correlated to geographic distribution. Through proteomic comparisons, we show that protein variation within LT and RC groups of snakes (Pseudonaja textilis) is high, thereby resulting in no discernible differences in venom composition between groups. We utilize complementary techniques to characterize the venom proteomes of 12 individual snakes from our study area, and indicate that individuals captured close to one another have more similar venom gel electrophoresis patterns than those captured at more distant locations. These data are important for understanding natural variation in and potential effects of captivity on venom composition. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Captive-breeding and conservation of the European mammal diversity

    Directory of Open Access Journals (Sweden)

    Spartaco Gippoliti

    2004-06-01

    Full Text Available Abstract Under the biological species concept, the intraspecific variability and true species richness of Palearctic mammals has often been overlooked, and therefore the need to conserve it. Recovery projects of endangered European mammals in Western Europe rely mainly upon translocation of conspecifics from viable populations in Central or Eastern Europe. From a wildlife management and restoration ecology point of view, many such recovery projects have been successful. However, from a biodiversity perspective it could be argued that they could have failed to protect the original European biodiversity. The increasing evidence of a complex phylogeographic pattern in many European mammals - especially in the Mediterranean region - has led to a reconsideration of the conservation unit and highlights the need for species-specific programmes for assuring the survival of threatened, distinctive populations. Such programs should also include captive breeding. It is therefore suggested that a two-level classification of captive breeding programmes is needed according to the degree of threat of concerned taxa, to maximise available resources without jeopardising in situ conservation. It is proposed to distinguish between a level I captive breeding programmes, which are part of the conservation strategy for seriously threatened taxa and need to be financed by state or federal agencies, and b "prophylactic" level II for vulnerable taxa or populations, and for which funds may be available mainly from the private sector. Available evidence suggests that given adequate husbandry techniques and pre-release training, even captive-bred carnivores can be successfully reintroduced to the wild. However, a closer collaboration among zoological gardens, zoologists and agencies involved in wildlife conservation is needed to avoid ill-conceived, potentially dangerous captive-breeding and re-introduction projects.

  10. Antibody response to rabies vaccination in captive and freeranging wolves (Canis lupus)

    Science.gov (United States)

    Federoff, N.E.

    2001-01-01

    Fourteen captive and five free-ranging Minnesota gray wolves (Canis lupus) were tested for the presence of rabies virus neutralizing antibodies (RVNA) after vaccination with an inactivated canine rabies vaccine. Blood was collected from all wolves prior to vaccination and at 1 mo postvaccination (PV) and from all captive and three wild wolves at 3 mo PV. In addition, one free-ranging wolf was sampled at 4 mo PV, and two free-ranging wolves were sampled at 6 mo PV. All wolves were seronegative prior to vaccination. RVNA were detected in 14 (100%) captive wolves and in four of five (80%) free-ranging wolves. The geometric mean titer of the captive wolves at 1 mo PV was significantly higher (P = 0.023) than in the free-ranging wolves. Five of 13 (38.5%) captive wolves and none of the three (0%) free-ranging wolves had measurable RVNA at 3 mo PV. No measurable RVNA were detected in the serum samples collected from the free-ranging wolves at 4 and 6 mo PV. These results should be interpreted with caution because of the small number of free-ranging wolves tested. Further research is needed to properly assess immune function and antibody response to vaccination in captive wolves in comparison with their free-ranging counterparts.

  11. An Assessment of the Status of Captive Broodstock Technology of Pacific Salmon, 1995 Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.; Mahnaken, Conrad V.W.; Hard, Jeffrey J.

    1995-06-01

    This report provides guidance for the refinement and use of captive broodstock technology for Pacific salmon (Oncorhynchus spp.) by bringing together information on the husbandry techniques, genetic risks, physiology, nutrition, and pathology affecting captive broodstocks. Captive broodstock rearing of Pacific salmon is an evolving technology, as yet without well defined standards. At present, we regard captive rearing of Pacific salmon as problematic: high mortality rates and low egg viability were common in the programs we reviewed for this report. One of the most important elements in fish husbandry is the culture environment itself. Many captive broodstock programs for Pacific salmon have reared fish from smolt-to-adult in seawater net-pens, and most have shown success in providing gametes for recovery efforts. However, some programs have lost entire brood years to diseases that transmitted rapidly in this medium. Current programs for endangered species of Pacific salmon rear most fish full-term to maturity in fresh well-water, since ground water is low in pathogens and thus helps ensure survival to adulthood. Our review suggested that captive rearing of fish in either freshwater, well-water, or filtered and sterilized seawater supplied to land-based tanks should produce higher survival than culture in seawater net-pens.

  12. Seroepidemiology of TmPV1 infection in captive and wild Florida manatees (Trichechus manatus latirostris).

    Science.gov (United States)

    Donà, Maria Gabriella; Rehtanz, Manuela; Adimey, Nicole M; Bossart, Gregory D; Jenson, Alfred B; Bonde, Robert K; Ghim, Shin-je

    2011-07-01

    In 1997, cutaneous papillomatosis caused by Florida manatee (Trichechus manatus latirostris [Tm]) papillomavirus 1 (TmPV1) was detected in seven captive manatees at the Homosassa Springs Wildlife State Park, Florida, USA, and, subsequently, in two wild manatees from the adjacent Homosassa River. Since then, papillomatosis has been reported in captive manatees housed in other locations, but not in wild animals. To determine TmPV1 antibody prevalence in captive and wild manatees sampled at various locations throughout Florida coastal regions, virus-like particles, composed of the L1 capsid protein of TmPV1, were generated with a baculovirus expression system and used to measure anti-TmPV1 antibodies in an enzyme-linked immunosorbent assay. Serologic analysis of 156 manatees revealed a TmPV1 antibody prevalence of 26.3%, with no significant difference between captive (n=39) and wild (n=117) manatees (28.2% and 25.6%, respectively). No antibody-positive wild animal showed PV-induced cutaneous lesions, whereas papillomatosis was observed in 72.7% of antibody-positive captive manatees. Our data indicate that Florida manatees living in the wild are naturally infected by TmPV1 but rarely show TmPV1-induced papillomatosis. Hence, it appears that the wild population would not be harmed in a case of contact with captive animals without visible lesions and productive infections, which could be thus released into the wild.

  13. Discrepancies in the occurrence of Balantidium coli between wild and captive African great apes.

    Science.gov (United States)

    Pomajbíková, Kateřina; Petrželková, Klára J; Profousová, Ilona; Petrášová, Jana; Modrý, David

    2010-12-01

    Balantidium coli is a ciliate reported in many mammalian species, including African great apes. In the former, asymptomatic infections as well as clinical balantidiasis have been reported in captivity. We carried out a cross-sectional study of B. coli in African great apes (chimpanzees, bonobos, and both species of gorillas) and examined 1,161 fecal samples from 28 captive facilities in Europe, plus 2 sanctuaries and 11 wild sites in Africa. Samples were analyzed with the use of Sheather's flotation and merthiolate-iodine-formaldehyde (MIFC) sedimentation. MIFC sedimentation was the more sensitive technique for diagnostics of B. coli in apes. Although not detected in any wild-ape populations, B. coli was diagnosed in 52.6% of captive individuals. Surprisingly, in the apes' feces, trophozoites of B. coli were commonly detected, in contrast with other animals, e.g., Old World monkeys, pigs, etc. Most likely reservoirs for B. coli in captive apes include synantropic rats. High starch diets in captive apes are likely to exacerbate the occurrence of balantidiasis in captive apes.

  14. Effects of environmental complexity and temporary captivity on foraging behavior of wild-caught meadow voles.

    Science.gov (United States)

    Kozuch, Amaranta E; McPhee, M Elsbeth

    2014-01-01

    Increased housing of wild nonhuman animals in captivity for conservation, research, and rehabilitation has revealed the importance of systematically analyzing effects of the captive environment on behavior. This study focused on the effects of complexity and time held in captivity on foraging behaviors of wild-caught, adult meadow voles (Microtus pennsylvanicus). Forty-six individuals captured from a meadow outside Oshkosh, WI, were assigned to 1 of 4 captive treatment groups: simple/50 days, complex/50 days. Number of dish visits, proportion foraging, and frequency of nonforaging behaviors recorded during a 15-min foraging trial were measured for all subjects. Kruskal-Wallis and Mann-Whitney U Tests were conducted to analyze 4 different comparisons within this behavioral data. Overall, neither time in captivity or environmental complexity affected nonforaging behaviors. In contrast, foraging behaviors did change with treatment: Voles were less active at food dishes and visited control dishes more in treatment group SS than in the other treatment groups. In addition, sex-related differences in foraging behaviors were maintained when voles were exposed to environmental complexity. This article includes options for wildlife managers to adapt captive environments to meet the welfare and behavioral needs of translocated wild nonhuman mammals.

  15. Keeping and breeding the rescued Sunda pangolins (Manis javanica) in captivity.

    Science.gov (United States)

    Zhang, Fuhua; Yu, Jiaming; Wu, Shibao; Li, Shaoshan; Zou, Cuiyun; Wang, Qiaoyun; Sun, Ruyong

    2017-12-01

    The Sunda pangolin (Manis javanica Desmarest, 1822) is a Critically Endangered species. Given that this species lacks effective policies for in situ conservation and prevention of poaching in the wild, ex situ conservation and a captive breeding program are urgently needed to save this species from extinction. However, techniques for the maintenance and captive breeding of pangolins have not been well developed. In June 2010, we established the Pangolin Research Base for Artificial Rescue and Conservation Breeding of South China Normal University (PRB-SCNU). To date, a total of 34 Sunda pangolin cubs have been born at PRB-SCNU, 26 of which were captive bred, indicating great progress in keeping and breeding the Sunda pangolin. The techniques for maintenance-including housing, transitioning to an artificial diet, husbandry, and captive breeding-are described in this paper. The purpose of this manuscript is to share our successful experiences and techniques in the maintenance, management, and captive breeding of Sunda pangolins, and to provide guidance and a reference for the captive care and management of Sunda pangolins and other pangolin species. © 2017 Wiley Periodicals, Inc.

  16. Behavioural Profiles of Brown and Sloth Bears in Captivity

    Science.gov (United States)

    Quintavalle Pastorino, Giovanni; Christodoulides, Yiannis; Curone, Giulio; Pearce-Kelly, Paul; Faustini, Massimo; Albertini, Mariangela; Preziosi, Richard; Mazzola, Silvia Michela

    2017-01-01

    Simple Summary Animal personality research is a growing field, since understanding animal personalities has notable implications in ecology and the evolution of animal behaviours. In the current study, we tested different methods described in the literature to obtain robust individual behavioural profiles. Data collected through behavioral observations were categorised into activity budgets, space usage, and social interactions for each individual. In addition, behavioural profile questionnaires were completed by the three zoo keepers who had regular interactions with the bears. The questionnaires included 22 adjectives, which were rated on a scale of 1–12 depending on how well they described each individual bear. The mean ratings of the keepers were used to create the behavioural profiles by adding the adjectives to the appropriate domains, according to the NEO Five Factor Inventory of personality model (NEO-FFI). The data gathered was used to produce behavioural profiles for all animals, in order to clarify the personality characteristics of each subject. Testing and improving existing methodologies to determine animal personality is important for providing optimal welfare and management of captive animals, since it can help to develop more effective management regimes in zoos by remodelling husbandry according to each animal’s personality type. Abstract Three brown bear (Ursus arctos arctos) individuals and two sloth bear (Melursus ursinus inornatus) individuals were observed in captivity to produce behavioural profiles for each individual. Data collected through behavioural observations were used to produce activity budgets, and to identify space usage and certain aspects of social behavior. Behaviour monitoring allowed the researchers to evaluate the welfare of the animals by identifying the occurrence of stereotypic behaviours, which are sometimes associated with stress. Behavioural profiles were created using data obtained through behavioural

  17. Tucannon River Spring Chinook Salmon Captive Broodstock Program, Annual Report 2001.

    Energy Technology Data Exchange (ETDEWEB)

    Gallinat, Michael P.; Bumgarner, Joseph D.

    2002-05-01

    This report summarizes the objectives, tasks, and accomplishments of the Tucannon River spring chinook captive brood during 2001. The WDFW initiated a captive broodstock program in 1997. The overall goal of the Tucannon River captive broodstock program is for the short-term, and eventually long-term, rebuilding of the Tucannon River spring chinook salmon run, with the hope that natural production will sustain itself. The project goal is to rear captive salmon selected from the supplementation program to adults, spawn them, rear their progeny, and release approximately 150,000 smolts annually into the Tucannon River between 2003-2007. These smolt releases, in combination with the current hatchery supplementation program (132,000 smolts) and wild production, are expected to produce 600-700 returning adult spring chinook to the Tucannon River each year from 2005-2010. The captive broodstock program will collect fish from five (1997-2001) brood years (BY). The captive broodstock program was initiated with 1997 BY juveniles, and the 2001 BY fish have been selected. As of Jan 1, 2002, WDFW has 17 BY 1997, 159 BY 1998, 316 BY 1999, 448 BY 2000, and approximately 1,200 BY 2001 fish on hand at LFH. The 2001 eggtake from the 1997 brood year (Age 4) was 233,894 eggs from 125 ripe females. Egg survival was 69%. Mean fecundity based on the 105 fully spawned females was 1,990 eggs/female. The 2001 eggtake from the 1998 brood year (Age 3) was 47,409 eggs from 41 ripe females. Egg survival was 81%. Mean fecundity based on the 39 fully spawned females was 1,160 eggs/female. The total 2001 eggtake from the captive brood program was 281,303 eggs. As of May 1, 2002 we have 171,495 BY 2001 captive brood progeny on hand. A total of 20,592 excess fish were marked as parr (AD/CWT) and will be released during early May, 2002 into the Tucannon River (rkm 40-45). This will allow us to stay within our maximum allowed number (150,000) of smolts released. During April 2002, WDFW volitionally

  18. Sound variation and function in captive Commerson's dolphins (Cephalorhynchus commersonii).

    Science.gov (United States)

    Yoshida, Yayoi M; Morisaka, Tadamichi; Sakai, Mai; Iwasaki, Mari; Wakabayashi, Ikuo; Seko, Atsushi; Kasamatsu, Masahiko; Akamatsu, Tomonari; Kohshima, Shiro

    2014-10-01

    Commerson's dolphin (Cephalorhynchus commersonii), one of the smallest dolphin species, has been reported to produce only narrow-band high-frequency (NBHF) clicks and no whistles. To clarify their sound repertoire and examine the function of each type, we analysed the sounds and behaviour of captive Commerson's dolphins in Toba Aquarium, Japan. All recorded sounds were NBHF clicks with peak frequency >110kHz. The recorded click-trains were categorised into four types based on the changing pattern of their Inter-click intervals (ICI): Decreasing type, with continuously decreasing ICI during the last part of the train; Increasing type, with continuously increasing ICI during the last part; Fluctuating type, with fluctuating ICI; and Burst-pulse type, with very short and constant ICI. The frequency of the Decreasing type increased when approaching an object newly introduced to the tank, suggesting that the sound is used for echolocation on approach. The Burst-pulse type suddenly increased in front of the object and was often oriented towards it, suggesting that it was used for echolocation in close proximity to the object. In contrast, the Increasing type was rarely recorded during approach, but increased when a dolphin approached another dolphin. The Increasing and Burst-pulse types also increased when dolphins began social behaviours. These results suggest that some NBHF clicks have functions other than echolocation, such as communication. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. The effects of intrinsic enrichment on captive felids.

    Science.gov (United States)

    Damasceno, Juliana; Genaro, Gelson; Quirke, Thomas; McCarthy, Shannen; McKeown, Sean; O'Riordan, Ruth

    2017-05-01

    Environmental enrichment is a well-known technique, which has been used to enhance the welfare of captive animals. The aim of this study is to investigate how three different forms of intrinsic enrichment, namely, a hay ball without scent, a hay ball with catnip, and a hay ball with cinnamon, influenced the behavior of six cheetah and two Sumatran tigers at Fota Wildlife Park, Ireland. Enrichment-directed behaviors, as well as pacing, locomotion, inactive, and exploratory behaviors were investigated. The results indicated that the three forms of enrichment had similar effects, in terms of enrichment-directed behavior, with cinnamon resulting in the highest levels of enrichment-directed behaviors. The cinnamon treatment resulted in a significant decrease in pacing behavior when compared with baseline observations. No evidence of habituation (i.e., a significant reduction in enrichment-directed behaviors) was observed for any of the three enrichments. This means that these low cost, easy to apply, practical forms of enrichment could be frequently applied for these species as part of an enrichment regime. © 2017 Wiley Periodicals, Inc.

  20. Population genetic diversity and hybrid detection in captive zebras.

    Science.gov (United States)

    Ito, Hideyuki; Langenhorst, Tanya; Ogden, Rob; Inoue-Murayama, Miho

    2015-08-21

    Zebras are members of the horse family. There are three species of zebras: the plains zebra Equus quagga, the Grevy's zebra E. grevyi and the mountain zebra E. zebra. The Grevy's zebra and the mountain zebra are endangered, and hybridization between the Grevy's zebra and the plains zebra has been documented, leading to a requirement for conservation genetic management within and between the species. We characterized 28 microsatellite markers in Grevy's zebra and assessed cross-amplification in plains zebra and two of its subspecies, as well as mountain zebra. A range of standard indices were employed to examine population genetic diversity and hybrid populations between Grevy's and plains zebra were simulated to investigate subspecies and hybrid detection. Microsatellite marker polymorphism was conserved across species with sufficient variation to enable individual identification in all populations. Comparative diversity estimates indicated greater genetic variation in plains zebra and its subspecies than Grevy's zebra, despite potential ascertainment bias. Species and subspecies differentiation were clearly demonstrated and F1 and F2 hybrids were correctly identified. These findings provide insights into captive population genetic diversity in zebras and support the use of these markers for identifying hybrids, including the known hybrid issue in the endangered Grevy's zebra.

  1. Spontaneous, generalized lipidosis in captive greater horseshoe bats (Rhinolophus ferrumequinum).

    Science.gov (United States)

    Gozalo, Alfonso S; Schwiebert, Rebecca S; Metzner, Walter; Lawson, Gregory W

    2005-11-01

    During a routine 6-month quarantine period, 3 of 34 greater horseshoe bats (Rhinolophus ferrumequinum) captured in mainland China and transported to the United States for use in echolocation studies were found dead with no prior history of illness. All animals were in good body condition at the time of death. At necropsy, a large amount of white fat was found within the subcutis, especially in the sacrolumbar region. The liver, kidneys, and heart were diffusely tan in color. Microscopic examination revealed that hepatocytes throughout the liver were filled with lipid, and in some areas, lipid granulomas were present. renal lesions included moderate amounts of lipid in the cortical tubular epithelium and large amounts of protein and lipid within Bowman's capsules in the glomeruli. In addition, one bat had large lipid vacuoles diffusely distributed throughout the myocardium. The exact pathologic mechanism inducing the hepatic, renal, and cardiac lipidosis is unknown. The horseshoe bats were captured during hibernation and immediately transported to the United States. It is possible that the large amount of fat stored coupled with changes in photoperiod, lack of exercise, and/or the stress of captivity might have contributed to altering the normal metabolic processes, leading to anorexia and consequently lipidosis in these animals.

  2. Ascarid infestation in captive Siberian tigers in China.

    Science.gov (United States)

    Peng, Zhiwei; Liu, Shijie; Hou, Zhijun; Xing, Mingwei

    2016-08-15

    The Siberian tiger is endangered and is listed by the International Union for the Conservation of Nature; the captive environment is utilized to maintain Siberian tiger numbers. Little information regarding the prevalence of parasites in Siberian tigers is available. A total of 277 fecal samples of Siberian tigers were analyzed in this study. The microscopic analysis indicated the presence of ascarid eggs of Toxascaris leonina and Toxocara cati. The ascarid infection rate was 67.5% in Siberian tigers. The internal transcribed spacer-1 (ITS-1) phylogenetic analysis indicated that T. leonina belonged to Toxascaris and that Toxo. cati belonged to Toxocara. The infestation rate and intensity of T. leonina were higher than those of Toxo. cati. One-way analysis of variance showed that the presence of T. leonina was significantly associated with age (Ptigers and is helpful for the prevention of the spread of infectious parasitic diseases among other tigers in the zoo. Copyright © 2016 Elsevier B.V. All rights reserved.

  3. Plasma cortisol levels in captive wild felines after chemical restraint

    Directory of Open Access Journals (Sweden)

    Nogueira G.P.

    1997-01-01

    Full Text Available Eight Panthera onca (Po, 13 Felis concolor (Fc, 7 Felis yagouaroundi (Fy, 7 Felis tigrina (Ft and 5 Felis pardalis (Fp specimens from São Paulo State zoos were used. All animals were restrained with darts containing 10 mg/kg ketamine and 1 mg/kg xylazine. Venous blood samples were collected as soon as possible (within 15-20 min and serum was frozen until the time for cortisol quantification. Cortisol was determined using a solid phase radioimmunoassay with an intra-assay coefficient of 8.51%. Data were analyzed statistically by the Kruskal-Wallis test, followed by Dunn's multiple comparisons test, and the one-sample t-test, with the level of significance set at P<0.05. Data are reported as means ± SEM. Cortisol levels differed among the captive felines: Po = 166 ± 33a, Fc = 670 ± 118b, Fy = 480 ± 83b, Ft = 237 ± 42ab, Fp = 97 ± 12a nmol/l (values followed by different superscript letters were significantly different (P<0.001. Since most of the veterinary procedures on these species involve chemical restraint, these results show the necessity of preventive measures in order to minimize the effect of restraint stress on more susceptible species

  4. Survey of cardiac pathologies in captive striped skunks (Mephitis mephitis).

    Science.gov (United States)

    Benato, Livia; Wack, Allison; Cerveny, Shannon N S; Rosenthal, Steven L; Bronson, Ellen

    2014-06-01

    Cardiac disease is a common finding in small mammals but it is rarely reported in striped skunks (Mephitis mephitis). The aim of this survey was to evaluate the prevalence of cardiac disease in striped skunks and to characterize the types of cardiac disease that might be present. In April 2010, a questionnaire was sent to veterinarians in zoologic collections with membership in the International Species Inventory System. Surveys were distributed to 55 institutions in the United States, Canada, and Europe. Twenty collections with a total of 95 skunks replied to the questionnaire. Of these, five collections reported at least one skunk with cardiac conditions for a total of 11 cases. In these 11 animals, the following conditions were diagnosed: myocardial fibrosis (n = 4), myxomatous valve degeneration (n = 4), hypertrophic cardiomyopathy (n = 1), dilated cardiomyopathy (n = 1), and valvular endocarditis (n = 1). Based on these findings, cardiac diseases should be considered as part of the differential diagnosis in captive striped skunks presenting with weakness, lethargy, and decreased appetite. Cardiac ultrasound also should be considered at the time of annual health examinations to evaluate for possible cardiac conditions at an early stage.

  5. Oviduct adenocarcinoma in some species of captive snakes.

    Science.gov (United States)

    Pereira, M E; Viner, T C

    2008-09-01

    This article reports 5 cases of oviduct adenocarcinoma in adult captive snakes from Smithsonian's National Zoological Park. This neoplasm was found in 1 of each of the following species: emerald tree boa (Corallus caninus), Amazonian tree boa (Corallus enydris enydris), Burmese rock python (Python molurus bivittatus), Northern pine snake (Pituophis melanoleucus melanoleucus), and corn snake (Elaphe guttata). Grossly, tan to red firm masses were found within oviducts in 3 cases. In an additional 2 cases, the primary tumor was detected only histologically. Microscopically, neoplasms were papillary, and often extended transmurally. The neoplastic cells were polygonal and organized in acini or cords, with often abundant fibrovascular stroma. Hemorrhages and necrosis were present in all cases. Inflammation, myxomatous material, desmoplasia, and bacteria were often observed. Histologic evidence of metastasis was present in all cases. Solid metastases were seen in all animals except the Northern pine snake and involved several organs including the liver, lung, and heart. Emboli of neoplastic cells were observed in all animals but the Burmese rock python and corn snake.

  6. Consecutive spawnings of Chinese amphioxus, Branchiostoma belcheri, in captivity.

    Directory of Open Access Journals (Sweden)

    Guang Li

    Full Text Available Cephalochordate amphioxus is a promising model animal for studying the evolutionary and developmental mechanisms of vertebrates because its unique phylogenetic position, simple body plan and sequenced genome. However, one major drawback for using amphioxus as a model organism is the restricted supply of living embryos since they are available only during spawning season that varies from a couple of days to several months according to species. Therefore we are aiming to develop methods for obtaining viable amphioxus embryos in non-spawning season. In the current study, we found that Branchiostoma belcheri could develop their gonads and spawn consecutively in the laboratory when cultured in a low density at a high temperature (25-28 °C supplied with sufficient food and proper cleanness. Among the approximate 150 observed animals, which spawned spontaneously between November and December 2011, 10% have spawned twice, 10% three times, and 80% four times, through April 2012. The quality and quantity of the gametes reproduced in the consecutive spawning have no obvious difference with those spawned once naturally. Spawning intervals varied dramatically both among different animals (from 1 to 5 months and between intervals of a single individual (from 27 to 74 days for one animal. In summary, we developed a method with which, for the first time, consecutive spawnings of amphioxus in captivity can be achieved. This has practical implications for the cultivation of other amphioxus species, and eventually will greatly promote the utilization of amphioxus as a model system.

  7. Experimental Mycoplasma gallisepticum infections in captive-reared wild turkeys

    Science.gov (United States)

    Rocke, Tonie E.; Yuill, Thomas M.; Amundson, Terry E.

    1988-01-01

    The effects of Mycoplasma gallisepticum (MG) infections on egg production, fertility, and hatchability were studied in captive-reared wild turkeys (Meleagris gallopavo). Three groups of adult birds, each consisting of four hens and two toms, were exposed to MG by the respiratory route at the beginning of their breeding season. Fourteen control birds received sterile growth medium. Although no mortality of infected or control birds occurred, egg production during the first breeding season after infection was reduced. The mean number of eggs/hen/day produced by infected groups the first breeding season postexposure (PE) was significantly lower than the control value. The mean number of eggs produced daily by the same hens 1 yr later was unaffected by MG infection. The pecentage of fertile eggs produced by infected groups was slightly reduced in both the first and second breeding seasons PE. Hatchability of fertile eggs from infected hens was significantly lower than eggs from control hens. Productivity may be impaired if MG infections occur in free-ranging wild turkey populations.

  8. Behavioural Profiles of Brown and Sloth Bears in Captivity.

    Science.gov (United States)

    Pastorino, Giovanni Quintavalle; Christodoulides, Yiannis; Curone, Giulio; Pearce-Kelly, Paul; Faustini, Massimo; Albertini, Mariangela; Preziosi, Richard; Mazzola, Silvia Michela

    2017-05-13

    Three brown bear ( Ursus arctos arctos ) individuals and two sloth bear ( Melursus ursinus inornatus ) individuals were observed in captivity to produce behavioural profiles for each individual. Data collected through behavioural observations were used to produce activity budgets, and to identify space usage and certain aspects of social behavior. Behaviour monitoring allowed the researchers to evaluate the welfare of the animals by identifying the occurrence of stereotypic behaviours, which are sometimes associated with stress. Behavioural profiles were created using data obtained through behavioural observations (coding) and keeper questionnaires (rating). The behavioural observations indicated a number of stereotypic behaviours in sloth bears but not in brown bears. The uniformity of zone usage was calculated to investigate if the enclosure size and features were adequate for use, and a social aspect of otherwise solitary animals was also identified. The behavioural profiles generated through coding and rating were compared to determine the reliability between these two methods in Ursids. Profiles were not compared between individuals since this study is not a comparison between different personality types but rather an effort (one of the few ones existing in literature) to select a valid and reproducible methodology capable of assessing personality in bears.

  9. Tuberculosis in captive Asian elephants (Elephas maximus) in Peninsular Malaysia.

    Science.gov (United States)

    Ong, B L; Ngeow, Y F; Razak, M F A Abdul; Yakubu, Y; Zakaria, Z; Mutalib, A R; Hassan, L; Ng, H F; Verasahib, K

    2013-07-01

    A cross-sectional study was conducted from 10 January to 9 April 2012, to determine the seroprevalence of tuberculosis (TB) of all captive Asian elephants and their handlers in six locations in Peninsular Malaysia. In addition, trunk-wash samples were examined for tubercle bacillus by culture and polymerase chain reaction (PCR). For 63 elephants and 149 elephant handlers, TB seroprevalence was estimated at 20.4% and 24.8%, respectively. From 151 trunkwash samples, 24 acid-fast isolates were obtained, 23 of which were identified by hsp65-based sequencing as non-tuberculous mycobacteria. The Mycobacterium tuberculosis-specific PCR was positive in the trunk-wash samples from three elephants which were also seropositive. Conversely, the trunk wash from seven seropositive elephants were PCR negative. Hence, there was evidence of active and latent TB in the elephants and the high seroprevalence in the elephants and their handlers suggests frequent, close contact, two-way transmission between animals and humans within confined workplaces.

  10. THE IMPACT OF RENEWABLE ENERGY SUBVENTION ON THE CAPTIVE CONSUMER

    Directory of Open Access Journals (Sweden)

    PALIU – POPA LUCIA

    2016-10-01

    Full Text Available In the context of the European Union policy in the energy field on promoting the development of new and renewable energy forms, the Community legislation on the promotion of renewable sources had a significant development in the recent years. Thus, alternative fossil fuels (geothermal energy, ocean energy, hydropower energy, solar energy, wind energy, biomass and biofuels contribute to the diversification of the supply on energy to reduce the greenhouse gas emissions and reduce the dependence on fossil fuels markets. Moreover, in accordance with the specifications of the Directive 2009/28/EC on energy from renewable sources there has been set as compulsory target the fact that an amount of 20% of the energy consumption of the European Union by 2020, to be derived from the renewable energy sources. In turn, this objective is detailed in the secondary national compulsory targets given the different starting points of Member States. Based on these aspects, in our country, the unsubsidized renewable energy (hydroelectric, together with the photovoltaic, wind and biomass energy represented in the past three years a contribution well above the target assumed by Romania for the year 2020 of total of the produced energy. In this context, this study aims, on the one hand, to emphasize that the subsidized renewable energy to the captive consumers, by increasing the share of green certificates, results in narrowing the market of the classic manufacturers, on the other hand, to account for these securities as due to the existence of subsidies for the operating activities.

  11. Exposure of the endangered golden monkey (Rhinopithecus roxellana) to heavy metals: a comparison of wild and captive animals.

    Science.gov (United States)

    Liu, Qiang; Chen, Yi-Ping; Maltby, Lorraine; Ma, Qing-Yi

    2015-05-01

    Golden monkeys are endemic to China and of high conservation concern. Conservation strategies include captive breeding, but the success of captive breeding programs may be being compromised by environmental pollution. Heavy metal exposure of wild and captive golden monkeys living in the Qinling Mountains was assessed by measuring fecal metal concentrations (As, Cd, Cr, Co, Cu, Mn, Hg, Ni, Pb, and Zn). Captive monkeys were exposed to higher concentrations of As, Hg, Pb, and Cr than monkeys living in the wild, while high background levels of Mn led to high exposure of wild monkeys. Seasonal variations in metal exposures were detected for both wild and captive monkeys; possible reasons being seasonal changes in either diet (wild monkeys) or metal content of food (captive monkeys). Coal combustion, waste incineration, and traffic-related activities were identified as possible sources of heavy metals exposure for captive animals. Efforts to conserve this endangered primate are potentially compromised by metal pollutants derived from increasing anthropogenic activities. Providing captive animals with uncontaminated food and relocating captive breeding centers away from sources of pollution will reduce pollutant exposure; but ultimately, there is a need to improve environmental quality by controlling pollutants at source.

  12. (Reinsurance captives, efficiency and moral hazard. An attractive manner of risk financing and risk management for companies in certain circumstances

    Directory of Open Access Journals (Sweden)

    Wim Weterings

    2014-03-01

    Full Text Available In this study the contribution is intended to provide more clarity and to demonstrate that under certain circumstances an insurance captive can have important efficiency effects and, among other things, a positive effect on moral hazard and adverse selection. For the purpose of acquiring more information on insurance captives and their operation, literature research was augmented by interviews conducted with the director of an insurance captive of a Dutch multinational, as well as with representatives from AON and Marsh, two major insurance brokers/consultancy firms in risk management that are often involved in the establishment and management of a captive

  13. Large-scale genetic survey provides insights into the captive management and reintroduction of giant pandas.

    Science.gov (United States)

    Shan, Lei; Hu, Yibo; Zhu, Lifeng; Yan, Li; Wang, Chengdong; Li, Desheng; Jin, Xuelin; Zhang, Chenglin; Wei, Fuwen

    2014-10-01

    The captive genetic management of threatened species strives to preserve genetic diversity and avoid inbreeding to ensure populations remain available, healthy, and viable for future reintroduction. Determining and responding to the genetic status of captive populations is therefore paramount to these programs. Here, we genotyped 19 microsatellite loci for 240 captive giant pandas (Ailuropoda melanoleuca) (∼64% of the captive population) from four breeding centers, Wolong (WL), Chengdu (CD), Louguantai (LGT), and Beijing (BJ), and analyzed 655 bp of mitochondrial DNA control region sequence for 220 of these animals. High levels of genetic diversity and low levels of inbreeding were estimated in the breeding centers, indicating that the captive population is genetically healthy and deliberate further genetic input from wild animals is unnecessary. However, the LGT population faces a higher risk of inbreeding, and significant genetic structure was detected among breeding centers, with LGT-CD and WL-BJ clustering separately. Based on these findings, we highlight that: 1) the LGT population should be managed as an independent captive population to resemble the genetic distinctness of their Qinling Mountain origins; 2) exchange between CD and WL should be encouraged because of similar wild founder sources; 3) the selection of captive individuals for reintroduction should consider their geographic origin, genetic background, and genetic contribution to wild populations; and 4) combining our molecular genetic data with existing pedigree data will better guide giant panda breeding and further reduce inbreeding into the future. © The Author 2014. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  14. Variability of Venom-Neutralizing Properties of Serum from Snakes of the Colubrid Genus Lampropeltis

    Science.gov (United States)

    1992-01-01

    chick in the terciopelo Bothrops asper venom by blood se- zootoxicologic studies on venoms. Copeia 1959: rum of the colubnd snake Cletie dIeia. Toxicon 20...effect of Bothrops jararaca and faded rattlesnake (Crotalus viridis concolor) venom: Waglerophis merremii snake plasma on the coagu- lethal toxicity and

  15. Snake mortality associated with late season radio-transmitter implantation

    Science.gov (United States)

    D. Craig Rudolph; Shirley J. Burgdorf; Richard R. Schaefer; Richard N. Conner; Robert T. Zappalorth

    1998-01-01

    Radio-telemetry is an increasingly used procedure to obtain data on the biology of free-living snakes (Reinert 1992, 1994). In Texas and Louisiana we have been using the surgical technique of Weatherhead and Anderka (1984) to implant transmitters in timber rattlesnakes (Crotalus horridus) and Louisiana pine snakes (Pituophis melanoleucus...

  16. Tucannon River Spring Chinook Salmon Captive Brood Program, FY 2000 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Bumgarner, Joseph D.; Gallinat, Michael P.

    2001-06-01

    This report summarizes the objectives, tasks, and accomplishments of the Tucannon River spring chinook captive brood program from program inception (1997) through April 2001. The WDFW initiated a captive broodstock program in 1997. The overall goal of the Tucannon River captive broodstock program is for the short-term, and eventually long-term, rebuilding of the Tucannon River spring chinook salmon run, with the hope that natural production will eventually sustain itself. The project goal is to rear captive salmon to adults, spawn them, rear their progeny, and release approximately 150,000 smolts annually into the Tucannon River between 2003-2007. These smolt releases, in combination with the current hatchery supplementation program (132,000 smolts), and wild production, is expected to produce 600-700 returning adult spring chinook to the Tucannon River each year from 2005-2010. The Master Plan, Environmental Assessment, and most facility modifications at LFH were completed for the Tucannon River spring chinook captive broodstock program during FY2000 and FY2001. DNA samples collected since 1997 have been sent to the WDFW genetics lab in Olympia for baseline DNA analysis. Results from the genetic analysis are not available at this time. The captive broodstock program is planned to collect fish from five (1997-2001) brood years (BY). The captive broodstock program was initiated with 1997 BY juveniles, and the 2000 BY fish have been selected. As of April 30, 2001, WDFW has 172 BY 1997, 262 BY 1998, 407 BY 1999, and approximately 1,190 BY 2000 fish on hand at LFH. Twelve of 13 mature 97 BY females were spawned in 2000. Total eggtake was 14,813. Mean fecundity was 1,298 eggs/female based on 11 fully spawned females. Egg survival to eye-up was 47.3%. This low survival was expected for three year old captive broodstock females. As of April 30, 2001, WDFW has 4,211 captive broodstock progeny on hand. These fish will be tagged with blank wire tag without fin clips and

  17. Tucannon River spring chinook salmon captive brood program, FY 2000 annual report; ANNUAL

    International Nuclear Information System (INIS)

    Bumgarner, Joseph D.; Gallinat, Michael P.

    2001-01-01

    This report summarizes the objectives, tasks, and accomplishments of the Tucannon River spring chinook captive brood program from program inception (1997) through April 2001. The WDFW initiated a captive broodstock program in 1997. The overall goal of the Tucannon River captive broodstock program is for the short-term, and eventually long-term, rebuilding of the Tucannon River spring chinook salmon run, with the hope that natural production will eventually sustain itself. The project goal is to rear captive salmon to adults, spawn them, rear their progeny, and release approximately 150,000 smolts annually into the Tucannon River between 2003-2007. These smolt releases, in combination with the current hatchery supplementation program (132,000 smolts), and wild production, is expected to produce 600-700 returning adult spring chinook to the Tucannon River each year from 2005-2010. The Master Plan, Environmental Assessment, and most facility modifications at LFH were completed for the Tucannon River spring chinook captive broodstock program during FY2000 and FY2001. DNA samples collected since 1997 have been sent to the WDFW genetics lab in Olympia for baseline DNA analysis. Results from the genetic analysis are not available at this time. The captive broodstock program is planned to collect fish from five (1997-2001) brood years (BY). The captive broodstock program was initiated with 1997 BY juveniles, and the 2000 BY fish have been selected. As of April 30, 2001, WDFW has 172 BY 1997, 262 BY 1998, 407 BY 1999, and approximately 1,190 BY 2000 fish on hand at LFH. Twelve of 13 mature 97 BY females were spawned in 2000. Total eggtake was 14,813. Mean fecundity was 1,298 eggs/female based on 11 fully spawned females. Egg survival to eye-up was 47.3%. This low survival was expected for three year old captive broodstock females. As of April 30, 2001, WDFW has 4,211 captive broodstock progeny on hand. These fish will be tagged with blank wire tag without fin clips and

  18. Steroid excretion during the ovarian cycle in captive and wild muriquis, Brachyteles arachnoides.

    Science.gov (United States)

    Ziegler, T E; Santos, C V; Pissinatti, A; Strier, K B

    1997-01-01

    Urine, feces, and copulation frequency were collected from two captive muriqui females, Brachyteles arachnoides, at the Centro de Primatologia do Rio de Janeiro following the resumption of postpartum ovarian cycles. Fecal steroid profiles from seven wild muriqui females at the Estação Biologica de Caratinga, Minas Gerais, Brazil, were compared to the captive females to determine the approximate patterns of steroid excretion relative to the urinary LH peak. Hormonal profiles from one of the captive female muriquis revealed a discrete urinary LH peak. For this female, fecal progesterone increased on the same day as the urinary LH peak, while fecal estradiol increased 6 days later and urinary steroids increased 5 days later. For both captive females, the onset of fecal progesterone increase was preceded by the onset of copulations, which occurred during at least a 5-day period. The complete fecal hormonal profiles of the one captive female for which continuos data were available were similar to those found in wild muriqui monkeys, with the onset of an increase in sustained progesterone levels occurring several days prior to the onset of sustained estradiol increase. These patterns suggest that fecal progesterone may be excreted rapidly in this species. The onset of sustained increase in fecal progesterone levels, together with the consistent delay in the onset of the sustained increase in estradiol, may provide the best indicators of the periovulatory period for muriqui females.

  19. Research on Captive Broodstock Technology for Pacific Salmon, 1995 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Swanson, Penny; Pascho, Ronald; Hershberger, William K. (Northwest and Alaska Fisheries Center, Coastal Zone and Estuarine Studies Division, Seattle, WA)

    1996-01-01

    This report summarizes research on captive broodstock technologies conducted during 1995 under Bonneville Power Administration Project 93-56. Investigations were conducted by the National Marine Fisheries Service (NMFS) in cooperation with the US Fish and Wildlife Service, University of Washington, and Northwest Biological Science Center (US Geological Survey). Studies encompassed several categories of research, including fish husbandry, reproductive physiology, immunology, pathology, nutrition, and genetics. Captive broodstock programs are being developed and implemented to aid recovery of endangered Pacific salmon stocks. Like salmon hatchery programs, however, captive broodstock programs are not without problems and risks to natural salmon populations. The research projects described in this report were developed in part based on a literature review, Assessment of the Status of Captive Broodstock Technology for Pacific Salmon. The work was divided into three major research areas: (1) research on sockeye salmon; (2) research on spring chinook salmon; and (3) research on quantitative genetic problems associated with captive broodstock programs. Investigations of nutrition, reproductive physiology, fish husbandry, and fish health were integrated into the research on sockeye and spring chinook salmon. A description of each investigation and its major findings and conclusions is presented.

  20. HEMATOLOGY AND PLASMA CHEMISTRY OF THE PLOUGHSHARE TORTOISE (ASTROCHELYS YNIPHORA) IN A CAPTIVE BREEDING PROGRAM.

    Science.gov (United States)

    López, Javier; Waters, Michael; Routh, Andrew; Rakotonanahary, Tsanta F; Woolaver, Lance; Thomasson, Ann; Holmes, Emma; Steinmetz, Hanspeter W

    2017-03-01

    Blood samples from 172 captive and 40 wild, healthy, juvenile and adult, ploughshare tortoises ( Astrochelys yniphora ) were analyzed to determine hematological and biochemical reference intervals. Hematological analytes included packed cell volume (PCV), white blood cell count (WBC), and WBC differential estimates. Biochemical analysis included total protein measured by photometry (TP) and by refractometry (TPr), albumin (ALB), creatine kinase (CK), aspartate aminotransferase (AST), glutamate dehydrogenase (GLDH), bile acids (BA), calcium (Ca), phosphorus (P), urea (UREA), and uric acid (UA). The jugular vein was identified as the preferred venipuncture site as subcarapacial vein venipuncture resulted in regular hemodilution. In due consideration of small sample sizes in some of the groups studied, adult tortoises had significantly higher plasma GLDH activity and TPr, TP, ALB, BA, and UREA concentrations and significantly lower AST activity and P concentration than juveniles. Captivity had a significant influence in some reference intervals, with captive adults presenting significantly higher WBC, and estimated counts of all white cell types as well as UREA and TPr than wild counterparts. Captive juveniles also showed significantly higher estimated monocyte and lower estimated eosinophil and basophil counts. Although these differences most likely reflect local environmental or dietary differences, without representing pathology or a deviation from the normal, they question the applicability of reference values from captive animals to wild animals and vice versa. Significant sex differences were only observed for PCV and UA. The reported reference intervals may serve as benchmarks for clinical assessment and conservation of this critically endangered species.

  1. Serum biochemistry of captive and free-ranging gray wolves (Canis lupus)

    Science.gov (United States)

    Constable, Peter; Hinchcliff, Ken; Demma, Nick; Callahan, Margaret; Dale, B.W.; Fox, Kevin; Adams, Layne G.; Wack, Ray; Kramer, Lynn

    1998-01-01

    Normal serum biochemistry values are frequently obtained from studies of captive sedentary (zoo) or free-ranging (wild) animals. It is frequently assumed that values from these two populations are directly referable to each other. We tested this assumption using 20 captive gray wolves (Canis lupus) in Minnesota, USA, and 11 free-ranging gray wolves in Alaska, USA. Free-ranging wolves had significantly (P<0.05) lower sodium, chloride, and creatine concentrations and significantly higher potassium and blood urea nitrogen (BUN) concentrations; BUN to creatine ratios; and alanine aminotransferase, aspartate aminotransferase, and creatine kinase activities relative to captive wolves. Corticosteroid-induced alkaline phosphatase activity (a marker of stress in domestic dogs) was detected in 3 of 11 free-ranging wolves and in 0 of 20 captive wolves (P = 0.037). This study provides clear evidence that serum biochemical differences can exist between captive and free-ranging populations of one species. Accordingly, evaluation of the health status of an animal should incorporate an understanding of the potential confounding effect that nutrition, activity level, and environmental stress could have on the factor(s) being measured.

  2. Rapid loss of antipredatory behaviour in captive-bred birds is linked to current avian invasions.

    Science.gov (United States)

    Carrete, Martina; Tella, José L

    2015-12-15

    Despite the importance of behaviour in conservation biology, there have been few studies that address behaviour in areas such as invasion ecology. There is an urgent need to identify specific traits that facilitate the establishment and spread of alien species to prevent biological invasions and their impact on biodiversity. Changes in antipredatory behaviour in captivity have been proposed to explain the higher invasiveness of wild-caught exotic species. We experimentally tested this hypothesis by assessing the response of wild-caught and captive-bred cage birds facing an approaching predator and their ability to escape from human capture, using species available in the Spanish pet market. Results showed the loss of antipredatory responses and escape abilities in captive-bred birds compared with wild-caught ones. An intraspecific comparison between wild-caught and the first generation of captive-bred birds pointed to a rapid behavioural loss in captivity (individual lifetime) rather than to differences among species (evolutionary exposure). In the context of current avian invasions, the proportion of individuals showing antipredatory responses within a species was positively related to the likelihood of the species being found escaped and breeding in the wild. These results offer a link between behaviour, fitness, and the invasion syndrome in birds.

  3. Stress, captivity, and reproduction in a wild bird species.

    Science.gov (United States)

    Dickens, Molly J; Bentley, George E

    2014-09-01

    In seasonal species, glucocorticoid concentrations are often highest during the breeding season. However, the role of increased hypothalamic-pituitary-adrenal (HPA) activity in the regulation of reproduction remains poorly understood. Our study is the first, to our knowledge, to document reproductive consequences of a non-pharmacological hindrance to seasonal HPA fluctuations. Using wild-caught male and female European starlings (Sturnus vulgaris) housed in an outdoor, semi-natural environment, we divided birds into two mixed-sex groups. One group remained in the outdoor aviary, where starlings breed at the appropriate time of year. The other group was transferred into an indoor flight aviary, where we predicted reproductive suppression to occur. We measured changes in corticosterone (CORT) at baseline and stress-induced concentrations prior to group separation and at the experiment's conclusion. After ten days, the birds showed remarkable differences in breeding behavior and HPA activity. Outdoor birds exhibited increases in baseline and stress-induced CORT and progressed into active breeding (pairing, nest building, egg laying, etc.). In contrast, indoor birds displayed no change in baseline or stress-induced CORT and few signs of active breeding. We found significant sex and treatment effects on expression of HPA and hypothalamic-pituitary-gonadal (HPG) axis elements, suggesting sex-specific regulatory mechanisms. Our data suggest a novel, facilitating role for the HPA axis in the transition between early breeding and active breeding in a wild, seasonal avian species. In addition, understanding how changes in housing condition affect seasonal HPA fluctuations may help alleviate barriers to breeding wild animals in captivity. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. Resting behaviors of captive bottlenose dolphins (Tursiops truncatus).

    Science.gov (United States)

    Sekiguchi, Yuske; Kohshima, Shiro

    2003-09-01

    In order to specify the resting behaviors in captive bottlenose dolphin, we quantitatively analyzed behavior of 16 dolphins in three aquariums in Japan. We observed their behaviors in the low-activity time (0 a.m.-3 a.m.), assuming that the resting behaviors would be most prominent and abundant at this time. We analyzed these behaviors based on the data of their diurnal activity rhythm that we have clarified by measuring swimming speed and breath frequency. The behavior patterns characteristic to the low-activity time could be categorized into the following three types: "bottom-rest" characterized by long immobile stay on the tank bottom, "surface-rest" characterized by long immobile stay at the water surface, and "swim-rest" characterized by slow circle-swim near the bottom along a fixed trajectory. During these behaviors, breath frequency was significantly lower than the daily mean and at least one eye tended to be closed. These three behaviors accounted for 86.6% of the total observation time in the low-activity time. The resting behaviors were often observed even in the high-activity time (0 p.m.-4 p.m.); these three behaviors accounted for 38.5% of the total observation time in the high-activity time. In swim-rest, frequency of sound emission was significantly lower than that of other behaviors with high-speed swimming, and both eyes or one eye, especially the eye facing the inner side of the swimming circle tended to be closed. The eye condition and the periodical change of circle-swim direction or position-exchange observed during swim-rest suggest a relation between this behavior and unihemispheric sleep. The change in the resting behavior observed in the dolphins under nervous situations suggests that the dolphins flexibly change the type and the quantity of the resting behaviors according to the situation.

  5. Third-party grooming in a captive chimpanzee group.

    Science.gov (United States)

    Russell, Yvan I

    2010-01-01

    Social grooming is ubiquitous among the captive chimpanzees at Chester Zoo. Seven individuals were chosen here for a study of third-party social dynamics. The grooming decisions of five adult males were analysed, but only insofar as they directed attention to a mother-daughter pair. Uniquely, the daughter was an unpopular and physically disabled subadult whose congenital motor impairments prevented her from grooming others effectively. The impetus for this study was the observation that some males increased their grooming towards the disabled daughter during days when the mother had a tumescent anogenital swelling (sexually attractive to males) compared to days when the mother was not tumescent (less attractive). Apparently, males were grooming the daughter with no possibility of payback (because the daughter could never "return the favour"). A "grooming rate" (avg. grooming time/hour) was calculated that showed the grooming efforts of all five males towards both mother and daughter. These rates were compared on days when (1) the mother's anogenital swelling was tumescent, and (2) days when the swelling was not tumescent. Each male showed a different pattern of behaviour. Two males groomed the daughter significantly more when the mother was tumescent. Results for all males were graphed against the quality of the social relationship between each male and the mother. Apparently, only males that had a weaker relationship to the mother groomed the daughter more when the mother was tumescent. This pattern did not exist for males with a stronger relationship to the mother. Possibly, the insecure males were using the disabled daughter as a way to curry favour with the attractive mother. If this is confirmed, then this type of triadic situation is a possible setting for indirect reciprocity to occur.

  6. Microplastic Contamination of Wild and Captive Flathead Grey Mullet (Mugil cephalus

    Directory of Open Access Journals (Sweden)

    Lewis T. O. Cheung

    2018-03-01

    Full Text Available A total of 60 flathead grey mullets were examined for microplastic ingestion. Thirty wild mullets were captured from the eastern coast of Hong Kong and 30 captive mullets were obtained from fish farms. Microplastic ingestion was detected in 60% of the wild mullets, with an average of 4.3 plastic items per mullet, while only 16.7% of captive mullets were found to have ingested microplastics, with an average of 0.2 items per mullet. The results suggested that wild mullets have a higher risk of microplastic ingestion than their captive counterparts. The most common plastic items were fibres that were green in colour and small in size (<2 mm. Polypropylene was the most common polymer (42%, followed by polyethylene (25%. In addition, the abundance of microplastics was positively correlated with larger body size among the mullets.

  7. Snake River Sockeye Salmon Captive Broodstock Program : Hatchery Element : Annual Progress Report, 2000.

    Energy Technology Data Exchange (ETDEWEB)

    Kline, Paul A.; Willard, Catherine

    2001-04-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and the National Marine Fisheries Service initiated efforts to conserve and rebuild populations in Idaho. Initial steps to recover sockeye salmon included the establishment of a captive broodstock program at the Idaho Department of Fish and Game Eagle Fish Hatchery. Sockeye salmon broodstock and culture responsibilities are shared with the National Marine Fisheries Service at two locations adjacent to Puget Sound in Washington State. Activities conducted by the Shoshone-Bannock Tribes and the National Marine Fisheries Service are reported under separate cover. Idaho Department of Fish and Game monitoring and evaluation activities of captive broodstock program fish releases are also reported under separate cover. Captive broodstock program activities conducted between January 1, 2000 and December 31, 2000 are presented in this report.

  8. Relationship between gastrointestinal transit time and anesthetic fasting protocols in the captive chimpanzee, Pan troglodytes.

    Science.gov (United States)

    Ardente, A; Chinnadurai, S; De Voe, R; Stringer, E; Webb, T; Ireland, J; Saker, K

    2011-06-01

    Lengthy social separation and prolonged fasting time contribute to increased risks associated with anesthesia in captive primates. This study is an initial attempt to identify a safe pre-anesthetic fasting procedure by identifying gastric emptying time (GET) and gastrointestinal transit time (GTT) of captive chimpanzees, Pan troglodytes. Seven adult chimpanzees at the North Carolina Zoo immobilized for annual physical examinations were fed barium-impregnated polyethylene spheres to measure GET. Eleven animals were individually fed a color dye marker and fecal passage was observed to determine GTT. Gastric emptying time (GET) was approximated to be >3 hours but fasting time of 3 hours would allow for complete gastric emptying and could potentially replace the current overnight fast (≥16 hour) to help minimize complications associated with pre-anesthetic fasting in captive primates. © 2011 John Wiley & Sons A/S.

  9. Lessons from a non-domestic canid: joint disease in captive raccoon dogs (Nyctereutes procyonoides

    Directory of Open Access Journals (Sweden)

    Dennis F. Lawler

    2012-12-01

    Full Text Available The purpose of this study was to describe pathological changes of the shoulder, elbow, hip and stifle joints of 16 museum skeletons of the raccoon dog (Nyctereutes procyonoides. The subjects had been held in long-term captivity and were probably used for fur farming or research, thus allowing sufficient longevity for joint disease to become recognisable. The prevalence of disorders that include osteochondrosis, osteoarthritis and changes compatible with hip dysplasia, was surprisingly high. Other changes that reflect near-normal or mild pathological conditions, including prominent articular margins and mild bony periarticular rim, were also prevalent. Our data form a basis for comparing joint pathology of captive raccoon dogs with other mammals and also suggest that contributing roles of captivity and genetic predisposition should be explored further in non-domestic canids.

  10. Nutrition of the captive western lowland gorilla (Gorilla gorilla gorilla): a dietary survey.

    Science.gov (United States)

    Smith, B K; Remis, M J; Dierenfeld, E S

    2014-01-01

    The successful management of captive animals requires attention to multiple interconnected factors. One critical aspect of the daily life of a captive animal is the recommended and/or provisioned diet. This study focuses on the diets of zoo-housed gorillas. A national survey of diets among zoo-housed gorillas was conducted to examine diets being offered to captive gorillas in the United States and Canada. This survey serves as a follow-up to a 1995 dietary survey of zoo-housed gorillas and goes further to quantify nutritional profiles at responding institutions. Results are encouraging, as zoos have made clear improvements in dietary nutrient profiles offered over the past 15 years. However, we suggest that zoological and sanctuary institutions follow Gorilla Species Survival Plan (SSP) recommendations and work to continuously improve diets provided, which could improve gorillas' health and well-being. © 2014 Wiley Periodicals, Inc.

  11. Tucannon River Spring Chinook Salmon Captive Broodstock Program, Annual Report 2002.

    Energy Technology Data Exchange (ETDEWEB)

    Gallinat, Michael; Varney, Michelle

    2003-05-01

    This report summarizes the objectives, tasks, and accomplishments of the Tucannon River Spring Chinook Captive Broodstock Program during 2002. The WDFW initiated a captive broodstock program in 1997. The overall goal of the Tucannon River captive broodstock program is for the short-term, and eventually long-term, rebuilding of the Tucannon River spring chinook salmon run, with the hope that natural production will sustain itself. The project goal is to rear captive salmon selected from the supplementation program to adults, spawn them, rear their progeny, and release approximately 150,000 smolts annually into the Tucannon River between 2003-2007. These smolt releases, in combination with the current hatchery supplementation program (132,000 smolts) and wild production, are expected to produce 600-700 returning adult spring chinook to the Tucannon River each year from 2005-2010. The captive broodstock program collected fish from five (1997-2001) brood years (BY). As of January 1, 2003, WDFW has approximately 11 BY 1998, 194 BY 1999, 314 BY 2000, 447 BY 2001, and 300 BY 2002 (for extra males) fish on hand at LFH. The 2002 eggtake from the 1997 brood year (Age 5) was 13,176 eggs from 10 ripe females. Egg survival was 22%. Mean fecundity based on the 5 fully spawned females was 1,803 eggs/female. The 2002 eggtake from the 1998 brood year (Age 4) was 143,709 eggs from 93 ripe females. Egg survival was 29%. Mean fecundity based on the 81 fully spawned females was 1,650 eggs/female. The 2002 eggtake from the 1999 brood year (Age 3) was 19,659 eggs from 18 ripe females. Egg survival was 55%. Mean fecundity based on the 18 fully spawned fish was 1,092 eggs/female. The total 2002 eggtake from the captive brood program was 176,544 eggs. A total of 120,833 dead eggs (68%) were removed with 55,711 live eggs remaining for the program. As of May 1, 2003 we had 46,417 BY 2002 captive brood progeny on hand A total of 20,592 excess BY 01 fish were marked as parr (AD/CWT) and

  12. A retrospective study of end-stage renal disease in captive polar bears (Ursus maritimus).

    Science.gov (United States)

    LaDouceur, Elise E B; Davis, Barbara; Tseng, Flo

    2014-03-01

    This retrospective study summarizes 11 cases of end-stage renal disease (ESRD) in captive polar bears (Ursus maritimus) from eight zoologic institutions across the United States and Canada. Ten bears were female, one was male, and the mean age at the time of death was 24 yr old. The most common clinical signs were lethargy, inappetence, and polyuria-polydipsia. Biochemical findings included azotemia, anemia, hyperphosphatemia, and isosthenuria. Histologic examination commonly showed glomerulonephropathies and interstitial fibrosis. Based on submissions to a private diagnostic institution over a 16-yr period, ESRD was the most commonly diagnosed cause of death or euthanasia in captive polar bears in the United States, with an estimated prevalence of over 20%. Further research is needed to discern the etiology of this apparently common disease of captive polar bears.

  13. Two distinct mtDNA lineages among captive African penguins in Japan.

    Science.gov (United States)

    Murata, Michiko; Murakami, Masaru

    2014-04-01

    The African penguin (Spheniscus demersus) is one of the world's most endangered seabirds. In Japan, although the number of African penguins in captivity continues to increase, genetic data have not been collected for either wild or captive populations. To reveal genetic diversity and characterization in captive African penguins, we analyzed the nucleotide sequences of mitochondrial DNA (mtDNA) from a sample of 236 African penguins. Analysis of 433 bp of the control region and 1,140 bp of cytochrome b sequences revealed the existence of two mtDNA clades. Control region haplotypes were much more divergent (d=3.39%) between the two clades than within each clade. The divergence of these clades may reflect differences at the subspecies or geographical population level in African penguins. These findings suggest that at least two distinct maternal lineages exist in the wild populations of the African penguin.

  14. Snake River sockeye salmon captive broodstock program: hatchery element: annual progress report, 2000.; ANNUAL

    International Nuclear Information System (INIS)

    Kline, Paul A.; Willard, Catherine

    2001-01-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and the National Marine Fisheries Service initiated efforts to conserve and rebuild populations in Idaho. Initial steps to recover sockeye salmon included the establishment of a captive broodstock program at the Idaho Department of Fish and Game Eagle Fish Hatchery. Sockeye salmon broodstock and culture responsibilities are shared with the National Marine Fisheries Service at two locations adjacent to Puget Sound in Washington State. Activities conducted by the Shoshone-Bannock Tribes and the National Marine Fisheries Service are reported under separate cover. Idaho Department of Fish and Game monitoring and evaluation activities of captive broodstock program fish releases are also reported under separate cover. Captive broodstock program activities conducted between January 1, 2000 and December 31, 2000 are presented in this report

  15. Dietary choices by four captive slender lorises (Loris tardigradus) when presented with various insect life stages.

    Science.gov (United States)

    Clayton, Jonathan B; Glander, Kenneth E

    2011-01-01

    The slender loris (Loris tardigradus) is a rare, nocturnal prosimian found only in the tropical rainforest of southern India and Sri Lanka. Little is known about their diet, though it is assumed that insects comprise a majority of their wild diet. Based on this assumption, captive lorises are offered a variety of insects or insect life stages; the species of insect or the life stage is often determined by what is easiest to buy or rear. Captive lorises at the Duke Lemur Center (DLC) were offered the opportunity to choose which life stage of mealworms (Tenebrio molito), superworms (Zophobus morio), or waxworms (Galleria mellonella) they preferred. The DLC captive lorises did not select the largest life stages of any insect offered. They preferred the larvae stage to the adult stage in all three insect species, and males and females had different insect species and life stage preferences. © 2010 Wiley-Liss, Inc.

  16. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1993 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    1994-11-01

    The National Marine Fisheries Service (NMFS), in cooperation with Idaho and BPA, has established captive broodstocks to aid recovery of endangered Snake River sockeye salmon. NMFS is currently maintaining four separate Redfish Lake sockeye Salmon captive broodstocks; all these broodstocks are being reared full-term to maturity in fresh (well) water. Experiments are also being conducted on nonendangered 1990 and 1991-brood Lake Wenatchee (WA) sockeye salmon to compare effects on survival and reproduction to maturity in fresh water and seawater; for both brood-years, fish reared in fresh water were larger than those reared in seawater. Data from captive rearing experiments suggest a ranking priority of circular tanks supplied with pathogen-free fresh water, circular tanks supplied with pumped/filtered/uv-sterilized seawater, and seawater net-pens for rearing sockeye salmon to maturity.

  17. Extrinsic factors significantly affect patterns of disease in free-ranging and captive cheetah (Acinonyx jubatus) populations.

    Science.gov (United States)

    Munson, Linda; Terio, Karen A; Worley, Michael; Jago, Mark; Bagot-Smith, Arthur; Marker, Laurie

    2005-07-01

    The cheetah (Acinonyx jubatus) has been considered a paradigm for disease vulnerability due to loss of genetic diversity. This species monomorphism has been suspected to be the basis for their general poor health and dwindling populations in captivity. North American and South African captive populations have high prevalences of hepatic veno-occlusive disease, glomerulosclerosis, gastritis, and systemic amyloidosis, diseases that are rare in other species. Unusually severe inflammatory reactions to common infectious agents have also been documented in captive cheetahs. The current study compared disease prevalences in free-ranging Namibian cheetahs with those in two captive populations of similar ages. The occurrence of diseases in the free-ranging population was determined from 49 necropsies and 27 gastric biopsies obtained between 1986 and 2003 and compared with prevalences in 147 North American and 80 South African captive cheetahs. Except for two cheetahs, the free-ranging population was in robust health with only mild lesions present, in contrast with significantly higher prevalences in the captive populations. Despite widespread heavy Helicobacter colonization in wild cheetahs, only 3% of the free-ranging population had moderate to severe gastritis, in contrast with 64% of captive cheetahs. No severe inflammatory reactions to viral infections were detected in the free-ranging animals. Because free-ranging Namibian cheetahs are as genetically impoverished as captive cheetahs, these findings caution against attributing loss of fitness solely to genetic factors and attest to the fundamental importance of extrinsic factors in wildlife health.

  18. Non-invasive assessment of reproductive status and stress in captive Asian elephants in three south Indian zoos.

    Science.gov (United States)

    Kumar, Vinod; Palugulla Reddy, Vivekananda; Kokkiligadda, Adiseshu; Shivaji, Sisinthy; Umapathy, Govindhaswamy

    2014-05-15

    Asian elephants in captivity need immediate attention to be bred so as to meet the increasing demand for captive elephants and to overcome the dependence on supplementing the captive stock with wild animals. Unfortunately, captive breeding programs across the globe have met with limited success and therefore more effort is needed to improve breeding in captivity. Endocrine profiling of reproductive hormones (progestagens and androgens) and the stress hormone (glucocorticoids) could facilitate better management and breeding strategies. In the present study, we investigated reproductive and stress physiology of 12 captive Asian elephants for 10-27 months using a non-invasive method based on steroid analysis of 1700 elephant dung samples. Most of the elephants were cycling regularly. Males during musth showed increased fecal androgen metabolite concentrations and exhibited a slight increase in fecal glucocorticoid metabolite levels. Elephants used in public festivals and processions showed significantly increased in faecal glucocorticoid metabolite levels. The results indicate that captive elephants require periodic health care, better husbandry practices and scientific management for sustainable captive population. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. Maintaining rear-fanged snakes for venom production: an evaluation of mortality and survival rates for Philodryas olfersii and P. patagoniensis in captivity

    OpenAIRE

    Braz, HB; Rocha, MMT; Furtado, MFD

    2012-01-01

    This study evaluates the mortality and average survival rates of captive female Philodryas olfersii and Philodryas patagoniensis snakes maintained for venom production. Also, two factors likely to reduce captive survival were studied - body condition at admission and seasonality. Mortality peaks occurred during the second month in captivity. More than half the individuals were dead at the end of the third month. This suggests that the first three months in captivity are the most critical in t...

  20. Assessing welfare of individual sirenians in the wild and in captivity

    Science.gov (United States)

    Flint, Mark; Bonde, Robert K.

    2017-01-01

    Assessing the welfare of wild populations of sirenians has required a “generalist” approach. The outcome has been a subjective decision as to whether what the observers are witnessing in an individual or group of animals is normal and whether that has positive or negative consequences. The understanding of sirenian welfare requirements, and a decision process for whether to support and maintain their natural habitats or to try to replicate it in a meaningful way in an artificial captive setting, is still in its early developmental stages and has dynamic qualities that are in need of urgent attention. In this chapter we use the knowledge and observations presented throughout the chapters on sirenians to outline a proposed standard approach for assessing welfare in individuals in wild populations, as well as guidelines for assessing captive groups of dugongs and manatees. In the wild, the suitability of the habitat and human impact on it, the limitations of carrying capacity, the dynamics of ecosystems, and the effects that the immediate environment will have on the known resident populations are examined. In captivity, we use the foundation of the Five Freedoms, based on experience derived from other captive species, and we combine this with experience from rehabilitating manatees in Europe and the United States and, more recently, dugongs in the Indo-Pacific, to identify requirements and to help us to assess the unique needs of these species when held in facilities. We present considerations and approaches to (1) holistically assess captive facilities and to assess the well-being of the individuals held in the facility, (2) derive a guideline for standard captive assessment, (3) determine if adequate welfare needs for the animals are being met, and (4) help to provide guidance on whether an animal is suitable for release after rehabilitation.

  1. Causes and correlates of calf mortality in captive Asian elephants (Elephas maximus.

    Directory of Open Access Journals (Sweden)

    Khyne U Mar

    Full Text Available Juvenile mortality is a key factor influencing population growth rate in density-independent, predation-free, well-managed captive populations. Currently at least a quarter of all Asian elephants live in captivity, but both the wild and captive populations are unsustainable with the present fertility and calf mortality rates. Despite the need for detailed data on calf mortality to manage effectively populations and to minimize the need for capture from the wild, very little is known of the causes and correlates of calf mortality in Asian elephants. Here we use the world's largest multigenerational demographic dataset on a semi-captive population of Asian elephants compiled from timber camps in Myanmar to investigate the survival of calves (n = 1020 to age five born to captive-born mothers (n = 391 between 1960 and 1999. Mortality risk varied significantly across different ages and was higher for males at any age. Maternal reproductive history was associated with large differences in both stillbirth and liveborn mortality risk: first-time mothers had a higher risk of calf loss as did mothers producing another calf soon (<3.7 years after a previous birth, and when giving birth at older age. Stillbirth (4% and pre-weaning mortality (25.6% were considerably lower than those reported for zoo elephants and used in published population viability analyses. A large proportion of deaths were caused by accidents and lack of maternal milk/calf weakness which both might be partly preventable by supplementary feeding of mothers and calves and work reduction of high-risk mothers. Our results on Myanmar timber elephants with an extensive keeping system provide an important comparison to compromised survivorship reported in zoo elephants. They have implications for improving captive working elephant management systems in range countries and for refining population viability analyses with realistic parameter values in order to predict future population

  2. Effect of captivity on genetic variance for five traits in the large milkweed bug (Oncopeltus fasciatus).

    Science.gov (United States)

    Rodríguez-Clark, K M

    2004-07-01

    Understanding the changes in genetic variance which may occur as populations move from nature into captivity has been considered important when populations in captivity are used as models of wild ones. However, the inherent significance of these changes has not previously been appreciated in a conservation context: are the methods aimed at founding captive populations with gene diversity representative of natural populations likely also to capture representative quantitative genetic variation? Here, I investigate changes in heritability and a less traditional measure, evolvability, between nature and captivity for the large milkweed bug, Oncopeltus fasciatus, to address this question. Founders were collected from a 100-km transect across the north-eastern US, and five traits (wing colour, pronotum colour, wing length, early fecundity and later fecundity) were recorded for founders and for their offspring during two generations in captivity. Analyses reveal significant heritable variation for some life history and morphological traits in both environments, with comparable absolute levels of evolvability across all traits (0-30%). Randomization tests show that while changes in heritability and total phenotypic variance were highly variable, additive genetic variance and evolvability remained stable across the environmental transition in the three morphological traits (changing 1-2% or less), while they declined significantly in the two life-history traits (5-8%). Although it is unclear whether the declines were due to selection or gene-by-environment interactions (or both), such declines do not appear inevitable: captive populations with small numbers of founders may contain substantial amounts of the evolvability found in nature, at least for some traits.

  3. Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

    2003-03-01

    Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2001.

  4. Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Program, 2000 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

    2003-03-01

    Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2000.

  5. Salmonella serovars and antimicrobial resistance in strains isolated from wild animals in captivity in Sinaloa, Mexico.

    Science.gov (United States)

    Silva-Hidalgo, Gabriela; López-Valenzuela, Martin; Juárez-Barranco, Felipe; Montiel-Vázquez, Edith; Valenzuela-Sánchez, Beatriz

    2014-08-01

    The aim of the present study was to evaluate the frequency of antibiotic resistance in Salmonella spp. strains from wild animals in captivity at the Culiacan Zoo and the Mazatlan Aquarium in Sinaloa, Mexico. We identified 17 different Salmonella enterica serovars at a prevalence of 19.90% (Culiacan Zoo) and 6.25% (Mazatlan Aquarium). Antibiotic sensitivity tests revealed that, of the 83 strains studied, 100% were multidrug resistant (MDR). The drugs against which the greatest resistance was observed were: penicillin, erythromycin, dicloxacillin, ampicillin, cephalothin, and chloramphenicol. We therefore conclude that MDR is common among Salmonella isolates originating from wild animals in captivity in Sinaloa.

  6. Estabilidad de la actividad neutralizante del antiveneno ofídico conservado a 4°C y a 16°C contra el veneno de Cascabel (Crotalus durissus cumanensis de Colombia

    Directory of Open Access Journals (Sweden)

    Jaime Ramírez

    1995-12-01

    Full Text Available Se determinó la actividad neutralizante de la letalidad de varios lotes de antiveneno polivalente (no liofilizado, producidos por el Instituto Nacional de Salud, los cuales fueron retados contra una mezcla de venenos de cascabel (Crotalus durissus cumanensis de Colombia. Se compara la actividad de los diferentes lotes almacenados en oscuridad a las temperaturas de 4°C y 16°C. Se estableció el porcentaje remanente de la potencia de cada lote para cada temperatura en los diferentes años a lo largo del período del estudio. Se concluye que el antiveneno almacenando en las condiciones recomendadas, mantiene casi la totalidad de la capacidad de neutralización (97.9% luego de tres años de almacenamiento, lo quecorresponde a lafechade expiración del producto. En cambio, el antiveneno almacenado a 16°C y oscuridad, luego de dos años de almacenamiento, mantiene el 87.9% de su capacidad protectora contra veneno de cascabel, protección similara la encontrada bajo las mismas condiciones de almacenamiento, paraveneno de Taya X, pasados dos años de almacenamiento (l, sustentando la recomendación de descartar el producto, transcurridos dos años de almacenamiento en estas condiciones.

  7. Dietary and faecal iron levels in captive black-and-white ruffed lemurs (Varecia variegata)

    OpenAIRE

    Caravaggi, Anthony; Bishop, Charles

    2016-01-01

    A poster derived from an undergraduate study of iron in captive ruffed lemur diets. The project was supported by the British and Irish Association of Zoos and Aquaria. Presented at the 11th BIAZA Research Symposium, Blackpool Zoo, 2009.

  8. Surviving the "School of Slavery": Acculturation in Sharon Draper's "Copper Sun" and Joyce Hansen's "The Captive"

    Science.gov (United States)

    Chandler, Karen Michele

    2016-01-01

    Although children's literature has long alluded to cultural connections between Africans and African Americans, very few texts establish clear lines of influence between particular African ethnic groups and African American characters and communities. Joyce Hansen's "The Captive" (1994) and Sharon Draper's "Copper Sun" (2006)…

  9. Cecal bacterial communities in wild Japanese rock ptarmigans and captive Svalbard rock ptarmigans.

    Science.gov (United States)

    Ushida, Kazunari; Segawa, Takahiro; Tsuchida, Sayaka; Murata, Koichi

    2016-02-01

    Preservation of indigenous gastrointestinal microbiota is deemed to be critical for successful captive breeding of endangered wild animals, yet its biology is poorly understood. Here, we investigated cecal bacterial communities in wild Japanese rock ptarmigans (Lagopus muta japonica) and compared them with those in Svalbard rock ptarmigans (L. m. hyperborea) in captivity. Ultra-deep sequencing of 16S rRNA gene indicated that the community structure of cecal microbiota in wild rock ptarmigans was remarkably different from that in captive Svalbard rock ptarmigans. Fundamental differences between bacterial communities in the two groups of birds were detected at the phylum level. Firmicutes, Actinobacteria, Bacteroidetes and Synergistetes were the major phyla detected in wild Japanese rock ptarmigans, whereas Firmicutes alone occupied more than 80% of abundance in captive Svalbard rock ptarmigans. Furthermore, unclassified genera of Coriobacteriaceae, Synergistaceae, Bacteroidaceae, Actinomycetaceae, Veillonellaceae and Clostridiales were the major taxa detected in wild individuals, whereas in zoo-reared birds, major genera were Ruminococcus, Blautia, Faecalibacterium and Akkermansia. Zoo-reared birds seemed to lack almost all rock ptarmigan-specific bacteria in their intestine, which may explain the relatively high rate of pathogenic infections affecting them. We show evidence that preservation and reconstitution of indigenous cecal microflora are critical for successful ex situ conservation and future re-introduction plan for the Japanese rock ptarmigan.

  10. Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2003 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hoffnagle, Timothy L.; Hair, Don; Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

    2004-07-01

    BPA Fish and Wildlife Program Project Number 1998-01-001 provides funding for the Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Program. This report satisfies the requirement that an annual report be submitted for FY 2003. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, these fish are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation. This report covers activities conducted and provides data analyses for the Grande Ronde Spring Chinook Salmon Captive broodstock Program from 1 January--31 December 2003. Since the fiscal year ends in the middle of the spawning period, an annual report based on calendar year is more logical. This document is the FY 2003 annual report. Detailed information on historic and present population status, project background, goals and objectives, significance to regional programs and relationships to other programs, methods and previous results are available in the 1995-2002 Project Status Report (Hoffnagle et al 2003).

  11. Dominance and its behavioral measures in a captive group of bonobos (Pan paniscus)

    NARCIS (Netherlands)

    Vervaecke, H; de Vries, Han; van Elsacker, L

    We investigated the existence of a social dominance hierarchy in the captive group of six adult bonobos at the Planckendael Zoo. We quantified the pattern of dyadic exchange of a number of behaviors to examine to what extent each behavior fits a linear rank order model. Following de Waal (1989), we

  12. Research on Captive Broodstock Programs for Pacific Salmon, 2001-2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry A.; Tezak, E.P. (National Marine Fisheries Service); Endicott, Rick (Long Live the Kings, Seattle, WA)

    2002-08-01

    In the 2000 Federal Columbia River Power System (FCRPS) Biological Opinion, NMFS identified six populations of steelhead and several salmon populations that had dropped to critically low levels and continue to decline. Following thorough risk-benefit analyses, captive propagation programs for some or all of the steelhead (Oncorhynchus mykiss) populations may be required to reduce the risk of extinction, and more programs may be required in the future. Thus, captive propagation programs designed to maintain or rebuild steelhead populations require intensive and rigorous scientific evaluation, much like the other objectives of BPA Project 1993-056-00 currently underway for chinook (O. tshawytscha) and sockeye salmon (O. nerka). Pacific salmon reared to the adult stage in captivity exhibit poor reproductive performance when released to spawn naturally. Poor fin quality and swimming performance, incomplete development of secondary sex characteristics, changes in maturation timing, and other factors may contribute to reduced spawning success. Improving natural reproductive performance is critical for the success of captive broodstock programs in which adult-release is a primary reintroduction strategy for maintaining ESA-listed populations.

  13. Ichthyodinium identified in the eggs of European eel (Anguilla anguilla) spawned in captivity

    DEFF Research Database (Denmark)

    Sørensen, Sune Riis; Tomkiewicz, Jonna; Skovgaard, A.

    2014-01-01

    A presumed parasitic protozoan was found in the eggs of European eel obtained from an experiment on captive breeding of eel, Anguilla anguilla, based on silver eels from a freshwater lake in the northern part of Denmark. Gross morphology of the organism was comparable to that of early stages...

  14. Serum Chemistry Variables of Bengal Tigers (Panthera tigris tigris Kept in Various Forms of Captivity

    Directory of Open Access Journals (Sweden)

    U. Farooq*, S. Sajjad1, M. Anwar1 and B.N. Khan2

    2012-05-01

    Full Text Available There is a dearth of published literature regarding the effect of captivity on serum chemistry variables of tigers kept in the zoos and wildlife sanctuaries. The present study was hence conducted to determine and compare serum chemistry values in tigers of Bengal origin (Panthera tigris tigris kept in captivity at Lahore zoo (LZ (n=4 and in semi natural environment of Lahore Wildlife Park (LWP (n=6, Pakistan. The tigers kept at LZ had significantly (P<0.05 higher mean concentrations of Cl- (108.6±0.57 versus 105.6±0.49 mmol/l and a significantly lower creatinine (1.78±0.06 versus 3.04±0.35mg/dl and AST values (41.66±0.77 versus 54.88±4.22 U/l than tigers kept at LWP. No other significant differences in serum chemistry were observed for both forms of captivity. Results would be useful for the evaluation of physiological and pathological alterations in wild and captive tiger individuals and populations not only in Pakistan but also for other countries harboring the Bengal tigers.

  15. Choanal and cloacal aerobic bacterial flora in captive green iguanas: a comparative analysis

    Directory of Open Access Journals (Sweden)

    Silvia Barazorda Romero

    2015-01-01

    Full Text Available The aims of this study were to characterize the choanal and cloacal aerobic bacterial flora in healthy captive green iguanas and to compare it with the bacterial flora of the biofilm present in the water container of each terrarium. Samples were collected from the choana and the cloaca of 20 healthy captive adult green iguanas and from the biofilm of 15 water containers. The final identification of aerobic bacteria was performed by matrix-assisted laser desorption ionization time-of-flight mass spectrometry. Salmonella positive samples were serotyped. The most common strains observed at each test location were from 1 choanae: Staphylococcus spp., Enterobacter cloacae and Comamonas testosteroni; 2 cloacae: Citrobacter spp., Salmonella spp. and Corynebacterium spp.; and 3 biofilms: Pseudomonas spp., Salmonella spp. and Acidovorax spp. We showed that apart from Salmonella spp., the choanal and cloacal bacterial flora differed from the microorganisms present in the biofilm of the animal’s water container. These data revealed that healthy captive adult green iguanas harbored several aerobic bacterial strains that in immunosuppressed reptiles may act as opportunistic pathogens. Also, several of the aerobic bacteria identified in samples are potential zoonotic agents. Characterization of the normal background flora in captive reptiles and their environment can contribute to an understanding of the spread of bacterial contamination and the risk of potential zoonotic diseases for people in contact with these animals.

  16. Functional Analysis and Treatment of Human-Directed Undesirable Behavior Exhibited by a Captive Chimpanzee

    Science.gov (United States)

    Martin, Allison L.; Bloomsmith, Mollie A.; Kelley, Michael E.; Marr, M. Jackson; Maple, Terry L.

    2011-01-01

    A functional analysis identified the reinforcer maintaining feces throwing and spitting exhibited by a captive adult chimpanzee ("Pan troglodytes"). The implementation of a function-based treatment combining extinction with differential reinforcement of an alternate behavior decreased levels of inappropriate behavior. These findings further…

  17. Tuberculosis surveillance of elephants (Elephas maximus) in Nepal at the captive-wild interface

    Science.gov (United States)

    A comprehensive elephant tuberculosis (TB) survey using culture and four serological screening tests was conducted in Nepal. Private and government-owned male and female captive Asian elephants (Elephas maximus) were included in the study. The mean reported age was 38 years (range 5-60 years). A tot...

  18. Captive insurance: is it the right choice for your insurance exposures?

    Science.gov (United States)

    Frese, Richard C

    2015-12-01

    Potential benefits of a captive insurance company include: Broader coverage Improved cash flow and stability. Direct access to reinsurance markets. Tax advantages. Better handling and control of risk management and claims. Potential drawbacks and challenges include: Startup capitalization. Underwriting losses. Administration and commitment.

  19. Molecular identification of Enterocytozoon bieneusi, Cryptosporidium, and Giardia in brazilian captive birds

    Science.gov (United States)

    A total of 85 fecal samples from captive birds collected from October 2013 to September 2014 in Uberlândia and Belo Horizonte in the state of Minas Gerais (Brazil) were evaluated for the presence of Enterocytozoon bieneusi, Cryptosporidium, and Giardia by PCR. Of these, 3 birds were found positive f...

  20. Wasted efforts: why captivity is not the best way to conserve species ...

    African Journals Online (AJOL)

    Conservation strategies of Malagasy turtles and tortoises are based principally on the captive - breeding of these species, with the ultimate aim of their possible reintroduction in the wild. Given the current precarious conservation status of endemic Malagasy turtle and tortoise species, it is clear that this approach has been a ...

  1. Comparative Serum Fatty Acid Profiles of Captive and Free-Ranging Cheetahs (Acinonyx jubatus) in Namibia.

    Science.gov (United States)

    Tordiffe, Adrian S W; Wachter, Bettina; Heinrich, Sonja K; Reyers, Fred; Mienie, Lodewyk J

    2016-01-01

    Cheetahs (Acinonyx jubatus) are highly specialised large felids, currently listed as vulnerable on the IUCN red data list. In captivity, they are known to suffer from a range of chronic non-infectious diseases. Although low heterozygosity and the stress of captivity have been suggested as possible causal factors, recent studies have started to focus on the contribution of potential dietary factors in the pathogenesis of these diseases. Fatty acids are an important component of the diet, not only providing a source of metabolisable energy, but serving other important functions in hormone production, cellular signalling as well as providing structural components in biological membranes. To develop a better understanding of lipid metabolism in cheetahs, we compared the total serum fatty acid profiles of 35 captive cheetahs to those of 43 free-ranging individuals in Namibia using gas chromatography-mass spectrometry. The unsaturated fatty acid concentrations differed most remarkably between the groups, with all of the polyunsaturated and monounsaturated fatty acids, except arachidonic acid and hypogeic acid, detected at significantly lower concentrations in the serum of the free-ranging animals. The influence of age and sex on the individual fatty acid concentrations was less notable. This study represents the first evaluation of the serum fatty acids of free-ranging cheetahs, providing critical information on the normal fatty acid profiles of free-living, healthy individuals of this species. The results raise several important questions about the potential impact of dietary fatty acid composition on the health of cheetahs in captivity.

  2. 78 FR 79659 - Chronic Wasting Disease Herd Certification Program and Interstate Movement of Farmed or Captive...

    Science.gov (United States)

    2013-12-31

    ... to be susceptible to CWD via natural routes of transmission include Rocky Mountain elk, mule deer...] Chronic Wasting Disease Herd Certification Program and Interstate Movement of Farmed or Captive Deer, Elk... effectively administered. Owners of deer, elk, and moose herds who choose to participate in the approved State...

  3. Isospora bocamontensis (Protozoa: Apicomplexa in captive yellow cardinal Gubernatrix cristata (Passeriformes: Emberezidae

    Directory of Open Access Journals (Sweden)

    Larissa Quinto Pereira

    2013-03-01

    Full Text Available The yellow cardinal (Gubernatrix cristata is a passerine found in southern Brazil, especially along the border with Uruguay and Argentina. It is an endangered species and its population is decreasing. Among the parasites that affect passerines, the genus Isospora is the most easily found in both captive and free-living birds. This parasite commonly causes injury to the intestinal tissue and could occasionally affect other organs. In this work we examined the occurrence of coccidiosis in captive yellow cardinals and its association with factors such as sex, use of parasiticides, type of enclosure, contact with feces, type of food and cleaning frequency. We collected fecal samples of 45 yellow cardinals, healthy and kept in captivity, in late afternoon at the end of the reproductive period. The examination showed parasitic infection by Isospora bocamontensis in 44.5% of the birds. This infection is not influenced by the sex of birds, but is significantly affected by the type of enclosure, contact with the feces, use of parasiticides, type of food and cleaning frequency. The results indicate that to keep yellow cardinals captive, these factors must be observed.

  4. Feeding and growth in a captive-born bottlenose dolphin Tursiops ...

    African Journals Online (AJOL)

    The feeding and growth of a captive-born bottlenose dolphin Tursiops trunatus calf were studied for 30 months post partum. Changes in the behaviours associated with suckling were monitored and suggested that the mammary glands need tactile stimulation before the calf can feed. The calf exhibited no teat preference ...

  5. SIVdrl detection in captive mandrills: are mandrills infected with a third strain of simian immunodeficiency virus?

    NARCIS (Netherlands)

    A.C. van der Kuyl (Antoinette); R. van den Burg (Remco); M.J. Hoyer (Mark); R.A. Gruters (Rob); A.D.M.E. Osterhaus (Albert); B. Berkhout (Ben)

    2004-01-01

    textabstractA pol-fragment of simian immunodeficiency virus (SIV) that is highly related to SIVdrl-pol from drill monkeys (Mandrillus leucophaeus) was detected in two mandrills (Mandrillus sphinx) from Amsterdam Zoo. These captivity-born mandrills had never been in contact with drill monkeys, and

  6. Variation in koala microbiomes within and between individuals: effect of body region and captivity status.

    Science.gov (United States)

    Alfano, Niccoló; Courtiol, Alexandre; Vielgrader, Hanna; Timms, Peter; Roca, Alfred L; Greenwood, Alex D

    2015-05-11

    Metagenomic analysis of 16S ribosomal RNA has been used to profile microbial communities at high resolution, and to examine their association with host diet or diseases. We examined the oral and gut microbiome composition of two captive koalas to determine whether bacterial communities are unusual in this species, given that their diet consists almost exclusively of Eucalyptus leaves. Despite a highly specialized diet, koala oral and gut microbiomes were similar in composition to the microbiomes from the same body regions of other mammals. Rectal swabs contained all of the diversity present in faecal samples, along with additional taxa, suggesting that faecal bacterial communities may merely subsample the gut bacterial diversity. Furthermore, the faecal microbiomes of the captive koalas were similar to those reported for wild koalas, suggesting that captivity may not compromise koala microbial health. Since koalas frequently suffer from ocular diseases caused by Chlamydia infection, we also examined the eye microbiome composition of two captive koalas, establishing the healthy baseline for this body part. The eye microbial community was very diverse, similar to other mammalian ocular microbiomes but with an unusually high representation of bacteria from the family Phyllobacteriaceae.

  7. Patterns of testicular activity in captive and wild Canada lynx (Lynx canadensis)

    Science.gov (United States)

    Kerry Fanson; Nadja C. Wielebnowski; Tanya M. Shenk; Walter J. Jakubas; John R. Squires; Jeffrey R. Lucas

    2010-01-01

    Canada lynx are listed as a threatened species in the contiguous US. Understanding the reproductive characteristics (i.e., mating system, behavior, physiology) of a species is useful for ensuring effective in situ and ex situ management plans. The goal of this study was to describe patterns of androgen expression in both captive and wild male Canada lynx using...

  8. Prey selection of a captive Oystercatcher Haematopus ostralegus hammering Mussels Mytilus edulis from the ventral side

    NARCIS (Netherlands)

    Ens, Bruno J.; Alting, D

    1996-01-01

    We studied prey choice of a captive Oystercatcher:hat hammered Mussels from the ventral side. The results replicate previous findings that ventral hammerers select Mussels of intermediate size, select against thick-shelled Mussels, abandon an increasing proportion of Mussels with increasing size and

  9. Activity patterns of Myosorex varius and M. Cafer in captivity | Baxter ...

    African Journals Online (AJOL)

    The circadian rhythms of captive Myosorex varius and M. cafer (Insectivora: Soricidae) were investigated. Both were predominantly nocturnal, M. varius being active for 4% of the day and 34% of the night, while comparable figures for M. cafer were 11% and 37% respectively. The mean level of daily activity in both forms was ...

  10. Patterns of ovarian and luteal activity in captive and wild Canada lynx (Lynx canadensis)

    Science.gov (United States)

    Kerry V. Fanson; Nadja C. Wielebnowski; Tanya M. Shenk; Jennifer H. Vashon; John R. Squires; Jeffrey R. Lucas

    2010-01-01

    Canada lynx face some unique breeding restrictions, which may have implications for population viability and captive management. The goal of this study was to improve our understanding of basic reproductive physiology in Canada lynx. Using fecal hormone metabolite analysis, we established normative patterns of fecal estrogen (fE) and progestagen (fP)...

  11. Rank and grooming reciprocity among females in a mixed-sex group of captive hamadryas baboons

    NARCIS (Netherlands)

    Leinfelder, I.; Vries, Han de; Deleu, R.; Nelissen, M.

    2001-01-01

    In a mixed-sex, captive group of hamadryas baboons (Papio hamadryas hamadryas) we investigated whether female grooming relationships are affected by their dominance ranks. Seyfarths [1977] grooming for support model and Barrett et al.s [1999] biological market model both predict that in primate

  12. Breeding facilities for polar bears, Thalarctos maritimus (Phipps, 1774), in captivity

    NARCIS (Netherlands)

    Jacobi, E.F.

    1968-01-01

    The breeding results of Polar Bears in captivity are in general very disappointing. Unsuitable maternity dens are the main cause. These should be completely closed, very quiet without outside disturbances and should have connection with a run and thus with an outside enclosure. The female should be

  13. A Literary and Linguistic Analysis of Scott O'Dell's "The Captive".

    Science.gov (United States)

    Stewig, John Warren

    This paper carefully examines the literary elements Scott O'Dell uses in his children's novel "The Captive," that so successfully engage even a reluctant reader. The paper explores the writer's style and subtle use of detail and foreshadowing. Quoting specific examples, the paper points out O'Dell's imaginative syntax and his ability to…

  14. Avian Malaria ( Plasmodium spp.) in Captive Magellanic Penguins ( Spheniscus magellanicus ) from Northern Argentina, 2010.

    Science.gov (United States)

    Vanstreels, Ralph Eric Thijl; Capellino, Félix; Silveira, Patricia; Braga, Érika M; Rodríguez-Heredia, Sergio Andres; Loureiro, Julio; Catão-Dias, José Luiz

    2016-07-01

    We report two cases of lethal avian malaria in Magellanic Penguins (Spheniscus magellanicus) captive at San Clemente del Tuyú, Argentina, approximately 560 km north of Argentinean breeding colonies of Magellanic Penguins. Blood smears revealed both penguins were concurrently infected by Plasmodium (Haemamoeba) tejerai, Plasmodium (Huffia) sp., and Plasmodium (Novyella) sp.

  15. Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

    2003-07-01

    Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.

  16. Combination therapy for footpad lesions in a captive Bengal tiger (Panthera tigris tigris).

    Science.gov (United States)

    Baker, David G

    2002-12-01

    A captive adult male Bengal tiger (Panthera tigris tigris) was treated for chronic footpad ulcers associated with pacing on concrete cage surfaces. Combination therapy of oral fluoxetine and acepromazine administration to diminate pacing behavior, daily application of moisturizing ointment, and oral vitamin E supplementation resulted in complete resolution of all footpad lesions. Subsequent clinical episodes completely resolved with similar treatments.

  17. Blood chemistry, protein electrophoresis, and hematologic values of captive Spanish imperial eagles (Aquila adalberti).

    Science.gov (United States)

    García-Montijano, Marino; García, Alfonso; Lemus, Jesús A; Montesinos, Andrés; Canales, Rocío; Luaces, Inés; Pereira, Pablo

    2002-06-01

    Hemograms and plasma chemistry values are presented for six male and six female, adult, clinically normal, captive Spanish imperial eagles (Aquila adalberti). No value was substantially different from that which might be predicted on the basis of work in other related species. This data should prove useful for the interpretation of laboratory findings in future clinical cases of this endangered species of eagle.

  18. Captive bubble and sessile drop surface characterization of a submerged aquatic plant, Hydrilla verticillata

    Science.gov (United States)

    The surface energy parameters of the invasive aquatic weed, Hydrilla verticillata, were determined using contact angle measurements using two different methods. The abaxial and adaxial surfaces of the leaves and stem were characterized for the weed while submerged in water using captive air and octa...

  19. Functional Analysis and Treatment of Self-Injury in a Captive Olive Baboon

    Science.gov (United States)

    Dorey, Nicole R.; Rosales-Ruiz, Jesoes; Smith, Richard; Lovelace, Bryan

    2009-01-01

    Self-injurious behavior (SIB), such as self-biting and head banging, has been reported to occur in approximately 10% of captive, individually housed nonhuman primates. Accounts of the etiology of SIB in primates range from ecological to physiological. However, to date, no research has examined the possible influence of social consequences…

  20. Management, breeding, and health records from a captive colony of pekin robins (Leiothrix lutea), 2001 - 2010.

    Science.gov (United States)

    da Cruz, Cláudio E F; de Oliveira, Luiz G S; Boabaid, Fabiana M; Zimermann, Francielli C; Stein, Gisele; Marks, Fernanda; Cerva, Cristine; Lieberknecht, Carlos; Canal, Claudio W; Driemeier, David

    2011-09-01

    Pekin robins (Leiothrix lutea) were once the most widely kept softbills in captivity. As a result of the Convention on the International Trade of Endangered Species of Fauna and Flora (CITES-1997), the worldwide trade of wild-caught pekin robins has been prohibited due to the depletion of native populations of this species. In Brazil, as in other countries, pekin robins imported prior to the enactment of the CITES have disappeared from aviaries because the end of the birds' natural life span has passed, and only very few captive-bred pekin robins now exist. While captive propagation fails to address the primary causes of wild bird population decline, it might help the recovery of populations of this species. This article presents records made over a 10-yr period of a captive colony of pekin robins. Emphasis is placed on the management of the flock, the ailments affecting the birds, and the findings associated with bird losses. The main causes of bird losses included rearing management failures and age-related disorders.

  1. Individual differences in the use of social information in foraging by captive great tits

    NARCIS (Netherlands)

    Marchetti, C.M.; Drent, P.J.

    2000-01-01

    We investigated individual differences in copying behaviour of captive great tits, Parus major, by analysing their response to a tutor indicating a new feeding site. We used two groups, each di seven male birds, labelled 'fast' and 'slow' explorers based on previous studies in which consistent

  2. Captivity Shapes the Gut Microbiota of Andean Bears: Insights into Health Surveillance

    Directory of Open Access Journals (Sweden)

    Andrea Borbón-García

    2017-07-01

    Full Text Available The Andean bear is an endemic species of the tropical Andes who has an almost exclusively plant-based diet. Since herbivorous mammals do not carry enzymes for fiber degradation, the establishment of symbiosis with cellulolytic microorganisms in their gastrointestinal (GI tract is necessary to help them fulfill their nutritional needs. Furthermore, as described for other mammals, a stable, diverse, and balanced gut microbial composition is an indicator of a healthy status of the host; under disturbances this balance can be lost, leading to potential diseases of the host. The goal of this study was to describe the gut microbiota of wild and captive Andean bears and determine how habitat status influences the composition and diversity of the gut symbiotic community. Fecal samples from wild (n = 28 and captive (n = 8 Andean bears were collected in “Reserva Pantano de Martos” and “Fundación Bioandina”, Colombia. Composition and diversity analyses were performed using amplicons from the V4 region of the 16S rDNA gene sequenced using the Ion PGM platform. PICRUSt algorithm was applied to predict the gene content of the gut microbiome of wild and captive Andean bears. A total of 5,411 and 838 OTUs were identified for wild and captive bears, respectively. Captive bears contained a lower number of bacterial phyla (n = 7 compared to wild individuals (n = 9. Proteobacteria (59.03% and Firmicutes (14.03% were the phyla that contributed the most to differences between wild and captive bears (overall dissimilarity = 87.72%. At family level, Enterobacteriaceae drove the main differences between the two groups (13.7%. PICRUSt metagenomics predictions suggested a similar pattern of relative abundance of gene families associated with the metabolism of carbohydrates across samples in wild individuals, despite the taxonomic differences of their gut microbiota. Captivity alters the availability and diversity of food resources, which likely reduces microbiota

  3. Treatment of cryptosporidiosis in captive green iguanas (Iguana iguana).

    Science.gov (United States)

    Gałęcki, Remigiusz; Sokół, Rajmund

    2018-03-15

    There are no standard guidelines for the treatment of cryptosporidiosis in reptiles. The aim of this study was to evaluate the efficacy of two cryptosporidiosis therapies in captive green iguanas. Eight green iguanas aged 2-6 years, including 6 (1 ♂ and 5 ♀) animals with chronic diarrhea, received treatment for cryptosporidiosis. The presence of Cryptosporidium sp. oocysts was determined in 8 iguanas (100%), Isospora sp. oocysts were detected in 3 animals (37.5%), and Oxyuridae eggs were observed in 5 iguanas (62.5%). The animals were divided into two therapeutic groups (A and B). Group A iguanas were administered halofuginone (Halocur, 0,50 mg/ml Intervet Productions S.A., France) at a dose of 110 mg/kg body weight (BW) every 7 days for 5 weeks. Group B animals were administered sulfadiazine and trimethoprim (Norodine Vet Oral Paste sulfadiazine 288,3 mg/g, trimethoprim 58 mg/g, ScanVet Animal Health A/S, Denmark) at 75 mg/kg BW per os every 5 days for 5 weeks and spiramycin and metronidazole (Stomorgyl, spiramycin 1500000 IU, metronidazole 250 mg, Merial, France) at 200 mg/kg BW every 5 days for 5 weeks. Both groups received hyperimmune bovine colostrum and subcutaneous fluids. Before treatment, the average number of Cryptosporidium sp. oocysts in 1 g of feces was determined at 1.71 * 10 5 (±313,262.44) in group A and 1.56 * 10 5 (±262,908.53) in group B; the average number of Isospora sp. oocysts was determined at 3.53 * 10 3 (±1747.38), and the average number of Oxyuridae eggs was determined at 810 (±496.74). Blood tests were performed once before treatment. The results of blood morphology and biochemistry tests before treatment revealed leukocytosis with a significant increase in heterophile and monocyte counts in all animals. Dehydration, elevated hematocrit values and low levels of Na + , Ca 2+ , PO 4 - and Cl - ions were observed in 6 iguanas. Two iguanas died during treatment. The gross necropsy revealed acute

  4. Spin Research Vehicle (SRV) in B-52 Captive Flight

    Science.gov (United States)

    1981-01-01

    This in-flight photo of NASA's B-52 mothership shows the bomber carrying a subscale model of an Air Force F-15, a remotely piloted vehicle that was used to conduct spin research. The F-15 Remotely Piloted Research Vehicles (RPRV) was air launched from the B-52 at approximately 45,000 feet and was controlled by a pilot in a ground cockpit complete with flight controls and a television screen. The F-15 model in this particular configuration was known as the Spin Research Vehicle (SRV). NASA B-52, Tail Number 008, is an air launch carrier aircraft, 'mothership,' as well as a research aircraft platform that has been used on a variety of research projects. The aircraft, a 'B' model built in 1952 and first flown on June 11, 1955, is the oldest B-52 in flying status and has been used on some of the most significant research projects in aerospace history. Some of the significant projects supported by B-52 008 include the X-15, the lifting bodies, HiMAT (highly maneuverable aircraft technology), Pegasus, validation of parachute systems developed for the space shuttle program (solid-rocket-booster recovery system and the orbiter drag chute system), and the X-38. The B-52 served as the launch vehicle on 106 X-15 flights and flew a total of 159 captive-carry and launch missions in support of that program from June 1959 to October 1968. Information gained from the highly successful X-15 program contributed to the Mercury, Gemini, and Apollo human spaceflight programs as well as space shuttle development. Between 1966 and 1975, the B-52 served as the launch aircraft for 127 of the 144 wingless lifting body flights. In the 1970s and 1980s, the B-52 was the launch aircraft for several aircraft at what is now the Dryden Flight Research Center, Edwards, California, to study spin-stall, high-angle-of attack, and maneuvering characteristics. These included the 3/8-scale F-15/spin research vehicle (SRV), the HiMAT (Highly Maneuverable Aircraft Technology) research vehicle, and the DAST

  5. Effect of Captive Environment on Plasma Cortisol Level and Behavioral Pattern of Bengal Tigers (Panthera tigris tigris

    Directory of Open Access Journals (Sweden)

    S. Sajjad, U. Farooq1*, M. Anwar, A. Khurshid2 and S.A. Bukhari1

    2011-06-01

    Full Text Available Captive environment in zoological parks often do not provide optimum conditions for natural behaviors due to spatial constraints and negative public reaction. These factors elicit stereotypic behavior in tigers such as pacing, head bobbing and aimless repetition of some movements, and are considered to be an indication of stress. The present study was conducted to assess the effect of captivity on the plasma cortisol level and behavioral pattern in Bengal tigers (Panthera tigris tigris. Tigers kept in captivity at the Lahore zoo (n=4 and in semi natural environment at the Lahore Wildlife Park (n=6 were used for this study, and standard protocols of housing and sampling were observed. The mean plasma cortisol values for the captive animals and those kept in a semi natural environment were 34.48±1.33 and 39.22±3.16µg/dl, respectively; and were statistically non significant. Similarly, no significant difference in the plasma cortisol levels was observed among the individuals within each form of captivity. From the behavioral survey it was observed that the time spent in pacing and resting was much longer for captive animals than animals confined to the semi natural environment. Thus, Technically monitored “Environmental Enrichment’ plans need to be devised which are as close as possible to the natural environment of the captive animals in order to achieve their utmost performance.

  6. Microsatellite variability reveals the necessity for genetic input from wild giant pandas (Ailuropoda melanoleuca) into the captive population.

    Science.gov (United States)

    Shen, Fujun; Zhang, Zhihe; He, Wei; Yue, Bisong; Zhang, Anju; Zhang, Liang; Hou, Rong; Wang, Chengdong; Watanabe, Toshi

    2009-03-01

    Recent success in breeding giant pandas in captivity has encouraged panda conservationists to believe that the ex situ population is ready to serve as a source for supporting the wild population. In this study, we used 11 microsatellite DNA markers to assess the amount and distribution of genetic variability present in the two largest captive populations (Chengdu Research Base of Giant Panda Breeding, Sichuan Province and the China Research and Conservation Center for the Giant Panda at Wolong, Sichuan Province). The data were compared with those samples from wild pandas living in two key giant panda nature reserves (Baoxing Nature Reserve and Wanglang Nature Reserve). The results show that the captive populations have retained lower levels of allelic diversity and heterozygosity compared to isolated wild populations. However, low inbreeding coefficients indicate that captive populations are under careful genetic management. Excessive heterozygosity suggests that the two captive populations have experienced a genetic bottleneck, presumably caused by founder effects. Moreover, evidence of increased genetic divergence demonstrates restricted breeding options within facilities. Based on these results, we conclude that the genetic diversity in the captive populations is not optimal. Introduction of genetic materials from wild pandas and improved exchange of genetic materials among institutions will be necessary for the captive pandas to be representative of the wild populations.

  7. Missile Captive Carry Monitoring and Helicopter Identification Using a Capacitive Microelectromechanical Systems Accelerometer

    Energy Technology Data Exchange (ETDEWEB)

    Hatchell, Brian K.; Mauss, Fredrick J.; Amaya, Ivan A.; Skorpik, James R.; Silvers, Kurt L.; Marotta, Steve

    2012-03-27

    Military missiles are exposed to many sources of mechanical vibration that can affect system reliability, safety, and mission effectiveness. The U. S. Army Aviation and Missile Research Development and Engineering Center (AMRDEC) has been developing missile health monitoring systems to assess and improve reliability, reduce life cycle costs, and increase system readiness. One of the most significant exposures to vibration occurs when the missile is being carried by a helicopter or other aviation platform, which is a condition known as captive carry. Recording the duration of captive carry exposure during the missile’s service life can enable the implementation of predictive maintenance and resource management programs. Since the vibration imparted by each class of helicopter varies in frequency and amplitude, tracking the vibration exposure from each helicopter separately can help quantify the severity and harmonic content of the exposure. Under the direction of AMRDEC staff, engineers at the Pacific Northwest National Laboratory have developed a Captive Carry Health Monitor (CCHM) for the Hellfire II missile. The CCHM is an embedded usage monitoring device installed on the outer skin of the Hellfire II missile to record the cumulative hours the host missile has been in captive carry mode. To classify the vibration by class of helicopter, the CCHM analyzes the amplitude and frequency content of the vibration with the Goertzel algorithm to detect the presence of distinctive rotor harmonics. Cumulative usage data are accessible in theater from an external display; monthly usage histograms are accessible through an internal download connector. This paper provides an overview of the CCHM electrical and package design, describes field testing and data analysis techniques used to monitor captive carry identify and the class of helicopter, and discusses the potential application of missile health and usage data for real-time reliability analysis and fleet management.

  8. Blood lipid concentrations and lipoprotein patterns in captive and wild American black bears (Ursus americanus).

    Science.gov (United States)

    Frank, Nicholas; Elliott, Sarah B; Allin, Shawn B; Ramsay, Edward C

    2006-02-01

    To compare blood lipid concentrations and lipoprotein patterns for captive and wild American black bears (Ursus americanus). 7 captive and 9 wild adult (> or = 4 years old) black bears. Blood was collected from 2 groups of captive black bears (groups A and B) and 1 group of wild black bears (group C). Blood triglyceride (TG) and cholesterol concentrations were compared among groups. Plasma lipoproteins were isolated by use of a self-generating gradient of iodixanol, and lipoprotein patterns were compared between groups A and B. Captive bears (mean +/- SD, 187.8 +/- 44.4 kg) weighed significantly more than wild bears (mean, 104.8 +/- 41.4 kg), but mean body weight did not differ between groups A and B. Mean blood TG concentrations for groups B (216.8 +/- 16.0 mg/dL) and C (190.7 +/- 34.0 mg/dL) were significantly higher than that of group A (103.9 +/- 25.3 mg/dL). Mean blood cholesterol concentration was also significantly higher for group B (227.8 +/- 8.2 mg/dL) than for groups A (171.7 +/- 35.5 mg/dL) or C (190.8 +/- 26.8 mg/dL). Mean very-low-density lipoprotein TG and low-density lipoprotein cholesterol concentrations were 2- and 3-fold higher, respectively, for group B, compared with concentrations for group A. Blood lipid concentrations vary significantly among populations of black bears. Plasma lipoprotein patterns of captive bears differed significantly between colonies and may have reflected differences in diet or management practices.

  9. Prevalence and characteristics of hair plucking in captive bonobos (Pan paniscus) in North American zoos.

    Science.gov (United States)

    Brand, Colin M; Marchant, Linda F

    2018-03-25

    When primates exhibit hair loss and are observed to engage in self or social hair plucking (a rapid jerking away of the hair shaft and follicle by the hand or mouth, often accompanied by inspection, and consumption) the altered appearance, and behavior patterns are thought to reflect individual physiological, and psychological well-being. Hair loss and hair plucking occur in many captive primate species, including all of the great apes. We present the first survey of this behavior among captive bonobos (N = 88; 50 females and 38 males) in seven zoos in the United States. We found that 43% of the population engaged in this behavior pattern and discounting youngsters (who are not observed to hair pluck until the age of five), 58% of individuals hair plucked. Of the individuals who hair plucked, 97% engaged in social plucking, whereas 46% engaged in self-directed plucking. We regressed the occurrence of hair plucking with multiple predictor variables using binary logistic regression and multimodel inference to determine which predictors best explained the prevalence of self-directed and social plucking. We also analyzed publicly available data on hair plucking in captive chimpanzees. We found that the occurrence of another abnormal behavior, age, origin, and pelage condition best explained self-directed plucking in bonobos. Social plucking was explained by age, origin, pelage, and sex. Our analysis of chimpanzee hair plucking revealed that plucking is strongly influenced by rearing and sex. This study demonstrates that hair plucking is more prevalent in captive bonobos compared to captive chimpanzees and gorillas, however, the covariates associated with hair plucking for each species are different. Our data suggest a potential link between self-directed plucking and well-being. However, the higher prevalence and etiology of social hair plucking is more difficult to explain. © 2018 Wiley Periodicals, Inc.

  10. Ejaculate traits in the Namibian cheetah (Acinonyx jubatus): influence of age, season and captivity.

    Science.gov (United States)

    Crosier, Adrienne E; Marker, Laurie; Howard, JoGayle; Pukazhenthi, Budhan S; Henghali, Josephine N; Wildt, David E

    2007-01-01

    The objective was to examine the influence of animal age, season and captivity status on seminal quality in wild-born cheetahs (Acinonyx jubatus) in Namibia, Africa. Animals were divided into three age categories: juvenile (14-24 months; n = 16 males, 23 ejaculates); adult (25-120 months; n = 76 males, 172 ejaculates); and aged (>120 months; n = 5 males, 5 ejaculates). Seasons were categorised into hot-wet (January-April), cold-dry (May-August) and hot-dry (September-December). A comparison between freshly wild-caught (n = 29 males, 41 ejaculates) and captive-held cheetahs (n = 68 males, 159 ejaculates) was also conducted. Raw ejaculates contained 69.0 +/- 1.1% motile spermatozoa (mean +/- s.e.m.) with 73.6 +/- 1.5% of these cells containing an intact acrosome. Overall, 18.4 +/- 0.9% of spermatozoa were morphologically normal, with midpiece anomalies being the most prevalent (approximately 39%) defect. Juvenile cheetahs produced ejaculates with poorer sperm motility, forward progressive status, lower seminal volume and fewer total motile spermatozoa than adult and aged animals. Spermatogenesis continued unabated throughout the year and was minimally influenced by season. Proportions of sperm malformations were also not affected by season. Ejaculates from captive cheetahs had increased volume and intact acrosomes, but lower sperm density than wild-caught counterparts. In summary, Namibian cheetahs produce an extraordinarily high proportion of pleiomorphic spermatozoa regardless of age, season or living (captive versus free-ranging) status. Young males less than 2 years of age produce poorer ejaculate quality than adult and aged males. Because (1) all study animals were wild born and (2) there was little difference between freshly caught males and those maintained in captivity for protracted periods, our results affirm that teratospermia in the cheetah is mostly genetically derived. It also appears that an ex situ environment for the Namibian cheetah can ensure sperm

  11. Snake River Sockeye Salmon Captive Broodstock; Research Element, 1993 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Keith A.

    1995-12-01

    In 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. Initial steps to recover the species include the establishment of captive broodstocks at the Eagle Fish Hatchery in Eagle, Idaho. Research and recovery activities for sockeye conducted by the Idaho Department of Fish and Game during the period of April 1993 to April 1994 are covered by this report. Eight anadromous adults (two female and six male) returned to the Redfish Lake Creek trap this year and were spawned at the Sawtooth Hatchery near Stanley, Idaho. Fecundity was 3160 for each female. The mean fertilization rate was 52% for female {open_quotes}A{close_quotes} and 65% for female {open_quotes}B.{close_quotes} Captive broodstock also spawned as well as residual sockeye captured in a Merwin trap in Redfish Lake. Spawning data from 72 fish spawned during this period is included in this report. Captive broodstock also matured later than normal (winter and spring 1994). Fish were spawned and samples were taken to investigate reasons for poor fertilization rates. Twenty-four out migrants of 1991 were selected for return to Redfish Lake for volitional spawning. Releases were made in August of 1993. All fish were implanted with sonic tags and tracking of this group began soon after the release to identify spawning-related activities. A research project is being conducted on captive broodstock diets. The project will investigate the effect of diet modification on spawn timing, gamete quality, and fertilization rates. A second project used ultrasound to examine fish for sexual maturity. The goal was to obtain a group a fish to be released f or volitional spawning. A total of 44 fish were found to be mature. The performance of all captive groups held at Eagle are included in this report.

  12. A novel holistic framework for genetic-based captive-breeding and reintroduction programs.

    Science.gov (United States)

    Attard, C R M; Möller, L M; Sasaki, M; Hammer, M P; Bice, C M; Brauer, C J; Carvalho, D C; Harris, J O; Beheregaray, L B

    2016-10-01

    Research in reintroduction biology has provided a greater understanding of the often limited success of species reintroductions and highlighted the need for scientifically rigorous approaches in reintroduction programs. We examined the recent genetic-based captive-breeding and reintroduction literature to showcase the underuse of the genetic data gathered. We devised a framework that takes full advantage of the genetic data through assessment of the genetic makeup of populations before (past component of the framework), during (present component), and after (future component) captive-breeding and reintroduction events to understand their conservation potential and maximize their success. We empirically applied our framework to two small fishes: Yarra pygmy perch (Nannoperca obscura) and southern pygmy perch (Nannoperca australis). Each of these species has a locally adapted and geographically isolated lineage that is endemic to the highly threatened lower Murray-Darling Basin in Australia. These two populations were rescued during Australia's recent decade-long Millennium Drought, when their persistence became entirely dependent on captive-breeding and subsequent reintroduction efforts. Using historical demographic analyses, we found differences and similarities between the species in the genetic impacts of past natural and anthropogenic events that occurred in situ, such as European settlement (past component). Subsequently, successful maintenance of genetic diversity in captivity-despite skewed brooder contribution to offspring-was achieved through carefully managed genetic-based breeding (present component). Finally, genetic monitoring revealed the survival and recruitment of released captive-bred offspring in the wild (future component). Our holistic framework often requires no additional data collection to that typically gathered in genetic-based breeding programs, is applicable to a wide range of species, advances the genetic considerations of reintroduction

  13. The incidence and antibiotic resistance of Salmonella species isolated from cloacae of captive veiled chameleons

    Directory of Open Access Journals (Sweden)

    Silvia Barazorda Romero

    2015-01-01

    Full Text Available Salmonella can be present in the intestinal flora of captive reptiles without clinical disease or it can cause life threatening morbidity. The presence of certain species of Salmonella in reptiles is consistent with them being the source of contamination in some cases of human disease. Thus, Salmonella positive animals can be a potential public health concern even more when strains acquire resistance to antibiotics. The nature and extent of Salmonella harboured by different species of reptiles commonly kept in captivity are not known. The aims of this study were to analyse the incidence of Salmonella species in cloacae as an indicator of the intestinal flora in a cohort of healthy captive bred female veiled chameleons. A cloacal sample was taken from each of fifteen healthy captive bred, adult female veiled chameleons that were housed at a teaching and research clinic. Salmonella isolates were confirmed by matrix-assisted laser desorption ionization time-of-flight mass spectrometry and positive cases were serotyped by slide agglutination test. Salmonella organisms were detected in 12 chameleons. Eighty percent of chameleons harboured 1 of 4 subspecies and serovars of Salmonella. All strains belonged to the species enterica, predominantly subspecies enterica (91.7 % and were distributed among 4 different serovars: S. Ago (58.3 %, S. Blijdorp (16.7 %, S. Tennessee (16.7 % and S. IV 45:g,z51:- (8.3 %. Antibiotic resistance to streptomycin was detected in one of 12 Salmonella strains: S. IV 45:g,z51:-. Our study extended the list of Salmonella found in healthy captive animals and included serovars S. Tennessee and S. IV 45:g,z51:- that have been associated with morbidity in humans.

  14. Social and spatial relationships in captive southern white rhinoceros (Ceratotherium simum simum).

    Science.gov (United States)

    Metrione, Lara C; Penfold, Linda M; Waring, George H

    2007-11-01

    Although critical to the conservation of white rhinoceros, captive breeding has proven challenging because of the poor and irregular reproductive health of many captive rhinos, and social interactions may play a significant role. This research investigated the social and spatial relationships of two captive groups of southern white rhinoceros (Ceratotherium simum simum) by examining the frequency of companion changes, the number of space maintenance vocalizations made per hour by each reproductively mature female, and dominant/subordinate interactions. The observed captive rhinos did not change their companionships during the study. They exhibited space maintenance vocalizations and display greater than once per hour, particularly when feeding. Females housed with four calves on 0.033 km(2) exhibited space maintenance vocalizations more frequently (X+/-SE = 6.19+/-0.199/hr) than females housed with one calf and more space (0.06 km(2), X+/-SE = 0.55+/-0.182/hr) and females housed without calves and more space (0.65 km(2), X+/-SE = 1.90+/-0.086/hr). Wider separation of food piles and of females with young calves is suggested to reduce the interpreted spatial stress. The presence of a large number of rhinos in restricted captive space resulted in the formation of herds with dominance hierarchies that were enforced during competition for food and shade. The most subordinate rhino in each of the herds exhibited unusual behaviors such as dung-kicking and nonestrus urine squirting, and neither has ever reproduced. Suppression of subordinate rhinos might lead to social stress that could negatively impact reproductive success. Zoo Biol 26:487-502, 2007. (c) 2007 Wiley-Liss, Inc.

  15. Linking inbreeding effects in captive populations with fitness in the wild: Release of replicated Drosophila melanogaster lines under different temperatures

    DEFF Research Database (Denmark)

    Kristensen, Torsten Nygård; Loeschcke, Volker; Hoffmann, Ary A.

    2008-01-01

    Inbreeding effects have been detected in captive populations of threatened species, but the extent to which these effects translate into fitness under field conditions is mostly unknown. We address this issue by comparing the performance of replicated noninbred and inbred Drosophila lines under...... conditions and involve traits not easily measured under laboratory conditions. More generally, inbreeding effects measured in captive populations may not necessarily predict their field performance, and programs to purge captive populations of deleterious alleles may not necessarily lead to fitness benefits...

  16. Evaluating genetic traceability methods for captive-bred marine fish and their applications in fisheries management and wildlife forensics

    DEFF Research Database (Denmark)

    Bylemans, Jonas; Maes, Gregory E.; Diopere, Eveline

    2016-01-01

    Growing demands for marine fish products is leading to increased pressure on already depleted wild populations and a rise in aquaculture production. Consequently, more captive-bred fish are released into the wild through accidental escape or deliberate releases. The increased mixing of captive......-bred and wild fish may affect the ecological and/or genetic integrity of wild fish populations. Unambiguous identification tools for captive-bred fish will be highly valuable to manage risks (fisheries management) and tracing of escapees and seafood products (wildlife forensics). Using single nucleotide...

  17. Evidence for chronic stress in captive but not free-ranging cheetahs (Acinonyx jubatus) based on adrenal morphology and function.

    Science.gov (United States)

    Terio, Karen A; Marker, Laurie; Munson, Linda

    2004-04-01

    The cheetah (Acinonyx jubatus) is highly endangered because of loss of habitat in the wild and failure to thrive in captivity. Cheetahs in zoos reproduce poorly and have high prevalences of unusual diseases that cause morbidity and mortality. These diseases are rarely observed in free-ranging cheetahs but have been documented in cheetahs that have been captured and held in captive settings either temporarily or permanently. Because captivity may be stressful for this species and stress is suspected as contributing to poor health and reproduction, this study aimed to measure chronic stress by comparing baseline concentrations of fecal corticoid metabolites and adrenal gland morphology between captive and free-ranging cheetahs. Additionally, concentrations of estradiol and testosterone metabolites were quantified to determine whether concentrations of gonadal steroids correlated with corticoid concentration and to assure that corticosteroids in the free-ranging samples were not altered by environmental conditions. Concetntrations of fecal corticoids, estradiol, and testosterone were quantified by radioimmunoassay in 20 free-ranging and 20 captive cheetahs from samples collected between 1994 and 1999. Concentrations of baseline fecal corticoids were significantly higher (p = 0.005) in captive cheetahs (196.08 +/- 36.20 ng/g dry feces) than free-ranging cheetahs (71.40 +/- 14.35 ng/g dry feces). Testosterone concentrations were lower in captive male cheetahs (9.09 +/- 2.84 ng/g dry feces) than in free-ranging cheetahs (34.52 +/- 12.11 ng/g dry feces), which suggests suppression by elevated corticoids in the captive males. Evidence for similar sulppression of estradiol concentrations in females was not present. Adrenal corticomedullary ratios were determined on midsagittal sections of adrenal glands from 13 free-ranging and 13 captive cheetahs obtained between 1991 and 2002. The degree of vacuolation of cortical cells in the zona fasciculata was graded for each animal

  18. Seroprevalence of avian paramyxovirus 1, 2, and 3 in captive and free-living birds of prey in Spain (preliminary results): implications for management of wild and captive populations.

    Science.gov (United States)

    Höfle, Ursula; Blanco, J M; Kaleta, E F

    2002-10-01

    Since December 1997, 700 blood plasma samples from 31 different species of captive and free-living birds of prey from Spain were analyzed by hemagglutination inhibition (HI) test for the presence of antibodies to avian paramyxovirus (aPMV) 1,2, and 3. Out of 700 birds, 120 tested positive for aPMV-1, 10 birds had antibodies to aPMV-2, and 4 birds tested positive against aPMV-3. Prevalence of antibodies against aPMV-1 was significantly higher in captive than in free-living birds of prey and in Falconiformes than in Strigidae and Accipitridae. Infection or exposure in captive birds may be due to the use of avian-derived food in rehabilitation and captive-breeding centers. This may be of concern at the time of reintroduction of these birds into free-living populations.

  19. X-15 Mated to B-52 Captive Flight

    Science.gov (United States)

    1960-01-01

    High-altitude contrails frame the B-52 mothership as it carries the X-15 aloft for a research flight on 13 April 1960 on Air Force Maj. Robert M. White's first X-15 flight. The X-15s were air-launched so that they would have enough rocket fuel to reach their high speed and altitude test points. For this early research flight, the X-15 was equipped with a pair of XLR-11 rocket engines until the XLR-99 was available. The X-15s made a total of 199 flights over a period of nearly 10 years--1959 to 1968--and set unofficial world speed and altitude records of 4,520 mph (Mach 6.7) and 354,200 feet. Information gained from the highly successful X-15 program contributed to the development of the Mercury, Gemini, and Apollo piloted spaceflight programs, and also the Space Shuttle program. NASA B-52, Tail Number 008, is an air launch carrier aircraft, 'mothership,' as well as a research aircraft platform that has been used on a variety of research projects. The aircraft, a 'B' model built in 1952 and first flown on June 11, 1955, is the oldest B-52 in flying status and has been used on some of the most significant research projects in aerospace history. Some of the significant projects supported by B-52 008 include the X-15, the lifting bodies, HiMAT (highly maneuverable aircraft technology), Pegasus, validation of parachute systems developed for the space shuttle program (solid-rocket-booster recovery system and the orbiter drag chute system), and the X-38. The B-52 served as the launch vehicle on 106 X-15 flights and flew a total of 159 captive-carry and launch missions in support of that program from June 1959 to October 1968. Information gained from the highly successful X-15 program contributed to the Mercury, Gemini, and Apollo human spaceflight programs as well as space shuttle development. Between 1966 and 1975, the B-52 served as the launch aircraft for 127 of the 144 wingless lifting body flights. In the 1970s and 1980s, the B-52 was the launch aircraft for several

  20. Ethno-veterinary practices in Southern India for captive Asian elephant ailments.

    Science.gov (United States)

    Jayakumar, Samidurai; Sathiskumar, Selvarasu; Baskaran, Nagarajan; Arumugam, Radjasegarin; Vanitha, Varadhrajan

    2017-03-22

    India has a long tradition of practicing Ayurvedic medicine not only for human ailments, but also for the management of livestock in the form of ethno-veterinary practices. Asian elephant is a significant part of Indian culture, and ethno-veterinary practices have extended to manage and cure various ailments of Asian elephant in captivity. Much of this knowledge has been lost in the light of modern practices. This study is aimed at documenting the existing knowledge on ethno-veterinary medicines practiced by elephant keepers (mahouts) in Tamil Nadu and Puducherry. The study was carried out between June 2015 and February 2016 employing a questionnaire survey among 50 selected informants (mahouts) with traditional knowledge on plants in veterinary medicine. Information was elicited from the informants on various diseases prevailing among captive elephants and the traditional treatment employed by them. In total, the study documented 53 plant species belonging to 29 families being used as medicine for 23 types of ailments prevailing among captive elephants. Ferula assa-foetida, Zingiber officinale, Piper longum, P. nigrum, Cuminum cyminum, Trachyspermum roxburghianum and Carum bulbocastanum were the most commonly used plants either independently or in combination. Among them, Ferula assa-foetida (12.4%) and Zingiber officinale (10.4%) had the highest usage. Of the 23 diseases reported, constipation was the most common ailment (14.6%) followed by bloating (8.7%) and flatulence (8.7%). Documentation of this indigenous knowledge is valuable for the communities concerned, both at present and in future and for scientific consideration for wider use of traditional knowledge in treating captive elephants. The study has identified 53 medicinal plants to treat various ailments among captive elephants in southern India. The most frequently used plants in the captive elephant health care practice are F. assafoetida, Z. officinale, P. longum and P.nigrum. Among the 29 families

  1. Research on Captive Broodstock Programs for Pacific Salmon, 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry A. (National Marine Fisheries Service)

    2005-11-01

    The success of captive broodstock programs depends on high in-culture survival, appropriate development of the reproductive system, and the behavior and survival of cultured salmon after release, either as adults or juveniles. Continuing captive broodstock research designed to improve technology is being conducted to cover all major life history stages of Pacific salmon. Accomplishments detailed in this report and those since the last project review period (FY 2003) are listed below by major objective. Objective 1: (i) Developed tools for monitoring the spawning success of captively reared Chinook salmon that can now be used for evaluating the reintroduction success of ESA-listed captive broodstocks in their natal habitats. (ii) Developed an automated temperature controlled rearing system to test the effects of seawater rearing temperature on reproductive success of Chinook salmon. Objective 2: (i) Determined that Columbia River sockeye salmon imprint at multiple developmental stages and the length of exposure to home water is important for successful imprinting. These results can be utilized for developing successful reintroduction strategies to minimize straying by ESA-listed sockeye salmon. (ii) Developed behavioral and physiological assays for imprinting in sockeye salmon. Objective 3: (i) Developed growth regime to reduce age-two male maturation in spring Chinook salmon, (ii) described reproductive cycle of returning hatchery Snake River spring Chinook salmon relative to captive broodstock, and (iii) found delays in egg development in captive broodstock prior to entry to fresh water. (iv) Determined that loss of Redfish Lake sockeye embryos prior to hatch is largely due to lack of egg fertilization rather than embryonic mortality. Objective 4 : (i) Demonstrated safety and efficacy limits against bacterial kidney disease (BKD) in fall Chinook of attenuated R. salmoninarum vaccine and commercial vaccine Renogen, (ii) improved prophylactic and therapeutic

  2. Snake River Sockeye Salmon Captive Broodstock Program; Research Element, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Willard, Catherine; Hebdon, J. Lance; Castillo, Jason (Idaho Department of Fish and Game, Boise, ID)

    2004-06-01

    On November 20, 1991, the National Oceanic Atmospheric Administration listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Shoshone-Bannock Tribes and Idaho Department of Fish and Game initiated the Snake River Sockeye Salmon Sawtooth Valley Project to conserve and rebuild populations in Idaho. Restoration efforts are focusing on Redfish, Pettit, and Alturas lakes within the Sawtooth Valley. The first release of hatchery-produced juvenile sockeye salmon from the captive broodstock program occurred in 1994. The first anadromous adult returns from the captive broodstock program were recorded in 1999 when six jacks and one jill were captured at IDFG's Sawtooth Fish Hatchery. In 2002, progeny from the captive broodstock program were released using four strategies: age-0 presmolts were released to Alturas, Pettit, and Redfish lakes in August and to Pettit and Redfish lakes in October, age-1 smolts were released to Redfish Lake Creek in May, eyed-eggs were planted in Pettit Lake in December, and hatchery-produced and anadromous adult sockeye salmon were released to Redfish Lake for volitional spawning in September. Oncorhynchus nerka population monitoring was conducted on Redfish, Alturas, and Pettit lakes using a midwater trawl in September 2002. Age-0, age-1, and age-2 O. nerka were captured in Redfish Lake, and population abundance was estimated at 50,204 fish. Age-0, age-1, age-2, and age-3 kokanee were captured in Alturas Lake, and population abundance was estimated at 24,374 fish. Age-2 and age-3 O. nerka were captured in Pettit Lake, and population abundance was estimated at 18,328 fish. The ultimate goal of the Idaho Department of Fish and Game (IDFG) captive broodstock development and evaluation efforts is to recover sockeye salmon runs in Idaho waters. Recovery is defined as reestablishing sockeye salmon runs and providing for utilization of sockeye salmon and kokanee resources by anglers

  3. Hepatic lipidosis and other test findings in two captive adult porcupines (Erethizon dorsatum) dying from a "sudden death syndrome".

    Science.gov (United States)

    Barigye, Robert; Schamber, Ev; Newell, Teresa K; Dyer, Neil W

    2007-11-01

    Routine postmortem examination and histologic evaluation of tissue sections demonstrated hepatic lipidosis (HL) in 2 adult captive porcupines with a history of sudden death. The male porcupine had a markedly enlarged pale liver that microscopically showed large unilocular vacuoles within hepatocellular cytoplasm. The periparturient female had similar but less marked hepatic lesions and an incidental pulmonary mycosis. These findings suggest HL as an important differential of spontaneous death in captive porcupines. It is hypothesized that in addition to the widely documented causes, HL in captive porcupines may be specifically associated with nutritional imbalances caused by the feeding of unsuitable commercial diets. The possible association of the condition with dietary and other factors in captive porcupines needs to be thoroughly investigated.

  4. 50 CFR 23.63 - What factors are considered in making a finding that an animal is bred in captivity?

    Science.gov (United States)

    2010-10-01

    ... INTERNATIONAL TRADE IN ENDANGERED SPECIES OF WILD FAUNA AND FLORA (CITES) Factors Considered in Making Certain... wildlife that was bred in captivity (see §§ 23.41 and 23.46). (b) Definitions. The following terms apply...

  5. GASTROINTESTINAL PARASITES IN CAPTIVE AND FREE-RANGING BIRDS AND POTENTIAL CROSS-TRANSMISSION IN A ZOO ENVIRONMENT.

    Science.gov (United States)

    Carrera-Játiva, Patricio D; Morgan, Eric R; Barrows, Michelle; Wronski, Torsten

    2018-03-01

    Gastrointestinal parasites are commonly reported in wild birds, but transmission amongst avifauna in zoological settings, and between these captive birds and wild birds in surrounding areas, remains poorly understood. A survey was undertaken to investigate the occurrence of gastrointestinal parasites in captive and free-ranging birds at Bristol Zoo Gardens between May and July 2016. A total of 348 fecal samples from 32 avian species were examined using the Mini-FLOTAC flotation method. Parasites were detected in 31% (45/145) of samples from captive birds and in 65.5% (133/203) of samples from free-ranging birds. Parasites of captive individuals included ascarids ( Heterakis spp. and other morphotypes), capillarids, oxyurids, strongyles, a trematode, and protozoans ( Eimeria spp., Isospora spp., Caryospora sp., and Entamoeba spp.). Parasites of free-ranging birds included ascarids ( Ascaridia spp., Porrocaecum spp., and other morphotypes), capillarids, oxyurids, strongyles ( Syngamus spp. and other morphotypes), cestodes ( Choanotaenia spp., Hymenolepis spp., and other morphotypes), a trematode, and protozoans ( Eimeria spp., Isospora spp., Entamoeba spp.). Similar types of parasites were detected in captive and free-ranging birds, but capillarid ova morphology was similar only between closely related species, eg in corvids (captive azure-winged magpies [ Cyanipica cyana] and wild jackdaws [ Corvus monedula]) and between wild columbids (collared doves [ Streptopelia decaocto], rock doves [ Columba livia], and wood pigeons [ Columba palumbus]). The prevalence and intensity of nematodes and coccidia in birds housed outdoors did not differ statistically from species housed indoors. Results indicate that captive and free-ranging birds may share parasites when closely related, but this would need to be confirmed by the study of adult specimens and molecular tests. Determining which parasites are present in captive and free-ranging species in zoological parks will support

  6. Effects of captive environment on Sumatran Tigers (Panthera tigris sumatrae) behaviour Implications of ex-situ conservation

    OpenAIRE

    Gomes, Diana Inês Oliveira

    2018-01-01

    In the past few years, the number of people fighting against the captivity of animals has increased. Many pro-animal organisations fight to close zoos and wildlife parks and ask for the releasing of those animals back into the wild. Wild animals are maintained in zoological facilities for purposes of education, conservation, research and recreation. Although zoos consist of captive environments (that are correlated to behaviour alterations and stereotypical movements), they prove themselves t...

  7. Comparative Study of Reproductive Development in Wild and Captive-Reared Greater Amberjack Seriola dumerili (Risso, 1810.

    Directory of Open Access Journals (Sweden)

    Rosa Zupa

    Full Text Available The greater amberjack Seriola dumerili is a large teleost fish with rapid growth and excellent flesh quality, whose domestication represents an ambitious challenge for aquaculture. The occurrence of reproductive dysfunctions in greater amberjack reared in captivity was investigated by comparing reproductive development of wild and captive-reared individuals. Wild and captive-reared breeders were sampled in the Mediterranean Sea during three different phases of the reproductive cycle: early gametogenesis (EARLY, late April-early May, advanced gametogenesis (ADVANCED, late May-early June and spawning (SPAWNING, late June-July. Fish reproductive state was evaluated using the gonado-somatic index (GSI, histological analysis of the gonads and determination of sex steroid levels in the plasma, and correlated with leptin expression in the liver and gonad biochemical composition. The GSI and sex steroid levels were lower in captive-reared than in wild fish. During the ADVANCED period, when the wild greater amberjack breeders were already in spawning condition, ovaries of captive-reared breeders showed extensive atresia of late vitellogenic oocytes and spermatogenic activity ceased in the testes of half of the examined males. During the SPAWNING period, all captive-reared fish had regressed gonads, while wild breeders still displayed reproductive activity. Liver leptin expression and gonad proximate composition of wild and captive greater amberjack were similar. However, the gonads of captive-reared fish showed different total polar lipid contents, as well as specific lipid classes and fatty acid profiles with respect to wild individuals. This study underlines the need for an improvement in rearing technology for this species, which should include minimum handling during the reproductive season and the formulation of a specific diet to overcome the observed gonadal decrements of phospholipids, DHA (22:6n-3 and ARA (20:4n-6, compared to wild breeders.

  8. The effect of captivity on the skin microbial symbionts in three Atelopus species from the lowlands of Colombia and Ecuador

    Directory of Open Access Journals (Sweden)

    Sandra V. Flechas

    2017-07-01

    Full Text Available Many amphibian species are at risk of extinction in their natural habitats due to the presence of the fungal pathogen Batrachochytrium dendrobatidis (Bd. For the most highly endangered species, captive assurance colonies have been established as an emergency measure to avoid extinction. Experimental research has suggested that symbiotic microorganisms in the skin of amphibians play a key role against Bd. While previous studies have addressed the effects of captivity on the cutaneous bacterial community, it remains poorly studied whether and how captive conditions affect the proportion of beneficial bacteria or their anti-Bd performance on amphibian hosts. In this study we sampled three amphibian species of the highly threatened genus, Atelopus, that remain in the wild but are also part of ex situ breeding programs in Colombia and Ecuador. Our goals were to (1 estimate the diversity of culturable bacterial assemblages in these three species of Atelopus, (2 describe the effect of captivity on the composition of skin microbiota, and (3 examine how captivity affects the bacterial ability to inhibit Bd growth. Using challenge assays we tested each bacterial isolate against Bd, and through sequencing of the 16S rRNA gene, we identified species from thirteen genera of bacteria that inhibited Bd growth. Surprisingly, we did not detect a reduction in skin bacteria diversity in captive frogs. Moreover, we found that frogs in captivity still harbor bacteria with anti-Bd activity. Although the scope of our study is limited to a few species and to the culturable portion of the bacterial community, our results indicate that captive programs do not necessarily change bacterial communities of the toad skins in a way that impedes the control of Bd in case of an eventual reintroduction.

  9. Internatural Activists and the “Blackfish Effect”: Contemplating Captive Orcas’ Protest Rhetoric through a Coherence Frame

    OpenAIRE

    Burford, Caitlyn; Schutten, Julie “Madrone” Kalil

    2017-01-01

    The documentary film Blackfish (2013; www.blackfishmovie.com) follows Tilikum, a captive SeaWorld prisoner-orca responsible for the death of trainer Dawn Brancheau and two others. The film has had a profound effect on public perceptions of orca captivity creating the “Blackfish Effect.” Our critical analysis of the film engages Plec’s (2013) internatural communication categories of complicity, implication, and coherence. We argue that the film illustrates the flawed hierarchy within the binar...

  10. Secretory phospholipases A(2) isolated from Bothrops asper and from Crotalus durissus terrificus snake venoms induce distinct mechanisms for biosynthesis of prostaglandins E2 and D2 and expression of cyclooxygenases.

    Science.gov (United States)

    Moreira, Vanessa; Gutiérrez, José Maria; Soares, Andreimar Martins; Zamunér, Stella Regina; Purgatto, Eduardo; Teixeira, Catarina de Fátima Pereira

    2008-09-01

    The effects of myotoxin III (MT-III), a phospholipase A(2) (sPLA2) from Bothrops asper snake venom, and crotoxin B (CB), a neurotoxic and myotoxic sPLA2 from the venom of Crotalus durissus terrificus, on cyclooxygenases (COXs) expression and biosynthesis of prostaglandins (PGs) were evaluated, together with the mechanisms involved in these effects. Upon intraperitoneal injection in mice, both sPLA(2)s promoted the synthesis of PGD2 and PGE2, with a different time-course. MT-III, but not CB, induced COX-2 expression by peritoneal leukocytes without modification on COX-1 constitutive expression, whereas CB increased the constitutive activity of COX-1. MT-III increased the enzymatic activity of COX-1 and COX-2. Similar effects were observed when these sPLA(2)s were incubated with isolated macrophages, evidencing a direct effect on these inflammatory cells. Moreover, both toxins elicited the release of arachidonic acid from macrophages in vitro. Inhibition of cPLA2 by AACOCF3, but not of iPLA2 by PACOCF3 or BEL, significantly reduced PGD2, PGE2 and arachidonic acid (AA) release promoted by MT-III. These inhibitors did not affect MT-III-induced COX-2 expression. In contrast, cPLA2 inhibition did not modify the effects of CB, whereas iPLA2 inhibition reduced PGD2 and AA production induced by CB. These findings imply that distinct regulatory mechanisms leading to PGs' synthesis are triggered by these snake venom sPLA(2)s. Such differences are likely to explain the dissimilar patterns of inflammatory reaction elicited by these sPLA(2)s in vivo.

  11. Cross-reactivity and cross-immunomodulation between venoms of the snakes Bothrops asper, Crotalus simus and Lachesis stenophrys, and its effect in the production of polyspecific antivenom for Central America.

    Science.gov (United States)

    Arroyo, Cynthia; Solano, Sergio; Segura, Álvaro; Herrera, María; Estrada, Ricardo; Villalta, Mauren; Vargas, Mariángela; Gutiérrez, José María; León, Guillermo

    2017-11-01

    A mixture of the venoms of Bothrops asper, Crotalus simus and Lachesis stenophrys is used as immunogen to produce the polyspecific Central American antivenom (PoliVal-ICP). In this work, we studied the ability of each of these venoms to modulate the antibody response induced by the other two venoms included in the immunization mixture. For that, equine monospecific, bispecific and polyspecific antivenoms were prepared and compared regarding their ability to neutralize the phospholipase A 2 , coagulant and lethal activities of each venom, and their anti-venom antibodies concentration. Results indicate that there is low cross-reactivity and cross-neutralization between venoms of B. asper, C. simus and L. stenophrys, hence justifying the use of all of them as immunogens for the production of the Central American antivenom. It was also found that the venom of B. asper reduces the anti-crotalic response while the venom of C. simus does not affect the anti-bothropic response. On the other hand, the venoms of B. asper and C. simus increase the anti-lachesic response, and L. stenoprhys venom reduced both the anti-bothropic and anti-crotalic responses. On the basis of these results, the immunization strategy can be adjusted by preventing or taking advantage of cross-immunomodulation between venoms, in order to maximize the antibody response towards all venoms. Immune responses can be improved by injecting horses with several immunogen mixtures, composed by one or two of the three venoms, and administering them at different times during the immunization, eventually generating a high titer against the three venoms. Our results suggest that addressing the issue of immunomodulation by venoms might improve antivenom manufacture worldwide. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Comparison of humoral immune response, neutralization capacity of anticrotalic serum in young ovines, clinical and weight evaluation between animals inoculated with Crotalus durissus terrificus venom, natural or Cobalt-60-irradiated

    International Nuclear Information System (INIS)

    Ferreira Junior, R.S.

    2005-01-01

    The Elisa technique was used to evaluate and compare the humoral immune response of young ovine to anticrotalic serum production. During serum production, the clinical and weight evaluation of the animals was performed. The parameters utilized were complete blood count, and dosage of urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin. The animals weight was verified fortnightly during the experiment. The neutralization capacity of the serum produced from the snake Crotalus durissus terrificus natural (NV) and Cobalt-60-irradiated venom (IrV) was evaluated by in vitro challenges. One group of six animals received natural venom, the second group received irradiated venom, and the third was the control group. The animals received six immunizations during 84 days with an interval of 14 days. There was a significant difference (p<5%) in the ELISA test for the profile of the antibodies produced by the experimental groups (NV< IrV). There was no significant difference (p<5%) for biochemical tests, complete blood count, and animals weight between the three groups tested. The group immunized with irradiated venom showed antibodies profile higher than the group immunized with natural venom. The neutralization capacity of the serum produced from the IrV was fivefold higher when compared to the serum produced with NV. The clinical and weight evaluation showed that the o vines in post-weaning phase did not have their physiological profiles altered, and showed an excellent increase in weight during the experimental period. These results indicate a new perspective for the utilization of o vines, aiming the commercial production of anticrotalic serum, which may be applied in the treatment of human and animal envenomation. The cost for its production may be reduced by the posterior utilization of hyperimmunized ovine in human feeding. (author)

  13. Neuromuscular paralysis by the basic phospholipase A2 subunit of crotoxin from Crotalus durissus terrificus snake venom needs its acid chaperone to concurrently inhibit acetylcholine release and produce muscle blockage.

    Science.gov (United States)

    Cavalcante, Walter L G; Noronha-Matos, José B; Timóteo, Maria A; Fontes, Marcos R M; Gallacci, Márcia; Correia-de-Sá, Paulo

    2017-11-01

    Crotoxin (CTX), a heterodimeric phospholipase A 2 (PLA 2 ) neurotoxin from Crotalus durissus terrificus snake venom, promotes irreversible blockade of neuromuscular transmission. Indirect electrophysiological evidence suggests that CTX exerts a primary inhibitory action on transmitter exocytosis, yet contribution of a postsynaptic action of the toxin resulting from nicotinic receptor desensitization cannot be excluded. Here, we examined the blocking effect of CTX on nerve-evoked transmitter release measured directly using radioisotope neurochemistry and video microscopy with the FM4-64 fluorescent dye. Experiments were conducted using mice phrenic-diaphragm preparations. Real-time fluorescence video microscopy and liquid scintillation spectrometry techniques were used to detect transmitter exocytosis and nerve-evoked [ 3 H]-acetylcholine ([ 3 H]ACh) release, respectively. Nerve-evoked myographic recordings were also carried out for comparison purposes. Both CTX (5μg/mL) and its basic PLA 2 subunit (CB, 20μg/mL) had biphasic effects on nerve-evoked transmitter exocytosis characterized by a transient initial facilitation followed by a sustained decay. CTX and CB reduced nerve-evoked [ 3 H]ACh release by 60% and 69%, respectively, but only the heterodimer, CTX, decreased the amplitude of nerve-evoked muscle twitches. Data show that CTX exerts a presynaptic inhibitory action on ACh release that is highly dependent on its intrinsic PLA 2 activity. Given the high safety margin of the neuromuscular transmission, one may argue that the presynaptic block caused by the toxin is not enough to produce muscle paralysis unless a concurrent postsynaptic inhibitory action is also exerted by the CTX heterodimer. Copyright © 2017. Published by Elsevier Inc.

  14. Comparison of humoral immune response, neutralization capacity of anticrotalic serum in young ovines, clinical and weight evaluation between animals inoculated with Crotalus durissus terrificus venom, natural or Cobalt-60-irradiated

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira Junior, R.S. E-mail: rseabra@cevap.org.br

    2005-07-01

    The Elisa technique was used to evaluate and compare the humoral immune response of young ovine to anticrotalic serum production. During serum production, the clinical and weight evaluation of the animals was performed. The parameters utilized were complete blood count, and dosage of urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin. The animals weight was verified fortnightly during the experiment. The neutralization capacity of the serum produced from the snake Crotalus durissus terrificus natural (NV) and Cobalt-60-irradiated venom (IrV) was evaluated by in vitro challenges. One group of six animals received natural venom, the second group received irradiated venom, and the third was the control group. The animals received six immunizations during 84 days with an interval of 14 days. There was a significant difference (p<5%) in the ELISA test for the profile of the antibodies produced by the experimental groups (NV

  15. The effects of hibernation and captivity on glucose metabolism and thyroid hormones in American black bear (Ursus americanus).

    Science.gov (United States)

    McCain, Stephanie; Ramsay, Ed; Kirk, Claudia

    2013-06-01

    American black bears (Ursus americanus) have been shown to become transiently insulin resistant and hypothyroid during winter, but no studies have investigated these changes in long-term captive bears or in bears which remain awake year-round. Wild, captive hibernating, and captive nonhibernating bears were evaluated at times corresponding to three of their major physiologic stages: fall (hyperphagic stage), winter (hibernation stage), and summer (normal activity stage). Combined insulin and glucose tolerance tests and thyroid hormone profiles were performed on all bears during each stage. All three groups of bears had evidence of insulin resistance during the winter, as compared to the summer or fall, based on glucose tolerance curves. Analysis of thyroid hormone concentration varied and distinct patterns or similarities were not apparent. While obesity in captive American black bears is multifactorial, the finding that, regardless of their ability to hibernate, captive bears retain similar physiology to their wild counterparts indicates that captive bears' complex physiologic changes need to be addressed in their management.

  16. Genetic assessments and parentage analysis of captive Bolson tortoises (Gopherus flavomarginatus inform their "rewilding" in New Mexico.

    Directory of Open Access Journals (Sweden)

    Taylor Edwards

    Full Text Available The Bolson tortoise (Gopherus flavomarginatus is the first species of extirpated megafauna to be repatriated into the United States. In September 2006, 30 individuals were translocated from Arizona to New Mexico with the long-term objective of restoring wild populations via captive propagation. We evaluated mtDNA sequences and allelic diversity among 11 microsatellite loci from the captive population and archived samples collected from wild individuals in Durango, Mexico (n = 28. Both populations exhibited very low genetic diversity and the captive population captured roughly 97.5% of the total wild diversity, making it a promising founder population. Genetic screening of other captive animals (n = 26 potentially suitable for reintroduction uncovered multiple hybrid G. flavomarginatus×G. polyphemus, which were ineligible for repatriation; only three of these individuals were verified as purebred G. flavomarginatus. We used these genetic data to inform mate pairing, reduce the potential for inbreeding and to monitor the maintenance of genetic diversity in the captive population. After six years of successful propagation, we analyzed the parentage of 241 hatchlings to assess the maintenance of genetic diversity. Not all adults contributed equally to successive generations. Most yearly cohorts of hatchlings failed to capture the diversity of the parental population. However, overlapping generations of tortoises helped to alleviate genetic loss because the entire six-year cohort of hatchlings contained the allelic diversity of the parental population. Polyandry and sperm storage occurred in the captives and future management strategies must consider such events.

  17. Annual cycles of urinary reproductive steroid concentrations in wild and captive endangered Fijian ground frogs (Platymantis vitiana).

    Science.gov (United States)

    Narayan, Edward J; Molinia, Frank C; Christi, Ketan S; Morley, Craig G; Cockrem, John F

    2010-03-01

    Annual cycles of reproductive steroid metabolites were measured in urine collected from free-living and captive tropical endangered Fijian ground frogs (Platymantis vitiana) a terrestrial breeding. Free-living frogs were sampled on Viwa Island, Fiji and captive frogs were maintained in an outdoor enclosure in Suva, Fiji. Urinary estrone, progesterone and testosterone metabolite concentrations increased in male and female frogs after hCG challenges, with clear peaks in steroid concentrations 2 or 3 days after the challenges. There were annual cycles of testosterone metabolites in wild and captive males, and of estrone and progesterone metabolites in wild and captive females. Peaks of steroid concentrations in the wet season corresponded with periods of mating and egg laying in females in December and January. Steroid concentrations declined in January and February when maximum egg sizes in females were also declining. Body weights of wild male and vitellogenic female frogs showed annual cycles. Body weights of non-vitellogenic female frogs varied significantly between months, although there was no clear pattern of annual changes. Body weights of the 3 captive male frogs and 4 captive female frogs were similar to those of the wild frogs. Estrone metabolites were 80% successful in identifying non-vitellogenic females from males. The results suggest that the Fijian ground frog is a seasonal breeder with an annual gonadal cycle, and this species is likely to be photoperiodic. Urinary steroid measurements can provide useful information on reproductive cycles in endangered amphibians. Copyright 2009 Elsevier Inc. All rights reserved.

  18. Effects of inbreeding on reproductive success, performance, litter size, and survival in captive red wolves (Canis rufus).

    Science.gov (United States)

    Rabon, David R; Waddell, William

    2010-01-01

    Captive-breeding programs have been widely used in the conservation of imperiled species, but the effects of inbreeding, frequently expressed in traits related to fitness, are nearly unavoidable in small populations with few founders. Following its planned extirpation in the wild, the endangered red wolf (Canis rufus) was preserved in captivity with just 14 founders. In this study, we evaluated the captive red wolf population for relationships between inbreeding and reproductive performance and fitness. Over 30 years of managed breeding, the level of inbreeding in the captive population has increased, and litter size has declined. Inbreeding levels were lower in sire and dam wolves that reproduced than in those that did not reproduce. However, there was no difference in the inbreeding level of actual litters and predicted litters. Litter size was negatively affected by offspring and paternal levels of inbreeding, but the effect of inbreeding on offspring survival was restricted to a positive influence. There was no apparent relationship between inbreeding and method of rearing offspring. The observable effects of inbreeding in the captive red wolf population currently do not appear to be a limiting factor in the conservation of the red wolf population. Additional studies exploring the extent of the effects of inbreeding will be required as inbreeding levels increase in the captive population.

  19. Research on Captive Broodstock Programs for Pacific Salmon, 2002-2003 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry A. (National Marine Fisheries Service)

    2004-01-01

    The success of captive broodstock programs depends on high in-culture survival, appropriate development of the reproductive system, and the behavior and survival of cultured salmon after release, either as adults or juveniles. Continuing captive broodstock research designed to improve technology is being conducted to cover all major life history stages of Pacific salmon. Current velocity in rearing vessels had little if any effect on reproductive behavior of captively reared steelhead. However, males and females reared in high velocity vessels participated a greater number of spawning events than siblings reared in low velocity tanks. Observations of nesting females and associated males in a natural stream (Hamma Hamma River) were consistent with those observed in a controlled spawning channel. DNA pedigree analyses did not reveal significant differences in the numbers of fry produced by steelhead reared in high and low velocity vessels. To determine the critical period(s) for imprinting for sockeye salmon, juvenile salmon are being exposed to known odorants at key developmental stages. Subsequently they will be tested for development of long-term memories of these odorants. In 2002-2003, the efficacy of EOG analysis for assessing imprinting was demonstrated and will be applied in these and other behavioral and molecular tools in the current work plan. Results of these experiments will be important to determine the critical periods for imprinting for the offspring of captively-reared fish destined for release into natal rivers or lakes. By early August, the oocytes of all of Rapid River Hatchery chinook salmon females returning from the ocean had advanced to the tertiary yolk globule stage; whereas, only some of the captively reared Lemhi River females sampled had advanced to this stage, and the degree of advancement was not dependent on rearing temperature. The mean spawning time of captive Lemhi River females was 3-4 weeks after that of the Rapid River fish

  20. Anatomopathological findings in captive-raised red-winged tinamou (Rhynchotus rufescens

    Directory of Open Access Journals (Sweden)

    Claudia Momo

    2016-09-01

    Full Text Available The red-winged tinamou (Rhynchotus rufescens, a bird from the Tinamidae family, can be easily adapted to captivity. It is considered suitable for producing good quality meat while presenting great feed conversion rate, characteristics that make it interesting for commercial production. Therefore, in order to determine the major diseases that affect these birds, 114 birds from two different aviary types that died over a 12-year period, 1994-2006, were analyzed macro- and microscopically. Anatomical and pathological examinations showed that the most frequently affected systems were the urinary and digestive tracts. In the urinary tract, the main finding was gout, followed by amyloidosis and parasitism by the trematode Paratanaisia confusa. In the digestive tract, the presence of foreign material and parasitism by Capillaria penidoi were observed in the esophagus and crop. This study aims to describe the main anatomical and pathological findings in captive-bred red-winged tinamou and correlate them with the aviary type.

  1. "Cattle car complexes": a correspondence with historical captivity and post-Holocaust witnesses.

    Science.gov (United States)

    Gigliotti, Simone

    2006-01-01

    This article explores critical complexes relating to the construction of historical captivity in deportation train journeys by examining fictional and testimonial accounts of that experience. Using Thane Rosenbaum’s short story "Cattle Car Complex," the author shows that fiction is a prism through which to view victims’ experiences of deportation-experiences that tend to be overlooked in interpretive literature about the Holocaust. Historians have examined deportations above all as a perpetrator narrative, utilizing contemporaneous documents and sources. Their treatment neglects the numerous testimonies about the debilitating effects of deportation travel, as well as the evocation of that traumatic transit in post-Holocaust texts and contexts such as fiction, film, art, and museological and commemorative practice. The author argues that sensory witness is a compelling paradigm that can reveal the silences and elisions in representations of historical captivity.

  2. Research on Captive Broodstock Programs for Pacific Salmon, 2000-2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry A.; Dittman, Andrew H. (National Marine Fisheries Service, Manchester, WA); Hardy, Ronald W. (University of Idaho, Hagerman Fish Culture Experiment Station, Hagerman, ID)

    2001-06-01

    It is not yet possible to define a feeding regimen for captively-reared stocks similar to their natural regimen that enhances the post-release fitness of juveniles and improves the reproductive performance of adults. In the natural environment, seasonal differences in food quality and quantity have profound effects on growth and 'wild' attributes, such as external coloration and fin quality. Formulating the right feeds for conservation fish held for long periods in captivity before release is more complicated than formulating diets for farm fish. Recent research in salmonid nutrition shows it is necessary to consider daily dietary protein intake and protein intake relative to total dietary energy level, rather than simply the levels of total dietary lipid.

  3. Humoral response to calicivirus in captive tigers given a dual-strain vaccine.

    Science.gov (United States)

    Harrison, Tara M; Harrison, Scott H; Sikarskie, James G; Armstrong, Douglas

    2014-03-01

    The current feline vaccine with a single strain of calicivirus has been used for captive tigers, yet it may not protect against virulent systemic calicivirus infections. A cross-institutional study investigated the humoral response to a new dual-strain, killed-virus calicivirus vaccine for nine captive tigers. The subspecies of these tigers were Amur (Panthera tigris altaica), Bengal (Panthera tigris tigris), and Malayan (Panthera tigris jacksoni). Serum neutralization titers for virulent feline calicivirus strain FCV-DD1 were higher following dual-strain vaccine administration. There were no reports of adverse vaccine reactions. Dual-strain vaccination may afford broadened cross-protection against different calicivirus strains and is desirable to reduce the risk of virulent systemic calicivirus disease in tigers.

  4. Ethological studies of the Veined Octopus Amphioctopus marinates (Taki (Cephalopoda: Octopodidae in captivity, Kerala, India

    Directory of Open Access Journals (Sweden)

    V. Sreeja

    2013-06-01

    Full Text Available Five Veined Octopus Amphioctopus marginatus (Taki, collected from Vizhinjam Bay in the Thiruvananthapuram District of Kerala, India were kept in aquariums to study their behaviour in captivity. Primary and secondary defence mechanisms studied included crypsis, hiding and escape behaviour. Deimatic behaviour was used by captive animals when camouflage failed and they were threatened. Crawling behaviour to escape from the aquarium was observed in all specimens. Stilt walking and bi-pedal locomotion were also observed. As a defence behaviour, A. marginatus used aquarium rocks to protect the soft underside of their bodies. A. marginatus demonstrated tool use of coconut shells to make protective shelters, carrying the shells for future use. A female specimen also selected a coconut shell for egg laying and performed parental care by continuously cleaning and aerating her eggs with her arms and by squirting jets of water over the eggs.

  5. Carotenoid supplementation enhances reproductive success in captive strawberry poison frogs (Oophaga pumilio).

    Science.gov (United States)

    Dugas, Matthew B; Yeager, Justin; Richards-Zawacki, Corinne L

    2013-01-01

    Amphibians are currently experiencing the most severe declines in biodiversity of any vertebrate, and their requirements for successful reproduction are poorly understood. Here, we show that supplementing the diet of prey items (fruit flies) with carotenoids has strong positive effects on the reproduction of captive strawberry poison frogs (Oophaga pumilio), substantially increasing the number of metamorphs produced by pairs. This improved reproduction most likely arose via increases in the quality of both the fertilized eggs from which tadpoles develop and trophic eggs that are fed to tadpoles by mothers. Frogs in this colony had previously been diagnosed with a Vitamin A deficiency, and this supplementation may have resolved this issue. These results support growing evidence of the importance of carotenoids in vertebrate reproduction and highlight the nuanced ways in which nutrition constrains captive populations. © 2013 Wiley Periodicals, Inc.

  6. Trapped in captivity: marital perceptions of wives of former prisoners of war.

    Science.gov (United States)

    Dekel, Rachel; Goldblatt, Hadass; Solomon, Zahava

    2005-01-01

    Knowledge on the experience of prisoners of war's (POWs) wives is sparse, and mostly concentrates on the first decade after captivity. The present qualitative study examined the marital perceptions of seven wives of POWs after three decades. Participants were recruited through therapists who worked with families of POWs. Data were collected by a semi-structured, in-depth focus group interview. The findings of the study shed light on: (1) The place of captivity in the life of the family over time and (2) the women's perception of their role and place in the marital relation as being responsible mainly for the husband's well being and the couple's relationship, while struggling to preserve their personal needs. The meaning of the results is discussed together with implications for practice.

  7. Russian War Captivity of 1914-1922: Sociological Dimension (on the Urals` Materials

    Directory of Open Access Journals (Sweden)

    Наталья Викторовна Суржикова

    2012-12-01

    Full Text Available The article constitutes an attempt to consider Russian captivity of 1914–1922 from the sociological perspective. The author demonstrates that captive foreigners being at the same time group of inclusion and group of exclusion played both positive and negative part. On the one hand, they contributed to the deformation of established social borders, norms and structures, on the other hand – to their qualitative change. In a direct or indirect ways appropriating strange (moreover, hostile environment, prisoners of war inevitably failed to become its organic part. In a large measure it was accounted for by the fact that Russian society due to acuteness of its internal contradictions denied foreign soldiers the perspective of successful socialization, depriving itself of a possibility to develop composite identities and respective differently directed social interactions which ensured the stability and success of the modern social entities.

  8. Gastrointestinal parasites of exotic birds living in captivity in the state of Sergipe, Northeastern Brazil.

    Science.gov (United States)

    Lima, Victor Fernando Santana; Bezerra, Taynar Lima; Andrade, Alex Fonseca de; Ramos, Rafael Antonio Nascimento; Faustino, Maria Aparecida da Glória; Alves, Leucio Câmara; Meira-Santos, Patrícia Oliveira

    2017-01-01

    Brazil has a wide diversity of exotic birds that were brought to this country during the European colonization. These animals are kept in captivity and, in some cases, in inadequate facilities, which may facilitate the introduction of pathogens, including gastrointestinal parasites. The purpose of this study was to identify the main gastrointestinal parasites that affect exotic birds living in captivity in the state of Sergipe, Northeastern Brazil. Fecal samples (n = 362) from exotic birds were analyzed by direct examination and by the Willis-Mollay technique. Eggs of Amidostomum sp., Ascaridia sp., Capillarinae, Heterakis sp., Trichostrongylidae, and oocysts of coccidians were identified in nine different bird species. This is the first report in Brazil of infection by Ascaridia sp. and Heterakis sp. in Nymphicus hollandicus; by Trichostrongylidae in Serinus canaria and Streptopelia risoria.

  9. Factors affecting aggression in a captive flock of Chilean flamingos (Phoenicopterus chilensis).

    Science.gov (United States)

    Perdue, Bonnie M; Gaalema, Diann E; Martin, Allison L; Dampier, Stephanie M; Maple, Terry L

    2011-01-01

    The influence of pair bond status, age and sex on aggression rates in a flock of 84 captive Chilean flamingos at Zoo Atlanta was examined. Analysis showed no difference between aggression rates of male and female flamingos, but adult flamingos had higher rates of aggression than juveniles. There were also significant differences in aggression depending on pair bond status (single, same-sex pair, male-female pair or group). Bonded birds were significantly more aggressive than single birds, which is consistent with the concept that unpaired birds are not breeding and do not need to protect pair bonds or eggs. Birds in typical pair bonds (male-female) and atypical pair bonds (same-sex pairs or groups) exhibited similar rates of aggression. These results contribute to the existing body of research on aggression in captive flamingos. © 2010 Wiley-Liss, Inc.

  10. Postmortal radiographic diagnosis of laminitis in a captive European moose (Alces alces).

    Science.gov (United States)

    Clauss, M; Keller, A; Peemöller, A; Nygrén, K; Hatt, J-M; Nuss, K

    2009-11-01

    A five year-old bull moose (Alces alces) was culled due to chronic hoof overgrowth that required frequent intervention. Radiographic examination revealed changes in phalangeal bone structure usually considered indicative for laminitis in domestic cattle; similar changes were absent in the hooves of a free-ranging moose of similar age. The captive animal had been maintained in exhibits whose flooring were much harder than the soil in natural moose habitat, and on a diet with a high proportion of easily fermentable carbohydrates. These findings indicate that chronic laminitis should be considered as a potential underlying factor for hoof overgrowth, and that measures aimed at reducing the incidence of laminitis in domestic cattle, such as the use of softer flooring and diets with a higher proportion of fibre, might have prophylactic potential in captive wild ruminants.

  11. A Severe Ranavirus Outbreak in Captive, Wild-Caught Box Turtles.

    Science.gov (United States)

    Kimble, Steven J A; Johnson, April J; Williams, Rod N; Hoverman, Jason T

    2017-12-01

    A Ranavirus outbreak in a captive population of wild-caught individuals was monitored using clinical evaluations and real-time PCR in 317 wild box turtles held in captivity during translocation. During the 2-year study period, the population experienced 71.6% mortality, suggesting that ranaviruses can rapidly attenuate populations. Wide variation in infection rate (7-94% per sampling period) was observed, which may have been driven by clearing and reinfection, adaptive immunity, or imperfect detection using noninvasive samples. Only nasal clinical signs were significantly related to infection status, and agreement among sample types was low. Subsequent to the initial outbreak, low mortality but high real-time PCR prevalence of Ranavirus was observed, suggesting that surviving individuals might be tolerant.

  12. Identification of a novel herpesvirus in captive Eastern box turtles (Terrapene carolina carolina).

    Science.gov (United States)

    Sim, Richard R; Norton, Terry M; Bronson, Ellen; Allender, Matthew C; Stedman, Nancy; Childress, April L; Wellehan, James F X

    2015-02-25

    Herpesviruses are significant pathogens of chelonians which most commonly cause upper respiratory tract disease and necrotizing stomatitis. Herpesvirus infection was identified in two populations of captive Eastern box turtles (Terrapene carolina carolina) using histopathology and polymerase chain reaction (PCR) with DNA sequencing. Necrotizing lesions with eosinophilic to amphophilic intranuclear inclusion bodies were identified in the tissues of one hatch-year individual in January 2013, which was herpesvirus positive by PCR. A separate captive group of adults had an observed herpesvirus prevalence of 58% using PCR in July 2011. In these cases, a novel herpesvirus, Terrapene herpesvirus 1 (TerHV1), was identified and serves as the first herpesvirus sequenced in the genus Terrapene. Similar to the other herpesviruses of the Order Testudines, TerHV1 clusters with the genus Scutavirus of the subfamily Alphaherpesvirinae. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. The effects of automated scatter feeders on captive grizzly bear activity budgets.

    Science.gov (United States)

    Andrews, Nathan L P; Ha, James C

    2014-01-01

    Although captive bears are popular zoo attractions, they are known to exhibit high levels of repetitive behaviors (RBs). These behaviors have also made them particularly popular subjects for welfare research. To date, most research on ursid welfare has focused on various feeding methods that seek to increase time spent searching for, extracting, or consuming food. Prior research indicates an average of a 50% reduction in RBs when attempts are successful and, roughly, a 50% success rate across studies. This research focused on decreasing time spent in an RB while increasing the time spent active by increasing time spent searching for, extracting, and consuming food. The utility of timed, automated scatter feeders was examined for use with captive grizzly bears (Ursis arctos horribilis). Findings include a significant decrease in time spent in RB and a significant increase in time spent active while the feeders were in use. Further, the bears exhibited a wider range of behaviors and a greater use of their enclosure.

  14. Suicide with two makes of captive-bolt guns (livestock stunners) fired simultaneously to the forehead.

    Science.gov (United States)

    Pircher, Rebecca; Geisenberger, Dorothee; Große Perdekamp, Markus; Neukamm, Merja; Pollak, Stefan; Schmidt, Ulrike; Thierauf-Emberger, Annette

    2017-11-01

    In humans, most fatalities from slaughterer's guns are suicides committed by persons familiar with stunning devices. The great majority of cases accounts for shots to the head, especially the frontal region. Only a small number of two subsequent cranial shots from captive-bolt humane killers have been reported up to now. In the case presented by the authors, a suicide by simultaneous shots to the head fired from two different makes of captive-bolt guns (one of them having two separate outlets for the combustion gases in the muzzle plane, the other type having no additional openings) is described for the first time. One of the shooting devices remained in firm contact with the left hand and produced patterned staining from rust corresponding to the surface relief of the gun. The medicolegal and criminalistic aspects of this unique case are discussed with reference to the pertinent literature.

  15. Cutaneous sarcoids in captive African lions associated with feline sarcoid-associated papillomavirus infection.

    Science.gov (United States)

    Orbell, G M B; Young, S; Munday, J S

    2011-11-01

    Solitary and multiple cutaneous and mucocutaneous masses were identified in 5 of 24 captive African lions (Panthera leo) over a 6-month-period. All masses were surgically excised, and all were histologically similar to equine and feline sarcoids. DNA was extracted from formalin-fixed, paraffin-embedded tissue. Polymerase chain reaction amplified DNA sequences that had been previously detected in feline sarcoids and clinically normal bovine skin. All lions had been fed a diet that included bovine carcasses that had not been skinned. Since the cessation of feeding bovine carcasses with cutaneous lesions, no additional skin lesions have been observed within any of the lions. Herein is described the clinical, gross, and histopathological findings of sarcoids in 5 captive lions. As the causative papillomavirus most likely has a bovine definitive host, it is hypothesized that the lions were exposed to the virus by feeding on bovine carcasses with skin still attached.

  16. BEHAVIOURAL DESCRIPTION OF Sapajus nigritus (GOLDFUSS, 1809 RAISED IN CAPTIVITY AT IPATINGA, MG

    Directory of Open Access Journals (Sweden)

    Felipe Santana Machado

    2014-08-01

    Full Text Available The maintenance of animals in captivity is one of the many ways of species preservation and allows studies that are often unattainable under natural conditions. Primate’s behavior and ecology studies supply tools for the development of conservation and management strategies. Consequently, the current research aimed to describe the patterns of behavior of a capuchin monkey, Sapajus nigritus, group raised in captivity at the Biodiversity Center of Associação Esportiva e Recreativa at Ipatinga, MG, Brazil. The Scan Sample was used with five minutes intervals. Ad libitum and Focal Animal were the complementary sampling. Twenty-three behavioral categories were recorded; this is considered average when compared to other ethograms. The behavioral class with greater prominence was foraging, however the different categories of behavior suggest a complex capacity of intra-specific interaction. The information serves as basic tools for the formulation of conservation strategies, management and to the comprehension of ecological interactions.

  17. Sharks in Captivity: The Role of Husbandry, Breeding, Education, and Citizen Science in Shark Conservation.

    Science.gov (United States)

    Grassmann, Michael; McNeil, Bryan; Wharton, Jim

    The role of public aquariums in promoting conservation has changed substantially over the decades, evolving from entertainment attractions to educational and research centres. In many facilities, larger sharks are an essential part of the collection and represent one of the biggest draws for the public. Displaying healthy elasmobranchs comes with many challenges, but improvements in husbandry techniques have enabled aquariums to have success with a variety of species. The establishment of organisations such as the Association of Zoos and Aquariums, and the completion of texts like the Elasmobranch Husbandry Manual, has helped set high standards of care for sharks in captivity and promoted international conservation efforts. Aquariums keeping sharks are in a unique position to influence local, regional, and international attitudes and policies by acting as both educational and research facilities. Interactions with multiple stakeholders of diverse educational and demographic backgrounds through the use of in-house advocacy, public outreach, media interviews, and partnerships with academic and government institutions enable these facilities to engage and share information with a broad audience. Although the data collected on sharks in captivity often cannot be directly translated to animals in the wild, it offers better insight into a number of life history traits and poorly understood behaviours, and has been the foundation for many captive breeding programs. Several Northeast Pacific (NEP) shark species are commonly displayed for long durations or bred in aquariums, while other less studied species have been held for short periods to collect valuable data that can be applied towards ongoing studies and conservation measures. Here, we discuss past and current tangible benefits of holding NEP sharks in captivity, as well as noting several ways in which future research and education activities will continue to inform and shape public opinions on shark management and

  18. Behaviour and diary activity of Sciurus ingrami (Thomas) in captivity (Rodentia, Sciuridae)

    OpenAIRE

    Bordignon, Marcelo; Monteiro Filho, Emygdio L.A

    1997-01-01

    From October 1994 to November 1995 the behaviour, postures and diurnal activity of tive captive squirrels Sciurus ingrami were observed and registered. Four basics postures, five grooming behaviours, displacements and face wiping behaviour were identified. Based on behavioural observations, the diurnal activity was divided into four categories: resting, displacement, teeding and maintenance. The time spent in each category varied seasonally and the squirrels spent more time resting during win...

  19. Salmonella serovars and antimicrobial resistance in strains isolated from wild animals in captivity in Sinaloa, Mexico

    OpenAIRE

    Silva-Hidalgo, Gabriela; López-Valenzuela, Martin; Juárez-Barranco, Felipe; Montiel-Vázquez, Edith; Valenzuela-Sánchez, Beatriz

    2014-01-01

    The aim of the present study was to evaluate the frequency of antibiotic resistance in Salmonella spp. strains from wild animals in captivity at the Culiacan Zoo and the Mazatlan Aquarium in Sinaloa, Mexico. We identified 17 different Salmonella enterica serovars at a prevalence of 19.90% (Culiacan Zoo) and 6.25% (Mazatlan Aquarium). Antibiotic sensitivity tests revealed that, of the 83 strains studied, 100% were multidrug resistant (MDR). The drugs against which the greatest resistance was o...

  20. Snake River Sockeye Salmon Captive Broodstock Program; Hatchery Element, 1998 Annual Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Kline, Paul A.; Heindel, Jeff A.

    1999-12-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and NMFS initiated efforts to conserve and rebuild populations in Idaho. Captive broodstock program activities conducted between January 1, 1998 and December 31, 1998, are presented in this report.